F496626

General Info

Members Datasets Scaffolds Average Seq Length
2275 673 2181 312

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10014408|Ga0075366_100144084
Length 364
Sequence MQLTPCVSHAVHHEVVHPRCGTPGFSFKQQNRGPGSAQRHCVPPRARDTGEIMTTSDIAIQVEGLTKSFGNRVVVRDLSMTVKRGSIYGFLGPNGSGKTTTIRMLCGLLTPDSGTGTCLGYDIRTEASKIKLQVGYMTQRFSLYQDLSVRENLEFVARLYDIADPVGAARAMVERLGLKGREEQLAGSLSGGWKQRLALGACTLPSPKLLLLDEPTAGVDPKARREFWNEIHALADDGLTVLVSTHYMDEAERCHEIAYIAYGQLLVHGTVPEVIAHSNLATYVVSGEGLGALSNEITGKSGIDMVAPFGTSLHVSGRNEAALEAAIAPYRANAHLKWERSEPSLEDVFIDLMGKAQDNFRDAA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
3 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
4 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
7 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
8 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
9 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
10 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
11 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
12 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
13 2643221640 Caulobacter sp. Root342 Isolate Unclassified
14 2643221642 Caulobacter sp. Root343 Isolate Unclassified
15 2643221734 Bosea sp. Root670 Isolate Unclassified
16 2643221736 Bosea sp. Root483D1 Isolate Unclassified
17 2738543024 Aminobacter sp. AP02 Isolate Unclassified
18 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
19 2818991467 Bosea vestrisii 3192 Isolate Unclassified
20 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
21 2841760612 Bosea sp. Tri-49 Isolate Nodule
22 2844104063 Bosea sp. Tri-39 Isolate Nodule
23 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
24 2851182111 Bosea sp. Tri-44 Isolate Nodule
25 2851246043 Bosea sp. Tri-54 Isolate Nodule
26 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
27 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
28 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
29 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
30 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
31 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
32 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
33 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
34 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
35 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
36 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
37 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
38 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
39 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
40 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
41 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
42 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
43 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
44 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
45 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
46 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
47 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
48 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
49 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
50 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
51 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
52 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
53 2922368715
54 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
55 2928058823 Ralstonia sp. 1138 Isolate Unclassified
56 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
57 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
58 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
59 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
60 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
61 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
62 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
63 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
64 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
65 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
66 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
67 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
68 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
69 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
70 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
71 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
72 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
73 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
74 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
75 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
76 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
77 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
78 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
79 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
80 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
81 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
82 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
83 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
84 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
85 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
86 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
87 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
88 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
89 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
90 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
91 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
92 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
93 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
94 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
95 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
96 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
97 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
98 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
99 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
100 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
101 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
102 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
103 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
104 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
105 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
106 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
107 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
108 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
109 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
110 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
111 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
112 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
113 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
114 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
115 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
116 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
117 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
118 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
119 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
120 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
121 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
122 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
123 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
124 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
125 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
126 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
127 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
128 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
129 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
130 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
131 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
132 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
133 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
134 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
135 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
136 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
137 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
138 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
139 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
140 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
141 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
142 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
143 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
144 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
145 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
146 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
147 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
148 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
149 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
150 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
151 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
152 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
153 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
154 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
155 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
156 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
157 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
158 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
159 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
160 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
161 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
162 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
163 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
164 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
165 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
166 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
167 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
168 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
169 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
170 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
171 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
172 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
173 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
174 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
175 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
176 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
177 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
178 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
179 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
180 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
181 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
182 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
183 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
184 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
185 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
186 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
187 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
188 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
189 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
190 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
191 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
192 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
193 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
194 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
195 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
196 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
197 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
198 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
199 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
200 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
201 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
202 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
203 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
204 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
205 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
206 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
207 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
208 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
209 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
210 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
211 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
212 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
213 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
214 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
215 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
216 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
217 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
218 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
219 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
220 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
221 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
222 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
223 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
224 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
225 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
226 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
227 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
228 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
229 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
230 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
231 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
232 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
233 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
234 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
235 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
236 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
237 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
238 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
239 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
240 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
241 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
242 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
243 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
244 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
245 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
246 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
247 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
248 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
249 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
250 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
251 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
252 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
253 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
254 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
255 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
256 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
257 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
258 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
259 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
260 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
261 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
262 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
263 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
265 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
266 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
267 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
274 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
275 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
278 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
279 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
282 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
283 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
284 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
285 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
287 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
288 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
289 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
291 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
292 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
362 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
363 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
364 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
365 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
368 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
369 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
370 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
371 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
375 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
376 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
377 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
378 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
379 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
380 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
381 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
382 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
383 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
384 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
385 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
386 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
387 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
388 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
389 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
390 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
391 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
392 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
393 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
394 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
395 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
396 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
397 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
398 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
399 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
400 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
401 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
402 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
403 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
404 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
405 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
406 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
407 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
408 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
409 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
410 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
411 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
412 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
413 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
414 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
415 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
416 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
417 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
418 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
419 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
420 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
421 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
422 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
423 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
424 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
425 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
426 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
427 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
428 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
429 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
430 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
431 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
432 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
433 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
434 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
435 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
436 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
437 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
438 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
439 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
440 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
441 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
442 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
443 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
444 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
445 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
446 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
447 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
448 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
449 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
450 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
451 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
452 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
453 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
454 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
455 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
456 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
457 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
458 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
459 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
460 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
461 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
462 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
463 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
464 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
465 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
466 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
467 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
468 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
469 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
470 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
471 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
472 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
473 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
474 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
475 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
476 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
477 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
478 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
479 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
480 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
481 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
482 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
483 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
484 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
485 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
486 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
487 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
488 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
489 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
490 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
491 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
492 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
493 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
494 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
495 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
496 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
497 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
498 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
499 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
500 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
501 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
502 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
503 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
504 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
505 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
506 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
507 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
508 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
509 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
510 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
511 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
512 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
513 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
514 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
515 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
516 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
517 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
518 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
519 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
520 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
521 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
522 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
523 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
524 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
525 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
526 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
527 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
528 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
529 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
530 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
531 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
532 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
533 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
534 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
535 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
536 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
537 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
538 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
539 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
540 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
541 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
542 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
543 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
544 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
545 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
546 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
547 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
548 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
549 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
550 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
551 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
552 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
553 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
554 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
555 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
556 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
557 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
558 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
559 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
560 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
561 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
562 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
563 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
564 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
565 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
566 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
567 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
568 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
569 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
570 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
571 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
572 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
573 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
574 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
575 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
576 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
577 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
578 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
579 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
580 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
581 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
582 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
583 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
584 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
585 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
586 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
587 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
588 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
589 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
590 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
591 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
592 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
593 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
594 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
595 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
596 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
597 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
598 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
599 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
600 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
601 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
602 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
603 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
604 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
605 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
606 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
607 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
608 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
609 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
610 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
611 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
612 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
613 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
614 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
615 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
616 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
617 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
618 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
619 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
620 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
621 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
622 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
623 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
624 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
625 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
626 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
627 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
628 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
629 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
630 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
631 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
632 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
633 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
634 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
635 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
636 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
637 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
638 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
639 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
640 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
641 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
642 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
643 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
644 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
645 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
646 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
647 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
648 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
649 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
650 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
651 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
652 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
653 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
654 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
655 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
656 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
657 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
658 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
659 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
660 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
661 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
662 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
663 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
664 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
665 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
666 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
667 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
668 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
669 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
670 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
671 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
672 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
673 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.87
Metatranscriptomes 0.04
Isolates 4.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.46
Nodule 2.73
Rhizoplane 5.67
Rhizosphere 81.93
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214739650 2209111006 Bacteria 3977
2 ARSoilYngRDRAFT_c00409 3300000042 Bacteria 5538
3 ARcpr5yngRDRAFT_c000424 3300000043 Bacteria 5559
4 ARSoilOldRDRAFT_c000395 3300000044 Bacteria 5402
5 ARCol0oldRDRAFT_c00662 3300000045 Bacteria 3002
6 ARCol0yngRDRAFT_1000418 3300000652 Bacteria 5543
7 JGI24741J21665_1000078 3300001915 Bacteria 24174
8 JGI24740J21852_10000286 3300001979 Bacteria 21522
9 JGI24739J22299_10000164 3300001989 Bacteria 21825
10 JGI24739J22299_10028424 3300001989 Bacteria 1950
11 JGI24737J22298_10007907 3300001990 Bacteria 3579
12 JGI24737J22298_10008240 3300001990 Bacteria 3497
13 JGI24750J21931_1001632 3300002070 Bacteria 2756
14 JGI24745J21846_1000369 3300002073 Bacteria 3934
15 JGI24748J21848_1000318 3300002074 Bacteria 5555
16 JGI24738J21930_10000112 3300002075 Bacteria 19038
17 JGI24749J21850_1000411 3300002076 Bacteria 6398
18 JGI24033J26618_1003093 3300002155 Bacteria 1738
19 JGI24034J26672_10001354 3300002239 Bacteria 3236
20 JGI24742J22300_10005491 3300002244 Bacteria 2085
21 JGI24751J29686_10013825 3300002459 Bacteria 1666
22 JGI25156J39149_1005916 3300002705 Bacteria 3432
23 JGI25157J39369_1000048 3300002741 Bacteria 117419
24 JGI25151J46595_10000345 3300003187 Bacteria 49779
25 JGI25151J46595_10062872 3300003187 Bacteria 1171
26 JGI25406J46586_10000740 3300003203 Bacteria 15253
27 Ga0055538_1001492 3300003751 Bacteria 4416
28 Ga0055538_1002447 3300003751 Bacteria 2720
29 Ga0055539_1000056 3300003752 Bacteria 155106
30 Ga0055533_1003980 3300003756 Bacteria 2798
31 Ga0055533_1006709 3300003756 Bacteria 1655
32 Ga0055532_1000111 3300003758 Bacteria 86875
33 Ga0055525_1000788 3300003759 Bacteria 10157
34 Ga0055535_1000114 3300003761 Bacteria 86875
35 Ga0055529_1000179 3300003763 Bacteria 86863
36 Ga0055526_1001487 3300003771 Bacteria 16633
37 Ga0055526_1005104 3300003771 Bacteria 7659
38 Ga0055524_1000020 3300003775 Bacteria 227971
39 Ga0055530_10008848 3300003791 Bacteria 3962
40 Ga0055531_10002697 3300003794 Bacteria 11698
41 Ga0055541_1003990 3300003841 Bacteria 2720
42 Ga0065165_1000234 3300005262 Bacteria 96709
43 Ga0065712_10086243 3300005290 Bacteria 2647
44 Ga0065715_10160425 3300005293 Bacteria 1635
45 Ga0065707_10160781 3300005295 Bacteria 1565
46 Ga0070658_10023943 3300005327 Bacteria 4898
47 Ga0070658_10055935 3300005327 Bacteria 3206
48 Ga0070676_10000755 3300005328 Bacteria 15911
49 Ga0070676_10008584 3300005328 Bacteria 5510
50 Ga0070676_10068026 3300005328 Bacteria 2131
51 Ga0070683_100000376 3300005329 Bacteria 31004
52 Ga0070683_100006748 3300005329 Bacteria 9639
53 Ga0070683_100022026 3300005329 Bacteria 5690
54 Ga0070683_100194441 3300005329 Bacteria 1926
55 Ga0070683_100206329 3300005329 Bacteria 1867
56 Ga0070683_100484563 3300005329 Bacteria 1181
57 Ga0070690_100000407 3300005330 Bacteria 21783
58 Ga0070690_100001711 3300005330 Bacteria 11573
59 Ga0070690_100050277 3300005330 Bacteria 2659
60 Ga0070690_100053872 3300005330 Bacteria 2574
61 Ga0070690_100296131 3300005330 Bacteria 1159
62 Ga0070670_100004417 3300005331 Bacteria 11775
63 Ga0070670_100006059 3300005331 Bacteria 10226
64 Ga0070670_100018977 3300005331 Bacteria 5897
65 Ga0070670_100079226 3300005331 Bacteria 2823
66 Ga0070670_100140243 3300005331 Bacteria 2090
67 Ga0070670_100222829 3300005331 Bacteria 1641
68 Ga0070677_10001400 3300005333 Bacteria 7691
69 Ga0070677_10001502 3300005333 Bacteria 7381
70 Ga0068869_100000523 3300005334 Bacteria 21387
71 Ga0068869_100011107 3300005334 Bacteria 5899
72 Ga0068869_100054758 3300005334 Bacteria 2905
73 Ga0068869_100206943 3300005334 Bacteria 1550
74 Ga0068869_100215429 3300005334 Bacteria 1520
75 Ga0070666_10000466 3300005335 Bacteria 24488
76 Ga0070666_10047076 3300005335 Bacteria 2894
77 Ga0070666_10062716 3300005335 Bacteria 2519
78 Ga0070666_10087063 3300005335 Bacteria 2141
79 Ga0070666_10184954 3300005335 Bacteria 1462
80 Ga0070680_100007212 3300005336 Bacteria 8473
81 Ga0070680_100011559 3300005336 Bacteria 6834
82 Ga0070682_100000141 3300005337 Bacteria 57251
83 Ga0070682_100007032 3300005337 Bacteria 6331
84 Ga0070682_100109705 3300005337 Bacteria 1837
85 Ga0070682_100212912 3300005337 Bacteria 1371
86 Ga0068868_100027258 3300005338 Bacteria 4359
87 Ga0068868_100242926 3300005338 Bacteria 1513
88 Ga0068868_100251374 3300005338 Bacteria 1488
89 Ga0070660_100000543 3300005339 Bacteria 25307
90 Ga0070660_100001961 3300005339 Bacteria 14190
91 Ga0070660_100002574 3300005339 Bacteria 12436
92 Ga0070660_100276028 3300005339 Bacteria 1375
93 Ga0070689_100003974 3300005340 Bacteria 9929
94 Ga0070689_100028408 3300005340 Bacteria 4227
95 Ga0070689_100078549 3300005340 Bacteria 2588
96 Ga0070689_100089726 3300005340 Bacteria 2421
97 Ga0070689_100123802 3300005340 Bacteria 2068
98 Ga0070689_100137868 3300005340 Bacteria 1960
99 Ga0070691_10000190 3300005341 Bacteria 20511
100 Ga0070691_10004978 3300005341 Bacteria 6046
101 Ga0070691_10033949 3300005341 Bacteria 2401
102 Ga0070687_100000212 3300005343 Bacteria 20234
103 Ga0070687_100000593 3300005343 Bacteria 12002
104 Ga0070687_100024082 3300005343 Bacteria 2901
105 Ga0070687_100025246 3300005343 Bacteria 2848
106 Ga0070687_100026519 3300005343 Bacteria 2791
107 Ga0070661_100000173 3300005344 Bacteria 53059
108 Ga0070661_100000242 3300005344 Bacteria 44945
109 Ga0070661_100003018 3300005344 Bacteria 11583
110 Ga0070692_10005286 3300005345 Bacteria 5484
111 Ga0070692_10025412 3300005345 Bacteria 2918
112 Ga0070668_100006225 3300005347 Bacteria 8840
113 Ga0070668_100014046 3300005347 Bacteria 5987
114 Ga0070668_100016022 3300005347 Bacteria 5608
115 Ga0070668_100031170 3300005347 Bacteria 4056
116 Ga0070668_100070088 3300005347 Bacteria 2729
117 Ga0070668_100118247 3300005347 Bacteria 2116
118 Ga0070669_100000593 3300005353 Bacteria 26849
119 Ga0070669_100007649 3300005353 Bacteria 7724
120 Ga0070669_100032151 3300005353 Bacteria 3790
121 Ga0070669_100041697 3300005353 Bacteria 3339
122 Ga0070669_100064881 3300005353 Bacteria 2690
123 Ga0070675_100000165 3300005354 Bacteria 40656
124 Ga0070675_100021102 3300005354 Bacteria 5202
125 Ga0070675_100036997 3300005354 Bacteria 3974
126 Ga0070675_100058675 3300005354 Bacteria 3174
127 Ga0070675_100076300 3300005354 Bacteria 2788
128 Ga0070675_100157582 3300005354 Bacteria 1950
129 Ga0070675_100360531 3300005354 Bacteria 1291
130 Ga0070671_100010995 3300005355 Bacteria 7262
131 Ga0070671_100034113 3300005355 Bacteria 4212
132 Ga0070671_100044105 3300005355 Bacteria 3705
133 Ga0070671_100389869 3300005355 Bacteria 1191
134 Ga0070674_100000450 3300005356 Bacteria 20737
135 Ga0070674_100002607 3300005356 Bacteria 9977
136 Ga0070674_100013737 3300005356 Bacteria 5012
137 Ga0070674_100083494 3300005356 Bacteria 2288
138 Ga0070674_100108245 3300005356 Bacteria 2036
139 Ga0070674_100136195 3300005356 Bacteria 1837
140 Ga0070674_100147287 3300005356 Bacteria 1773
141 Ga0070673_100000665 3300005364 Bacteria 18941
142 Ga0070673_100001190 3300005364 Bacteria 14967
143 Ga0070673_100004753 3300005364 Bacteria 8630
144 Ga0070673_100024068 3300005364 Bacteria 4458
145 Ga0070673_100064059 3300005364 Bacteria 2927
146 Ga0070673_100090746 3300005364 Bacteria 2496
147 Ga0070688_100002746 3300005365 Bacteria 8940
148 Ga0070688_100018523 3300005365 Bacteria 4019
149 Ga0070688_100023504 3300005365 Bacteria 3627
150 Ga0070688_100025047 3300005365 Bacteria 3529
151 Ga0070688_100037673 3300005365 Bacteria 2948
152 Ga0070688_100042800 3300005365 Bacteria 2787
153 Ga0070688_100218920 3300005365 Bacteria 1341
154 Ga0070659_100000694 3300005366 Bacteria 24488
155 Ga0070659_100000988 3300005366 Bacteria 20880
156 Ga0070659_100002948 3300005366 Bacteria 12131
157 Ga0070667_100000759 3300005367 Bacteria 30677
158 Ga0070667_100213145 3300005367 Bacteria 1717
159 Ga0070667_100504026 3300005367 Bacteria 1110
160 Ga0070703_10008070 3300005406 Bacteria 2959
161 Ga0070709_10001787 3300005434 Bacteria 11677
162 Ga0070709_10003620 3300005434 Bacteria 8296
163 Ga0070709_10206494 3300005434 Bacteria 1394
164 Ga0070714_100025805 3300005435 Bacteria 4853
165 Ga0070714_100033001 3300005435 Bacteria 4325
166 Ga0070714_100079218 3300005435 Bacteria 2856
167 Ga0070713_100002939 3300005436 Bacteria 11174
168 Ga0070713_100010515 3300005436 Bacteria 6688
169 Ga0070713_100220835 3300005436 Bacteria 1719
170 Ga0070713_100244279 3300005436 Bacteria 1636
171 Ga0070713_100330564 3300005436 Bacteria 1410
172 Ga0070710_10016270 3300005437 Bacteria 3782
173 Ga0070710_10022175 3300005437 Bacteria 3319
174 Ga0070701_10009176 3300005438 Bacteria 4323
175 Ga0070701_10032675 3300005438 Bacteria 2594
176 Ga0070701_10040592 3300005438 Bacteria 2367
177 Ga0070711_100001062 3300005439 Bacteria 14664
178 Ga0070711_100043413 3300005439 Bacteria 3045
179 Ga0070711_100060365 3300005439 Bacteria 2636
180 Ga0070711_100287592 3300005439 Bacteria 1303
181 Ga0070705_100003865 3300005440 Bacteria 7326
182 Ga0070705_100004154 3300005440 Bacteria 7076
183 Ga0070705_100025331 3300005440 Bacteria 3215
184 Ga0070705_100032729 3300005440 Bacteria 2891
185 Ga0070700_100000364 3300005441 Bacteria 23195
186 Ga0070700_100017344 3300005441 Bacteria 4115
187 Ga0070700_100066395 3300005441 Bacteria 2290
188 Ga0070700_100069747 3300005441 Bacteria 2239
189 Ga0070700_100376077 3300005441 Bacteria 1061
190 Ga0070694_100000649 3300005444 Bacteria 19210
191 Ga0070694_100001077 3300005444 Bacteria 15614
192 Ga0070694_100047299 3300005444 Bacteria 2891
193 Ga0070694_100050844 3300005444 Bacteria 2795
194 Ga0070694_100073966 3300005444 Bacteria 2354
195 Ga0070694_100152974 3300005444 Bacteria 1686
196 Ga0070708_100030085 3300005445 Bacteria 4690
197 Ga0070708_100038832 3300005445 Bacteria 4162
198 Ga0070663_100000021 3300005455 Bacteria 111983
199 Ga0070663_100000417 3300005455 Bacteria 22399
200 Ga0070663_100012645 3300005455 Bacteria 5348
201 Ga0070663_100167727 3300005455 Bacteria 1695
202 Ga0070663_100489381 3300005455 Bacteria 1020
203 Ga0070678_100001012 3300005456 Bacteria 14620
204 Ga0070678_100018026 3300005456 Bacteria 4565
205 Ga0070662_100000796 3300005457 Bacteria 19367
206 Ga0070662_100002178 3300005457 Bacteria 12011
207 Ga0070662_100032526 3300005457 Bacteria 3666
208 Ga0070662_100062666 3300005457 Bacteria 2718
209 Ga0070662_100084433 3300005457 Bacteria 2372
210 Ga0070662_100157238 3300005457 Bacteria 1775
211 Ga0070681_10002475 3300005458 Bacteria 16918
212 Ga0070681_10016649 3300005458 Bacteria 7339
213 Ga0070681_10087478 3300005458 Bacteria 3069
214 Ga0070681_10136554 3300005458 Bacteria 2383
215 Ga0070681_10257766 3300005458 Bacteria 1656
216 Ga0068867_100008573 3300005459 Bacteria 7215
217 Ga0068867_100009775 3300005459 Bacteria 6759
218 Ga0068867_100103397 3300005459 Bacteria 2179
219 Ga0068867_100148389 3300005459 Bacteria 1840
220 Ga0068867_100200676 3300005459 Bacteria 1597
221 Ga0070685_10000547 3300005466 Bacteria 21062
222 Ga0070685_10018553 3300005466 Bacteria 3743
223 Ga0070685_10040869 3300005466 Bacteria 2641
224 Ga0070707_100016314 3300005468 Bacteria 6972
225 Ga0070699_100203864 3300005518 Bacteria 1759
226 Ga0070699_100210654 3300005518 Bacteria 1730
227 Ga0070679_100010894 3300005530 Bacteria 8638
228 Ga0070679_100017764 3300005530 Bacteria 6887
229 Ga0070679_100024204 3300005530 Bacteria 5950
230 Ga0070679_100024538 3300005530 Bacteria 5909
231 Ga0070679_100063734 3300005530 Bacteria 3674
232 Ga0070679_100086334 3300005530 Bacteria 3125
233 Ga0070684_100000755 3300005535 Bacteria 22399
234 Ga0070684_100008740 3300005535 Bacteria 7940
235 Ga0070684_100069164 3300005535 Bacteria 3105
236 Ga0070684_100089433 3300005535 Bacteria 2737
237 Ga0070684_100127448 3300005535 Bacteria 2294
238 Ga0070684_100339739 3300005535 Bacteria 1380
239 Ga0070697_100191576 3300005536 Bacteria 1736
240 Ga0070697_100242034 3300005536 Bacteria 1541
241 Ga0068853_100000483 3300005539 Bacteria 27159
242 Ga0068853_100010268 3300005539 Bacteria 7573
243 Ga0068853_100194550 3300005539 Bacteria 1843
244 Ga0068853_100417435 3300005539 Bacteria 1258
245 Ga0070672_100000527 3300005543 Bacteria 22399
246 Ga0070672_100007090 3300005543 Bacteria 7582
247 Ga0070672_100035069 3300005543 Bacteria 3811
248 Ga0070672_100086203 3300005543 Bacteria 2525
249 Ga0070672_100121135 3300005543 Bacteria 2141
250 Ga0070686_100002014 3300005544 Bacteria 11269
251 Ga0070686_100002916 3300005544 Bacteria 9390
252 Ga0070686_100021984 3300005544 Bacteria 3796
253 Ga0070686_100024116 3300005544 Bacteria 3644
254 Ga0070686_100128964 3300005544 Bacteria 1746
255 Ga0070686_100160971 3300005544 Bacteria 1581
256 Ga0070695_100001734 3300005545 Bacteria 12268
257 Ga0070695_100003705 3300005545 Bacteria 8902
258 Ga0070695_100007603 3300005545 Bacteria 6421
259 Ga0070695_100008191 3300005545 Bacteria 6197
260 Ga0070695_100012588 3300005545 Bacteria 5079
261 Ga0070696_100001310 3300005546 Bacteria 16245
262 Ga0070696_100006474 3300005546 Bacteria 7828
263 Ga0070696_100007364 3300005546 Bacteria 7349
264 Ga0070696_100040533 3300005546 Bacteria 3215
265 Ga0070696_100066301 3300005546 Bacteria 2532
266 Ga0070696_100246159 3300005546 Bacteria 1350
267 Ga0070693_100000199 3300005547 Bacteria 28265
268 Ga0070693_100002021 3300005547 Bacteria 9278
269 Ga0070693_100013889 3300005547 Bacteria 4113
270 Ga0070693_100063136 3300005547 Bacteria 2158
271 Ga0070693_100066424 3300005547 Bacteria 2111
272 Ga0070665_100102196 3300005548 Bacteria 2870
273 Ga0070665_100104237 3300005548 Bacteria 2839
274 Ga0070665_100205626 3300005548 Bacteria 1969
275 Ga0070665_100622941 3300005548 Bacteria 1092
276 Ga0070704_100000987 3300005549 Bacteria 14504
277 Ga0070704_100010219 3300005549 Bacteria 5710
278 Ga0070704_100040973 3300005549 Bacteria 3193
279 Ga0070704_100065953 3300005549 Bacteria 2608
280 Ga0070704_100283793 3300005549 Bacteria 1373
281 Ga0068855_100004444 3300005563 Bacteria 17127
282 Ga0068855_100007848 3300005563 Bacteria 12897
283 Ga0068855_100017545 3300005563 Bacteria 8607
284 Ga0068855_100054642 3300005563 Bacteria 4693
285 Ga0068855_100079069 3300005563 Bacteria 3815
286 Ga0068855_100093856 3300005563 Bacteria 3460
287 Ga0068855_100105815 3300005563 Bacteria 3234
288 Ga0068855_100170351 3300005563 Bacteria 2466
289 Ga0068855_100285978 3300005563 Bacteria 1829
290 Ga0068855_100307027 3300005563 Bacteria 1756
291 Ga0068855_100409977 3300005563 Bacteria 1484
292 Ga0070664_100000021 3300005564 Bacteria 111983
293 Ga0070664_100000895 3300005564 Bacteria 23168
294 Ga0070664_100006659 3300005564 Bacteria 9319
295 Ga0070664_100008621 3300005564 Bacteria 8249
296 Ga0070664_100136076 3300005564 Bacteria 2160
297 Ga0070664_100294447 3300005564 Bacteria 1465
298 Ga0068857_100001816 3300005577 Bacteria 17161
299 Ga0068857_100005420 3300005577 Bacteria 10880
300 Ga0068857_100036924 3300005577 Bacteria 4327
301 Ga0068854_100000011 3300005578 Bacteria 172150
302 Ga0068854_100001666 3300005578 Bacteria 13522
303 Ga0068854_100003863 3300005578 Bacteria 9390
304 Ga0068854_100007178 3300005578 Bacteria 7114
305 Ga0068854_100010188 3300005578 Bacteria 6092
306 Ga0068854_100034293 3300005578 Bacteria 3544
307 Ga0068854_100068033 3300005578 Bacteria 2597
308 Ga0068856_100000645 3300005614 Bacteria 37823
309 Ga0068856_100001538 3300005614 Bacteria 24179
310 Ga0068856_100085686 3300005614 Bacteria 3130
311 Ga0070702_100001415 3300005615 Bacteria 9801
312 Ga0070702_100009437 3300005615 Bacteria 4775
313 Ga0068852_100002972 3300005616 Bacteria 11773
314 Ga0068852_100012393 3300005616 Bacteria 6472
315 Ga0068852_100030886 3300005616 Bacteria 4414
316 Ga0068852_100036124 3300005616 Bacteria 4131
317 Ga0068852_100051059 3300005616 Bacteria 3546
318 Ga0068852_100083940 3300005616 Bacteria 2834
319 Ga0068852_100137926 3300005616 Bacteria 2254
320 Ga0068852_100182071 3300005616 Bacteria 1977
321 Ga0068859_100002139 3300005617 Bacteria 20084
322 Ga0068859_100012949 3300005617 Bacteria 8379
323 Ga0068859_100013486 3300005617 Bacteria 8195
324 Ga0068859_100018324 3300005617 Bacteria 7039
325 Ga0068859_100030307 3300005617 Bacteria 5428
326 Ga0068859_100032539 3300005617 Bacteria 5238
327 Ga0068859_100213502 3300005617 Bacteria 2016
328 Ga0068859_100289308 3300005617 Bacteria 1731
329 Ga0068859_100638845 3300005617 Bacteria 1157
330 Ga0068864_100000227 3300005618 Bacteria 50765
331 Ga0068864_100000632 3300005618 Bacteria 29500
332 Ga0068864_100004366 3300005618 Bacteria 11607
333 Ga0068864_100006069 3300005618 Bacteria 9915
334 Ga0068864_100029499 3300005618 Bacteria 4648
335 Ga0068864_100161358 3300005618 Bacteria 2038
336 Ga0068864_100180306 3300005618 Bacteria 1931
337 Ga0068864_100392529 3300005618 Bacteria 1317
338 Ga0068866_10000386 3300005718 Bacteria 20693
339 Ga0068866_10001618 3300005718 Bacteria 9533
340 Ga0068866_10003190 3300005718 Bacteria 6752
341 Ga0068866_10026345 3300005718 Bacteria 2745
342 Ga0068866_10037864 3300005718 Bacteria 2371
343 Ga0068866_10187261 3300005718 Bacteria 1227
344 Ga0068861_100000162 3300005719 Bacteria 34965
345 Ga0068861_100002152 3300005719 Bacteria 12764
346 Ga0068861_100003021 3300005719 Bacteria 11111
347 Ga0068861_100005060 3300005719 Bacteria 8895
348 Ga0068861_100255554 3300005719 Bacteria 1497
349 Ga0068861_100285928 3300005719 Bacteria 1422
350 Ga0068851_10000157 3300005834 Bacteria 36145
351 Ga0068851_10010920 3300005834 Bacteria 4248
352 Ga0068851_10036970 3300005834 Bacteria 2447
353 Ga0068870_10000155 3300005840 Bacteria 23940
354 Ga0068870_10000433 3300005840 Bacteria 15858
355 Ga0068870_10006157 3300005840 Bacteria 5276
356 Ga0068863_100000125 3300005841 Bacteria 80636
357 Ga0068863_100000495 3300005841 Bacteria 39957
358 Ga0068863_100013426 3300005841 Bacteria 7898
359 Ga0068863_100026988 3300005841 Bacteria 5476
360 Ga0068863_100028778 3300005841 Bacteria 5305
361 Ga0068863_100053159 3300005841 Bacteria 3838
362 Ga0068863_100137490 3300005841 Bacteria 2334
363 Ga0068858_100000025 3300005842 Bacteria 160546
364 Ga0068858_100000783 3300005842 Bacteria 33229
365 Ga0068858_100002197 3300005842 Bacteria 19756
366 Ga0068858_100014113 3300005842 Bacteria 7535
367 Ga0068858_100023775 3300005842 Bacteria 5709
368 Ga0068858_100041756 3300005842 Bacteria 4253
369 Ga0068858_100102711 3300005842 Bacteria 2667
370 Ga0068858_100308801 3300005842 Bacteria 1510
371 Ga0068860_100022860 3300005843 Bacteria 6046
372 Ga0068860_100028377 3300005843 Bacteria 5386
373 Ga0068860_100029109 3300005843 Bacteria 5313
374 Ga0068860_100081388 3300005843 Bacteria 3079
375 Ga0068860_100293748 3300005843 Bacteria 1591
376 Ga0068862_100005032 3300005844 Bacteria 11123
377 Ga0068862_100011560 3300005844 Bacteria 7283
378 Ga0068862_100020393 3300005844 Bacteria 5537
379 Ga0068862_100260433 3300005844 Bacteria 1583
380 Ga0081455_10000204 3300005937 Bacteria 75793
381 Ga0081455_10000678 3300005937 Bacteria 44138
382 Ga0081455_10000930 3300005937 Bacteria 37470
383 Ga0081455_10003638 3300005937 Bacteria 17663
384 Ga0081455_10006948 3300005937 Bacteria 12035
385 Ga0081455_10007844 3300005937 Bacteria 11178
386 Ga0081455_10009223 3300005937 Bacteria 10167
387 Ga0081455_10027231 3300005937 Bacteria 5239
388 Ga0081455_10041301 3300005937 Bacteria 4058
389 Ga0081455_10116121 3300005937 Bacteria 2117
390 Ga0081455_10186999 3300005937 Bacteria 1564
391 Ga0081538_10006317 3300005981 Bacteria 10463
392 Ga0081538_10063492 3300005981 Bacteria 2096
393 Ga0081540_1000147 3300005983 Bacteria 72589
394 Ga0081540_1000488 3300005983 Bacteria 38967
395 Ga0081540_1029769 3300005983 Bacteria 3036
396 Ga0081540_1036346 3300005983 Bacteria 2627
397 Ga0081539_10001093 3300005985 Bacteria 49316
398 Ga0081539_10001435 3300005985 Bacteria 40814
399 Ga0070717_10006465 3300006028 Bacteria 8622
400 Ga0070717_10173632 3300006028 Bacteria 1876
401 Ga0070717_10361401 3300006028 Bacteria 1299
402 Ga0070717_10449823 3300006028 Bacteria 1161
403 Ga0075365_10017782 3300006038 Bacteria 4359
404 Ga0075368_10018336 3300006042 Bacteria 2629
405 Ga0075368_10042087 3300006042 Bacteria 1796
406 Ga0075363_100154694 3300006048 Bacteria 1296
407 Ga0075364_10054632 3300006051 Bacteria 2612
408 Ga0075364_10057771 3300006051 Bacteria 2542
409 Ga0075364_10180919 3300006051 Bacteria 1427
410 Ga0075364_10258432 3300006051 Bacteria 1184
411 Ga0075432_10000464 3300006058 Bacteria 12026
412 Ga0070715_10000506 3300006163 Bacteria 10167
413 Ga0070715_10005760 3300006163 Bacteria 4163
414 Ga0070716_100003033 3300006173 Bacteria 7836
415 Ga0070716_100006056 3300006173 Bacteria 5895
416 Ga0070716_100192187 3300006173 Bacteria 1350
417 Ga0070716_100213925 3300006173 Bacteria 1290
418 Ga0070712_100002932 3300006175 Bacteria 10573
419 Ga0070712_100015569 3300006175 Bacteria 4903
420 Ga0070712_100147977 3300006175 Bacteria 1800
421 Ga0070712_100341756 3300006175 Bacteria 1222
422 Ga0075367_10000448 3300006178 Bacteria 15330
423 Ga0075367_10002073 3300006178 Bacteria 8978
424 Ga0075367_10013054 3300006178 Bacteria 4453
425 Ga0075367_10016320 3300006178 Bacteria 4055
426 Ga0075367_10061433 3300006178 Bacteria 2242
427 Ga0075367_10083947 3300006178 Bacteria 1930
428 Ga0075367_10088950 3300006178 Bacteria 1877
429 Ga0075367_10111869 3300006178 Bacteria 1677
430 Ga0075366_10009106 3300006195 Bacteria 5536
431 Ga0075366_10010862 3300006195 Bacteria 5124
432 Ga0075366_10014408 3300006195 Bacteria 4515
433 Ga0097621_100000010 3300006237 Bacteria 112867
434 Ga0097621_100012497 3300006237 Bacteria 6298
435 Ga0097621_100015252 3300006237 Bacteria 5776
436 Ga0097621_100089391 3300006237 Bacteria 2575
437 Ga0097621_100121279 3300006237 Bacteria 2217
438 Ga0075370_10051596 3300006353 Bacteria 2333
439 Ga0068871_100000034 3300006358 Bacteria 71462
440 Ga0068871_100003125 3300006358 Bacteria 11363
441 Ga0068871_100011248 3300006358 Bacteria 6559
442 Ga0068871_100013600 3300006358 Bacteria 6043
443 Ga0068871_100026363 3300006358 Bacteria 4534
444 Ga0068871_100045140 3300006358 Bacteria 3546
445 Ga0068871_100151675 3300006358 Bacteria 1977
446 Ga0075428_100001444 3300006844 Bacteria 25394
447 Ga0075428_100010157 3300006844 Bacteria 10457
448 Ga0075428_100016761 3300006844 Bacteria 8090
449 Ga0075428_100047877 3300006844 Bacteria 4695
450 Ga0075428_100083890 3300006844 Bacteria 3477
451 Ga0075428_100232697 3300006844 Bacteria 1988
452 Ga0075430_100000342 3300006846 Bacteria 33715
453 Ga0075430_100005590 3300006846 Bacteria 10623
454 Ga0075430_100023265 3300006846 Bacteria 5272
455 Ga0075430_100070585 3300006846 Bacteria 2930
456 Ga0075430_100143839 3300006846 Bacteria 1986
457 Ga0075430_100188731 3300006846 Bacteria 1713
458 Ga0075431_100000004 3300006847 Bacteria 106006
459 Ga0075431_100001945 3300006847 Bacteria 19707
460 Ga0075431_100004052 3300006847 Bacteria 14278
461 Ga0075431_100031321 3300006847 Bacteria 5478
462 Ga0075431_100039758 3300006847 Bacteria 4846
463 Ga0075431_100081418 3300006847 Bacteria 3343
464 Ga0075431_100152214 3300006847 Bacteria 2382
465 Ga0075431_100238113 3300006847 Bacteria 1852
466 Ga0075431_100249100 3300006847 Bacteria 1805
467 Ga0075433_10000774 3300006852 Bacteria 21997
468 Ga0075433_10009145 3300006852 Bacteria 7912
469 Ga0075433_10017476 3300006852 Bacteria 5941
470 Ga0075433_10048652 3300006852 Bacteria 3688
471 Ga0075433_10075502 3300006852 Bacteria 2966
472 Ga0075433_10080279 3300006852 Bacteria 2875
473 Ga0075433_10098099 3300006852 Bacteria 2594
474 Ga0075433_10301797 3300006852 Bacteria 1418
475 Ga0075434_100001700 3300006871 Bacteria 18837
476 Ga0075434_100003917 3300006871 Bacteria 13330
477 Ga0075434_100005910 3300006871 Bacteria 11193
478 Ga0075434_100011633 3300006871 Bacteria 8311
479 Ga0075434_100020745 3300006871 Bacteria 6377
480 Ga0075434_100029592 3300006871 Bacteria 5389
481 Ga0075434_100049823 3300006871 Bacteria 4160
482 Ga0075434_100089483 3300006871 Bacteria 3080
483 Ga0075434_100120172 3300006871 Bacteria 2642
484 Ga0075434_100293557 3300006871 Bacteria 1646
485 Ga0075434_100681426 3300006871 Bacteria 1046
486 Ga0075429_100005048 3300006880 Bacteria 11352
487 Ga0075429_100007130 3300006880 Bacteria 9709
488 Ga0075429_100029221 3300006880 Bacteria 4788
489 Ga0075429_100053077 3300006880 Bacteria 3527
490 Ga0075429_100081001 3300006880 Bacteria 2831
491 Ga0068865_100000230 3300006881 Bacteria 31147
492 Ga0068865_100003704 3300006881 Bacteria 9184
493 Ga0068865_100022027 3300006881 Bacteria 4150
494 Ga0075436_100001839 3300006914 Bacteria 14545
495 Ga0097620_100002139 3300006931 Bacteria 20084
496 Ga0097620_100012950 3300006931 Bacteria 8379
497 Ga0097620_100013487 3300006931 Bacteria 8195
498 Ga0097620_100018325 3300006931 Bacteria 7039
499 Ga0097620_100030307 3300006931 Bacteria 5428
500 Ga0097620_100032540 3300006931 Bacteria 5238
501 Ga0097620_100213511 3300006931 Bacteria 2016
502 Ga0097620_100289323 3300006931 Bacteria 1731
503 Ga0097620_100638887 3300006931 Bacteria 1157
504 Ga0099824_1017617 3300006942 Bacteria 6127
505 Ga0099822_1002963 3300006943 Bacteria 21553
506 Ga0075435_100000238 3300007076 Bacteria 33882
507 Ga0075435_100018036 3300007076 Bacteria 5355
508 Ga0075435_100024146 3300007076 Bacteria 4713
509 Ga0075435_100038749 3300007076 Bacteria 3801
510 Ga0075435_100208391 3300007076 Bacteria 1657
511 Ga0099794_10002061 3300007265 Bacteria 7291
512 Ga0099794_10002598 3300007265 Bacteria 6706
513 Ga0105251_10009243 3300009011 Bacteria 5842
514 Ga0105244_10140441 3300009036 Bacteria 1162
515 Ga0105250_10075623 3300009092 Bacteria 1362
516 Ga0105240_10010891 3300009093 Bacteria 12739
517 Ga0105240_10013662 3300009093 Bacteria 11136
518 Ga0105240_10028302 3300009093 Bacteria 7321
519 Ga0105240_10032653 3300009093 Bacteria 6737
520 Ga0105240_10064092 3300009093 Bacteria 4568
521 Ga0105240_10121696 3300009093 Bacteria 3142
522 Ga0105240_10136404 3300009093 Bacteria 2938
523 Ga0105240_10444767 3300009093 Bacteria 1452
524 Ga0105240_10532950 3300009093 Bacteria 1301
525 Ga0111539_10000593 3300009094 Bacteria 46768
526 Ga0111539_10000932 3300009094 Bacteria 38323
527 Ga0111539_10002162 3300009094 Bacteria 26296
528 Ga0111539_10010377 3300009094 Bacteria 11726
529 Ga0111539_10028808 3300009094 Bacteria 6772
530 Ga0111539_10063344 3300009094 Bacteria 4376
531 Ga0111539_10077376 3300009094 Bacteria 3915
532 Ga0111539_10102595 3300009094 Bacteria 3358
533 Ga0111539_10158986 3300009094 Bacteria 2643
534 Ga0105245_10000258 3300009098 Bacteria 50464
535 Ga0105245_10001230 3300009098 Bacteria 23117
536 Ga0105245_10007375 3300009098 Bacteria 9628
537 Ga0105245_10035099 3300009098 Bacteria 4450
538 Ga0105245_10084954 3300009098 Bacteria 2900
539 Ga0105245_10106904 3300009098 Bacteria 2597
540 Ga0105245_10149302 3300009098 Bacteria 2208
541 Ga0105247_10001538 3300009101 Bacteria 16473
542 Ga0105247_10002128 3300009101 Bacteria 13684
543 Ga0105247_10027659 3300009101 Bacteria 3429
544 Ga0114129_10000582 3300009147 Bacteria 45047
545 Ga0114129_10020239 3300009147 Bacteria 9470
546 Ga0114129_10026350 3300009147 Bacteria 8231
547 Ga0114129_10046243 3300009147 Bacteria 6117
548 Ga0114129_10047166 3300009147 Bacteria 6055
549 Ga0114129_10128586 3300009147 Bacteria 3481
550 Ga0114129_10542262 3300009147 Bacteria 1514
551 Ga0114129_10660461 3300009147 Bacteria 1348
552 Ga0105243_10000846 3300009148 Bacteria 29054
553 Ga0105243_10007162 3300009148 Bacteria 8575
554 Ga0105243_10013532 3300009148 Bacteria 6171
555 Ga0105243_10031832 3300009148 Bacteria 4069
556 Ga0105243_10070856 3300009148 Bacteria 2816
557 Ga0105243_10199818 3300009148 Bacteria 1752
558 Ga0105243_10253695 3300009148 Bacteria 1572
559 Ga0105241_10002261 3300009174 Bacteria 14471
560 Ga0105241_10003482 3300009174 Bacteria 11707
561 Ga0105241_10037591 3300009174 Bacteria 3648
562 Ga0105241_10043563 3300009174 Bacteria 3399
563 Ga0105241_10052670 3300009174 Bacteria 3109
564 Ga0105242_10000037 3300009176 Bacteria 91293
565 Ga0105242_10005854 3300009176 Bacteria 9473
566 Ga0105242_10009393 3300009176 Bacteria 7503
567 Ga0105242_10038990 3300009176 Bacteria 3823
568 Ga0105242_10072671 3300009176 Bacteria 2857
569 Ga0105248_10000744 3300009177 Bacteria 36599
570 Ga0105248_10009760 3300009177 Bacteria 10578
571 Ga0105248_10011746 3300009177 Bacteria 9659
572 Ga0105248_10014815 3300009177 Bacteria 8588
573 Ga0105248_10024935 3300009177 Bacteria 6647
574 Ga0105248_10038670 3300009177 Bacteria 5340
575 Ga0105248_10097121 3300009177 Bacteria 3319
576 Ga0105248_10131174 3300009177 Bacteria 2828
577 Ga0105248_10257977 3300009177 Bacteria 1962
578 Ga0105248_10291505 3300009177 Bacteria 1837
579 Ga0105248_10459702 3300009177 Bacteria 1435
580 Ga0105237_10000927 3300009545 Bacteria 39487
581 Ga0105237_10001564 3300009545 Bacteria 29835
582 Ga0105237_10028586 3300009545 Bacteria 5677
583 Ga0105237_10041135 3300009545 Bacteria 4662
584 Ga0105237_10060613 3300009545 Bacteria 3784
585 Ga0105237_10121585 3300009545 Bacteria 2605
586 Ga0105237_10130250 3300009545 Bacteria 2510
587 Ga0105237_10204747 3300009545 Bacteria 1974
588 Ga0105237_10339578 3300009545 Bacteria 1507
589 Ga0105237_10452190 3300009545 Bacteria 1290
590 Ga0105238_10005667 3300009551 Bacteria 12346
591 Ga0105238_10006361 3300009551 Bacteria 11745
592 Ga0105238_10022046 3300009551 Bacteria 6492
593 Ga0105249_10000209 3300009553 Bacteria 67037
594 Ga0105249_10007022 3300009553 Bacteria 9828
595 Ga0105249_10010037 3300009553 Bacteria 8310
596 Ga0105249_10018811 3300009553 Bacteria 6157
597 Ga0105249_10085541 3300009553 Bacteria 2939
598 Ga0105249_10808355 3300009553 Bacteria 1002
599 Ga0099796_10047501 3300010159 Bacteria 1477
600 Ga0105239_10001392 3300010375 Bacteria 32410
601 Ga0105239_10022736 3300010375 Bacteria 6912
602 Ga0105239_10034226 3300010375 Bacteria 5578
603 Ga0105239_10045801 3300010375 Bacteria 4793
604 Ga0105239_10085668 3300010375 Bacteria 3473
605 Ga0105239_10102725 3300010375 Bacteria 3163
606 Ga0105239_10206985 3300010375 Bacteria 2198
607 Ga0105239_10371495 3300010375 Bacteria 1616
608 Ga0105239_10629240 3300010375 Bacteria 1225
609 Ga0105246_10002021 3300011119 Bacteria 12259
610 Ga0105246_10008790 3300011119 Bacteria 6215
611 Ga0105246_10018874 3300011119 Bacteria 4397
612 Ga0105246_10044594 3300011119 Bacteria 3015
613 Ga0105246_10064206 3300011119 Bacteria 2564
614 Ga0105246_10226807 3300011119 Bacteria 1468
615 Ga0157373_10010027 3300013100 Bacteria 6982
616 Ga0157373_10019018 3300013100 Bacteria 4999
617 Ga0157373_10239531 3300013100 Bacteria 1282
618 Ga0157371_10000072 3300013102 Bacteria 163917
619 Ga0157371_10000585 3300013102 Bacteria 43238
620 Ga0157371_10008348 3300013102 Bacteria 8263
621 Ga0157371_10030194 3300013102 Bacteria 3911
622 Ga0157371_10212814 3300013102 Bacteria 1387
623 Ga0157371_10243078 3300013102 Bacteria 1295
624 Ga0157370_10001115 3300013104 Bacteria 33632
625 Ga0157370_10015394 3300013104 Bacteria 7774
626 Ga0157370_10038246 3300013104 Bacteria 4642
627 Ga0157369_10009534 3300013105 Bacteria 11103
628 Ga0157369_10041328 3300013105 Bacteria 5033
629 Ga0157369_10093663 3300013105 Bacteria 3206
630 Ga0157369_10116021 3300013105 Bacteria 2843
631 Ga0157369_10235643 3300013105 Bacteria 1912
632 Ga0171462_1022 3300013250 Bacteria 141292
633 Ga0157374_10000108 3300013296 Bacteria 75890
634 Ga0157374_10009050 3300013296 Bacteria 8532
635 Ga0157374_10017678 3300013296 Bacteria 6283
636 Ga0157374_10229166 3300013296 Bacteria 1825
637 Ga0157374_10334180 3300013296 Bacteria 1503
638 Ga0157378_10000994 3300013297 Bacteria 25964
639 Ga0157378_10001580 3300013297 Bacteria 20573
640 Ga0157378_10025417 3300013297 Bacteria 5215
641 Ga0157378_10068904 3300013297 Bacteria 3173
642 Ga0157378_10114386 3300013297 Bacteria 2478
643 Ga0163162_10001677 3300013306 Bacteria 20764
644 Ga0163162_10016503 3300013306 Bacteria 7215
645 Ga0163162_10017229 3300013306 Bacteria 7069
646 Ga0163162_10191376 3300013306 Bacteria 2174
647 Ga0163162_10493455 3300013306 Bacteria 1355
648 Ga0157372_10006418 3300013307 Bacteria 12516
649 Ga0157372_10085368 3300013307 Bacteria 3580
650 Ga0157372_10152833 3300013307 Bacteria 2665
651 Ga0157375_10000263 3300013308 Bacteria 47730
652 Ga0157375_10004135 3300013308 Bacteria 12590
653 Ga0157375_10037022 3300013308 Bacteria 4671
654 Ga0157375_10050465 3300013308 Bacteria 4081
655 Ga0163163_10002532 3300014325 Bacteria 15468
656 Ga0163163_10022304 3300014325 Bacteria 5992
657 Ga0157380_10000294 3300014326 Bacteria 30013
658 Ga0157380_10058635 3300014326 Bacteria 3069
659 Ga0157380_10162170 3300014326 Bacteria 1944
660 Ga0157380_10241729 3300014326 Bacteria 1628
661 Ga0157380_10408779 3300014326 Bacteria 1290
662 Ga0182008_10020985 3300014497 Bacteria 3359
663 Ga0157377_10001222 3300014745 Bacteria 10959
664 Ga0157377_10001850 3300014745 Bacteria 9241
665 Ga0157377_10061491 3300014745 Bacteria 2146
666 Ga0157379_10000315 3300014968 Bacteria 38481
667 Ga0157379_10001196 3300014968 Bacteria 21126
668 Ga0157379_10002453 3300014968 Bacteria 15540
669 Ga0157379_10004779 3300014968 Bacteria 11636
670 Ga0157379_10099136 3300014968 Bacteria 2616
671 Ga0157379_10287997 3300014968 Bacteria 1495
672 Ga0157379_10561289 3300014968 Bacteria 1063
673 Ga0157376_10000342 3300014969 Bacteria 31043
674 Ga0157376_10000775 3300014969 Bacteria 20857
675 Ga0157376_10001088 3300014969 Bacteria 17800
676 Ga0157376_10134798 3300014969 Bacteria 2208
677 Ga0182006_1002237 3300015261 Bacteria 10702
678 Ga0163161_10000523 3300017792 Bacteria 31363
679 Ga0163161_10006061 3300017792 Bacteria 8380
680 Ga0163161_10019776 3300017792 Bacteria 4724
681 Ga0163161_10078438 3300017792 Bacteria 2427
682 Ga0163161_10188941 3300017792 Bacteria 1582
683 Ga0154015_1708714 3300020610 Bacteria 4535
684 Ga0213872_10002352 3300021361 Bacteria 11227
685 Ga0213872_10050957 3300021361 Bacteria 1879
686 Ga0213876_10007213 3300021384 Bacteria 6059
687 Ga0213875_10009268 3300021388 Bacteria 4995
688 Ga0209784_101379 3300025224 Bacteria 3342
689 Ga0209566_103054 3300025225 Bacteria 2744
690 Ga0209674_102329 3300025226 Bacteria 4165
691 Ga0209672_101368 3300025228 Bacteria 9087
692 Ga0209147_100015 3300025229 Bacteria 565073
693 Ga0209258_100021 3300025242 Bacteria 565073
694 Ga0209646_1000131 3300025246 Bacteria 128289
695 Ga0209026_1000038 3300025250 Bacteria 281227
696 Ga0209026_1000141 3300025250 Bacteria 114545
697 Ga0209677_100616 3300025253 Bacteria 19095
698 Ga0209148_1000574 3300025254 Bacteria 34124
699 Ga0209148_1002896 3300025254 Bacteria 5239
700 Ga0209759_1000031 3300025256 Bacteria 281227
701 Ga0209759_1000554 3300025256 Bacteria 38251
702 Ga0209759_1001806 3300025256 Bacteria 10808
703 Ga0209759_1005376 3300025256 Bacteria 4503
704 Ga0209233_1004212 3300025261 Bacteria 4931
705 Ga0207666_1000010 3300025271 Bacteria 46973
706 Ga0209455_1000028 3300025272 Bacteria 565073
707 Ga0209455_1000299 3300025272 Bacteria 51077
708 Ga0209455_1000834 3300025272 Bacteria 16636
709 Ga0209673_1024878 3300025273 Bacteria 2002
710 Ga0209130_1000279 3300025284 Bacteria 63145
711 Ga0209130_1024083 3300025284 Bacteria 1334
712 Ga0207673_1000265 3300025290 Bacteria 5342
713 Ga0209675_1006326 3300025291 Bacteria 4775
714 Ga0209676_1001544 3300025292 Bacteria 20733
715 Ga0209025_1000008 3300025294 Bacteria 1130876
716 Ga0209025_1002215 3300025294 Bacteria 21453
717 Ga0209564_1000049 3300025295 Bacteria 362075
718 Ga0209564_1024318 3300025295 Bacteria 2073
719 Ga0209758_1000128 3300025297 Bacteria 186771
720 Ga0209758_1002030 3300025297 Bacteria 21763
721 Ga0209050_1002892 3300025298 Bacteria 13533
722 Ga0209256_1000014 3300025299 Bacteria 687409
723 Ga0207426_1020373 3300025302 Bacteria 2305
724 Ga0209051_1002343 3300025303 Bacteria 13718
725 Ga0209257_1000304 3300025304 Bacteria 107843
726 Ga0207697_10000186 3300025315 Bacteria 32405
727 Ga0207697_10000586 3300025315 Bacteria 20751
728 Ga0207697_10003939 3300025315 Bacteria 7220
729 Ga0207697_10014762 3300025315 Bacteria 3235
730 Ga0207656_10016141 3300025321 Bacteria 2903
731 Ga0207656_10088441 3300025321 Bacteria 1403
732 Ga0207653_10006329 3300025885 Bacteria 3693
733 Ga0207653_10007308 3300025885 Bacteria 3443
734 Ga0207682_10000123 3300025893 Bacteria 34953
735 Ga0207682_10002226 3300025893 Bacteria 8750
736 Ga0207682_10006038 3300025893 Bacteria 4898
737 Ga0207692_10012990 3300025898 Bacteria 3598
738 Ga0207692_10137747 3300025898 Bacteria 1385
739 Ga0207642_10021680 3300025899 Bacteria 2534
740 Ga0207642_10024721 3300025899 Bacteria 2419
741 Ga0207710_10002765 3300025900 Bacteria 8022
742 Ga0207710_10016457 3300025900 Bacteria 3129
743 Ga0207710_10025144 3300025900 Bacteria 2569
744 Ga0207688_10000079 3300025901 Bacteria 36923
745 Ga0207688_10000889 3300025901 Bacteria 15094
746 Ga0207688_10004916 3300025901 Bacteria 7275
747 Ga0207688_10030347 3300025901 Bacteria 2980
748 Ga0207688_10032402 3300025901 Bacteria 2888
749 Ga0207688_10051688 3300025901 Bacteria 2302
750 Ga0207680_10000378 3300025903 Bacteria 21298
751 Ga0207680_10001117 3300025903 Bacteria 12657
752 Ga0207680_10001483 3300025903 Bacteria 11098
753 Ga0207680_10267674 3300025903 Bacteria 1184
754 Ga0207647_10000318 3300025904 Bacteria 39988
755 Ga0207647_10001066 3300025904 Bacteria 21111
756 Ga0207647_10046161 3300025904 Bacteria 2715
757 Ga0207647_10052353 3300025904 Bacteria 2520
758 Ga0207699_10003769 3300025906 Bacteria 7238
759 Ga0207699_10043874 3300025906 Bacteria 2600
760 Ga0207699_10055544 3300025906 Bacteria 2357
761 Ga0207699_10183013 3300025906 Bacteria 1410
762 Ga0207645_10000016 3300025907 Bacteria 114058
763 Ga0207645_10000023 3300025907 Bacteria 98724
764 Ga0207645_10015180 3300025907 Bacteria 5128
765 Ga0207645_10015487 3300025907 Bacteria 5063
766 Ga0207645_10149818 3300025907 Bacteria 1522
767 Ga0207645_10177026 3300025907 Bacteria 1399
768 Ga0207645_10228600 3300025907 Bacteria 1228
769 Ga0207643_10000007 3300025908 Bacteria 171706
770 Ga0207643_10000010 3300025908 Bacteria 159218
771 Ga0207643_10022196 3300025908 Bacteria 3493
772 Ga0207643_10045726 3300025908 Bacteria 2473
773 Ga0207705_10062714 3300025909 Bacteria 2685
774 Ga0207705_10087317 3300025909 Bacteria 2281
775 Ga0207705_10114006 3300025909 Bacteria 1999
776 Ga0207684_10032114 3300025910 Bacteria 4465
777 Ga0207654_10006607 3300025911 Bacteria 5831
778 Ga0207654_10038790 3300025911 Bacteria 2675
779 Ga0207654_10056535 3300025911 Bacteria 2277
780 Ga0207707_10002015 3300025912 Bacteria 18441
781 Ga0207707_10038893 3300025912 Bacteria 4158
782 Ga0207707_10063342 3300025912 Bacteria 3218
783 Ga0207707_10240776 3300025912 Bacteria 1573
784 Ga0207695_10000029 3300025913 Bacteria 548364
785 Ga0207695_10001390 3300025913 Bacteria 40902
786 Ga0207695_10001875 3300025913 Bacteria 32916
787 Ga0207695_10002415 3300025913 Bacteria 27668
788 Ga0207695_10500480 3300025913 Bacteria 1097
789 Ga0207695_10513131 3300025913 Bacteria 1080
790 Ga0207671_10033905 3300025914 Bacteria 3796
791 Ga0207671_10037291 3300025914 Bacteria 3605
792 Ga0207671_10053873 3300025914 Bacteria 2981
793 Ga0207671_10075982 3300025914 Bacteria 2513
794 Ga0207693_10001182 3300025915 Bacteria 23298
795 Ga0207693_10019775 3300025915 Bacteria 5353
796 Ga0207693_10020341 3300025915 Bacteria 5280
797 Ga0207693_10062939 3300025915 Bacteria 2907
798 Ga0207693_10189055 3300025915 Bacteria 1621
799 Ga0207663_10010046 3300025916 Bacteria 5018
800 Ga0207660_10000393 3300025917 Bacteria 28822
801 Ga0207660_10125685 3300025917 Bacteria 1947
802 Ga0207662_10000014 3300025918 Bacteria 85091
803 Ga0207662_10000136 3300025918 Bacteria 35258
804 Ga0207662_10000666 3300025918 Bacteria 15602
805 Ga0207662_10017308 3300025918 Bacteria 4076
806 Ga0207662_10041037 3300025918 Bacteria 2723
807 Ga0207662_10063779 3300025918 Bacteria 2216
808 Ga0207657_10000060 3300025919 Bacteria 101953
809 Ga0207657_10001190 3300025919 Bacteria 27644
810 Ga0207657_10002615 3300025919 Bacteria 19455
811 Ga0207657_10005707 3300025919 Bacteria 12993
812 Ga0207657_10007391 3300025919 Bacteria 11268
813 Ga0207657_10009870 3300025919 Bacteria 9559
814 Ga0207657_10035478 3300025919 Bacteria 4471
815 Ga0207657_10084082 3300025919 Bacteria 2668
816 Ga0207657_10222897 3300025919 Bacteria 1510
817 Ga0207649_10000434 3300025920 Bacteria 30314
818 Ga0207649_10002957 3300025920 Bacteria 9351
819 Ga0207649_10004994 3300025920 Bacteria 7169
820 Ga0207649_10116894 3300025920 Bacteria 1792
821 Ga0207652_10001720 3300025921 Bacteria 19098
822 Ga0207652_10033930 3300025921 Bacteria 4299
823 Ga0207652_10052264 3300025921 Bacteria 3506
824 Ga0207652_10055225 3300025921 Bacteria 3415
825 Ga0207652_10078015 3300025921 Bacteria 2891
826 Ga0207652_10078596 3300025921 Bacteria 2881
827 Ga0207652_10262833 3300025921 Bacteria 1557
828 Ga0207646_10073508 3300025922 Bacteria 3054
829 Ga0207646_10440132 3300025922 Bacteria 1176
830 Ga0207681_10000273 3300025923 Bacteria 38704
831 Ga0207681_10003056 3300025923 Bacteria 10517
832 Ga0207681_10030327 3300025923 Bacteria 3525
833 Ga0207694_10028904 3300025924 Bacteria 4228
834 Ga0207694_10060994 3300025924 Bacteria 2935
835 Ga0207694_10071637 3300025924 Bacteria 2708
836 Ga0207694_10091471 3300025924 Bacteria 2401
837 Ga0207694_10423131 3300025924 Bacteria 1110
838 Ga0207650_10000179 3300025925 Bacteria 74527
839 Ga0207650_10001932 3300025925 Bacteria 14593
840 Ga0207650_10016066 3300025925 Bacteria 5225
841 Ga0207650_10019097 3300025925 Bacteria 4817
842 Ga0207650_10079507 3300025925 Bacteria 2483
843 Ga0207650_10151563 3300025925 Bacteria 1830
844 Ga0207650_10228230 3300025925 Bacteria 1501
845 Ga0207650_10401372 3300025925 Bacteria 1135
846 Ga0207659_10000097 3300025926 Bacteria 51545
847 Ga0207659_10002576 3300025926 Bacteria 10800
848 Ga0207659_10045817 3300025926 Bacteria 3086
849 Ga0207659_10092949 3300025926 Bacteria 2256
850 Ga0207659_10298069 3300025926 Bacteria 1323
851 Ga0207687_10001031 3300025927 Bacteria 18938
852 Ga0207687_10010099 3300025927 Bacteria 6173
853 Ga0207687_10015685 3300025927 Bacteria 4972
854 Ga0207687_10025434 3300025927 Bacteria 3961
855 Ga0207687_10159802 3300025927 Bacteria 1728
856 Ga0207687_10311939 3300025927 Bacteria 1270
857 Ga0207687_10356981 3300025927 Bacteria 1192
858 Ga0207700_10042358 3300025928 Bacteria 3337
859 Ga0207700_10043817 3300025928 Bacteria 3290
860 Ga0207700_10079033 3300025928 Bacteria 2561
861 Ga0207664_10022395 3300025929 Bacteria 4717
862 Ga0207664_10045298 3300025929 Bacteria 3449
863 Ga0207664_10195694 3300025929 Bacteria 1742
864 Ga0207644_10003263 3300025931 Bacteria 10474
865 Ga0207644_10005450 3300025931 Bacteria 8289
866 Ga0207644_10296593 3300025931 Bacteria 1301
867 Ga0207690_10000962 3300025932 Bacteria 18398
868 Ga0207690_10058526 3300025932 Bacteria 2606
869 Ga0207690_10148504 3300025932 Bacteria 1735
870 Ga0207690_10155495 3300025932 Bacteria 1699
871 Ga0207706_10000132 3300025933 Bacteria 81128
872 Ga0207706_10000867 3300025933 Bacteria 31142
873 Ga0207706_10002958 3300025933 Bacteria 16402
874 Ga0207706_10005330 3300025933 Bacteria 11990
875 Ga0207706_10013242 3300025933 Bacteria 7504
876 Ga0207706_10023602 3300025933 Bacteria 5522
877 Ga0207706_10045631 3300025933 Bacteria 3882
878 Ga0207706_10118505 3300025933 Bacteria 2328
879 Ga0207706_10126349 3300025933 Bacteria 2249
880 Ga0207706_10178034 3300025933 Bacteria 1868
881 Ga0207686_10002591 3300025934 Bacteria 9812
882 Ga0207686_10020419 3300025934 Bacteria 3784
883 Ga0207686_10061425 3300025934 Bacteria 2382
884 Ga0207709_10007329 3300025935 Bacteria 6150
885 Ga0207709_10037131 3300025935 Bacteria 2893
886 Ga0207709_10039422 3300025935 Bacteria 2821
887 Ga0207709_10040253 3300025935 Bacteria 2797
888 Ga0207709_10081485 3300025935 Bacteria 2087
889 Ga0207670_10000085 3300025936 Bacteria 64040
890 Ga0207670_10000536 3300025936 Bacteria 20898
891 Ga0207670_10016232 3300025936 Bacteria 4469
892 Ga0207670_10032250 3300025936 Bacteria 3367
893 Ga0207670_10034683 3300025936 Bacteria 3264
894 Ga0207670_10109699 3300025936 Bacteria 1986
895 Ga0207669_10001135 3300025937 Bacteria 11370
896 Ga0207669_10003445 3300025937 Bacteria 6840
897 Ga0207669_10010902 3300025937 Bacteria 4397
898 Ga0207669_10083876 3300025937 Bacteria 2051
899 Ga0207669_10087120 3300025937 Bacteria 2021
900 Ga0207669_10125193 3300025937 Bacteria 1754
901 Ga0207669_10202374 3300025937 Bacteria 1442
902 Ga0207704_10000119 3300025938 Bacteria 43208
903 Ga0207704_10005358 3300025938 Bacteria 5911
904 Ga0207704_10037957 3300025938 Bacteria 2788
905 Ga0207704_10239576 3300025938 Bacteria 1354
906 Ga0207665_10000417 3300025939 Bacteria 29333
907 Ga0207665_10011736 3300025939 Bacteria 5757
908 Ga0207665_10039742 3300025939 Bacteria 3137
909 Ga0207665_10082576 3300025939 Bacteria 2214
910 Ga0207691_10000011 3300025940 Bacteria 147984
911 Ga0207691_10000544 3300025940 Bacteria 37754
912 Ga0207691_10017646 3300025940 Bacteria 6764
913 Ga0207691_10026368 3300025940 Bacteria 5453
914 Ga0207691_10026536 3300025940 Bacteria 5435
915 Ga0207691_10074625 3300025940 Bacteria 3059
916 Ga0207691_10096853 3300025940 Bacteria 2637
917 Ga0207691_10136406 3300025940 Bacteria 2164
918 Ga0207691_10215423 3300025940 Bacteria 1667
919 Ga0207711_10000230 3300025941 Bacteria 59916
920 Ga0207711_10002468 3300025941 Bacteria 16502
921 Ga0207711_10006466 3300025941 Bacteria 9864
922 Ga0207711_10017097 3300025941 Bacteria 6025
923 Ga0207711_10050101 3300025941 Bacteria 3575
924 Ga0207711_10132100 3300025941 Bacteria 2239
925 Ga0207711_10182248 3300025941 Bacteria 1910
926 Ga0207711_10336764 3300025941 Bacteria 1396
927 Ga0207689_10000011 3300025942 Bacteria 123627
928 Ga0207689_10001743 3300025942 Bacteria 20521
929 Ga0207689_10003591 3300025942 Bacteria 14170
930 Ga0207689_10030494 3300025942 Bacteria 4494
931 Ga0207689_10034495 3300025942 Bacteria 4203
932 Ga0207689_10126425 3300025942 Bacteria 2103
933 Ga0207661_10000785 3300025944 Bacteria 20682
934 Ga0207661_10030250 3300025944 Bacteria 4169
935 Ga0207661_10172158 3300025944 Bacteria 1885
936 Ga0207679_10000029 3300025945 Bacteria 183002
937 Ga0207679_10000300 3300025945 Bacteria 37069
938 Ga0207679_10021303 3300025945 Bacteria 4393
939 Ga0207679_10082319 3300025945 Bacteria 2464
940 Ga0207679_10117271 3300025945 Bacteria 2112
941 Ga0207679_10421203 3300025945 Bacteria 1178
942 Ga0207679_10473913 3300025945 Bacteria 1113
943 Ga0207667_10016422 3300025949 Bacteria 8368
944 Ga0207667_10029754 3300025949 Bacteria 5917
945 Ga0207667_10030515 3300025949 Bacteria 5832
946 Ga0207667_10059281 3300025949 Bacteria 4010
947 Ga0207667_10076268 3300025949 Bacteria 3479
948 Ga0207667_10085963 3300025949 Bacteria 3255
949 Ga0207667_10123301 3300025949 Bacteria 2670
950 Ga0207667_10254925 3300025949 Bacteria 1795
951 Ga0207667_10333392 3300025949 Bacteria 1549
952 Ga0207651_10000083 3300025960 Bacteria 42310
953 Ga0207651_10222048 3300025960 Bacteria 1528
954 Ga0207712_10000471 3300025961 Bacteria 33929
955 Ga0207712_10033305 3300025961 Bacteria 3483
956 Ga0207712_10056537 3300025961 Bacteria 2764
957 Ga0207712_10180966 3300025961 Bacteria 1656
958 Ga0207668_10000862 3300025972 Bacteria 18292
959 Ga0207668_10019200 3300025972 Bacteria 4315
960 Ga0207668_10026173 3300025972 Bacteria 3784
961 Ga0207668_10048640 3300025972 Bacteria 2911
962 Ga0207668_10153781 3300025972 Bacteria 1784
963 Ga0207668_10166758 3300025972 Bacteria 1723
964 Ga0207640_10000012 3300025981 Bacteria 242060
965 Ga0207640_10003185 3300025981 Bacteria 8831
966 Ga0207640_10005770 3300025981 Bacteria 6748
967 Ga0207640_10060368 3300025981 Bacteria 2506
968 Ga0207640_10064903 3300025981 Bacteria 2434
969 Ga0207640_10102421 3300025981 Bacteria 2011
970 Ga0207658_10002203 3300025986 Bacteria 14473
971 Ga0207658_10004693 3300025986 Bacteria 9468
972 Ga0207658_10008154 3300025986 Bacteria 7134
973 Ga0207658_10016451 3300025986 Bacteria 5087
974 Ga0207658_10053843 3300025986 Bacteria 2975
975 Ga0207658_10064787 3300025986 Bacteria 2742
976 Ga0207658_10118036 3300025986 Bacteria 2110
977 Ga0207677_10000992 3300026023 Bacteria 15647
978 Ga0207677_10011508 3300026023 Bacteria 5050
979 Ga0207677_10017141 3300026023 Bacteria 4310
980 Ga0207677_10064421 3300026023 Bacteria 2552
981 Ga0207677_10157105 3300026023 Bacteria 1762
982 Ga0207677_10298753 3300026023 Bacteria 1329
983 Ga0207703_10000105 3300026035 Bacteria 99702
984 Ga0207703_10000850 3300026035 Bacteria 29911
985 Ga0207703_10001380 3300026035 Bacteria 22185
986 Ga0207703_10010241 3300026035 Bacteria 7347
987 Ga0207703_10040329 3300026035 Bacteria 3736
988 Ga0207703_10050654 3300026035 Bacteria 3362
989 Ga0207639_10004451 3300026041 Bacteria 9457
990 Ga0207639_10046686 3300026041 Bacteria 3269
991 Ga0207639_10316947 3300026041 Bacteria 1383
992 Ga0207678_10001568 3300026067 Bacteria 21015
993 Ga0207678_10011293 3300026067 Bacteria 7839
994 Ga0207678_10045376 3300026067 Bacteria 3800
995 Ga0207678_10160109 3300026067 Bacteria 1922
996 Ga0207678_10271067 3300026067 Bacteria 1455
997 Ga0207678_10310586 3300026067 Bacteria 1356
998 Ga0207708_10002060 3300026075 Bacteria 14813
999 Ga0207708_10007559 3300026075 Bacteria 8038
1000 Ga0207708_10059728 3300026075 Bacteria 2910
1001 Ga0207702_10000668 3300026078 Bacteria 37297
1002 Ga0207702_10003639 3300026078 Bacteria 13965
1003 Ga0207641_10000012 3300026088 Bacteria 375486
1004 Ga0207641_10000510 3300026088 Bacteria 43699
1005 Ga0207641_10003139 3300026088 Bacteria 14841
1006 Ga0207641_10018681 3300026088 Bacteria 5684
1007 Ga0207641_10020080 3300026088 Bacteria 5485
1008 Ga0207641_10020130 3300026088 Bacteria 5478
1009 Ga0207641_10302803 3300026088 Bacteria 1510
1010 Ga0207648_10000258 3300026089 Bacteria 57424
1011 Ga0207648_10002351 3300026089 Bacteria 20407
1012 Ga0207648_10013008 3300026089 Bacteria 7764
1013 Ga0207648_10013661 3300026089 Bacteria 7539
1014 Ga0207648_10021296 3300026089 Bacteria 5827
1015 Ga0207648_10025816 3300026089 Bacteria 5227
1016 Ga0207648_10081627 3300026089 Bacteria 2820
1017 Ga0207676_10000315 3300026095 Bacteria 41410
1018 Ga0207676_10003788 3300026095 Bacteria 10694
1019 Ga0207676_10004531 3300026095 Bacteria 9830
1020 Ga0207676_10005003 3300026095 Bacteria 9387
1021 Ga0207676_10013714 3300026095 Bacteria 5819
1022 Ga0207676_10029863 3300026095 Bacteria 4085
1023 Ga0207676_10045153 3300026095 Bacteria 3403
1024 Ga0207676_10050627 3300026095 Bacteria 3239
1025 Ga0207676_10071457 3300026095 Bacteria 2786
1026 Ga0207676_10093462 3300026095 Bacteria 2476
1027 Ga0207676_10109448 3300026095 Bacteria 2309
1028 Ga0207674_10000608 3300026116 Bacteria 46971
1029 Ga0207674_10001878 3300026116 Bacteria 26750
1030 Ga0207674_10017132 3300026116 Bacteria 7910
1031 Ga0207674_10026074 3300026116 Bacteria 6218
1032 Ga0207674_10034261 3300026116 Bacteria 5311
1033 Ga0207674_10040706 3300026116 Bacteria 4812
1034 Ga0207674_10077619 3300026116 Bacteria 3327
1035 Ga0207674_10078801 3300026116 Bacteria 3299
1036 Ga0207674_10557201 3300026116 Bacteria 1107
1037 Ga0207675_100000164 3300026118 Bacteria 58951
1038 Ga0207675_100000805 3300026118 Bacteria 31142
1039 Ga0207675_100009234 3300026118 Bacteria 9248
1040 Ga0207675_100009286 3300026118 Bacteria 9221
1041 Ga0207675_100015555 3300026118 Bacteria 7096
1042 Ga0207675_100235558 3300026118 Bacteria 1767
1043 Ga0207675_100358800 3300026118 Bacteria 1430
1044 Ga0207683_10000082 3300026121 Bacteria 74842
1045 Ga0207683_10001556 3300026121 Bacteria 20639
1046 Ga0207683_10015896 3300026121 Bacteria 6409
1047 Ga0207683_10017934 3300026121 Bacteria 6037
1048 Ga0207683_10105638 3300026121 Bacteria 2517
1049 Ga0207683_10126685 3300026121 Bacteria 2295
1050 Ga0207698_10000377 3300026142 Bacteria 25983
1051 Ga0207698_10102778 3300026142 Bacteria 2373
1052 Ga0207698_10127582 3300026142 Bacteria 2167
1053 Ga0207698_10154784 3300026142 Bacteria 1995
1054 Ga0209589_1000018 3300027357 Bacteria 192614
1055 Ga0209489_100026 3300027361 Bacteria 192614
1056 Ga0209700_100035 3300027363 Bacteria 192614
1057 Ga0210002_1001863 3300027617 Bacteria 3013
1058 Ga0209588_1012847 3300027671 Bacteria 2548
1059 Ga0209966_1000761 3300027695 Bacteria 6647
1060 Ga0209998_10001920 3300027717 Bacteria 4889
1061 Ga0209998_10005097 3300027717 Bacteria 2759
1062 Ga0209813_10001858 3300027866 Bacteria 4763
1063 Ga0209974_10034036 3300027876 Bacteria 1692
1064 Ga0207428_10000124 3300027907 Bacteria 105795
1065 Ga0207428_10000420 3300027907 Bacteria 52679
1066 Ga0207428_10000703 3300027907 Bacteria 38851
1067 Ga0207428_10004141 3300027907 Bacteria 13907
1068 Ga0207428_10007925 3300027907 Bacteria 9652
1069 Ga0207428_10012221 3300027907 Bacteria 7552
1070 Ga0207428_10058246 3300027907 Bacteria 3066
1071 Ga0268266_10000550 3300028379 Bacteria 52292
1072 Ga0268266_10012891 3300028379 Bacteria 7216
1073 Ga0268266_10013888 3300028379 Bacteria 6935
1074 Ga0268266_10060106 3300028379 Bacteria 3275
1075 Ga0268266_10079273 3300028379 Bacteria 2859
1076 Ga0268266_10329741 3300028379 Bacteria 1430
1077 Ga0268265_10000749 3300028380 Bacteria 31597
1078 Ga0268265_10001170 3300028380 Bacteria 22993
1079 Ga0268265_10003744 3300028380 Bacteria 10813
1080 Ga0268265_10007616 3300028380 Bacteria 7304
1081 Ga0268265_10042501 3300028380 Bacteria 3373
1082 Ga0268265_10077901 3300028380 Bacteria 2605
1083 Ga0268264_10001878 3300028381 Bacteria 19073
1084 Ga0268264_10004697 3300028381 Bacteria 11610
1085 Ga0268264_10009146 3300028381 Bacteria 8212
1086 Ga0268264_10015913 3300028381 Bacteria 6161
1087 Ga0268264_10039189 3300028381 Bacteria 3915
1088 Ga0268264_10112638 3300028381 Bacteria 2386
1089 Ga0268264_10174224 3300028381 Bacteria 1948
1090 Ga0268264_10325472 3300028381 Bacteria 1455
1091 Ga0265318_10023738 3300028577 Bacteria 2440
1092 Ga0307515_10030159 3300028794 Bacteria 9125
1093 Ga0307515_10306008 3300028794 Bacteria 1269
1094 Ga0265338_10024767 3300028800 Bacteria 6118
1095 Ga0265338_10177672 3300028800 Bacteria 1626
1096 Ga0265332_10001311 3300031238 Bacteria 14161
1097 Ga0265332_10063720 3300031238 Bacteria 1575
1098 Ga0265320_10068295 3300031240 Bacteria 1680
1099 Ga0265325_10000105 3300031241 Bacteria 59642
1100 Ga0265325_10000522 3300031241 Bacteria 27711
1101 Ga0265325_10005654 3300031241 Bacteria 7690
1102 Ga0265325_10026904 3300031241 Bacteria 3112
1103 Ga0265325_10044264 3300031241 Bacteria 2319
1104 Ga0265325_10058174 3300031241 Bacteria 1970
1105 Ga0265329_10015969 3300031242 Bacteria 2613
1106 Ga0265340_10003441 3300031247 Bacteria 8935
1107 Ga0265340_10024453 3300031247 Bacteria 3068
1108 Ga0265339_10002938 3300031249 Bacteria 12049
1109 Ga0265339_10004703 3300031249 Bacteria 9264
1110 Ga0265331_10122127 3300031250 Bacteria 1191
1111 Ga0265316_10077815 3300031344 Bacteria 2547
1112 Ga0265316_10078231 3300031344 Bacteria 2539
1113 Ga0265316_10085797 3300031344 Bacteria 2408
1114 Ga0307513_10067426 3300031456 Bacteria 3754
1115 Ga0265313_10005622 3300031595 Bacteria 9166
1116 Ga0265313_10108941 3300031595 Bacteria 1220
1117 Ga0265314_10000279 3300031711 Bacteria 74300
1118 Ga0265314_10014192 3300031711 Bacteria 6390
1119 Ga0265314_10046476 3300031711 Bacteria 3062
1120 Ga0265314_10118072 3300031711 Bacteria 1675
1121 Ga0265342_10000287 3300031712 Bacteria 57222
1122 Ga0265342_10002165 3300031712 Bacteria 17313
1123 Ga0265342_10046924 3300031712 Bacteria 2595
1124 Ga0265342_10062934 3300031712 Bacteria 2182
1125 Ga0316576_10018285 3300031727 Bacteria 4781
1126 Ga0316578_10070343 3300031728 Bacteria 2071
1127 Ga0307516_10177300 3300031730 Bacteria 1867
1128 Ga0307405_10023129 3300031731 Bacteria 3527
1129 Ga0307410_10054673 3300031852 Bacteria 2707
1130 Ga0307412_10000002 3300031911 Bacteria 743446
1131 Ga0307412_10132078 3300031911 Bacteria 1815
1132 Ga0307411_10184887 3300032005 Bacteria 1585
1133 Ga0316583_10001319 3300032133 Bacteria 8195
1134 Ga0316583_10019034 3300032133 Bacteria 2466
1135 Ga0373930_0000557 3300034816 Bacteria 5130
1136 Ga0373930_0006765 3300034816 Bacteria 1952
1137 Ga0373948_0000160 3300034817 Bacteria 7409
1138 Ga0373948_0012264 3300034817 Bacteria 1527
1139 Ga0373950_0001396 3300034818 Bacteria 3141
1140 Ga0373950_0009406 3300034818 Bacteria 1560
1141 Ga0373958_0001091 3300034819 Bacteria 3577
1142 Ga0373958_0004385 3300034819 Bacteria 2088
1143 Ga0373959_0001344 3300034820 Bacteria 3926
1144 Ga0373938_0000092 3300034957 Bacteria 12211
1145 Ga0373938_0000725 3300034957 Bacteria 5331
1146 Ga0373928_0000404 3300035084 Bacteria 8588
1147 Ga0373928_0004133 3300035084 Bacteria 2767
1148 Ga0373928_0008191 3300035084 Bacteria 2026
1149 Ga0373929_0000856 3300035085 Bacteria 5927
1150 Ga0373934_0013054 3300035086 Bacteria 3138
1151 Ga0373934_0092341 3300035086 Bacteria 1221
1152 Ga0373940_0000069 3300035088 Bacteria 11756
1153 Ga0373944_0000522 3300035089 Bacteria 9004
1154 Ga0373944_0003976 3300035089 Bacteria 3827
1155 Ga0373949_0002201 3300035090 Bacteria 5100
1156 Ga0373949_0003185 3300035090 Bacteria 3988
1157 Ga0373951_0003116 3300035091 Bacteria 4090
1158 Ga0373951_0005474 3300035091 Bacteria 2950
1159 Ga0373951_0008001 3300035091 Bacteria 2396
1160 Ga0373952_0002122 3300035092 Bacteria 3563
1161 Ga0373952_0002777 3300035092 Bacteria 3161
1162 Ga0373923_0000908 3300035111 Bacteria 7900
1163 Ga0373923_0080762 3300035111 Bacteria 1410
1164 Ga0373932_0000510 3300035112 Bacteria 11939
1165 Ga0373932_0001365 3300035112 Bacteria 6841
1166 Ga0373932_0009934 3300035112 Bacteria 2295
1167 Ga0373932_0040184 3300035112 Bacteria 1345
1168 Ga0373936_0005389 3300035113 Bacteria 4820
1169 Ga0373936_0013341 3300035113 Bacteria 3136
1170 Ga0373936_0015050 3300035113 Bacteria 2962
1171 Ga0373936_0059670 3300035113 Bacteria 1555
1172 Ga0373939_0001165 3300035114 Bacteria 6436
1173 Ga0373939_0002803 3300035114 Bacteria 4090
1174 Ga0373941_0010323 3300035115 Bacteria 2383
1175 Ga0373945_0000687 3300035116 Bacteria 9768
1176 Ga0373945_0000695 3300035116 Bacteria 9737
1177 Ga0373945_0014690 3300035116 Bacteria 2627
1178 Ga0373953_0014939 3300035117 Bacteria 2802
1179 Ga0373953_0068520 3300035117 Bacteria 1460
1180 Ga0373954_0009734 3300035118 Bacteria 4233
1181 Ga0373954_0085357 3300035118 Bacteria 1511
1182 Ga0373954_0103123 3300035118 Bacteria 1377
1183 Ga0373954_0114970 3300035118 Bacteria 1303
1184 Ga0373956_0017796 3300035119 Bacteria 3002
1185 Ga0373956_0059014 3300035119 Bacteria 1735
1186 Ga0373957_0029482 3300035120 Bacteria 2005
1187 Ga0373957_0031346 3300035120 Bacteria 1953
1188 Ga0373957_0051938 3300035120 Bacteria 1569
1189 Ga0373960_0002095 3300035121 Bacteria 4490
1190 Ga0373960_0011297 3300035121 Bacteria 2197
1191 Ga0373960_0027371 3300035121 Bacteria 1565
1192 Ga0373943_0009246 3300035170 Bacteria 4416
1193 Ga0373943_0029437 3300035170 Bacteria 2594
1194 Ga0373946_0001403 3300035171 Bacteria 8345
1195 Ga0373946_0001976 3300035171 Bacteria 7170
1196 Ga0373946_0002566 3300035171 Bacteria 6422
1197 Ga0373946_0029392 3300035171 Bacteria 2187
1198 Ga0373955_0000419 3300035172 Bacteria 17956
1199 Ga0373955_0002082 3300035172 Bacteria 8628
1200 Ga0373955_0243423 3300035172 Bacteria 1077
1201 Ga0373942_0001103 3300035207 Bacteria 7179
1202 Ga0373942_0001725 3300035207 Bacteria 5558
1203 Ga0373942_0009085 3300035207 Bacteria 2322
1204 Ga0373942_0025850 3300035207 Bacteria 1516
1205 Ga0373961_0000636 3300035241 Bacteria 12674
1206 Ga0373961_0005322 3300035241 Bacteria 3094
1207 Ga0373961_0023826 3300035241 Bacteria 1650
1208 Ga0373962_0000974 3300035242 Bacteria 6617
1209 Ga0373962_0007950 3300035242 Bacteria 2603
1210 Ga0373962_0036726 3300035242 Bacteria 1365
1211 Ga0373962_0047522 3300035242 Bacteria 1228
1212 Ga0316574_0016743 3300035398 Bacteria 4276
1213 Ga0316574_0033236 3300035398 Bacteria 3139
1214 Ga0373924_0000402 3300035410 Bacteria 13279
1215 Ga0373924_0042186 3300035410 Bacteria 1871
1216 Ga0373931_0000186 3300035691 Bacteria 26950
1217 Ga0373931_0001154 3300035691 Bacteria 11223
1218 Ga0373931_0004674 3300035691 Bacteria 6267
1219 Ga0373931_0012507 3300035691 Bacteria 4112
1220 Ga0373931_0027768 3300035691 Bacteria 2891
1221 Ga0373931_0032737 3300035691 Bacteria 2691
1222 Ga0373931_0065645 3300035691 Bacteria 1967
1223 Ga0373931_0081569 3300035691 Bacteria 1786
1224 Ga0373935_0000012 3300035692 Bacteria 81961
1225 Ga0373935_0006436 3300035692 Bacteria 7012
1226 Ga0373935_0012773 3300035692 Bacteria 5056
1227 Ga0373935_0026018 3300035692 Bacteria 3608
1228 Ga0373935_0034435 3300035692 Bacteria 3156
1229 Ga0373935_0346345 3300035692 Bacteria 1059
1230 Ga0373927_0000690 3300035695 Bacteria 25756
1231 Ga0373927_0006963 3300035695 Bacteria 7676
1232 Ga0373927_0063141 3300035695 Bacteria 2395
1233 Ga0373927_0071664 3300035695 Bacteria 2242
1234 Ga0373927_0087588 3300035695 Bacteria 2021
1235 Ga0373927_0145711 3300035695 Bacteria 1550
1236 Ga0373927_0211942 3300035695 Bacteria 1272
1237 Ga0373933_0012736 3300035724 Bacteria 4650
1238 Ga0373933_0017609 3300035724 Bacteria 4008
1239 Ga0373933_0030144 3300035724 Bacteria 3140
1240 Ga0373933_0177674 3300035724 Bacteria 1357
1241 Ga0373947_0005091 3300035725 Bacteria 7701
1242 Ga0373947_0014053 3300035725 Bacteria 4589
1243 Ga0373947_0019098 3300035725 Bacteria 3951
1244 Ga0373947_0019486 3300035725 Bacteria 3912
1245 Ga0373947_0029213 3300035725 Bacteria 3234
1246 Ga0373947_0039335 3300035725 Bacteria 2813
1247 Ga0373937_0000054 3300036401 Bacteria 102542
1248 Ga0373937_0011291 3300036401 Bacteria 7833
1249 Ga0373937_0020009 3300036401 Bacteria 5995
1250 Ga0373937_0020661 3300036401 Bacteria 5904
1251 Ga0373937_0036701 3300036401 Bacteria 4467
1252 Ga0373937_0062979 3300036401 Bacteria 3410
1253 Ga0373937_0232530 3300036401 Bacteria 1736
1254 Ga0373937_0348384 3300036401 Bacteria 1403
1255 Ga0316582_0048052 3300036647 Bacteria 2696
1256 Ga0316584_0019941 3300036712 Bacteria 4853
1257 Ga0316584_0031916 3300036712 Bacteria 3895
1258 Ga0316584_0053077 3300036712 Bacteria 3033
1259 Ga0373925_0000018 3300037068 Bacteria 174213
1260 Ga0373925_0001295 3300037068 Bacteria 21971
1261 Ga0373925_0005692 3300037068 Bacteria 9263
1262 Ga0373925_0007297 3300037068 Bacteria 8077
1263 Ga0373925_0036300 3300037068 Bacteria 3638
1264 Ga0373925_0040062 3300037068 Bacteria 3467
1265 Ga0373925_0075207 3300037068 Bacteria 2559
1266 Ga0373925_0109642 3300037068 Bacteria 2131
1267 Ga0373925_0112537 3300037068 Bacteria 2104
1268 Ga0395899_0025638 3300037312 Bacteria 4450
1269 Ga0395899_0121147 3300037312 Bacteria 1874
1270 Ga0395900_0000389 3300037418 Bacteria 63583
1271 Ga0395900_0007211 3300037418 Bacteria 11520
1272 Ga0395900_0032651 3300037418 Bacteria 5354
1273 Ga0395900_0109689 3300037418 Bacteria 2835
1274 Ga0395900_0246956 3300037418 Bacteria 1788
1275 Ga0395898_0000866 3300037466 Bacteria 49465
1276 Ga0395898_0001457 3300037466 Bacteria 33463
1277 Ga0395898_0083798 3300037466 Bacteria 3073
1278 Ga0395898_0421298 3300037466 Bacteria 1272
1279 Ga0395898_0583043 3300037466 Bacteria 1061
1280 Ga0395905_0000247 3300037471 Bacteria 81281
1281 Ga0395905_0001000 3300037471 Bacteria 36208
1282 Ga0395905_0016737 3300037471 Bacteria 6967
1283 Ga0395905_0019296 3300037471 Bacteria 6464
1284 Ga0395905_0028187 3300037471 Bacteria 5293
1285 Ga0316581_0014058 3300037588 Bacteria 2275
1286 Ga0436364_0640796 3300037853 Bacteria 7924
1287 Ga0395901_0000164 3300038443 Bacteria 86884
1288 Ga0395901_0020788 3300038443 Bacteria 6719
1289 Ga0395901_0036486 3300038443 Bacteria 5082
1290 Ga0395901_0192631 3300038443 Bacteria 2138
1291 Ga0395901_0267977 3300038443 Bacteria 1777
1292 Ga0242420_015944 3300038996 Bacteria 1303
1293 Ga0436365_0151816 3300039437 Bacteria 2509
1294 Ga0436365_0176480 3300039437 Bacteria 1914
1295 Ga0436365_0399377 3300039437 Bacteria 16297
1296 Ga0436365_1111496 3300039437 Bacteria 2306
1297 Ga0436361_0314886 3300039447 Bacteria 11377
1298 Ga0436361_0858198 3300039447 Bacteria 8320
1299 Ga0436361_1122840 3300039447 Bacteria 3489
1300 Ga0436363_0214172 3300039450 Bacteria 2876
1301 Ga0436362_0442315 3300039453 Bacteria 3421
1302 Ga0439438_026698 3300041405 Bacteria 1564
1303 Ga0439453_0005714 3300041408 Bacteria 1905
1304 Ga0451841_1083948 3300041498 Bacteria 3735
1305 Ga0451849_0312684 3300041505 Bacteria 2578
1306 Ga0451853_0652838 3300041512 Bacteria 3634
1307 Ga0439441_013117 3300042001 Bacteria 1434
1308 Ga0439443_014105 3300042003 Bacteria 1200
1309 Ga0439435_0007908 3300042436 Bacteria 2454
1310 Ga0439464_0011331 3300042439 Bacteria 2362
1311 Ga0439460_0016420 3300042461 Bacteria 1971
1312 Ga0451577_0302490 3300042876 Bacteria 1449
1313 Ga0466972_0049686 3300044658 Bacteria 2026
1314 Ga0466966_0044437 3300044684 Bacteria 2844
1315 Ga0466966_0048070 3300044684 Bacteria 2718
1316 Ga0466963_0020354 3300044694 Bacteria 4172
1317 Ga0466963_0145732 3300044694 Bacteria 1643
1318 Ga0453684_0121340 3300044712 Bacteria 3155
1319 Ga0466959_0012108 3300045049 Bacteria 6224
1320 Ga0466959_0153074 3300045049 Bacteria 1624
1321 Ga0451576_0052484 3300045051 Bacteria 4272
1322 Ga0466967_0202584 3300045976 Bacteria 1880
1323 Ga0495617_017240 3300046452 Bacteria 2439
1324 Ga0495592_0000001 3300046454 Bacteria 305819
1325 Ga0495592_0001116 3300046454 Bacteria 18677
1326 Ga0495592_0008124 3300046454 Bacteria 7881
1327 Ga0495592_0028640 3300046454 Bacteria 4217
1328 Ga0495603_0006081 3300046455 Bacteria 7216
1329 Ga0495603_0008589 3300046455 Bacteria 6173
1330 Ga0495603_0076891 3300046455 Bacteria 1958
1331 Ga0495590_0001563 3300046457 Bacteria 9806
1332 Ga0495629_0000938 3300046459 Bacteria 23431
1333 Ga0495629_0002067 3300046459 Bacteria 15573
1334 Ga0495629_0006898 3300046459 Bacteria 8377
1335 Ga0495638_0000538 3300046460 Bacteria 43673
1336 Ga0495638_0038104 3300046460 Bacteria 3057
1337 Ga0495638_0041088 3300046460 Bacteria 2928
1338 Ga0495638_0041377 3300046460 Bacteria 2915
1339 Ga0495638_0045554 3300046460 Bacteria 2758
1340 Ga0495641_0008922 3300046461 Bacteria 6031
1341 Ga0495641_0021653 3300046461 Bacteria 3230
1342 Ga0495641_0097227 3300046461 Bacteria 1314
1343 Ga0495651_0003892 3300046462 Bacteria 11420
1344 Ga0495651_0006050 3300046462 Bacteria 9238
1345 Ga0495651_0035538 3300046462 Bacteria 3878
1346 Ga0495651_0055830 3300046462 Bacteria 3034
1347 Ga0495651_0112691 3300046462 Bacteria 2009
1348 Ga0495653_0000292 3300046463 Bacteria 40544
1349 Ga0495653_0010574 3300046463 Bacteria 7556
1350 Ga0495653_0016343 3300046463 Bacteria 6045
1351 Ga0495580_0005632 3300046472 Bacteria 10305
1352 Ga0495580_0021831 3300046472 Bacteria 4721
1353 Ga0495580_0030249 3300046472 Bacteria 3922
1354 Ga0495580_0078267 3300046472 Bacteria 2306
1355 Ga0495582_0001705 3300046473 Bacteria 12400
1356 Ga0495582_0004472 3300046473 Bacteria 7863
1357 Ga0495582_0012581 3300046473 Bacteria 4665
1358 Ga0495582_0075516 3300046473 Bacteria 1867
1359 Ga0495639_0041465 3300046475 Bacteria 2073
1360 Ga0495639_0041666 3300046475 Bacteria 2069
1361 Ga0495639_0123726 3300046475 Bacteria 1235
1362 Ga0495662_0002781 3300046476 Bacteria 8842
1363 Ga0495662_0009334 3300046476 Bacteria 4811
1364 Ga0495662_0166719 3300046476 Bacteria 1085
1365 Ga0495664_0000001 3300046477 Bacteria 757730
1366 Ga0495664_0001609 3300046477 Bacteria 12011
1367 Ga0495664_0011414 3300046477 Bacteria 5008
1368 Ga0495664_0032556 3300046477 Bacteria 3060
1369 Ga0495664_0079246 3300046477 Bacteria 1968
1370 Ga0495584_0020427 3300046491 Bacteria 3365
1371 Ga0495584_0032213 3300046491 Bacteria 2654
1372 Ga0495584_0088635 3300046491 Bacteria 1560
1373 Ga0495585_0003281 3300046492 Bacteria 11009
1374 Ga0495594_0014978 3300046499 Bacteria 4070
1375 Ga0495594_0017444 3300046499 Bacteria 3794
1376 Ga0495594_0022175 3300046499 Bacteria 3395
1377 Ga0495594_0061423 3300046499 Bacteria 2080
1378 Ga0495607_0014759 3300046501 Bacteria 5078
1379 Ga0495606_0064301 3300046507 Bacteria 2335
1380 Ga0495606_0069208 3300046507 Bacteria 2230
1381 Ga0495606_0071298 3300046507 Bacteria 2188
1382 Ga0495606_0105552 3300046507 Bacteria 1708
1383 Ga0495608_0000050 3300046511 Bacteria 96603
1384 Ga0495608_0022714 3300046511 Bacteria 4302
1385 Ga0495608_0071149 3300046511 Bacteria 2270
1386 Ga0495608_0071872 3300046511 Bacteria 2257
1387 Ga0495608_0083554 3300046511 Bacteria 2073
1388 Ga0495608_0103461 3300046511 Bacteria 1835
1389 Ga0495610_0002386 3300046512 Bacteria 15820
1390 Ga0495618_0000045 3300046514 Bacteria 94654
1391 Ga0495618_0021418 3300046514 Bacteria 3985
1392 Ga0495620_0065140 3300046515 Bacteria 1505
1393 Ga0495628_0000003 3300046516 Bacteria 470339
1394 Ga0495628_0002046 3300046516 Bacteria 18273
1395 Ga0495628_0014251 3300046516 Bacteria 6671
1396 Ga0495628_0087099 3300046516 Bacteria 2421
1397 Ga0495628_0122491 3300046516 Bacteria 1994
1398 Ga0495630_0002190 3300046517 Bacteria 13605
1399 Ga0495630_0061243 3300046517 Bacteria 2826
1400 Ga0495630_0144694 3300046517 Bacteria 1807
1401 Ga0495630_0358191 3300046517 Bacteria 1117
1402 Ga0495630_0427415 3300046517 Bacteria 1015
1403 Ga0495631_0006999 3300046518 Bacteria 5773
1404 Ga0495637_0044942 3300046520 Bacteria 1877
1405 Ga0495643_0157266 3300046522 Bacteria 1121
1406 Ga0495648_0000204 3300046524 Bacteria 68918
1407 Ga0495663_0038871 3300046525 Bacteria 1440
1408 Ga0495666_0018191 3300046526 Bacteria 3500
1409 Ga0495666_0044622 3300046526 Bacteria 2140
1410 Ga0495642_0065173 3300046528 Bacteria 1516
1411 Ga0495652_0000001 3300046529 Bacteria 1045081
1412 Ga0495652_0011016 3300046529 Bacteria 8193
1413 Ga0495652_0030624 3300046529 Bacteria 4717
1414 Ga0495652_0113148 3300046529 Bacteria 2179
1415 Ga0495652_0130273 3300046529 Bacteria 1992
1416 Ga0495652_0133415 3300046529 Bacteria 1962
1417 Ga0495654_0033178 3300046530 Bacteria 2614
1418 Ga0495665_0000583 3300046531 Bacteria 18617
1419 Ga0495665_0021898 3300046531 Bacteria 3437
1420 Ga0495665_0035715 3300046531 Bacteria 2654
1421 Ga0495665_0037429 3300046531 Bacteria 2590
1422 Ga0495640_0000006 3300046533 Bacteria 285419
1423 Ga0495640_0053962 3300046533 Bacteria 2755
1424 Ga0495640_0170654 3300046533 Bacteria 1390
1425 Ga0495640_0201372 3300046533 Bacteria 1261
1426 Ga0495586_0026239 3300046535 Bacteria 3117
1427 Ga0495587_0000028 3300046536 Bacteria 138663
1428 Ga0495587_0006079 3300046536 Bacteria 7876
1429 Ga0495587_0020228 3300046536 Bacteria 4111
1430 Ga0495587_0028702 3300046536 Bacteria 3381
1431 Ga0495598_0002157 3300046537 Bacteria 4023
1432 Ga0495609_0043864 3300046538 Bacteria 2007
1433 Ga0495621_0049713 3300046539 Bacteria 1497
1434 Ga0495645_0000004 3300046543 Bacteria 532661
1435 Ga0495645_0001781 3300046543 Bacteria 14625
1436 Ga0495645_0064319 3300046543 Bacteria 2655
1437 Ga0495622_0000115 3300046557 Bacteria 69111
1438 Ga0495622_0012353 3300046557 Bacteria 3952
1439 Ga0495622_0029965 3300046557 Bacteria 2542
1440 Ga0495633_0020888 3300046558 Bacteria 3284
1441 Ga0495667_0000001 3300046559 Bacteria 834831
1442 Ga0495667_0002342 3300046559 Bacteria 12672
1443 Ga0495667_0027911 3300046559 Bacteria 3800
1444 Ga0495656_0001283 3300046615 Bacteria 8165
1445 Ga0495656_0007105 3300046615 Bacteria 3949
1446 Ga0495656_0073267 3300046615 Bacteria 1527
1447 Ga0495668_0006076 3300046616 Bacteria 7996
1448 Ga0495668_0058775 3300046616 Bacteria 2122
1449 Ga0495668_0106814 3300046616 Bacteria 1531
1450 Ga0495634_0000531 3300046642 Bacteria 37387
1451 Ga0495634_0124886 3300046642 Bacteria 1645
1452 Ga0495611_0017651 3300046648 Bacteria 3055
1453 Ga0495625_0096862 3300046660 Bacteria 2031
1454 Ga0495635_0000007 3300046663 Bacteria 278786
1455 Ga0495635_0000736 3300046663 Bacteria 21173
1456 Ga0495635_0045100 3300046663 Bacteria 3041
1457 Ga0495635_0092251 3300046663 Bacteria 2071
1458 Ga0495635_0207896 3300046663 Bacteria 1326
1459 Ga0495635_0256111 3300046663 Bacteria 1179
1460 Ga0495659_0003459 3300046664 Bacteria 5039
1461 Ga0495659_0112603 3300046664 Bacteria 1064
1462 Ga0495588_0018157 3300046674 Bacteria 3425
1463 Ga0495588_0046290 3300046674 Bacteria 2231
1464 Ga0495657_0000136 3300046675 Bacteria 65707
1465 Ga0495657_0007642 3300046675 Bacteria 8326
1466 Ga0495657_0259047 3300046675 Bacteria 1045
1467 Ga0495599_0000002 3300046678 Bacteria 348168
1468 Ga0495599_0002064 3300046678 Bacteria 11642
1469 Ga0495599_0002943 3300046678 Bacteria 9902
1470 Ga0495599_0003364 3300046678 Bacteria 9345
1471 Ga0495599_0109613 3300046678 Bacteria 1720
1472 Ga0495623_0000052 3300046679 Bacteria 71268
1473 Ga0495623_0002286 3300046679 Bacteria 12776
1474 Ga0495623_0033924 3300046679 Bacteria 3274
1475 Ga0495646_0000036 3300046680 Bacteria 81182
1476 Ga0495646_0000229 3300046680 Bacteria 27971
1477 Ga0495646_0008853 3300046680 Bacteria 6392
1478 Ga0495646_0048957 3300046680 Bacteria 2566
1479 Ga0495647_0003818 3300046681 Bacteria 4849
1480 Ga0495647_0003893 3300046681 Bacteria 4815
1481 Ga0495647_0004269 3300046681 Bacteria 4629
1482 Ga0495647_0012633 3300046681 Bacteria 2912
1483 Ga0495658_0001370 3300046683 Bacteria 12779
1484 Ga0495658_0064581 3300046683 Bacteria 2109
1485 Ga0495669_0036431 3300046684 Bacteria 2175
1486 Ga0495613_0006674 3300046689 Bacteria 8621
1487 Ga0495613_0204140 3300046689 Bacteria 1392
1488 Ga0495624_0007027 3300046690 Bacteria 7937
1489 Ga0495624_0051697 3300046690 Bacteria 2598
1490 Ga0495624_0096582 3300046690 Bacteria 1820
1491 Ga0495670_0009490 3300046691 Bacteria 4782
1492 Ga0495670_0044346 3300046691 Bacteria 2220
1493 Ga0495649_0148075 3300046694 Bacteria 1234
1494 Ga0495589_0019321 3300046794 Bacteria 3496
1495 Ga0495589_0080033 3300046794 Bacteria 1590
1496 Ga0495589_0089633 3300046794 Bacteria 1494
1497 Ga0495600_0000037 3300046809 Bacteria 78434
1498 Ga0495600_0003589 3300046809 Bacteria 9137
1499 Ga0495600_0066578 3300046809 Bacteria 2355
1500 Ga0495600_0079822 3300046809 Bacteria 2136
1501 Ga0495600_0084137 3300046809 Bacteria 2076
1502 Ga0495581_0002869 3300047315 Bacteria 9849
1503 Ga0495581_0005348 3300047315 Bacteria 7424
1504 Ga0495581_0026915 3300047315 Bacteria 3335
1505 Ga0495581_0028543 3300047315 Bacteria 3234
1506 Ga0495581_0065762 3300047315 Bacteria 2096
1507 Ga0495604_0000594 3300047317 Bacteria 31291
1508 Ga0495604_0004128 3300047317 Bacteria 11531
1509 Ga0495604_0009381 3300047317 Bacteria 7740
1510 Ga0495604_0044756 3300047317 Bacteria 3456
1511 Ga0495604_0062749 3300047317 Bacteria 2837
1512 Ga0495604_0087410 3300047317 Bacteria 2322
1513 Ga0495674_0000001 3300047319 Bacteria 778665
1514 Ga0495674_0016647 3300047319 Bacteria 6860
1515 Ga0495674_0030389 3300047319 Bacteria 4912
1516 Ga0495674_0154887 3300047319 Bacteria 1920
1517 Ga0495674_0250035 3300047319 Bacteria 1459
1518 Ga0495674_0461575 3300047319 Bacteria 1019
1519 Ga0495672_0084107 3300047320 Bacteria 1765
1520 Ga0495672_0196517 3300047320 Bacteria 1011
1521 Ga0495676_0029215 3300047321 Bacteria 4696
1522 Ga0495676_0041609 3300047321 Bacteria 3779
1523 Ga0495676_0133369 3300047321 Bacteria 1789
1524 Ga0495676_0137445 3300047321 Bacteria 1755
1525 Ga0495676_0142937 3300047321 Bacteria 1713
1526 Ga0495680_0000705 3300047322 Bacteria 37488
1527 Ga0495680_0005567 3300047322 Bacteria 11823
1528 Ga0495680_0029672 3300047322 Bacteria 4476
1529 Ga0495680_0032425 3300047322 Bacteria 4241
1530 Ga0495680_0047393 3300047322 Bacteria 3381
1531 Ga0495680_0187623 3300047322 Bacteria 1489
1532 Ga0495683_0062382 3300047323 Bacteria 1844
1533 Ga0495675_0000049 3300047444 Bacteria 80913
1534 Ga0495675_0013037 3300047444 Bacteria 5241
1535 Ga0495675_0096788 3300047444 Bacteria 1850
1536 Ga0495673_0000549 3300047469 Bacteria 38306
1537 Ga0495684_0000046 3300047471 Bacteria 92658
1538 Ga0495684_0009067 3300047471 Bacteria 7683
1539 Ga0495686_0001010 3300047472 Bacteria 34135
1540 Ga0495593_0019494 3300047673 Bacteria 3802
1541 Ga0495593_0024062 3300047673 Bacteria 3378
1542 Ga0495593_0046470 3300047673 Bacteria 2313
1543 Ga0495593_0055527 3300047673 Bacteria 2084
1544 Ga0495593_0068993 3300047673 Bacteria 1839
1545 Ga0495593_0104015 3300047673 Bacteria 1454
1546 Ga0495602_0000102 3300048088 Bacteria 81094
1547 Ga0495602_0006950 3300048088 Bacteria 11884
1548 Ga0495602_0010823 3300048088 Bacteria 9452
1549 Ga0495602_0064697 3300048088 Bacteria 3160
1550 Ga0495602_0117409 3300048088 Bacteria 2148
1551 Ga0495602_0269817 3300048088 Bacteria 1258
1552 Ga0495614_0049574 3300048089 Bacteria 1800
1553 Ga0495615_0010946 3300048090 Bacteria 1830
1554 Ga0495626_0016841 3300048091 Bacteria 3704
1555 Ga0496100_0000057 3300048903 Bacteria 67216
1556 Ga0496100_0020943 3300048903 Bacteria 3929
1557 Ga0496100_0053690 3300048903 Bacteria 2625
1558 Ga0496101_0001297 3300048904 Bacteria 14944
1559 Ga0496101_0062186 3300048904 Bacteria 2714
1560 Ga0496101_0088770 3300048904 Bacteria 2296
1561 Ga0496101_0100620 3300048904 Bacteria 2163
1562 Ga0496101_0103103 3300048904 Bacteria 2138
1563 Ga0496102_0001628 3300048905 Bacteria 19791
1564 Ga0496102_0014038 3300048905 Bacteria 6956
1565 Ga0496102_0018224 3300048905 Bacteria 6164
1566 Ga0496102_0037445 3300048905 Bacteria 4376
1567 Ga0496102_0039412 3300048905 Bacteria 4269
1568 Ga0496102_0055267 3300048905 Bacteria 3620
1569 Ga0496102_0086231 3300048905 Bacteria 2899
1570 Ga0496102_0201507 3300048905 Bacteria 1876
1571 Ga0496102_0221596 3300048905 Bacteria 1783
1572 Ga0496102_0419324 3300048905 Bacteria 1257
1573 Ga0496102_0531635 3300048905 Bacteria 1098
1574 Ga0496103_0003173 3300048906 Bacteria 10102
1575 Ga0496103_0011059 3300048906 Bacteria 5344
1576 Ga0496103_0021222 3300048906 Bacteria 3907
1577 Ga0496103_0035118 3300048906 Bacteria 3069
1578 Ga0496103_0049258 3300048906 Bacteria 2605
1579 Ga0496103_0063892 3300048906 Bacteria 2293
1580 Ga0496103_0077381 3300048906 Bacteria 2088
1581 Ga0496103_0095398 3300048906 Bacteria 1879
1582 Ga0496104_0000473 3300048907 Bacteria 34581
1583 Ga0496104_0000658 3300048907 Bacteria 29624
1584 Ga0496104_0015806 3300048907 Bacteria 6846
1585 Ga0496104_0018542 3300048907 Bacteria 6351
1586 Ga0496104_0041108 3300048907 Bacteria 4334
1587 Ga0496104_0047741 3300048907 Bacteria 4036
1588 Ga0496104_0082990 3300048907 Bacteria 3056
1589 Ga0496104_0210552 3300048907 Bacteria 1855
1590 Ga0496104_0304674 3300048907 Bacteria 1505
1591 Ga0496105_0003726 3300048908 Bacteria 11349
1592 Ga0496105_0021279 3300048908 Bacteria 5248
1593 Ga0496105_0036173 3300048908 Bacteria 4066
1594 Ga0496105_0080610 3300048908 Bacteria 2688
1595 Ga0496105_0092155 3300048908 Bacteria 2502
1596 Ga0496105_0124592 3300048908 Bacteria 2124
1597 Ga0496105_0235320 3300048908 Bacteria 1487
1598 Ga0496105_0257971 3300048908 Bacteria 1410
1599 Ga0496106_0000518 3300048909 Bacteria 27401
1600 Ga0496106_0007682 3300048909 Bacteria 7975
1601 Ga0496106_0030675 3300048909 Bacteria 4007
1602 Ga0496106_0044188 3300048909 Bacteria 3343
1603 Ga0496106_0050012 3300048909 Bacteria 3149
1604 Ga0496106_0126633 3300048909 Bacteria 2000
1605 Ga0496106_0150080 3300048909 Bacteria 1838
1606 Ga0496106_0158851 3300048909 Bacteria 1787
1607 Ga0496106_0195262 3300048909 Bacteria 1610
1608 Ga0496106_0233352 3300048909 Bacteria 1469
1609 Ga0496106_0242130 3300048909 Bacteria 1441
1610 Ga0496107_0001129 3300048910 Bacteria 16115
1611 Ga0496107_0005941 3300048910 Bacteria 8366
1612 Ga0496107_0013210 3300048910 Bacteria 5770
1613 Ga0496107_0032488 3300048910 Bacteria 3731
1614 Ga0496107_0043356 3300048910 Bacteria 3232
1615 Ga0496107_0110025 3300048910 Bacteria 2024
1616 Ga0496107_0259055 3300048910 Bacteria 1294
1617 Ga0496108_0003535 3300048911 Bacteria 12534
1618 Ga0496108_0004254 3300048911 Bacteria 11528
1619 Ga0496108_0012179 3300048911 Bacteria 6993
1620 Ga0496108_0020612 3300048911 Bacteria 5417
1621 Ga0496108_0024111 3300048911 Bacteria 5009
1622 Ga0496108_0029895 3300048911 Bacteria 4515
1623 Ga0496108_0037213 3300048911 Bacteria 4052
1624 Ga0496108_0039692 3300048911 Bacteria 3923
1625 Ga0496108_0042331 3300048911 Bacteria 3802
1626 Ga0496108_0052486 3300048911 Bacteria 3417
1627 Ga0496108_0076816 3300048911 Bacteria 2823
1628 Ga0496108_0268325 3300048911 Bacteria 1485
1629 Ga0496109_0000390 3300048912 Bacteria 39843
1630 Ga0496109_0002432 3300048912 Bacteria 15587
1631 Ga0496109_0003961 3300048912 Bacteria 12362
1632 Ga0496109_0030741 3300048912 Bacteria 4813
1633 Ga0496109_0058639 3300048912 Bacteria 3517
1634 Ga0496109_0061649 3300048912 Bacteria 3429
1635 Ga0496109_0064585 3300048912 Bacteria 3350
1636 Ga0496109_0072844 3300048912 Bacteria 3156
1637 Ga0496109_0081537 3300048912 Bacteria 2981
1638 Ga0496109_0297222 3300048912 Bacteria 1522
1639 Ga0496109_0435476 3300048912 Bacteria 1238
1640 Ga0496110_0001450 3300048913 Bacteria 17181
1641 Ga0496110_0004413 3300048913 Bacteria 10894
1642 Ga0496110_0006332 3300048913 Bacteria 9352
1643 Ga0496110_0015032 3300048913 Bacteria 6437
1644 Ga0496110_0020927 3300048913 Bacteria 5527
1645 Ga0496110_0022934 3300048913 Bacteria 5305
1646 Ga0496110_0023924 3300048913 Bacteria 5201
1647 Ga0496110_0129990 3300048913 Bacteria 2273
1648 Ga0496110_0152934 3300048913 Bacteria 2089
1649 Ga0496110_0594489 3300048913 Bacteria 1004
1650 Ga0496111_0014553 3300048914 Bacteria 5378
1651 Ga0496111_0018730 3300048914 Bacteria 4798
1652 Ga0496111_0035239 3300048914 Bacteria 3575
1653 Ga0496111_0052514 3300048914 Bacteria 2943
1654 Ga0496111_0056716 3300048914 Bacteria 2835
1655 Ga0496111_0156701 3300048914 Bacteria 1690
1656 Ga0496111_0203775 3300048914 Bacteria 1470
1657 Ga0496112_0031693 3300048915 Bacteria 5128
1658 Ga0496112_0034957 3300048915 Bacteria 4890
1659 Ga0496112_0040952 3300048915 Bacteria 4531
1660 Ga0496112_0062844 3300048915 Bacteria 3663
1661 Ga0496112_0110623 3300048915 Bacteria 2717
1662 Ga0496112_0153816 3300048915 Bacteria 2267
1663 Ga0496112_0243757 3300048915 Bacteria 1749
1664 Ga0496112_0247172 3300048915 Bacteria 1735
1665 Ga0496112_0266396 3300048915 Bacteria 1662
1666 Ga0496112_0420521 3300048915 Bacteria 1275
1667 Ga0496113_0016626 3300048916 Bacteria 5086
1668 Ga0496113_0016768 3300048916 Bacteria 5067
1669 Ga0496113_0030441 3300048916 Bacteria 3907
1670 Ga0496113_0041021 3300048916 Bacteria 3413
1671 Ga0496113_0088028 3300048916 Bacteria 2389
1672 Ga0496114_0002944 3300048917 Bacteria 13059
1673 Ga0496114_0005270 3300048917 Bacteria 10103
1674 Ga0496114_0010304 3300048917 Bacteria 7438
1675 Ga0496114_0033841 3300048917 Bacteria 4213
1676 Ga0496114_0054788 3300048917 Bacteria 3325
1677 Ga0496114_0257801 3300048917 Bacteria 1535
1678 Ga0496115_0002786 3300048918 Bacteria 12565
1679 Ga0496115_0032489 3300048918 Bacteria 4116
1680 Ga0496115_0232048 3300048918 Bacteria 1521
1681 Ga0496116_0000887 3300048919 Bacteria 37313
1682 Ga0496117_0000222 3300048920 Bacteria 107624
1683 Ga0496117_0000253 3300048920 Bacteria 101211
1684 Ga0496117_0002759 3300048920 Bacteria 21513
1685 Ga0496117_0003345 3300048920 Bacteria 18726
1686 Ga0496117_0017537 3300048920 Bacteria 5975
1687 Ga0496117_0056336 3300048920 Bacteria 2739
1688 Ga0496118_0000167 3300048921 Bacteria 119146
1689 Ga0496118_0006187 3300048921 Bacteria 13263
1690 Ga0496118_0026254 3300048921 Bacteria 4969
1691 Ga0496119_0013662 3300048922 Bacteria 6443
1692 Ga0496120_0000466 3300048923 Bacteria 63527
1693 Ga0496122_0068956 3300048925 Bacteria 2535
1694 Ga0496122_0182002 3300048925 Bacteria 1252
1695 Ga0496123_0093279 3300048926 Bacteria 1778
1696 Ga0496125_0004409 3300048928 Bacteria 16267
1697 Ga0496125_0029890 3300048928 Bacteria 4885
1698 Ga0496125_0051251 3300048928 Bacteria 3406
1699 Ga0496126_0022827 3300048929 Bacteria 6075
1700 Ga0496126_0060274 3300048929 Bacteria 3414
1701 Ga0496126_0107255 3300048929 Bacteria 2436
1702 Ga0496126_0136521 3300048929 Bacteria 2115
1703 Ga0495678_000680 3300049459 Bacteria 31270
1704 Ga0501031_0026704 3300049568 Bacteria 3763
1705 Ga0501031_0034444 3300049568 Bacteria 3305
1706 Ga0501031_0038563 3300049568 Bacteria 3118
1707 Ga0501031_0100498 3300049568 Bacteria 1887
1708 Ga0501032_0023752 3300049569 Bacteria 4232
1709 Ga0501032_0025720 3300049569 Bacteria 4056
1710 Ga0501032_0042861 3300049569 Bacteria 3068
1711 Ga0501032_0048692 3300049569 Bacteria 2861
1712 Ga0501032_0077655 3300049569 Bacteria 2210
1713 Ga0501033_0000304 3300049570 Bacteria 46485
1714 Ga0501033_0004330 3300049570 Bacteria 11389
1715 Ga0501033_0013461 3300049570 Bacteria 6227
1716 Ga0501033_0049360 3300049570 Bacteria 3123
1717 Ga0501033_0053089 3300049570 Bacteria 3002
1718 Ga0501033_0059675 3300049570 Bacteria 2817
1719 Ga0501033_0089252 3300049570 Bacteria 2255
1720 Ga0501033_0099591 3300049570 Bacteria 2122
1721 Ga0501033_0140685 3300049570 Bacteria 1744
1722 Ga0501033_0172016 3300049570 Bacteria 1555
1723 Ga0501033_0189613 3300049570 Bacteria 1471
1724 Ga0501034_0000032 3300049571 Bacteria 243763
1725 Ga0501034_0002292 3300049571 Bacteria 23472
1726 Ga0501034_0004395 3300049571 Bacteria 15700
1727 Ga0501034_0010486 3300049571 Bacteria 9648
1728 Ga0501034_0022272 3300049571 Bacteria 6458
1729 Ga0501034_0024348 3300049571 Bacteria 6157
1730 Ga0501034_0053749 3300049571 Bacteria 4055
1731 Ga0501034_0160351 3300049571 Bacteria 2220
1732 Ga0501034_0190130 3300049571 Bacteria 2015
1733 Ga0501034_0199173 3300049571 Bacteria 1961
1734 Ga0501034_0203301 3300049571 Bacteria 1938
1735 Ga0501034_0214666 3300049571 Bacteria 1878
1736 Ga0501034_0219246 3300049571 Bacteria 1855
1737 Ga0501034_0298743 3300049571 Bacteria 1547
1738 Ga0501034_0310541 3300049571 Bacteria 1511
1739 Ga0501034_0312038 3300049571 Bacteria 1507
1740 Ga0501034_0482900 3300049571 Bacteria 1154
1741 Ga0501034_0523169 3300049571 Bacteria 1098
1742 Ga0501036_0000609 3300049572 Bacteria 25966
1743 Ga0501036_0011664 3300049572 Bacteria 7282
1744 Ga0501036_0018617 3300049572 Bacteria 5822
1745 Ga0501036_0049811 3300049572 Bacteria 3548
1746 Ga0501036_0082138 3300049572 Bacteria 2723
1747 Ga0501036_0236687 3300049572 Bacteria 1531
1748 Ga0501037_0000154 3300049573 Bacteria 64077
1749 Ga0501037_0000457 3300049573 Bacteria 33231
1750 Ga0501037_0005109 3300049573 Bacteria 9545
1751 Ga0501037_0007475 3300049573 Bacteria 7994
1752 Ga0501037_0007550 3300049573 Bacteria 7963
1753 Ga0501037_0021125 3300049573 Bacteria 4809
1754 Ga0501037_0044551 3300049573 Bacteria 3258
1755 Ga0501037_0045634 3300049573 Bacteria 3216
1756 Ga0501037_0140685 3300049573 Bacteria 1727
1757 Ga0501038_0000129 3300049574 Bacteria 64365
1758 Ga0501038_0004895 3300049574 Bacteria 12439
1759 Ga0501038_0021125 3300049574 Bacteria 5848
1760 Ga0501038_0034365 3300049574 Bacteria 4458
1761 Ga0501038_0037679 3300049574 Bacteria 4238
1762 Ga0501038_0040225 3300049574 Bacteria 4086
1763 Ga0501038_0065969 3300049574 Bacteria 3084
1764 Ga0501038_0072882 3300049574 Bacteria 2909
1765 Ga0501038_0095153 3300049574 Bacteria 2488
1766 Ga0501038_0097220 3300049574 Bacteria 2456
1767 Ga0501038_0124946 3300049574 Bacteria 2118
1768 Ga0501038_0166436 3300049574 Bacteria 1788
1769 Ga0501038_0182600 3300049574 Bacteria 1692
1770 Ga0501038_0247237 3300049574 Bacteria 1414
1771 Ga0501038_0276942 3300049574 Bacteria 1321
1772 Ga0501038_0348513 3300049574 Bacteria 1154
1773 Ga0501039_0012235 3300049575 Bacteria 6541
1774 Ga0501039_0012490 3300049575 Bacteria 6485
1775 Ga0501039_0014998 3300049575 Bacteria 5928
1776 Ga0501039_0031133 3300049575 Bacteria 4113
1777 Ga0501039_0036821 3300049575 Bacteria 3775
1778 Ga0501039_0043689 3300049575 Bacteria 3461
1779 Ga0501039_0053438 3300049575 Bacteria 3126
1780 Ga0501039_0069713 3300049575 Bacteria 2731
1781 Ga0501039_0279886 3300049575 Bacteria 1311
1782 Ga0501039_0340485 3300049575 Bacteria 1179
1783 Ga0501039_0376114 3300049575 Bacteria 1116
1784 Ga0501040_0054184 3300049576 Bacteria 2749
1785 Ga0501040_0057783 3300049576 Bacteria 2664
1786 Ga0501040_0058568 3300049576 Bacteria 2645
1787 Ga0501040_0149428 3300049576 Bacteria 1648
1788 Ga0501041_0030312 3300049577 Bacteria 3265
1789 Ga0501041_0036124 3300049577 Bacteria 2994
1790 Ga0501041_0037357 3300049577 Bacteria 2943
1791 Ga0501041_0055423 3300049577 Bacteria 2420
1792 Ga0501042_0029591 3300049578 Bacteria 3863
1793 Ga0501042_0043117 3300049578 Bacteria 3212
1794 Ga0501042_0073812 3300049578 Bacteria 2440
1795 Ga0501042_0086320 3300049578 Bacteria 2250
1796 Ga0501042_0128216 3300049578 Bacteria 1827
1797 Ga0501042_0219673 3300049578 Bacteria 1371
1798 Ga0501042_0268637 3300049578 Bacteria 1231
1799 Ga0501043_0000007 3300049579 Bacteria 224595
1800 Ga0501043_0002387 3300049579 Bacteria 15915
1801 Ga0501043_0008265 3300049579 Bacteria 8200
1802 Ga0501043_0013674 3300049579 Bacteria 6353
1803 Ga0501043_0023144 3300049579 Bacteria 4873
1804 Ga0501043_0026751 3300049579 Bacteria 4526
1805 Ga0501043_0039248 3300049579 Bacteria 3721
1806 Ga0501043_0290922 3300049579 Bacteria 1250
1807 Ga0501046_0022708 3300049580 Bacteria 5167
1808 Ga0501046_0023608 3300049580 Bacteria 5055
1809 Ga0501046_0029874 3300049580 Bacteria 4428
1810 Ga0501046_0039003 3300049580 Bacteria 3807
1811 Ga0501046_0074250 3300049580 Bacteria 2638
1812 Ga0501046_0113522 3300049580 Bacteria 2068
1813 Ga0501047_0000228 3300049581 Bacteria 66588
1814 Ga0501047_0018542 3300049581 Bacteria 6674
1815 Ga0501047_0022017 3300049581 Bacteria 6122
1816 Ga0501047_0023967 3300049581 Bacteria 5861
1817 Ga0501047_0047526 3300049581 Bacteria 4145
1818 Ga0501047_0070860 3300049581 Bacteria 3355
1819 Ga0501047_0078034 3300049581 Bacteria 3185
1820 Ga0501047_0186846 3300049581 Bacteria 1937
1821 Ga0501047_0274392 3300049581 Bacteria 1532
1822 Ga0501048_0000467 3300049582 Bacteria 28373
1823 Ga0501048_0036812 3300049582 Bacteria 3516
1824 Ga0501048_0036986 3300049582 Bacteria 3507
1825 Ga0501048_0042613 3300049582 Bacteria 3249
1826 Ga0501048_0046503 3300049582 Bacteria 3098
1827 Ga0501048_0074175 3300049582 Bacteria 2401
1828 Ga0501048_0081862 3300049582 Bacteria 2277
1829 Ga0501048_0116623 3300049582 Bacteria 1886
1830 Ga0501048_0195092 3300049582 Bacteria 1435
1831 Ga0501067_0001440 3300049583 Bacteria 12925
1832 Ga0501067_0032258 3300049583 Bacteria 2907
1833 Ga0501067_0156874 3300049583 Bacteria 1268
1834 Ga0501068_0005463 3300049584 Bacteria 6959
1835 Ga0501068_0006700 3300049584 Bacteria 6363
1836 Ga0501068_0026123 3300049584 Bacteria 3438
1837 Ga0501068_0050955 3300049584 Bacteria 2503
1838 Ga0501068_0059908 3300049584 Bacteria 2311
1839 Ga0501068_0112359 3300049584 Bacteria 1695
1840 Ga0501068_0186186 3300049584 Bacteria 1314
1841 Ga0501069_0000027 3300049585 Bacteria 106217
1842 Ga0501069_0022000 3300049585 Bacteria 3464
1843 Ga0501069_0153176 3300049585 Bacteria 1325
1844 Ga0501070_0000650 3300049586 Bacteria 31944
1845 Ga0501070_0003235 3300049586 Bacteria 14160
1846 Ga0501070_0012221 3300049586 Bacteria 7244
1847 Ga0501070_0023230 3300049586 Bacteria 5194
1848 Ga0501070_0025188 3300049586 Bacteria 4989
1849 Ga0501070_0028311 3300049586 Bacteria 4699
1850 Ga0501070_0031603 3300049586 Bacteria 4435
1851 Ga0501070_0046778 3300049586 Bacteria 3598
1852 Ga0501070_0048508 3300049586 Bacteria 3527
1853 Ga0501070_0062631 3300049586 Bacteria 3081
1854 Ga0501070_0072607 3300049586 Bacteria 2848
1855 Ga0501070_0078473 3300049586 Bacteria 2732
1856 Ga0501070_0129484 3300049586 Bacteria 2085
1857 Ga0501070_0194428 3300049586 Bacteria 1666
1858 Ga0501071_0023874 3300049587 Bacteria 4273
1859 Ga0501071_0037993 3300049587 Bacteria 3439
1860 Ga0501071_0039825 3300049587 Bacteria 3362
1861 Ga0501071_0047759 3300049587 Bacteria 3076
1862 Ga0501071_0059676 3300049587 Bacteria 2760
1863 Ga0501071_0069454 3300049587 Bacteria 2565
1864 Ga0501071_0071194 3300049587 Bacteria 2534
1865 Ga0501071_0145683 3300049587 Bacteria 1765
1866 Ga0501072_0002741 3300049588 Bacteria 13226
1867 Ga0501072_0032608 3300049588 Bacteria 4080
1868 Ga0501072_0042559 3300049588 Bacteria 3567
1869 Ga0501072_0044133 3300049588 Bacteria 3506
1870 Ga0501072_0073674 3300049588 Bacteria 2699
1871 Ga0501072_0114778 3300049588 Bacteria 2144
1872 Ga0501072_0133126 3300049588 Bacteria 1982
1873 Ga0501072_0157212 3300049588 Bacteria 1813
1874 Ga0501072_0231670 3300049588 Bacteria 1471
1875 Ga0501073_0002531 3300049589 Bacteria 13656
1876 Ga0501073_0005847 3300049589 Bacteria 9179
1877 Ga0501073_0008662 3300049589 Bacteria 7537
1878 Ga0501073_0010128 3300049589 Bacteria 6928
1879 Ga0501073_0040645 3300049589 Bacteria 3289
1880 Ga0501073_0053525 3300049589 Bacteria 2825
1881 Ga0501073_0062948 3300049589 Bacteria 2587
1882 Ga0501073_0068394 3300049589 Bacteria 2475
1883 Ga0501073_0144041 3300049589 Bacteria 1651
1884 Ga0501073_0242929 3300049589 Bacteria 1243
1885 Ga0501074_0000066 3300049590 Bacteria 50258
1886 Ga0501074_0005965 3300049590 Bacteria 8789
1887 Ga0501074_0011852 3300049590 Bacteria 6338
1888 Ga0501074_0019332 3300049590 Bacteria 4948
1889 Ga0501074_0038162 3300049590 Bacteria 3481
1890 Ga0501074_0054993 3300049590 Bacteria 2870
1891 Ga0501074_0058479 3300049590 Bacteria 2778
1892 Ga0501074_0068958 3300049590 Bacteria 2542
1893 Ga0501074_0072586 3300049590 Bacteria 2472
1894 Ga0501075_0023384 3300049591 Bacteria 4525
1895 Ga0501075_0030682 3300049591 Bacteria 3983
1896 Ga0501075_0067649 3300049591 Bacteria 2697
1897 Ga0501075_0088384 3300049591 Bacteria 2349
1898 Ga0501075_0089253 3300049591 Bacteria 2337
1899 Ga0501075_0133836 3300049591 Bacteria 1888
1900 Ga0501075_0184450 3300049591 Bacteria 1592
1901 Ga0501076_0008667 3300049592 Bacteria 7466
1902 Ga0501076_0016336 3300049592 Bacteria 5628
1903 Ga0501076_0024692 3300049592 Bacteria 4648
1904 Ga0501076_0027629 3300049592 Bacteria 4400
1905 Ga0501076_0033886 3300049592 Bacteria 3988
1906 Ga0501076_0034132 3300049592 Bacteria 3975
1907 Ga0501076_0106976 3300049592 Bacteria 2258
1908 Ga0501076_0136652 3300049592 Bacteria 1990
1909 Ga0501077_0000799 3300049593 Bacteria 19041
1910 Ga0501077_0003835 3300049593 Bacteria 9057
1911 Ga0501077_0008515 3300049593 Bacteria 6357
1912 Ga0501077_0020448 3300049593 Bacteria 4191
1913 Ga0501077_0028103 3300049593 Bacteria 3574
1914 Ga0501077_0135284 3300049593 Bacteria 1563
1915 Ga0501077_0260391 3300049593 Bacteria 1103
1916 Ga0501257_016727 3300049686 Bacteria 1703
1917 Ga0501079_0003834 3300049741 Bacteria 11103
1918 Ga0501079_0018682 3300049741 Bacteria 5296
1919 Ga0501079_0023616 3300049741 Bacteria 4718
1920 Ga0501079_0037517 3300049741 Bacteria 3735
1921 Ga0501079_0056423 3300049741 Bacteria 3031
1922 Ga0501079_0065427 3300049741 Bacteria 2805
1923 Ga0501079_0099832 3300049741 Bacteria 2250
1924 Ga0501079_0117586 3300049741 Bacteria 2067
1925 Ga0501079_0136756 3300049741 Bacteria 1908
1926 Ga0501080_0000112 3300049742 Bacteria 56408
1927 Ga0501080_0000667 3300049742 Bacteria 27300
1928 Ga0501080_0002747 3300049742 Bacteria 15450
1929 Ga0501080_0003520 3300049742 Bacteria 13788
1930 Ga0501080_0010850 3300049742 Bacteria 8338
1931 Ga0501080_0011076 3300049742 Bacteria 8251
1932 Ga0501080_0021270 3300049742 Bacteria 6005
1933 Ga0501080_0078784 3300049742 Bacteria 3064
1934 Ga0501080_0112526 3300049742 Bacteria 2523
1935 Ga0501080_0113723 3300049742 Bacteria 2509
1936 Ga0501080_0151340 3300049742 Bacteria 2144
1937 Ga0501080_0191651 3300049742 Bacteria 1878
1938 Ga0501080_0217169 3300049742 Bacteria 1751
1939 Ga0501080_0260754 3300049742 Bacteria 1579
1940 Ga0501080_0282616 3300049742 Bacteria 1508
1941 Ga0501080_0334192 3300049742 Bacteria 1370
1942 Ga0501081_0006981 3300049743 Bacteria 7343
1943 Ga0501081_0007100 3300049743 Bacteria 7279
1944 Ga0501081_0009580 3300049743 Bacteria 6316
1945 Ga0501081_0099671 3300049743 Bacteria 2052
1946 Ga0501081_0205423 3300049743 Bacteria 1429
1947 Ga0501081_0327699 3300049743 Bacteria 1126
1948 Ga0501083_0000012 3300049744 Bacteria 178668
1949 Ga0501083_0008454 3300049744 Bacteria 7274
1950 Ga0501083_0026421 3300049744 Bacteria 4012
1951 Ga0501083_0042101 3300049744 Bacteria 3097
1952 Ga0501083_0046988 3300049744 Bacteria 2918
1953 Ga0501083_0058070 3300049744 Bacteria 2589
1954 Ga0501083_0064068 3300049744 Bacteria 2450
1955 Ga0501083_0108473 3300049744 Bacteria 1826
1956 Ga0501083_0112825 3300049744 Bacteria 1786
1957 Ga0501083_0209695 3300049744 Bacteria 1270
1958 Ga0501035_0000073 3300049822 Bacteria 122603
1959 Ga0501035_0000806 3300049822 Bacteria 33416
1960 Ga0501035_0004944 3300049822 Bacteria 12646
1961 Ga0501035_0014779 3300049822 Bacteria 7209
1962 Ga0501035_0049479 3300049822 Bacteria 3766
1963 Ga0501035_0050558 3300049822 Bacteria 3724
1964 Ga0501035_0067200 3300049822 Bacteria 3181
1965 Ga0501035_0079606 3300049822 Bacteria 2894
1966 Ga0501035_0252748 3300049822 Bacteria 1496
1967 Ga0501035_0318459 3300049822 Bacteria 1307
1968 Ga0501044_0000118 3300049823 Bacteria 95218
1969 Ga0501044_0000782 3300049823 Bacteria 38567
1970 Ga0501044_0006265 3300049823 Bacteria 13150
1971 Ga0501044_0011013 3300049823 Bacteria 9815
1972 Ga0501044_0015666 3300049823 Bacteria 8165
1973 Ga0501044_0018005 3300049823 Bacteria 7574
1974 Ga0501044_0018710 3300049823 Bacteria 7418
1975 Ga0501044_0025239 3300049823 Bacteria 6301
1976 Ga0501044_0074055 3300049823 Bacteria 3460
1977 Ga0501044_0083860 3300049823 Bacteria 3221
1978 Ga0501044_0107349 3300049823 Bacteria 2803
1979 Ga0501044_0211047 3300049823 Bacteria 1896
1980 Ga0501044_0229971 3300049823 Bacteria 1802
1981 Ga0501044_0278337 3300049823 Bacteria 1607
1982 Ga0501045_0009307 3300049824 Bacteria 6872
1983 Ga0501045_0037862 3300049824 Bacteria 3507
1984 Ga0501045_0076765 3300049824 Bacteria 2462
1985 Ga0501045_0106708 3300049824 Bacteria 2075
1986 Ga0501045_0135882 3300049824 Bacteria 1828
1987 nmdc:mga03683_54584_c1 3300050489 Bacteria 1676
1988 nmdc:mga03n38_72829_c2 3300050490 Bacteria 1192
1989 nmdc:mga03n38_8992_c1 3300050490 Bacteria 3610
1990 nmdc:mga03n38_9059_c1 3300050490 Bacteria 3601
1991 nmdc:mga00v17_3731_c1 3300050491 Bacteria 7336
1992 nmdc:mga00v17_45806_c1 3300050491 Bacteria 2644
1993 nmdc:mga00v17_49678_c1 3300050491 Bacteria 2546
1994 nmdc:mga00v17_71097_c1 3300050491 Bacteria 2156
1995 nmdc:mga00v17_96633_c1 3300050491 Bacteria 1861
1996 nmdc:mga0yw44_2821_c1 3300050492 Bacteria 7539
1997 nmdc:mga0yw44_30618_c1 3300050492 Bacteria 3121
1998 nmdc:mga0k408_24301_c1 3300050493 Bacteria 3425
1999 nmdc:mga0k408_38558_c1 3300050493 Bacteria 2742
2000 nmdc:mga0k408_45156_c1 3300050493 Bacteria 2542
2001 nmdc:mga0k408_79882_c1 3300050493 Bacteria 1914
2002 nmdc:mga06z11_1145_c1 3300050494 Bacteria 9683
2003 nmdc:mga06z11_146699_c1 3300050494 Bacteria 1338
2004 nmdc:mga06z11_16695_c1 3300050494 Bacteria 3313
2005 nmdc:mga06z11_1846_c1 3300050494 Bacteria 7989
2006 nmdc:mga06z11_242936_c1 3300050494 Bacteria 1058
2007 nmdc:mga06z11_34895_c1 3300050494 Bacteria 2472
2008 nmdc:mga06z11_4530_c1 3300050494 Bacteria 5475
2009 nmdc:mga06z11_50293_c1 3300050494 Bacteria 2130
2010 nmdc:mga06z11_61868_c1 3300050494 Bacteria 1954
2011 nmdc:mga04h51_1364_c1 3300050495 Bacteria 5619
2012 nmdc:mga04h51_5630_c1 3300050495 Bacteria 3203
2013 nmdc:mga07m45_15551_c1 3300050496 Bacteria 4063
2014 nmdc:mga07m45_31195_c1 3300050496 Bacteria 2953
2015 nmdc:mga07m45_93113_c1 3300050496 Bacteria 1727
2016 nmdc:mga05p37_114306_c1 3300050507 Bacteria 3318
2017 nmdc:mga05p37_123415_c1 3300050507 Bacteria 3181
2018 nmdc:mga05p37_138208_c1 3300050507 Bacteria 2986
2019 nmdc:mga05p37_143860_c1 3300050507 Bacteria 2920
2020 nmdc:mga05p37_234893_c1 3300050507 Bacteria 2207
2021 nmdc:mga05p37_26709_c1 3300050507 Bacteria 7022
2022 nmdc:mga05p37_30390_c1 3300050507 Bacteria 6592
2023 nmdc:mga05p37_409778_c1 3300050507 Bacteria 1580
2024 nmdc:mga05p37_40_c1 3300050507 Bacteria 108168
2025 nmdc:mga05p37_45_c2 3300050507 Bacteria 24882
2026 nmdc:mga05p37_97690_c1 3300050507 Bacteria 3618
2027 nmdc:mga09592_1055_c1 3300050508 Bacteria 21846
2028 nmdc:mga09592_13677_c1 3300050508 Bacteria 6632
2029 nmdc:mga09592_388436_c1 3300050508 Bacteria 1206
2030 nmdc:mga09592_42573_c1 3300050508 Bacteria 3820
2031 nmdc:mga09592_47664_c1 3300050508 Bacteria 3612
2032 nmdc:mga09592_69574_c1 3300050508 Bacteria 2986
2033 nmdc:mga0qj67_201_c1 3300050509 Bacteria 40409
2034 nmdc:mga0qj67_340273_c1 3300050509 Bacteria 1213
2035 nmdc:mga0qj67_59066_c1 3300050509 Bacteria 3041
2036 nmdc:mga0qj67_701_c1 3300050509 Bacteria 22836
2037 nmdc:mga0qj67_83082_c1 3300050509 Bacteria 2568
2038 nmdc:mga0qj67_92191_c1 3300050509 Bacteria 2435
2039 nmdc:mga06r32_119_c1 3300050510 Bacteria 56718
2040 nmdc:mga06r32_123807_c1 3300050510 Bacteria 2552
2041 nmdc:mga06r32_160077_c1 3300050510 Bacteria 2233
2042 nmdc:mga06r32_227_c1 3300050510 Bacteria 45651
2043 nmdc:mga06r32_58526_c1 3300050510 Bacteria 3703
2044 nmdc:mga06r32_7788_c1 3300050510 Bacteria 9631
2045 nmdc:mga08y16_1134_c1 3300050511 Bacteria 26246
2046 nmdc:mga08y16_12172_c1 3300050511 Bacteria 9043
2047 nmdc:mga08y16_1989_c1 3300050511 Bacteria 20867
2048 nmdc:mga08y16_493840_c1 3300050511 Bacteria 1244
2049 nmdc:mga08y16_49490_c1 3300050511 Bacteria 4398
2050 nmdc:mga08y16_60474_c1 3300050511 Bacteria 3956
2051 nmdc:mga08y16_636_c1 3300050511 Bacteria 32950
2052 nmdc:mga08y16_97375_c1 3300050511 Bacteria 3064
2053 nmdc:mga0n895_181899_c1 3300050512 Bacteria 2134
2054 nmdc:mga0n895_219702_c1 3300050512 Bacteria 1929
2055 nmdc:mga0n895_258545_c1 3300050512 Bacteria 1767
2056 nmdc:mga0n895_2629_c1 3300050512 Bacteria 14147
2057 nmdc:mga0n895_26544_c1 3300050512 Bacteria 5487
2058 nmdc:mga0n895_29685_c1 3300050512 Bacteria 5218
2059 nmdc:mga0n895_3165_c1 3300050512 Bacteria 13152
2060 nmdc:mga0n895_39571_c1 3300050512 Bacteria 4575
2061 nmdc:mga0n895_50_c1 3300050512 Bacteria 71634
2062 nmdc:mga0n895_547773_c1 3300050512 Bacteria 1163
2063 nmdc:mga0n895_55201_c1 3300050512 Bacteria 3910
2064 nmdc:mga0n895_56040_c1 3300050512 Bacteria 3882
2065 nmdc:mga0rr50_15874_c1 3300050513 Bacteria 4984
2066 nmdc:mga0rr50_2855_c1 3300050513 Bacteria 9829
2067 nmdc:mga0rr50_3210_c1 3300050513 Bacteria 9361
2068 nmdc:mga0rr50_365400_c1 3300050513 Bacteria 1215
2069 nmdc:mga0rr50_39952_c1 3300050513 Bacteria 3407
2070 nmdc:mga0rr50_42793_c1 3300050513 Bacteria 3310
2071 nmdc:mga08x19_103273_c1 3300050514 Bacteria 1893
2072 nmdc:mga08x19_121910_c1 3300050514 Bacteria 1748
2073 nmdc:mga08x19_3095_c1 3300050514 Bacteria 9993
2074 nmdc:mga0a205_110140_c1 3300050515 Bacteria 2652
2075 nmdc:mga0a205_2228_c1 3300050515 Bacteria 17060
2076 nmdc:mga0a205_24863_c1 3300050515 Bacteria 3389
2077 nmdc:mga0a205_28560_c1 3300050515 Bacteria 5334
2078 nmdc:mga0a205_44889_c1 3300050515 Bacteria 4262
2079 nmdc:mga0a205_449204_c1 3300050515 Bacteria 1149
2080 nmdc:mga0a205_5479_c1 3300050515 Bacteria 11429
2081 nmdc:mga0a205_77964_c1 3300050515 Bacteria 3201
2082 nmdc:mga0a205_892_c1 3300050515 Bacteria 24533
2083 nmdc:mga0sz30_11641_c1 3300050516 Bacteria 3403
2084 nmdc:mga0sz30_22936_c1 3300050516 Bacteria 2536
2085 nmdc:mga0sz30_6619_c1 3300050516 Bacteria 4314
2086 nmdc:mga0sz30_70832_c2 3300050516 Bacteria 963
2087 Ga0495601_0000006 3300053077 Bacteria 373770
2088 Ga0495601_0004041 3300053077 Bacteria 8454
2089 Ga0495601_0036691 3300053077 Bacteria 3062
2090 Ga0495612_0000004 3300053078 Bacteria 286946
2091 Ga0495612_0007152 3300053078 Bacteria 4566
2092 Ga0495612_0017355 3300053078 Bacteria 2882
2093 Ga0495612_0034206 3300053078 Bacteria 2057
2094 Ga0495655_0000309 3300053083 Bacteria 8652
2095 Ga0495655_0050389 3300053083 Bacteria 1100
2096 Ga0495595_0000227 3300053084 Bacteria 22346
2097 Ga0495595_0000577 3300053084 Bacteria 14028
2098 Ga0495595_0002620 3300053084 Bacteria 7052
2099 Ga0495595_0003875 3300053084 Bacteria 5969
2100 Ga0495595_0005520 3300053084 Bacteria 5121
2101 Ga0495619_0000027 3300053085 Bacteria 165001
2102 Ga0495619_0000260 3300053085 Bacteria 38574
2103 Ga0495619_0000655 3300053085 Bacteria 22730
2104 Ga0495619_0002246 3300053085 Bacteria 12779
2105 Ga0495619_0002796 3300053085 Bacteria 11389
2106 Ga0495619_0014245 3300053085 Bacteria 5023
2107 Ga0495619_0021429 3300053085 Bacteria 4125
2108 Ga0495619_0118832 3300053085 Bacteria 1811
2109 Ga0500578_0000166 3300053086 Bacteria 78688
2110 Ga0500643_000641 3300053087 Bacteria 23561
2111 Ga0500643_005110 3300053087 Bacteria 5730
2112 Ga0500643_015526 3300053087 Bacteria 2608
2113 Ga0500643_039697 3300053087 Bacteria 1389
2114 Ga0500644_0000301 3300053088 Bacteria 26471
2115 Ga0500644_0000731 3300053088 Bacteria 11546
2116 Ga0500651_0018718 3300053093 Bacteria 4290
2117 Ga0500651_0032130 3300053093 Bacteria 3308
2118 Ga0500566_0000554 3300053094 Bacteria 20984
2119 Ga0500641_0006722 3300053096 Bacteria 4088
2120 Ga0500641_0030745 3300053096 Bacteria 2113
2121 Ga0500554_002030 3300053102 Bacteria 3924
2122 Ga0500562_044939 3300053108 Bacteria 1177
2123 Ga0500593_009994 3300053117 Bacteria 3961
2124 Ga0500594_0000310 3300053118 Bacteria 10933
2125 Ga0500595_000144 3300053119 Bacteria 46478
2126 Ga0500595_000540 3300053119 Bacteria 22705
2127 Ga0500608_000213 3300053122 Bacteria 23181
2128 Ga0500608_003545 3300053122 Bacteria 5873
2129 Ga0500652_000016 3300053131 Bacteria 126768
2130 Ga0500652_000707 3300053131 Bacteria 11326
2131 Ga0500559_0000985 3300053136 Bacteria 17756
2132 Ga0500559_0085824 3300053136 Bacteria 1436
2133 Ga0500561_0014749 3300053137 Bacteria 1721
2134 Ga0500564_000061 3300053138 Bacteria 29201
2135 Ga0500568_0000002 3300053139 Bacteria 880601
2136 Ga0500568_0000219 3300053139 Bacteria 49081
2137 Ga0500616_0000006 3300053153 Bacteria 944738
2138 Ga0500616_0016172 3300053153 Bacteria 4253
2139 Ga0500616_0044293 3300053153 Bacteria 2374
2140 Ga0500616_0056913 3300053153 Bacteria 2039
2141 Ga0500616_0117134 3300053153 Bacteria 1278
2142 Ga0500620_000218 3300053155 Bacteria 11324
2143 Ga0500622_0005137 3300053156 Bacteria 7938
2144 Ga0500622_0021522 3300053156 Bacteria 3422
2145 Ga0500622_0044030 3300053156 Bacteria 2313
2146 Ga0500627_0044783 3300053158 Bacteria 1912
2147 Ga0500627_0049371 3300053158 Bacteria 1830
2148 Ga0500636_0004010 3300053177 Bacteria 8301
2149 Ga0500636_0027796 3300053177 Bacteria 3340
2150 Ga0500636_0035683 3300053177 Bacteria 2942
2151 Ga0500637_0010125 3300053178 Bacteria 4828
2152 Ga0500645_000946 3300053730 Bacteria 16529
2153 Ga0500645_021461 3300053730 Bacteria 1993
2154 Ga0500601_002057 3300053737 Bacteria 2159
2155 Ga0501084_0007053 3300054114 Bacteria 9264
2156 Ga0501084_0012125 3300054114 Bacteria 7135
2157 Ga0501084_0018555 3300054114 Bacteria 5789
2158 Ga0501084_0037059 3300054114 Bacteria 4074
2159 Ga0501084_0048508 3300054114 Bacteria 3555
2160 Ga0501084_0058942 3300054114 Bacteria 3213
2161 Ga0501084_0077123 3300054114 Bacteria 2794
2162 Ga0501084_0107364 3300054114 Bacteria 2345
2163 Ga0501084_0165007 3300054114 Bacteria 1869
2164 Ga0501084_0264800 3300054114 Bacteria 1451
2165 Ga0501084_0295723 3300054114 Bacteria 1367
2166 Ga0501084_0372771 3300054114 Bacteria 1206
2167 Ga0501084_0416045 3300054114 Bacteria 1136
2168 Ga0501082_0020050 3300060353 Bacteria 5762
2169 Ga0501082_0069046 3300060353 Bacteria 3042
2170 Ga0501082_0089571 3300060353 Bacteria 2656
2171 Ga0501082_0166557 3300060353 Bacteria 1915
2172 Ga0501082_0186482 3300060353 Bacteria 1805
2173 Ga0466962_0065609 3300061719 Bacteria 1733
2174 Ga0530510_0015460 3300061734 Bacteria 5393
2175 Ga0530510_0019810 3300061734 Bacteria 4781
2176 Ga0530510_0050596 3300061734 Bacteria 3001
2177 Ga0530510_0058163 3300061734 Bacteria 2795
2178 Ga0530510_0066456 3300061734 Bacteria 2614
2179 Ga0530510_0086829 3300061734 Bacteria 2279
2180 Ga0530510_0103047 3300061734 Bacteria 2087
2181 Ga0530510_0225458 3300061734 Bacteria 1394

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0327699 Ga0501081_0327699_12_1058 290
2 3300049575 Ga0501039_0014998 Ga0501039_0014998_4533_5465 295
3 3300049576 Ga0501040_0057783 Ga0501040_0057783_1697_2629 295
4 3300049582 Ga0501048_0074175 Ga0501048_0074175_1438_2370 295
5 3300049591 Ga0501075_0023384 Ga0501075_0023384_1422_2354 295
6 3300049593 Ga0501077_0135284 Ga0501077_0135284_63_995 295
7 3300049742 Ga0501080_0282616 Ga0501080_0282616_141_1073 295
8 3300049743 Ga0501081_0009580 Ga0501081_0009580_1304_2236 295
9 3300060353 Ga0501082_0069046 Ga0501082_0069046_1463_2395 295
10 3300061734 Ga0530510_0058163 Ga0530510_0058163_414_1346 295
11 3300005459 Ga0068867_100148389 Ga0068867_1001483892 297
12 3300006852 Ga0075433_10017476 Ga0075433_100174763 297
13 3300006871 Ga0075434_100003917 Ga0075434_1000039173 297
14 3300035695 Ga0373927_0211942 Ga0373927_0211942_11_904 297
15 3300048907 Ga0496104_0210552 Ga0496104_0210552_715_1614 297
16 3300048920 Ga0496117_0000222 Ga0496117_0000222_100154_101056 297
17 3300050513 nmdc:mga0rr50_42793_c1 nmdc:mga0rr50_42793_c1_1175_2119 297
18 3300050515 nmdc:mga0a205_28560_c1 nmdc:mga0a205_28560_c1_1970_2914 297
19 3300050516 nmdc:mga0sz30_70832_c2 nmdc:mga0sz30_70832_c2_58_951 297
20 3300005444 Ga0070694_100152974 Ga0070694_1001529742 298
21 3300026041 Ga0207639_10316947 Ga0207639_103169472 299
22 3300006846 Ga0075430_100023265 Ga0075430_1000232655 300
23 3300009147 Ga0114129_10542262 Ga0114129_105422622 300
24 3300035398 Ga0316574_0033236 Ga0316574_0033236_1218_2120 300
25 3300038996 Ga0242420_015944 Ga0242420_015944_254_1174 300
26 3300039437 Ga0436365_0151816 Ga0436365_0151816_1480_2391 300
27 3300050509 nmdc:mga0qj67_59066_c1 nmdc:mga0qj67_59066_c1_290_1192 300
28 iso_pu_bacteria 2643221564 2643838391 300
29 3300005335 Ga0070666_10000466 Ga0070666_100004661 301
30 3300025903 Ga0207680_10001483 Ga0207680_100014832 301
31 3300025949 Ga0207667_10333392 Ga0207667_103333922 301
32 iso_pu_bacteria 2582581279 2585148209 301
33 iso_pu_bacteria 2643221550 2643770350 301
34 iso_pu_bacteria 2643221623 2644133919 301
35 iso_pu_bacteria 2738543024 2739307852 301
36 iso_pu_bacteria 2841734538 2841736477 301
37 iso_pu_bacteria 2847686936 2847690042 301
38 iso_pu_bacteria 2856349417 2856350641 301
39 iso_pu_bacteria 2857349434 2857353024 301
40 iso_pu_bacteria 2871444079 2871444891 301
41 iso_pu_bacteria 2871474448 2871475144 301
42 iso_pu_bacteria 2874102143 2874107369 301
43 iso_pu_bacteria 2878788777 2878789460 301
44 iso_pu_bacteria 2881155292 2881159391 301
45 iso_pu_bacteria 2885342637 2885343846 301
46 iso_pu_bacteria 2885350715 2885356231 301
47 iso_pu_bacteria 2888350351 2888353300 301
48 iso_pu_bacteria 2889010040 2889015017 301
49 iso_pu_bacteria 2889016732 2889019907 301
50 iso_pu_bacteria 2906328253 2906334097 301
51 iso_pu_bacteria 2906354277 2906355316 301
52 iso_pu_bacteria 2922130491 2922133807 301
53 iso_pu_bacteria 2922158528 2922162061 301
54 iso_pu_bacteria 2922185730 2922188433 301
55 iso_pu_bacteria 2924762789 2924766098 301
56 iso_pu_bacteria 2937836603 2937838945 301
57 iso_pu_bacteria 2937891427 2937898285 301
58 iso_pu_bacteria 2958064165 2958071040 301
59 iso_pu_bacteria 2958071322 2958075343 301
60 iso_pu_bacteria 2958100919 2958107187 301
61 iso_pu_bacteria 2958115193 2958120216 301
62 iso_pu_bacteria 2958172287 2958176807 301
63 iso_pu_bacteria 2961127735 2961135895 301
64 iso_pu_bacteria 2965062239 2965064222 301
65 iso_pu_bacteria 2965119406 2965121948 301
66 iso_pu_bacteria 2968091066 2968093323 301
67 iso_pu_bacteria 2968097103 2968100841 301
68 iso_pu_bacteria 2968117919 2968122564 301
69 iso_pu_bacteria 2968128360 2968134066 301
70 iso_pu_bacteria 2977858184 2977864017 301
71 iso_pu_bacteria 2977942078 2977945624 301
72 iso_pu_bacteria 2977971508 2977976183 301
73 iso_pu_bacteria 2979710463 2979710643 301
74 iso_pu_bacteria 2979742915 2979748682 301
75 iso_pu_bacteria 2979779861 2979782325 301
76 iso_pu_bacteria 2987636660 2987641616 301
77 iso_pu_bacteria 2987652177 2987656192 301
78 iso_pu_bacteria 2987666974 2987667024 301
79 iso_pu_bacteria 2996310559 2996311952 301
80 iso_pu_bacteria 2996336353 2996341446 301
81 iso_pu_bacteria 3004203850 3004209572 301
82 iso_pu_bacteria 8002285264 8002291125 301
83 iso_pu_bacteria 8004445564 8004448621 301
84 iso_pu_bacteria 8004633249 8004638148 301
85 iso_pu_bacteria 8004640170 8004645282 301
86 iso_pu_bacteria 8004703790 8004706629 301
87 3300005455 Ga0070663_100489381 Ga0070663_1004893811 302
88 3300005457 Ga0070662_100157238 Ga0070662_1001572382 302
89 3300005937 Ga0081455_10186999 Ga0081455_101869992 302
90 3300006852 Ga0075433_10301797 Ga0075433_103017972 302
91 3300006871 Ga0075434_100049823 Ga0075434_1000498233 302
92 3300009147 Ga0114129_10047166 Ga0114129_100471664 302
93 3300025986 Ga0207658_10016451 Ga0207658_100164512 302
94 3300026067 Ga0207678_10271067 Ga0207678_102710672 302
95 3300026116 Ga0207674_10078801 Ga0207674_100788012 302
96 3300044658 Ga0466972_0049686 Ga0466972_0049686_810_1724 302
97 3300044684 Ga0466966_0044437 Ga0466966_0044437_1545_2459 302
98 3300049570 Ga0501033_0059675 Ga0501033_0059675_234_1154 302
99 3300049822 Ga0501035_0049479 Ga0501035_0049479_1582_2502 302
100 3300050507 nmdc:mga05p37_138208_c1 nmdc:mga05p37_138208_c1_950_1861 302
101 3300061719 Ga0466962_0065609 Ga0466962_0065609_47_961 302
102 iso_pu_bacteria 2585428106 2587917098 302
103 iso_pu_bacteria 2643221640 2644223697 302
104 iso_pu_bacteria 2643221642 2644236215 302
105 3300006178 Ga0075367_10013054 Ga0075367_100130544 303
106 3300009098 Ga0105245_10106904 Ga0105245_101069044 303
107 3300025918 Ga0207662_10017308 Ga0207662_100173083 303
108 3300046518 Ga0495631_0006999 Ga0495631_0006999_1866_2777 303
109 3300047472 Ga0495686_0001010 Ga0495686_0001010_3574_4485 303
110 3300050494 nmdc:mga06z11_16695_c1 nmdc:mga06z11_16695_c1_277_1200 303
111 3300053131 Ga0500652_000707 Ga0500652_000707_10195_11130 303
112 3300053156 Ga0500622_0005137 Ga0500622_0005137_6569_7480 303
113 iso_pu_bacteria 2643221603 2644026058 303
114 3300002741 JGI25157J39369_1000048 JGI25157J39369_100004835 304
115 3300003791 Ga0055530_10008848 Ga0055530_100088483 304
116 3300003794 Ga0055531_10002697 Ga0055531_100026974 304
117 3300005331 Ga0070670_100079226 Ga0070670_1000792262 304
118 3300005563 Ga0068855_100170351 Ga0068855_1001703512 304
119 3300005578 Ga0068854_100010188 Ga0068854_1000101882 304
120 3300005618 Ga0068864_100000632 Ga0068864_10000063219 304
121 3300005841 Ga0068863_100000125 Ga0068863_10000012520 304
122 3300005842 Ga0068858_100000025 Ga0068858_10000002578 304
123 3300005937 Ga0081455_10007844 Ga0081455_100078442 304
124 3300009177 Ga0105248_10024935 Ga0105248_100249352 304
125 3300009551 Ga0105238_10022046 Ga0105238_100220461 304
126 3300010375 Ga0105239_10022736 Ga0105239_100227365 304
127 3300013105 Ga0157369_10116021 Ga0157369_101160212 304
128 3300014968 Ga0157379_10004779 Ga0157379_100047798 304
129 3300025246 Ga0209646_1000131 Ga0209646_100013134 304
130 3300025250 Ga0209026_1000038 Ga0209026_100003834 304
131 3300025253 Ga0209677_100616 Ga0209677_1006169 304
132 3300025256 Ga0209759_1000031 Ga0209759_100003134 304
133 3300025292 Ga0209676_1001544 Ga0209676_10015443 304
134 3300025295 Ga0209564_1024318 Ga0209564_10243182 304
135 3300025298 Ga0209050_1002892 Ga0209050_100289213 304
136 3300025304 Ga0209257_1000304 Ga0209257_100030482 304
137 3300025907 Ga0207645_10015180 Ga0207645_100151801 304
138 3300025911 Ga0207654_10038790 Ga0207654_100387902 304
139 3300025913 Ga0207695_10001390 Ga0207695_1000139024 304
140 3300025913 Ga0207695_10513131 Ga0207695_105131311 304
141 3300025924 Ga0207694_10091471 Ga0207694_100914713 304
142 3300025925 Ga0207650_10151563 Ga0207650_101515632 304
143 3300025941 Ga0207711_10050101 Ga0207711_100501013 304
144 3300025949 Ga0207667_10059281 Ga0207667_100592813 304
145 3300026035 Ga0207703_10000105 Ga0207703_1000010561 304
146 3300026078 Ga0207702_10000668 Ga0207702_100006685 304
147 3300026088 Ga0207641_10000012 Ga0207641_10000012327 304
148 3300026095 Ga0207676_10000315 Ga0207676_1000031512 304
149 3300026142 Ga0207698_10102778 Ga0207698_101027782 304
150 3300028794 Ga0307515_10030159 Ga0307515_100301593 304
151 3300028800 Ga0265338_10024767 Ga0265338_100247674 304
152 3300036647 Ga0316582_0048052 Ga0316582_0048052_83_997 304
153 3300036712 Ga0316584_0053077 Ga0316584_0053077_651_1565 304
154 3300037068 Ga0373925_0109642 Ga0373925_0109642_671_1678 304
155 3300041498 Ga0451841_1083948 Ga0451841_1083948_1470_2393 304
156 3300041505 Ga0451849_0312684 Ga0451849_0312684_1019_1942 304
157 3300041512 Ga0451853_0652838 Ga0451853_0652838_1687_2610 304
158 3300046457 Ga0495590_0001563 Ga0495590_0001563_3489_4406 304
159 3300046460 Ga0495638_0000538 Ga0495638_0000538_8173_9090 304
160 3300046512 Ga0495610_0002386 Ga0495610_0002386_11706_12623 304
161 3300046524 Ga0495648_0000204 Ga0495648_0000204_4309_5226 304
162 3300046528 Ga0495642_0065173 Ga0495642_0065173_157_1086 304
163 3300046530 Ga0495654_0033178 Ga0495654_0033178_391_1308 304
164 3300046616 Ga0495668_0006076 Ga0495668_0006076_4079_4996 304
165 3300046616 Ga0495668_0106814 Ga0495668_0106814_435_1352 304
166 3300046660 Ga0495625_0096862 Ga0495625_0096862_357_1277 304
167 3300047469 Ga0495673_0000549 Ga0495673_0000549_10289_11206 304
168 3300048912 Ga0496109_0061649 Ga0496109_0061649_2394_3308 304
169 3300048917 Ga0496114_0257801 Ga0496114_0257801_200_1114 304
170 3300048920 Ga0496117_0000253 Ga0496117_0000253_4918_5844 304
171 3300048928 Ga0496125_0004409 Ga0496125_0004409_10566_11501 304
172 3300048929 Ga0496126_0022827 Ga0496126_0022827_2934_3869 304
173 3300049459 Ga0495678_000680 Ga0495678_000680_2605_3522 304
174 3300049589 Ga0501073_0008662 Ga0501073_0008662_2825_3769 304
175 3300049686 Ga0501257_016727 Ga0501257_016727_461_1378 304
176 3300050516 nmdc:mga0sz30_11641_c1 nmdc:mga0sz30_11641_c1_226_1161 304
177 3300053086 Ga0500578_0000166 Ga0500578_0000166_34700_35617 304
178 3300053087 Ga0500643_039697 Ga0500643_039697_77_994 304
179 3300053088 Ga0500644_0000731 Ga0500644_0000731_2721_3638 304
180 3300053102 Ga0500554_002030 Ga0500554_002030_1969_2892 304
181 3300053118 Ga0500594_0000310 Ga0500594_0000310_6528_7445 304
182 3300053122 Ga0500608_000213 Ga0500608_000213_19363_20298 304
183 3300053136 Ga0500559_0085824 Ga0500559_0085824_131_1066 304
184 3300053138 Ga0500564_000061 Ga0500564_000061_2648_3565 304
185 3300053156 Ga0500622_0021522 Ga0500622_0021522_2324_3259 304
186 3300053730 Ga0500645_021461 Ga0500645_021461_751_1680 304
187 iso_pu_bacteria 2643221734 2644735144 304
188 iso_pu_bacteria 2643221736 2644743292 304
189 iso_pu_bacteria 2818991467 2819719721 304
190 iso_pu_bacteria 2841760612 2841761151 304
191 iso_pu_bacteria 2844104063 2844104176 304
192 iso_pu_bacteria 2851182111 2851184174 304
193 iso_pu_bacteria 2851246043 2851247164 304
194 iso_pu_bacteria 2894772417 2894773363 304
195 iso_pu_bacteria 2917699015 2917699041 304
196 iso_pu_bacteria 8057529695 8057530636 304
197 3300003187 JGI25151J46595_10000345 JGI25151J46595_100003455 305
198 3300003187 JGI25151J46595_10062872 JGI25151J46595_100628721 305
199 3300003771 Ga0055526_1001487 Ga0055526_10014872 305
200 3300003771 Ga0055526_1005104 Ga0055526_10051045 305
201 3300003775 Ga0055524_1000020 Ga0055524_100002034 305
202 3300005262 Ga0065165_1000234 Ga0065165_100023464 305
203 3300005330 Ga0070690_100000407 Ga0070690_1000004073 305
204 3300005356 Ga0070674_100136195 Ga0070674_1001361952 305
205 3300005365 Ga0070688_100037673 Ga0070688_1000376732 305
206 3300005539 Ga0068853_100010268 Ga0068853_1000102689 305
207 3300005548 Ga0070665_100102196 Ga0070665_1001021962 305
208 3300005548 Ga0070665_100104237 Ga0070665_1001042373 305
209 3300005937 Ga0081455_10027231 Ga0081455_100272313 305
210 3300005985 Ga0081539_10001093 Ga0081539_1000109353 305
211 3300006048 Ga0075363_100154694 Ga0075363_1001546942 305
212 3300006178 Ga0075367_10061433 Ga0075367_100614332 305
213 3300006178 Ga0075367_10083947 Ga0075367_100839472 305
214 3300006847 Ga0075431_100031321 Ga0075431_1000313213 305
215 3300006880 Ga0075429_100081001 Ga0075429_1000810013 305
216 3300007265 Ga0099794_10002598 Ga0099794_100025986 305
217 3300009093 Ga0105240_10444767 Ga0105240_104447672 305
218 3300009101 Ga0105247_10027659 Ga0105247_100276592 305
219 3300009147 Ga0114129_10128586 Ga0114129_101285863 305
220 3300009545 Ga0105237_10130250 Ga0105237_101302503 305
221 3300009551 Ga0105238_10006361 Ga0105238_100063614 305
222 3300009553 Ga0105249_10808355 Ga0105249_108083551 305
223 3300010375 Ga0105239_10102725 Ga0105239_101027253 305
224 3300013250 Ga0171462_1022 Ga0171462_102289 305
225 3300013308 Ga0157375_10004135 Ga0157375_100041353 305
226 3300021361 Ga0213872_10050957 Ga0213872_100509571 305
227 3300021388 Ga0213875_10009268 Ga0213875_100092683 305
228 3300025250 Ga0209026_1000141 Ga0209026_100014133 305
229 3300025256 Ga0209759_1000554 Ga0209759_100055428 305
230 3300025273 Ga0209673_1024878 Ga0209673_10248782 305
231 3300025284 Ga0209130_1000279 Ga0209130_100027920 305
232 3300025291 Ga0209675_1006326 Ga0209675_10063264 305
233 3300025294 Ga0209025_1000008 Ga0209025_1000008959 305
234 3300025294 Ga0209025_1002215 Ga0209025_10022156 305
235 3300025295 Ga0209564_1000049 Ga0209564_1000049157 305
236 3300025299 Ga0209256_1000014 Ga0209256_1000014482 305
237 3300025913 Ga0207695_10500480 Ga0207695_105004802 305
238 3300025914 Ga0207671_10033905 Ga0207671_100339053 305
239 3300025924 Ga0207694_10071637 Ga0207694_100716372 305
240 3300026041 Ga0207639_10046686 Ga0207639_100466863 305
241 3300026118 Ga0207675_100235558 Ga0207675_1002355582 305
242 3300028379 Ga0268266_10060106 Ga0268266_100601062 305
243 3300028794 Ga0307515_10306008 Ga0307515_103060082 305
244 3300031241 Ga0265325_10058174 Ga0265325_100581743 305
245 3300031727 Ga0316576_10018285 Ga0316576_100182854 305
246 3300031730 Ga0307516_10177300 Ga0307516_101773002 305
247 3300032133 Ga0316583_10001319 Ga0316583_100013193 305
248 3300035398 Ga0316574_0016743 Ga0316574_0016743_1743_2672 305
249 3300035692 Ga0373935_0006436 Ga0373935_0006436_4945_5862 305
250 3300035695 Ga0373927_0000690 Ga0373927_0000690_2585_3502 305
251 3300036712 Ga0316584_0031916 Ga0316584_0031916_1466_2395 305
252 3300037068 Ga0373925_0001295 Ga0373925_0001295_9884_10801 305
253 3300037418 Ga0395900_0246956 Ga0395900_0246956_508_1425 305
254 3300037471 Ga0395905_0000247 Ga0395905_0000247_26309_27226 305
255 3300037471 Ga0395905_0016737 Ga0395905_0016737_2759_3676 305
256 3300037588 Ga0316581_0014058 Ga0316581_0014058_431_1360 305
257 3300037853 Ga0436364_0640796 Ga0436364_0640796_1720_2637 305
258 3300038443 Ga0395901_0020788 Ga0395901_0020788_987_1907 305
259 3300038443 Ga0395901_0036486 Ga0395901_0036486_3547_4467 305
260 3300039447 Ga0436361_0858198 Ga0436361_0858198_6516_7448 305
261 3300041405 Ga0439438_026698 Ga0439438_026698_454_1374 305
262 3300046460 Ga0495638_0038104 Ga0495638_0038104_1930_2847 305
263 3300046460 Ga0495638_0045554 Ga0495638_0045554_1005_1922 305
264 3300046507 Ga0495606_0069208 Ga0495606_0069208_648_1568 305
265 3300046515 Ga0495620_0065140 Ga0495620_0065140_12_932 305
266 3300046694 Ga0495649_0148075 Ga0495649_0148075_148_1068 305
267 3300048905 Ga0496102_0419324 Ga0496102_0419324_319_1245 305
268 3300048906 Ga0496103_0049258 Ga0496103_0049258_1363_2283 305
269 3300048909 Ga0496106_0044188 Ga0496106_0044188_757_1683 305
270 3300048909 Ga0496106_0195262 Ga0496106_0195262_587_1513 305
271 3300048910 Ga0496107_0013210 Ga0496107_0013210_2988_3914 305
272 3300048911 Ga0496108_0268325 Ga0496108_0268325_27_953 305
273 3300048912 Ga0496109_0064585 Ga0496109_0064585_2209_3135 305
274 3300048915 Ga0496112_0062844 Ga0496112_0062844_424_1350 305
275 3300048920 Ga0496117_0056336 Ga0496117_0056336_576_1502 305
276 3300048922 Ga0496119_0013662 Ga0496119_0013662_1072_1992 305
277 3300048923 Ga0496120_0000466 Ga0496120_0000466_28780_29700 305
278 3300048925 Ga0496122_0068956 Ga0496122_0068956_1515_2441 305
279 3300048925 Ga0496122_0182002 Ga0496122_0182002_202_1128 305
280 3300048926 Ga0496123_0093279 Ga0496123_0093279_95_1021 305
281 3300048928 Ga0496125_0051251 Ga0496125_0051251_2123_3049 305
282 3300049571 Ga0501034_0004395 Ga0501034_0004395_10744_11661 305
283 3300049571 Ga0501034_0298743 Ga0501034_0298743_306_1250 305
284 3300049571 Ga0501034_0482900 Ga0501034_0482900_178_1098 305
285 3300049572 Ga0501036_0049811 Ga0501036_0049811_206_1132 305
286 3300049574 Ga0501038_0034365 Ga0501038_0034365_2483_3409 305
287 3300049574 Ga0501038_0065969 Ga0501038_0065969_2055_2981 305
288 3300049574 Ga0501038_0097220 Ga0501038_0097220_1433_2362 305
289 3300049574 Ga0501038_0166436 Ga0501038_0166436_319_1245 305
290 3300049574 Ga0501038_0182600 Ga0501038_0182600_630_1556 305
291 3300049574 Ga0501038_0348513 Ga0501038_0348513_13_936 305
292 3300049575 Ga0501039_0012235 Ga0501039_0012235_908_1834 305
293 3300049575 Ga0501039_0031133 Ga0501039_0031133_1500_2426 305
294 3300049575 Ga0501039_0376114 Ga0501039_0376114_67_993 305
295 3300049576 Ga0501040_0054184 Ga0501040_0054184_1206_2135 305
296 3300049576 Ga0501040_0058568 Ga0501040_0058568_802_1728 305
297 3300049576 Ga0501040_0149428 Ga0501040_0149428_556_1482 305
298 3300049577 Ga0501041_0036124 Ga0501041_0036124_406_1332 305
299 3300049577 Ga0501041_0037357 Ga0501041_0037357_310_1236 305
300 3300049577 Ga0501041_0055423 Ga0501041_0055423_1022_1948 305
301 3300049578 Ga0501042_0043117 Ga0501042_0043117_421_1347 305
302 3300049578 Ga0501042_0073812 Ga0501042_0073812_129_1055 305
303 3300049578 Ga0501042_0086320 Ga0501042_0086320_380_1306 305
304 3300049578 Ga0501042_0128216 Ga0501042_0128216_552_1481 305
305 3300049578 Ga0501042_0219673 Ga0501042_0219673_390_1316 305
306 3300049579 Ga0501043_0039248 Ga0501043_0039248_1940_2866 305
307 3300049580 Ga0501046_0029874 Ga0501046_0029874_2275_3201 305
308 3300049580 Ga0501046_0074250 Ga0501046_0074250_743_1672 305
309 3300049580 Ga0501046_0113522 Ga0501046_0113522_39_965 305
310 3300049581 Ga0501047_0047526 Ga0501047_0047526_2716_3657 305
311 3300049581 Ga0501047_0070860 Ga0501047_0070860_1433_2362 305
312 3300049582 Ga0501048_0036986 Ga0501048_0036986_1513_2442 305
313 3300049582 Ga0501048_0042613 Ga0501048_0042613_699_1625 305
314 3300049582 Ga0501048_0046503 Ga0501048_0046503_1147_2073 305
315 3300049582 Ga0501048_0195092 Ga0501048_0195092_371_1297 305
316 3300049583 Ga0501067_0001440 Ga0501067_0001440_2838_3779 305
317 3300049583 Ga0501067_0032258 Ga0501067_0032258_1238_2167 305
318 3300049584 Ga0501068_0186186 Ga0501068_0186186_56_997 305
319 3300049585 Ga0501069_0022000 Ga0501069_0022000_2482_3411 305
320 3300049587 Ga0501071_0037993 Ga0501071_0037993_1634_2560 305
321 3300049587 Ga0501071_0039825 Ga0501071_0039825_801_1727 305
322 3300049587 Ga0501071_0069454 Ga0501071_0069454_147_1073 305
323 3300049587 Ga0501071_0071194 Ga0501071_0071194_1513_2442 305
324 3300049587 Ga0501071_0145683 Ga0501071_0145683_420_1346 305
325 3300049588 Ga0501072_0032608 Ga0501072_0032608_1472_2398 305
326 3300049588 Ga0501072_0042559 Ga0501072_0042559_1033_1959 305
327 3300049588 Ga0501072_0044133 Ga0501072_0044133_822_1748 305
328 3300049588 Ga0501072_0073674 Ga0501072_0073674_63_989 305
329 3300049588 Ga0501072_0114778 Ga0501072_0114778_661_1587 305
330 3300049588 Ga0501072_0133126 Ga0501072_0133126_984_1913 305
331 3300049589 Ga0501073_0010128 Ga0501073_0010128_5830_6771 305
332 3300049589 Ga0501073_0144041 Ga0501073_0144041_58_978 305
333 3300049589 Ga0501073_0242929 Ga0501073_0242929_242_1183 305
334 3300049590 Ga0501074_0019332 Ga0501074_0019332_1545_2474 305
335 3300049590 Ga0501074_0054993 Ga0501074_0054993_602_1528 305
336 3300049590 Ga0501074_0058479 Ga0501074_0058479_523_1449 305
337 3300049591 Ga0501075_0030682 Ga0501075_0030682_1209_2135 305
338 3300049591 Ga0501075_0067649 Ga0501075_0067649_1716_2642 305
339 3300049591 Ga0501075_0088384 Ga0501075_0088384_594_1520 305
340 3300049591 Ga0501075_0089253 Ga0501075_0089253_80_1006 305
341 3300049591 Ga0501075_0184450 Ga0501075_0184450_309_1235 305
342 3300049592 Ga0501076_0008667 Ga0501076_0008667_3984_4910 305
343 3300049592 Ga0501076_0016336 Ga0501076_0016336_4010_4936 305
344 3300049592 Ga0501076_0027629 Ga0501076_0027629_502_1443 305
345 3300049592 Ga0501076_0034132 Ga0501076_0034132_1842_2771 305
346 3300049592 Ga0501076_0106976 Ga0501076_0106976_910_1836 305
347 3300049593 Ga0501077_0020448 Ga0501077_0020448_2176_3105 305
348 3300049593 Ga0501077_0028103 Ga0501077_0028103_1397_2323 305
349 3300049741 Ga0501079_0023616 Ga0501079_0023616_3040_3966 305
350 3300049741 Ga0501079_0037517 Ga0501079_0037517_929_1855 305
351 3300049741 Ga0501079_0099832 Ga0501079_0099832_874_1800 305
352 3300049741 Ga0501079_0117586 Ga0501079_0117586_179_1105 305
353 3300049741 Ga0501079_0136756 Ga0501079_0136756_561_1502 305
354 3300049742 Ga0501080_0113723 Ga0501080_0113723_677_1606 305
355 3300049742 Ga0501080_0217169 Ga0501080_0217169_409_1335 305
356 3300049743 Ga0501081_0006981 Ga0501081_0006981_2369_3295 305
357 3300049743 Ga0501081_0099671 Ga0501081_0099671_208_1134 305
358 3300049743 Ga0501081_0205423 Ga0501081_0205423_484_1410 305
359 3300049744 Ga0501083_0042101 Ga0501083_0042101_1818_2759 305
360 3300049744 Ga0501083_0058070 Ga0501083_0058070_427_1374 305
361 3300049744 Ga0501083_0108473 Ga0501083_0108473_850_1776 305
362 3300049823 Ga0501044_0211047 Ga0501044_0211047_614_1531 305
363 3300049824 Ga0501045_0037862 Ga0501045_0037862_887_1813 305
364 3300049824 Ga0501045_0076765 Ga0501045_0076765_451_1377 305
365 3300049824 Ga0501045_0106708 Ga0501045_0106708_1023_1949 305
366 3300050490 nmdc:mga03n38_72829_c2 nmdc:mga03n38_72829_c2_223_1152 305
367 3300050492 nmdc:mga0yw44_30618_c1 nmdc:mga0yw44_30618_c1_598_1527 305
368 3300050493 nmdc:mga0k408_24301_c1 nmdc:mga0k408_24301_c1_585_1505 305
369 3300050494 nmdc:mga06z11_4530_c1 nmdc:mga06z11_4530_c1_1747_2676 305
370 3300050494 nmdc:mga06z11_61868_c1 nmdc:mga06z11_61868_c1_318_1247 305
371 3300050495 nmdc:mga04h51_5630_c1 nmdc:mga04h51_5630_c1_707_1636 305
372 3300050508 nmdc:mga09592_13677_c1 nmdc:mga09592_13677_c1_2193_3116 305
373 3300050516 nmdc:mga0sz30_6619_c1 nmdc:mga0sz30_6619_c1_991_1917 305
374 3300053083 Ga0495655_0000309 Ga0495655_0000309_5668_6594 305
375 3300053087 Ga0500643_015526 Ga0500643_015526_15_932 305
376 3300053137 Ga0500561_0014749 Ga0500561_0014749_768_1685 305
377 3300053139 Ga0500568_0000219 Ga0500568_0000219_18783_19712 305
378 3300053153 Ga0500616_0016172 Ga0500616_0016172_2709_3626 305
379 3300053153 Ga0500616_0117134 Ga0500616_0117134_256_1173 305
380 3300053155 Ga0500620_000218 Ga0500620_000218_6958_7878 305
381 3300053156 Ga0500622_0044030 Ga0500622_0044030_841_1758 305
382 3300053158 Ga0500627_0049371 Ga0500627_0049371_784_1704 305
383 3300053177 Ga0500636_0027796 Ga0500636_0027796_738_1655 305
384 3300053737 Ga0500601_002057 Ga0500601_002057_392_1330 305
385 3300054114 Ga0501084_0018555 Ga0501084_0018555_4805_5746 305
386 3300054114 Ga0501084_0037059 Ga0501084_0037059_108_1034 305
387 3300054114 Ga0501084_0048508 Ga0501084_0048508_1374_2300 305
388 3300054114 Ga0501084_0058942 Ga0501084_0058942_1828_2757 305
389 3300054114 Ga0501084_0107364 Ga0501084_0107364_296_1222 305
390 3300054114 Ga0501084_0295723 Ga0501084_0295723_383_1324 305
391 3300060353 Ga0501082_0020050 Ga0501082_0020050_2009_2935 305
392 3300060353 Ga0501082_0089571 Ga0501082_0089571_994_1935 305
393 3300061734 Ga0530510_0015460 Ga0530510_0015460_2998_3924 305
394 3300061734 Ga0530510_0019810 Ga0530510_0019810_2166_3092 305
395 3300061734 Ga0530510_0050596 Ga0530510_0050596_1805_2731 305
396 3300061734 Ga0530510_0066456 Ga0530510_0066456_210_1136 305
397 iso_pu_bacteria 2513237082 2513553496 305
398 iso_pu_bacteria 2513237083 2513559577 305
399 iso_pu_bacteria 2602042107 2603861062 305
400 iso_pu_bacteria 2816332527 2818241582 305
401 iso_pu_bacteria 2884298095 2884298250 305
402 iso_pu_bacteria 2888378607 2888382471 305
403 iso_pu_bacteria 2888419890 2888423051 305
404 iso_pu_bacteria 2893066018 2893069005 305
405 iso_pu_bacteria 2922368715 2922375495 305
406 iso_pu_bacteria 2935694250 2935695402 305
407 iso_pu_bacteria 2935703347 2935709489 305
408 iso_pu_bacteria 2936002035 2936008282 305
409 iso_pu_bacteria 641736151 642426367 305
410 iso_pu_bacteria 8003955200 8003956580 305
411 iso_pu_bacteria 8019576017 8019580821 305
412 iso_pu_bacteria 8019608314 8019615774 305
413 3300003203 JGI25406J46586_10000740 JGI25406J46586_1000074011 306
414 3300005330 Ga0070690_100053872 Ga0070690_1000538723 306
415 3300005341 Ga0070691_10004978 Ga0070691_100049782 306
416 3300005343 Ga0070687_100025246 Ga0070687_1000252462 306
417 3300005345 Ga0070692_10025412 Ga0070692_100254122 306
418 3300005406 Ga0070703_10008070 Ga0070703_100080702 306
419 3300005544 Ga0070686_100128964 Ga0070686_1001289642 306
420 3300005545 Ga0070695_100007603 Ga0070695_1000076034 306
421 3300005563 Ga0068855_100054642 Ga0068855_1000546422 306
422 3300005618 Ga0068864_100180306 Ga0068864_1001803062 306
423 3300005718 Ga0068866_10001618 Ga0068866_100016184 306
424 3300005719 Ga0068861_100255554 Ga0068861_1002555542 306
425 3300005937 Ga0081455_10009223 Ga0081455_100092234 306
426 3300005981 Ga0081538_10063492 Ga0081538_100634923 306
427 3300005985 Ga0081539_10001435 Ga0081539_1000143523 306
428 3300006358 Ga0068871_100003125 Ga0068871_1000031258 306
429 3300006852 Ga0075433_10075502 Ga0075433_100755024 306
430 3300006871 Ga0075434_100011633 Ga0075434_1000116334 306
431 3300006881 Ga0068865_100022027 Ga0068865_1000220274 306
432 3300006914 Ga0075436_100001839 Ga0075436_10000183916 306
433 3300007076 Ga0075435_100000238 Ga0075435_10000023816 306
434 3300009094 Ga0111539_10063344 Ga0111539_100633443 306
435 3300009098 Ga0105245_10035099 Ga0105245_100350994 306
436 3300010375 Ga0105239_10085668 Ga0105239_100856683 306
437 3300025284 Ga0209130_1024083 Ga0209130_10240832 306
438 3300025885 Ga0207653_10007308 Ga0207653_100073084 306
439 3300025899 Ga0207642_10021680 Ga0207642_100216802 306
440 3300025918 Ga0207662_10000666 Ga0207662_100006664 306
441 3300025927 Ga0207687_10025434 Ga0207687_100254343 306
442 3300025936 Ga0207670_10034683 Ga0207670_100346832 306
443 3300025938 Ga0207704_10037957 Ga0207704_100379572 306
444 3300025949 Ga0207667_10085963 Ga0207667_100859632 306
445 3300026023 Ga0207677_10157105 Ga0207677_101571052 306
446 3300026035 Ga0207703_10040329 Ga0207703_100403293 306
447 3300026075 Ga0207708_10007559 Ga0207708_100075595 306
448 3300026095 Ga0207676_10045153 Ga0207676_100451533 306
449 3300026118 Ga0207675_100015555 Ga0207675_1000155552 306
450 3300028380 Ga0268265_10042501 Ga0268265_100425012 306
451 3300028381 Ga0268264_10009146 Ga0268264_100091463 306
452 3300028381 Ga0268264_10039189 Ga0268264_100391894 306
453 3300031240 Ga0265320_10068295 Ga0265320_100682952 306
454 3300035113 Ga0373936_0005389 Ga0373936_0005389_3672_4604 306
455 3300035171 Ga0373946_0001976 Ga0373946_0001976_4227_5159 306
456 3300035725 Ga0373947_0019486 Ga0373947_0019486_846_1778 306
457 3300036401 Ga0373937_0036701 Ga0373937_0036701_1386_2318 306
458 3300037068 Ga0373925_0036300 Ga0373925_0036300_1830_2762 306
459 3300046455 Ga0495603_0006081 Ga0495603_0006081_2935_3867 306
460 3300046459 Ga0495629_0000938 Ga0495629_0000938_13184_14116 306
461 3300046472 Ga0495580_0078267 Ga0495580_0078267_706_1638 306
462 3300046475 Ga0495639_0123726 Ga0495639_0123726_266_1198 306
463 3300046511 Ga0495608_0071149 Ga0495608_0071149_720_1646 306
464 3300046526 Ga0495666_0018191 Ga0495666_0018191_2436_3368 306
465 3300046533 Ga0495640_0170654 Ga0495640_0170654_383_1315 306
466 3300046543 Ga0495645_0064319 Ga0495645_0064319_1286_2212 306
467 3300046557 Ga0495622_0029965 Ga0495622_0029965_1307_2239 306
468 3300046663 Ga0495635_0207896 Ga0495635_0207896_338_1270 306
469 3300047315 Ga0495581_0065762 Ga0495581_0065762_1132_2064 306
470 3300047673 Ga0495593_0019494 Ga0495593_0019494_164_1096 306
471 3300047673 Ga0495593_0068993 Ga0495593_0068993_303_1235 306
472 3300048088 Ga0495602_0117409 Ga0495602_0117409_455_1381 306
473 3300048089 Ga0495614_0049574 Ga0495614_0049574_522_1454 306
474 3300048904 Ga0496101_0062186 Ga0496101_0062186_72_1004 306
475 3300048905 Ga0496102_0037445 Ga0496102_0037445_3039_3971 306
476 3300048907 Ga0496104_0082990 Ga0496104_0082990_1655_2587 306
477 3300048911 Ga0496108_0052486 Ga0496108_0052486_1639_2571 306
478 3300049742 Ga0501080_0334192 Ga0501080_0334192_337_1266 306
479 3300050511 nmdc:mga08y16_97375_c1 nmdc:mga08y16_97375_c1_180_1112 306
480 3300050512 nmdc:mga0n895_2629_c1 nmdc:mga0n895_2629_c1_10962_11894 306
481 3300050513 nmdc:mga0rr50_3210_c1 nmdc:mga0rr50_3210_c1_2561_3493 306
482 3300050514 nmdc:mga08x19_3095_c1 nmdc:mga08x19_3095_c1_1859_2791 306
483 3300050515 nmdc:mga0a205_892_c1 nmdc:mga0a205_892_c1_23469_24401 306
484 3300053078 Ga0495612_0034206 Ga0495612_0034206_487_1413 306
485 3300053085 Ga0495619_0002246 Ga0495619_0002246_11224_12156 306
486 3300002459 JGI24751J29686_10013825 JGI24751J29686_100138252 307
487 3300005327 Ga0070658_10023943 Ga0070658_100239435 307
488 3300005327 Ga0070658_10055935 Ga0070658_100559353 307
489 3300005328 Ga0070676_10068026 Ga0070676_100680261 307
490 3300005329 Ga0070683_100006748 Ga0070683_1000067483 307
491 3300005329 Ga0070683_100206329 Ga0070683_1002063292 307
492 3300005329 Ga0070683_100484563 Ga0070683_1004845631 307
493 3300005331 Ga0070670_100018977 Ga0070670_1000189772 307
494 3300005333 Ga0070677_10001400 Ga0070677_100014006 307
495 3300005334 Ga0068869_100054758 Ga0068869_1000547582 307
496 3300005335 Ga0070666_10047076 Ga0070666_100470763 307
497 3300005335 Ga0070666_10184954 Ga0070666_101849542 307
498 3300005338 Ga0068868_100027258 Ga0068868_1000272582 307
499 3300005338 Ga0068868_100242926 Ga0068868_1002429262 307
500 3300005340 Ga0070689_100089726 Ga0070689_1000897263 307
501 3300005343 Ga0070687_100000593 Ga0070687_1000005932 307
502 3300005353 Ga0070669_100007649 Ga0070669_1000076493 307
503 3300005354 Ga0070675_100157582 Ga0070675_1001575822 307
504 3300005355 Ga0070671_100034113 Ga0070671_1000341134 307
505 3300005356 Ga0070674_100013737 Ga0070674_1000137375 307
506 3300005356 Ga0070674_100108245 Ga0070674_1001082452 307
507 3300005364 Ga0070673_100004753 Ga0070673_1000047535 307
508 3300005364 Ga0070673_100024068 Ga0070673_1000240682 307
509 3300005365 Ga0070688_100018523 Ga0070688_1000185232 307
510 3300005365 Ga0070688_100218920 Ga0070688_1002189201 307
511 3300005366 Ga0070659_100000694 Ga0070659_10000069420 307
512 3300005438 Ga0070701_10040592 Ga0070701_100405922 307
513 3300005440 Ga0070705_100004154 Ga0070705_1000041545 307
514 3300005440 Ga0070705_100025331 Ga0070705_1000253311 307
515 3300005441 Ga0070700_100017344 Ga0070700_1000173444 307
516 3300005441 Ga0070700_100069747 Ga0070700_1000697472 307
517 3300005444 Ga0070694_100050844 Ga0070694_1000508442 307
518 3300005445 Ga0070708_100030085 Ga0070708_1000300854 307
519 3300005456 Ga0070678_100018026 Ga0070678_1000180262 307
520 3300005457 Ga0070662_100062666 Ga0070662_1000626662 307
521 3300005457 Ga0070662_100084433 Ga0070662_1000844332 307
522 3300005466 Ga0070685_10018553 Ga0070685_100185533 307
523 3300005468 Ga0070707_100016314 Ga0070707_1000163146 307
524 3300005530 Ga0070679_100024538 Ga0070679_1000245383 307
525 3300005530 Ga0070679_100063734 Ga0070679_1000637343 307
526 3300005535 Ga0070684_100008740 Ga0070684_1000087405 307
527 3300005535 Ga0070684_100069164 Ga0070684_1000691642 307
528 3300005543 Ga0070672_100007090 Ga0070672_1000070902 307
529 3300005543 Ga0070672_100035069 Ga0070672_1000350692 307
530 3300005544 Ga0070686_100002916 Ga0070686_1000029168 307
531 3300005544 Ga0070686_100160971 Ga0070686_1001609712 307
532 3300005546 Ga0070696_100066301 Ga0070696_1000663012 307
533 3300005546 Ga0070696_100246159 Ga0070696_1002461592 307
534 3300005549 Ga0070704_100040973 Ga0070704_1000409732 307
535 3300005563 Ga0068855_100007848 Ga0068855_1000078488 307
536 3300005564 Ga0070664_100136076 Ga0070664_1001360762 307
537 3300005578 Ga0068854_100007178 Ga0068854_1000071786 307
538 3300005578 Ga0068854_100034293 Ga0068854_1000342932 307
539 3300005615 Ga0070702_100009437 Ga0070702_1000094373 307
540 3300005616 Ga0068852_100012393 Ga0068852_1000123936 307
541 3300005617 Ga0068859_100213502 Ga0068859_1002135022 307
542 3300005617 Ga0068859_100289308 Ga0068859_1002893082 307
543 3300005618 Ga0068864_100029499 Ga0068864_1000294994 307
544 3300005718 Ga0068866_10000386 Ga0068866_1000038620 307
545 3300005718 Ga0068866_10037864 Ga0068866_100378642 307
546 3300005719 Ga0068861_100000162 Ga0068861_1000001622 307
547 3300005834 Ga0068851_10000157 Ga0068851_1000015721 307
548 3300005834 Ga0068851_10010920 Ga0068851_100109204 307
549 3300005840 Ga0068870_10000433 Ga0068870_1000043316 307
550 3300005841 Ga0068863_100137490 Ga0068863_1001374902 307
551 3300005842 Ga0068858_100102711 Ga0068858_1001027112 307
552 3300005981 Ga0081538_10006317 Ga0081538_100063179 307
553 3300005983 Ga0081540_1000147 Ga0081540_100014747 307
554 3300005983 Ga0081540_1000488 Ga0081540_100048828 307
555 3300006038 Ga0075365_10017782 Ga0075365_100177822 307
556 3300006051 Ga0075364_10180919 Ga0075364_101809192 307
557 3300006195 Ga0075366_10010862 Ga0075366_100108624 307
558 3300006237 Ga0097621_100015252 Ga0097621_1000152522 307
559 3300006358 Ga0068871_100013600 Ga0068871_1000136004 307
560 3300006358 Ga0068871_100026363 Ga0068871_1000263635 307
561 3300006931 Ga0097620_100213511 Ga0097620_1002135112 307
562 3300006931 Ga0097620_100289323 Ga0097620_1002893232 307
563 3300007076 Ga0075435_100038749 Ga0075435_1000387493 307
564 3300007265 Ga0099794_10002061 Ga0099794_100020615 307
565 3300009093 Ga0105240_10013662 Ga0105240_100136625 307
566 3300009098 Ga0105245_10001230 Ga0105245_1000123019 307
567 3300009148 Ga0105243_10070856 Ga0105243_100708562 307
568 3300009148 Ga0105243_10199818 Ga0105243_101998182 307
569 3300009176 Ga0105242_10005854 Ga0105242_100058543 307
570 3300009177 Ga0105248_10009760 Ga0105248_100097603 307
571 3300009177 Ga0105248_10459702 Ga0105248_104597022 307
572 3300009545 Ga0105237_10000927 Ga0105237_1000092738 307
573 3300009551 Ga0105238_10005667 Ga0105238_100056674 307
574 3300009553 Ga0105249_10007022 Ga0105249_100070222 307
575 3300010375 Ga0105239_10001392 Ga0105239_1000139230 307
576 3300011119 Ga0105246_10018874 Ga0105246_100188744 307
577 3300013102 Ga0157371_10000585 Ga0157371_100005853 307
578 3300013296 Ga0157374_10009050 Ga0157374_100090503 307
579 3300013296 Ga0157374_10017678 Ga0157374_100176786 307
580 3300013297 Ga0157378_10000994 Ga0157378_100009942 307
581 3300013297 Ga0157378_10025417 Ga0157378_100254174 307
582 3300013306 Ga0163162_10191376 Ga0163162_101913763 307
583 3300013308 Ga0157375_10037022 Ga0157375_100370224 307
584 3300014325 Ga0163163_10002532 Ga0163163_100025323 307
585 3300014326 Ga0157380_10241729 Ga0157380_102417292 307
586 3300014745 Ga0157377_10001850 Ga0157377_100018507 307
587 3300014745 Ga0157377_10061491 Ga0157377_100614912 307
588 3300014968 Ga0157379_10000315 Ga0157379_100003153 307
589 3300014968 Ga0157379_10099136 Ga0157379_100991362 307
590 3300014969 Ga0157376_10001088 Ga0157376_100010883 307
591 3300017792 Ga0163161_10188941 Ga0163161_101889411 307
592 3300025254 Ga0209148_1000574 Ga0209148_100057415 307
593 3300025261 Ga0209233_1004212 Ga0209233_10042127 307
594 3300025272 Ga0209455_1000834 Ga0209455_100083412 307
595 3300025315 Ga0207697_10000586 Ga0207697_100005863 307
596 3300025315 Ga0207697_10014762 Ga0207697_100147622 307
597 3300025321 Ga0207656_10088441 Ga0207656_100884412 307
598 3300025893 Ga0207682_10002226 Ga0207682_100022263 307
599 3300025893 Ga0207682_10006038 Ga0207682_100060382 307
600 3300025900 Ga0207710_10025144 Ga0207710_100251442 307
601 3300025901 Ga0207688_10000079 Ga0207688_100000793 307
602 3300025901 Ga0207688_10004916 Ga0207688_100049166 307
603 3300025903 Ga0207680_10000378 Ga0207680_100003782 307
604 3300025903 Ga0207680_10267674 Ga0207680_102676742 307
605 3300025904 Ga0207647_10001066 Ga0207647_1000106611 307
606 3300025907 Ga0207645_10000016 Ga0207645_1000001676 307
607 3300025907 Ga0207645_10177026 Ga0207645_101770262 307
608 3300025908 Ga0207643_10000010 Ga0207643_1000001076 307
609 3300025908 Ga0207643_10022196 Ga0207643_100221963 307
610 3300025909 Ga0207705_10114006 Ga0207705_101140062 307
611 3300025910 Ga0207684_10032114 Ga0207684_100321143 307
612 3300025912 Ga0207707_10240776 Ga0207707_102407762 307
613 3300025914 Ga0207671_10075982 Ga0207671_100759823 307
614 3300025917 Ga0207660_10125685 Ga0207660_101256852 307
615 3300025918 Ga0207662_10000014 Ga0207662_1000001467 307
616 3300025919 Ga0207657_10000060 Ga0207657_1000006054 307
617 3300025920 Ga0207649_10004994 Ga0207649_100049943 307
618 3300025920 Ga0207649_10116894 Ga0207649_101168942 307
619 3300025921 Ga0207652_10052264 Ga0207652_100522641 307
620 3300025921 Ga0207652_10055225 Ga0207652_100552254 307
621 3300025921 Ga0207652_10262833 Ga0207652_102628332 307
622 3300025922 Ga0207646_10073508 Ga0207646_100735082 307
623 3300025923 Ga0207681_10003056 Ga0207681_100030569 307
624 3300025924 Ga0207694_10060994 Ga0207694_100609942 307
625 3300025925 Ga0207650_10000179 Ga0207650_1000017930 307
626 3300025925 Ga0207650_10079507 Ga0207650_100795072 307
627 3300025926 Ga0207659_10002576 Ga0207659_100025769 307
628 3300025926 Ga0207659_10092949 Ga0207659_100929492 307
629 3300025926 Ga0207659_10298069 Ga0207659_102980691 307
630 3300025927 Ga0207687_10010099 Ga0207687_100100996 307
631 3300025931 Ga0207644_10296593 Ga0207644_102965931 307
632 3300025933 Ga0207706_10000132 Ga0207706_1000013237 307
633 3300025933 Ga0207706_10002958 Ga0207706_100029586 307
634 3300025933 Ga0207706_10045631 Ga0207706_100456313 307
635 3300025935 Ga0207709_10081485 Ga0207709_100814852 307
636 3300025936 Ga0207670_10000085 Ga0207670_1000008532 307
637 3300025937 Ga0207669_10202374 Ga0207669_102023742 307
638 3300025938 Ga0207704_10005358 Ga0207704_100053585 307
639 3300025940 Ga0207691_10000011 Ga0207691_1000001150 307
640 3300025940 Ga0207691_10026368 Ga0207691_100263684 307
641 3300025940 Ga0207691_10215423 Ga0207691_102154232 307
642 3300025941 Ga0207711_10000230 Ga0207711_1000023030 307
643 3300025941 Ga0207711_10336764 Ga0207711_103367642 307
644 3300025942 Ga0207689_10000011 Ga0207689_1000001176 307
645 3300025942 Ga0207689_10034495 Ga0207689_100344952 307
646 3300025944 Ga0207661_10030250 Ga0207661_100302504 307
647 3300025945 Ga0207679_10000300 Ga0207679_100003006 307
648 3300025945 Ga0207679_10117271 Ga0207679_101172712 307
649 3300025945 Ga0207679_10473913 Ga0207679_104739132 307
650 3300025949 Ga0207667_10076268 Ga0207667_100762683 307
651 3300025961 Ga0207712_10033305 Ga0207712_100333053 307
652 3300025972 Ga0207668_10026173 Ga0207668_100261732 307
653 3300025981 Ga0207640_10005770 Ga0207640_100057704 307
654 3300025986 Ga0207658_10004693 Ga0207658_100046939 307
655 3300026023 Ga0207677_10017141 Ga0207677_100171413 307
656 3300026035 Ga0207703_10000850 Ga0207703_1000085025 307
657 3300026067 Ga0207678_10011293 Ga0207678_100112937 307
658 3300026088 Ga0207641_10020080 Ga0207641_100200804 307
659 3300026088 Ga0207641_10302803 Ga0207641_103028032 307
660 3300026089 Ga0207648_10000258 Ga0207648_1000025837 307
661 3300026089 Ga0207648_10013661 Ga0207648_100136617 307
662 3300026089 Ga0207648_10021296 Ga0207648_100212964 307
663 3300026095 Ga0207676_10013714 Ga0207676_100137144 307
664 3300026095 Ga0207676_10029863 Ga0207676_100298632 307
665 3300026095 Ga0207676_10050627 Ga0207676_100506272 307
666 3300026116 Ga0207674_10001878 Ga0207674_1000187823 307
667 3300026116 Ga0207674_10077619 Ga0207674_100776193 307
668 3300026118 Ga0207675_100000164 Ga0207675_10000016438 307
669 3300026118 Ga0207675_100009234 Ga0207675_1000092348 307
670 3300026121 Ga0207683_10001556 Ga0207683_1000155617 307
671 3300026121 Ga0207683_10105638 Ga0207683_101056382 307
672 3300027671 Ga0209588_1012847 Ga0209588_10128472 307
673 3300028379 Ga0268266_10000550 Ga0268266_100005509 307
674 3300028380 Ga0268265_10000749 Ga0268265_100007493 307
675 3300028381 Ga0268264_10004697 Ga0268264_100046973 307
676 3300031344 Ga0265316_10085797 Ga0265316_100857972 307
677 3300031712 Ga0265342_10062934 Ga0265342_100629342 307
678 3300035116 Ga0373945_0000695 Ga0373945_0000695_1973_2899 307
679 3300035118 Ga0373954_0009734 Ga0373954_0009734_2138_3064 307
680 3300035121 Ga0373960_0027371 Ga0373960_0027371_123_1052 307
681 3300035171 Ga0373946_0001403 Ga0373946_0001403_4329_5255 307
682 3300035172 Ga0373955_0000419 Ga0373955_0000419_9197_10123 307
683 3300035410 Ga0373924_0000402 Ga0373924_0000402_6239_7165 307
684 3300035692 Ga0373935_0000012 Ga0373935_0000012_49974_50900 307
685 3300035695 Ga0373927_0006963 Ga0373927_0006963_4354_5280 307
686 3300035724 Ga0373933_0030144 Ga0373933_0030144_2055_2981 307
687 3300035725 Ga0373947_0014053 Ga0373947_0014053_747_1673 307
688 3300036401 Ga0373937_0000054 Ga0373937_0000054_16753_17679 307
689 3300037068 Ga0373925_0000018 Ga0373925_0000018_116539_117465 307
690 3300037312 Ga0395899_0025638 Ga0395899_0025638_2547_3491 307
691 3300037418 Ga0395900_0000389 Ga0395900_0000389_4795_5739 307
692 3300037466 Ga0395898_0000866 Ga0395898_0000866_9580_10524 307
693 3300037466 Ga0395898_0001457 Ga0395898_0001457_31998_32921 307
694 3300037466 Ga0395898_0083798 Ga0395898_0083798_1012_1941 307
695 3300037471 Ga0395905_0028187 Ga0395905_0028187_1406_2335 307
696 3300038443 Ga0395901_0000164 Ga0395901_0000164_23762_24706 307
697 3300039450 Ga0436363_0214172 Ga0436363_0214172_751_1680 307
698 3300046454 Ga0495592_0000001 Ga0495592_0000001_90933_91859 307
699 3300046459 Ga0495629_0006898 Ga0495629_0006898_3428_4354 307
700 3300046462 Ga0495651_0035538 Ga0495651_0035538_59_985 307
701 3300046463 Ga0495653_0000292 Ga0495653_0000292_24758_25684 307
702 3300046476 Ga0495662_0002781 Ga0495662_0002781_1406_2332 307
703 3300046477 Ga0495664_0000001 Ga0495664_0000001_224502_225428 307
704 3300046511 Ga0495608_0000050 Ga0495608_0000050_49238_50164 307
705 3300046514 Ga0495618_0000045 Ga0495618_0000045_62625_63551 307
706 3300046516 Ga0495628_0000003 Ga0495628_0000003_55559_56485 307
707 3300046517 Ga0495630_0002190 Ga0495630_0002190_9529_10455 307
708 3300046529 Ga0495652_0000001 Ga0495652_0000001_601737_602663 307
709 3300046531 Ga0495665_0037429 Ga0495665_0037429_1617_2543 307
710 3300046533 Ga0495640_0000006 Ga0495640_0000006_49373_50299 307
711 3300046536 Ga0495587_0000028 Ga0495587_0000028_108350_109276 307
712 3300046543 Ga0495645_0000004 Ga0495645_0000004_118008_118934 307
713 3300046559 Ga0495667_0000001 Ga0495667_0000001_441705_442631 307
714 3300046642 Ga0495634_0000531 Ga0495634_0000531_24508_25434 307
715 3300046663 Ga0495635_0000007 Ga0495635_0000007_249036_249962 307
716 3300046675 Ga0495657_0000136 Ga0495657_0000136_55551_56477 307
717 3300046678 Ga0495599_0000002 Ga0495599_0000002_316088_317014 307
718 3300046679 Ga0495623_0000052 Ga0495623_0000052_24735_25661 307
719 3300046680 Ga0495646_0000036 Ga0495646_0000036_55674_56600 307
720 3300046683 Ga0495658_0064581 Ga0495658_0064581_472_1401 307
721 3300046809 Ga0495600_0000037 Ga0495600_0000037_24567_25493 307
722 3300047315 Ga0495581_0002869 Ga0495581_0002869_8039_8965 307
723 3300047317 Ga0495604_0000594 Ga0495604_0000594_76_1002 307
724 3300047319 Ga0495674_0000001 Ga0495674_0000001_424439_425365 307
725 3300047321 Ga0495676_0142937 Ga0495676_0142937_363_1289 307
726 3300047322 Ga0495680_0000705 Ga0495680_0000705_27366_28292 307
727 3300047444 Ga0495675_0000049 Ga0495675_0000049_55445_56371 307
728 3300047471 Ga0495684_0000046 Ga0495684_0000046_74602_75528 307
729 3300048088 Ga0495602_0000102 Ga0495602_0000102_55596_56522 307
730 3300048904 Ga0496101_0100620 Ga0496101_0100620_288_1217 307
731 3300048905 Ga0496102_0531635 Ga0496102_0531635_112_1041 307
732 3300048909 Ga0496106_0150080 Ga0496106_0150080_217_1146 307
733 3300048909 Ga0496106_0242130 Ga0496106_0242130_184_1113 307
734 3300048911 Ga0496108_0024111 Ga0496108_0024111_1256_2185 307
735 3300048911 Ga0496108_0039692 Ga0496108_0039692_2746_3675 307
736 3300048913 Ga0496110_0015032 Ga0496110_0015032_4972_5901 307
737 3300048915 Ga0496112_0420521 Ga0496112_0420521_184_1113 307
738 3300048916 Ga0496113_0041021 Ga0496113_0041021_2043_2972 307
739 3300048916 Ga0496113_0088028 Ga0496113_0088028_389_1312 307
740 3300048917 Ga0496114_0054788 Ga0496114_0054788_1192_2121 307
741 3300049575 Ga0501039_0340485 Ga0501039_0340485_163_1095 307
742 3300050493 nmdc:mga0k408_79882_c1 nmdc:mga0k408_79882_c1_685_1620 307
743 3300050496 nmdc:mga07m45_31195_c1 nmdc:mga07m45_31195_c1_321_1256 307
744 3300050507 nmdc:mga05p37_123415_c1 nmdc:mga05p37_123415_c1_1518_2444 307
745 3300050508 nmdc:mga09592_388436_c1 nmdc:mga09592_388436_c1_44_973 307
746 3300050511 nmdc:mga08y16_493840_c1 nmdc:mga08y16_493840_c1_300_1229 307
747 3300050512 nmdc:mga0n895_39571_c1 nmdc:mga0n895_39571_c1_2276_3205 307
748 3300050513 nmdc:mga0rr50_39952_c1 nmdc:mga0rr50_39952_c1_1477_2406 307
749 3300050514 nmdc:mga08x19_121910_c1 nmdc:mga08x19_121910_c1_163_1098 307
750 3300050515 nmdc:mga0a205_449204_c1 nmdc:mga0a205_449204_c1_182_1111 307
751 3300053077 Ga0495601_0000006 Ga0495601_0000006_264489_265415 307
752 3300053078 Ga0495612_0000004 Ga0495612_0000004_49245_50171 307
753 3300053084 Ga0495595_0000227 Ga0495595_0000227_9544_10470 307
754 3300053085 Ga0495619_0000027 Ga0495619_0000027_55747_56673 307
755 3300053153 Ga0500616_0044293 Ga0500616_0044293_754_1683 307
756 3300053158 Ga0500627_0044783 Ga0500627_0044783_147_1079 307
757 3300061734 Ga0530510_0225458 Ga0530510_0225458_422_1348 307
758 iso_pu_bacteria 2894232714 2894242454 307
759 iso_pu_bacteria 2919450847 2919451291 307
760 3300001989 JGI24739J22299_10028424 JGI24739J22299_100284242 308
761 3300005328 Ga0070676_10008584 Ga0070676_100085844 308
762 3300005330 Ga0070690_100296131 Ga0070690_1002961311 308
763 3300005331 Ga0070670_100006059 Ga0070670_1000060596 308
764 3300005331 Ga0070670_100140243 Ga0070670_1001402432 308
765 3300005334 Ga0068869_100011107 Ga0068869_1000111072 308
766 3300005334 Ga0068869_100206943 Ga0068869_1002069432 308
767 3300005335 Ga0070666_10062716 Ga0070666_100627162 308
768 3300005339 Ga0070660_100000543 Ga0070660_10000054323 308
769 3300005340 Ga0070689_100078549 Ga0070689_1000785493 308
770 3300005340 Ga0070689_100123802 Ga0070689_1001238022 308
771 3300005340 Ga0070689_100137868 Ga0070689_1001378681 308
772 3300005347 Ga0070668_100014046 Ga0070668_1000140462 308
773 3300005354 Ga0070675_100360531 Ga0070675_1003605311 308
774 3300005355 Ga0070671_100389869 Ga0070671_1003898691 308
775 3300005364 Ga0070673_100090746 Ga0070673_1000907462 308
776 3300005367 Ga0070667_100213145 Ga0070667_1002131452 308
777 3300005439 Ga0070711_100287592 Ga0070711_1002875921 308
778 3300005457 Ga0070662_100032526 Ga0070662_1000325262 308
779 3300005459 Ga0068867_100008573 Ga0068867_1000085734 308
780 3300005535 Ga0070684_100127448 Ga0070684_1001274482 308
781 3300005543 Ga0070672_100121135 Ga0070672_1001211352 308
782 3300005547 Ga0070693_100063136 Ga0070693_1000631362 308
783 3300005549 Ga0070704_100283793 Ga0070704_1002837931 308
784 3300005563 Ga0068855_100307027 Ga0068855_1003070272 308
785 3300005564 Ga0070664_100294447 Ga0070664_1002944472 308
786 3300005616 Ga0068852_100030886 Ga0068852_1000308866 308
787 3300005617 Ga0068859_100002139 Ga0068859_1000021395 308
788 3300005617 Ga0068859_100018324 Ga0068859_1000183244 308
789 3300005617 Ga0068859_100638845 Ga0068859_1006388452 308
790 3300005618 Ga0068864_100006069 Ga0068864_1000060697 308
791 3300005618 Ga0068864_100392529 Ga0068864_1003925292 308
792 3300005718 Ga0068866_10187261 Ga0068866_101872612 308
793 3300005719 Ga0068861_100002152 Ga0068861_1000021524 308
794 3300005840 Ga0068870_10006157 Ga0068870_100061575 308
795 3300005841 Ga0068863_100013426 Ga0068863_1000134265 308
796 3300005842 Ga0068858_100002197 Ga0068858_1000021974 308
797 3300005844 Ga0068862_100011560 Ga0068862_1000115602 308
798 3300005983 Ga0081540_1036346 Ga0081540_10363462 308
799 3300006175 Ga0070712_100147977 Ga0070712_1001479772 308
800 3300006178 Ga0075367_10016320 Ga0075367_100163204 308
801 3300006178 Ga0075367_10088950 Ga0075367_100889501 308
802 3300006178 Ga0075367_10111869 Ga0075367_101118692 308
803 3300006195 Ga0075366_10014408 Ga0075366_100144084 308
804 3300006353 Ga0075370_10051596 Ga0075370_100515962 308
805 3300006844 Ga0075428_100047877 Ga0075428_1000478773 308
806 3300006846 Ga0075430_100000342 Ga0075430_10000034236 308
807 3300006847 Ga0075431_100238113 Ga0075431_1002381132 308
808 3300006852 Ga0075433_10048652 Ga0075433_100486522 308
809 3300006871 Ga0075434_100029592 Ga0075434_1000295926 308
810 3300006931 Ga0097620_100002139 Ga0097620_1000021395 308
811 3300006931 Ga0097620_100018325 Ga0097620_1000183254 308
812 3300006931 Ga0097620_100638887 Ga0097620_1006388872 308
813 3300009093 Ga0105240_10010891 Ga0105240_1001089114 308
814 3300009093 Ga0105240_10121696 Ga0105240_101216963 308
815 3300009093 Ga0105240_10532950 Ga0105240_105329502 308
816 3300009148 Ga0105243_10253695 Ga0105243_102536952 308
817 3300009174 Ga0105241_10037591 Ga0105241_100375911 308
818 3300009174 Ga0105241_10043563 Ga0105241_100435633 308
819 3300009177 Ga0105248_10257977 Ga0105248_102579772 308
820 3300009177 Ga0105248_10291505 Ga0105248_102915052 308
821 3300009545 Ga0105237_10001564 Ga0105237_1000156432 308
822 3300009545 Ga0105237_10060613 Ga0105237_100606133 308
823 3300009545 Ga0105237_10339578 Ga0105237_103395782 308
824 3300009545 Ga0105237_10452190 Ga0105237_104521901 308
825 3300010159 Ga0099796_10047501 Ga0099796_100475012 308
826 3300010375 Ga0105239_10045801 Ga0105239_100458013 308
827 3300010375 Ga0105239_10629240 Ga0105239_106292402 308
828 3300013100 Ga0157373_10010027 Ga0157373_100100276 308
829 3300013104 Ga0157370_10001115 Ga0157370_1000111528 308
830 3300013105 Ga0157369_10093663 Ga0157369_100936632 308
831 3300013105 Ga0157369_10235643 Ga0157369_102356432 308
832 3300013296 Ga0157374_10000108 Ga0157374_1000010821 308
833 3300013306 Ga0163162_10493455 Ga0163162_104934552 308
834 3300014325 Ga0163163_10022304 Ga0163163_100223043 308
835 3300014326 Ga0157380_10408779 Ga0157380_104087792 308
836 3300014497 Ga0182008_10020985 Ga0182008_100209853 308
837 3300014968 Ga0157379_10001196 Ga0157379_1000119613 308
838 3300021361 Ga0213872_10002352 Ga0213872_100023528 308
839 3300025256 Ga0209759_1005376 Ga0209759_10053762 308
840 3300025297 Ga0209758_1000128 Ga0209758_1000128212 308
841 3300025302 Ga0207426_1020373 Ga0207426_10203732 308
842 3300025901 Ga0207688_10051688 Ga0207688_100516882 308
843 3300025904 Ga0207647_10000318 Ga0207647_1000031820 308
844 3300025904 Ga0207647_10052353 Ga0207647_100523532 308
845 3300025907 Ga0207645_10015487 Ga0207645_100154873 308
846 3300025907 Ga0207645_10149818 Ga0207645_101498182 308
847 3300025908 Ga0207643_10045726 Ga0207643_100457262 308
848 3300025913 Ga0207695_10000029 Ga0207695_1000002990 308
849 3300025913 Ga0207695_10002415 Ga0207695_100024152 308
850 3300025914 Ga0207671_10037291 Ga0207671_100372913 308
851 3300025915 Ga0207693_10019775 Ga0207693_100197752 308
852 3300025918 Ga0207662_10063779 Ga0207662_100637792 308
853 3300025919 Ga0207657_10001190 Ga0207657_1000119018 308
854 3300025925 Ga0207650_10016066 Ga0207650_100160666 308
855 3300025925 Ga0207650_10401372 Ga0207650_104013721 308
856 3300025933 Ga0207706_10013242 Ga0207706_100132423 308
857 3300025935 Ga0207709_10039422 Ga0207709_100394222 308
858 3300025936 Ga0207670_10109699 Ga0207670_101096992 308
859 3300025937 Ga0207669_10010902 Ga0207669_100109023 308
860 3300025937 Ga0207669_10087120 Ga0207669_100871202 308
861 3300025940 Ga0207691_10026536 Ga0207691_100265366 308
862 3300025940 Ga0207691_10136406 Ga0207691_101364062 308
863 3300025941 Ga0207711_10182248 Ga0207711_101822482 308
864 3300025942 Ga0207689_10003591 Ga0207689_100035915 308
865 3300025945 Ga0207679_10421203 Ga0207679_104212032 308
866 3300025949 Ga0207667_10029754 Ga0207667_100297544 308
867 3300025949 Ga0207667_10254925 Ga0207667_102549252 308
868 3300025972 Ga0207668_10019200 Ga0207668_100192002 308
869 3300025986 Ga0207658_10008154 Ga0207658_100081545 308
870 3300025986 Ga0207658_10118036 Ga0207658_101180361 308
871 3300026023 Ga0207677_10298753 Ga0207677_102987532 308
872 3300026035 Ga0207703_10001380 Ga0207703_100013807 308
873 3300026067 Ga0207678_10160109 Ga0207678_101601092 308
874 3300026088 Ga0207641_10003139 Ga0207641_100031395 308
875 3300026089 Ga0207648_10013008 Ga0207648_100130083 308
876 3300026095 Ga0207676_10004531 Ga0207676_100045317 308
877 3300026095 Ga0207676_10071457 Ga0207676_100714572 308
878 3300026095 Ga0207676_10109448 Ga0207676_101094482 308
879 3300026116 Ga0207674_10026074 Ga0207674_100260742 308
880 3300026116 Ga0207674_10040706 Ga0207674_100407063 308
881 3300026118 Ga0207675_100009286 Ga0207675_1000092864 308
882 3300026121 Ga0207683_10017934 Ga0207683_100179343 308
883 3300027907 Ga0207428_10058246 Ga0207428_100582462 308
884 3300028380 Ga0268265_10007616 Ga0268265_100076164 308
885 3300028381 Ga0268264_10015913 Ga0268264_100159133 308
886 3300028381 Ga0268264_10325472 Ga0268264_103254722 308
887 3300031241 Ga0265325_10000522 Ga0265325_100005223 308
888 3300031247 Ga0265340_10024453 Ga0265340_100244532 308
889 3300031456 Ga0307513_10067426 Ga0307513_100674263 308
890 3300031911 Ga0307412_10000002 Ga0307412_10000002291 308
891 3300035241 Ga0373961_0023826 Ga0373961_0023826_171_1103 308
892 3300035692 Ga0373935_0346345 Ga0373935_0346345_27_956 308
893 3300035695 Ga0373927_0145711 Ga0373927_0145711_29_964 308
894 3300035724 Ga0373933_0177674 Ga0373933_0177674_86_1018 308
895 3300035725 Ga0373947_0019098 Ga0373947_0019098_2289_3236 308
896 3300037068 Ga0373925_0075207 Ga0373925_0075207_156_1121 308
897 3300037418 Ga0395900_0032651 Ga0395900_0032651_4246_5220 308
898 3300037466 Ga0395898_0421298 Ga0395898_0421298_268_1242 308
899 3300037471 Ga0395905_0019296 Ga0395905_0019296_1501_2433 308
900 3300038443 Ga0395901_0267977 Ga0395901_0267977_439_1371 308
901 3300039447 Ga0436361_0314886 Ga0436361_0314886_8411_9409 308
902 3300041408 Ga0439453_0005714 Ga0439453_0005714_33_959 308
903 3300042003 Ga0439443_014105 Ga0439443_014105_25_951 308
904 3300042436 Ga0439435_0007908 Ga0439435_0007908_1249_2175 308
905 3300045049 Ga0466959_0012108 Ga0466959_0012108_605_1567 308
906 3300046460 Ga0495638_0041377 Ga0495638_0041377_1537_2478 308
907 3300046463 Ga0495653_0016343 Ga0495653_0016343_1804_2748 308
908 3300046472 Ga0495580_0005632 Ga0495580_0005632_3807_4760 308
909 3300046473 Ga0495582_0075516 Ga0495582_0075516_197_1141 308
910 3300046477 Ga0495664_0011414 Ga0495664_0011414_2799_3743 308
911 3300046491 Ga0495584_0020427 Ga0495584_0020427_2068_3000 308
912 3300046507 Ga0495606_0064301 Ga0495606_0064301_1113_2057 308
913 3300046507 Ga0495606_0071298 Ga0495606_0071298_399_1343 308
914 3300046507 Ga0495606_0105552 Ga0495606_0105552_690_1634 308
915 3300046516 Ga0495628_0014251 Ga0495628_0014251_3971_4915 308
916 3300046517 Ga0495630_0427415 Ga0495630_0427415_25_957 308
917 3300046522 Ga0495643_0157266 Ga0495643_0157266_50_982 308
918 3300046529 Ga0495652_0030624 Ga0495652_0030624_2623_3567 308
919 3300046531 Ga0495665_0000583 Ga0495665_0000583_11519_12463 308
920 3300046557 Ga0495622_0000115 Ga0495622_0000115_52462_53406 308
921 3300046678 Ga0495599_0109613 Ga0495599_0109613_217_1161 308
922 3300046680 Ga0495646_0008853 Ga0495646_0008853_4487_5431 308
923 3300046690 Ga0495624_0007027 Ga0495624_0007027_6236_7180 308
924 3300046690 Ga0495624_0096582 Ga0495624_0096582_23_967 308
925 3300046794 Ga0495589_0019321 Ga0495589_0019321_1295_2239 308
926 3300046809 Ga0495600_0084137 Ga0495600_0084137_435_1379 308
927 3300047317 Ga0495604_0004128 Ga0495604_0004128_6175_7119 308
928 3300047319 Ga0495674_0016647 Ga0495674_0016647_4774_5718 308
929 3300047320 Ga0495672_0084107 Ga0495672_0084107_133_1077 308
930 3300047323 Ga0495683_0062382 Ga0495683_0062382_142_1086 308
931 3300047673 Ga0495593_0024062 Ga0495593_0024062_254_1198 308
932 3300048088 Ga0495602_0010823 Ga0495602_0010823_6198_7142 308
933 3300048091 Ga0495626_0016841 Ga0495626_0016841_825_1769 308
934 3300048905 Ga0496102_0014038 Ga0496102_0014038_4347_5294 308
935 3300048905 Ga0496102_0055267 Ga0496102_0055267_625_1569 308
936 3300048906 Ga0496103_0035118 Ga0496103_0035118_1630_2577 308
937 3300048906 Ga0496103_0063892 Ga0496103_0063892_357_1301 308
938 3300048910 Ga0496107_0259055 Ga0496107_0259055_305_1237 308
939 3300048912 Ga0496109_0058639 Ga0496109_0058639_1116_2063 308
940 3300048914 Ga0496111_0156701 Ga0496111_0156701_229_1161 308
941 3300048920 Ga0496117_0002759 Ga0496117_0002759_15437_16381 308
942 3300048920 Ga0496117_0003345 Ga0496117_0003345_2824_3768 308
943 3300048921 Ga0496118_0000167 Ga0496118_0000167_4410_5354 308
944 3300048921 Ga0496118_0006187 Ga0496118_0006187_1526_2470 308
945 3300048929 Ga0496126_0107255 Ga0496126_0107255_664_1596 308
946 3300049568 Ga0501031_0026704 Ga0501031_0026704_2595_3536 308
947 3300049568 Ga0501031_0038563 Ga0501031_0038563_1778_2710 308
948 3300049569 Ga0501032_0025720 Ga0501032_0025720_2675_3616 308
949 3300049569 Ga0501032_0077655 Ga0501032_0077655_762_1694 308
950 3300049570 Ga0501033_0049360 Ga0501033_0049360_286_1218 308
951 3300049570 Ga0501033_0089252 Ga0501033_0089252_675_1607 308
952 3300049570 Ga0501033_0099591 Ga0501033_0099591_932_1864 308
953 3300049570 Ga0501033_0140685 Ga0501033_0140685_712_1653 308
954 3300049571 Ga0501034_0190130 Ga0501034_0190130_961_1893 308
955 3300049572 Ga0501036_0236687 Ga0501036_0236687_342_1274 308
956 3300049573 Ga0501037_0000457 Ga0501037_0000457_22657_23598 308
957 3300049573 Ga0501037_0021125 Ga0501037_0021125_313_1245 308
958 3300049574 Ga0501038_0037679 Ga0501038_0037679_616_1557 308
959 3300049574 Ga0501038_0247237 Ga0501038_0247237_441_1373 308
960 3300049574 Ga0501038_0276942 Ga0501038_0276942_236_1168 308
961 3300049575 Ga0501039_0043689 Ga0501039_0043689_2064_2996 308
962 3300049575 Ga0501039_0069713 Ga0501039_0069713_705_1679 308
963 3300049578 Ga0501042_0268637 Ga0501042_0268637_273_1205 308
964 3300049579 Ga0501043_0013674 Ga0501043_0013674_1292_2233 308
965 3300049579 Ga0501043_0023144 Ga0501043_0023144_2981_3913 308
966 3300049580 Ga0501046_0039003 Ga0501046_0039003_982_1914 308
967 3300049582 Ga0501048_0116623 Ga0501048_0116623_571_1503 308
968 3300049584 Ga0501068_0005463 Ga0501068_0005463_384_1316 308
969 3300049585 Ga0501069_0153176 Ga0501069_0153176_197_1129 308
970 3300049586 Ga0501070_0062631 Ga0501070_0062631_110_1042 308
971 3300049586 Ga0501070_0072607 Ga0501070_0072607_735_1667 308
972 3300049588 Ga0501072_0002741 Ga0501072_0002741_7901_8833 308
973 3300049590 Ga0501074_0038162 Ga0501074_0038162_789_1721 308
974 3300049591 Ga0501075_0133836 Ga0501075_0133836_397_1329 308
975 3300049592 Ga0501076_0024692 Ga0501076_0024692_666_1598 308
976 3300049592 Ga0501076_0136652 Ga0501076_0136652_214_1146 308
977 3300049593 Ga0501077_0008515 Ga0501077_0008515_3968_4900 308
978 3300049593 Ga0501077_0260391 Ga0501077_0260391_126_1070 308
979 3300049741 Ga0501079_0018682 Ga0501079_0018682_1093_2025 308
980 3300049741 Ga0501079_0056423 Ga0501079_0056423_1038_1979 308
981 3300049742 Ga0501080_0151340 Ga0501080_0151340_727_1659 308
982 3300049742 Ga0501080_0191651 Ga0501080_0191651_693_1625 308
983 3300049743 Ga0501081_0007100 Ga0501081_0007100_6192_7124 308
984 3300049744 Ga0501083_0112825 Ga0501083_0112825_247_1185 308
985 3300049822 Ga0501035_0050558 Ga0501035_0050558_899_1831 308
986 3300049823 Ga0501044_0000782 Ga0501044_0000782_22689_23621 308
987 3300049823 Ga0501044_0018710 Ga0501044_0018710_2000_2932 308
988 3300049823 Ga0501044_0074055 Ga0501044_0074055_1903_2835 308
989 3300049823 Ga0501044_0229971 Ga0501044_0229971_535_1467 308
990 3300049824 Ga0501045_0135882 Ga0501045_0135882_618_1550 308
991 3300050489 nmdc:mga03683_54584_c1 nmdc:mga03683_54584_c1_660_1592 308
992 3300050491 nmdc:mga00v17_49678_c1 nmdc:mga00v17_49678_c1_1181_2113 308
993 3300050491 nmdc:mga00v17_96633_c1 nmdc:mga00v17_96633_c1_568_1539 308
994 3300050493 nmdc:mga0k408_45156_c1 nmdc:mga0k408_45156_c1_439_1377 308
995 3300050494 nmdc:mga06z11_242936_c1 nmdc:mga06z11_242936_c1_93_1025 308
996 3300050494 nmdc:mga06z11_34895_c1 nmdc:mga06z11_34895_c1_1415_2347 308
997 3300050509 nmdc:mga0qj67_340273_c1 nmdc:mga0qj67_340273_c1_246_1172 308
998 3300050510 nmdc:mga06r32_160077_c1 nmdc:mga06r32_160077_c1_626_1564 308
999 3300050511 nmdc:mga08y16_49490_c1 nmdc:mga08y16_49490_c1_1403_2338 308
1000 3300050512 nmdc:mga0n895_26544_c1 nmdc:mga0n895_26544_c1_3071_4006 308
1001 3300050515 nmdc:mga0a205_24863_c1 nmdc:mga0a205_24863_c1_932_1867 308
1002 3300053083 Ga0495655_0050389 Ga0495655_0050389_13_942 308
1003 3300053087 Ga0500643_000641 Ga0500643_000641_17589_18515 308
1004 3300053087 Ga0500643_005110 Ga0500643_005110_2448_3374 308
1005 3300053096 Ga0500641_0030745 Ga0500641_0030745_150_1091 308
1006 3300053108 Ga0500562_044939 Ga0500562_044939_170_1114 308
1007 3300054114 Ga0501084_0012125 Ga0501084_0012125_1581_2513 308
1008 3300054114 Ga0501084_0077123 Ga0501084_0077123_1047_2021 308
1009 3300054114 Ga0501084_0264800 Ga0501084_0264800_388_1326 308
1010 3300060353 Ga0501082_0166557 Ga0501082_0166557_206_1195 308
1011 3300061734 Ga0530510_0103047 Ga0530510_0103047_172_1104 308
1012 3300001915 JGI24741J21665_1000078 JGI24741J21665_10000789 309
1013 3300001979 JGI24740J21852_10000286 JGI24740J21852_100002863 309
1014 3300002705 JGI25156J39149_1005916 JGI25156J39149_10059162 309
1015 3300003751 Ga0055538_1001492 Ga0055538_10014925 309
1016 3300003751 Ga0055538_1002447 Ga0055538_10024473 309
1017 3300003752 Ga0055539_1000056 Ga0055539_10000563 309
1018 3300003756 Ga0055533_1003980 Ga0055533_10039803 309
1019 3300003756 Ga0055533_1006709 Ga0055533_10067092 309
1020 3300003758 Ga0055532_1000111 Ga0055532_100011176 309
1021 3300003759 Ga0055525_1000788 Ga0055525_10007883 309
1022 3300003761 Ga0055535_1000114 Ga0055535_100011476 309
1023 3300003763 Ga0055529_1000179 Ga0055529_100017976 309
1024 3300003841 Ga0055541_1003990 Ga0055541_10039903 309
1025 3300005295 Ga0065707_10160781 Ga0065707_101607811 309
1026 3300005330 Ga0070690_100050277 Ga0070690_1000502773 309
1027 3300005334 Ga0068869_100215429 Ga0068869_1002154291 309
1028 3300005337 Ga0070682_100007032 Ga0070682_1000070326 309
1029 3300005337 Ga0070682_100109705 Ga0070682_1001097052 309
1030 3300005341 Ga0070691_10033949 Ga0070691_100339492 309
1031 3300005343 Ga0070687_100024082 Ga0070687_1000240822 309
1032 3300005344 Ga0070661_100000173 Ga0070661_10000017326 309
1033 3300005344 Ga0070661_100003018 Ga0070661_1000030188 309
1034 3300005347 Ga0070668_100006225 Ga0070668_1000062258 309
1035 3300005347 Ga0070668_100031170 Ga0070668_1000311702 309
1036 3300005347 Ga0070668_100070088 Ga0070668_1000700882 309
1037 3300005353 Ga0070669_100032151 Ga0070669_1000321515 309
1038 3300005353 Ga0070669_100041697 Ga0070669_1000416972 309
1039 3300005354 Ga0070675_100036997 Ga0070675_1000369973 309
1040 3300005354 Ga0070675_100058675 Ga0070675_1000586752 309
1041 3300005354 Ga0070675_100076300 Ga0070675_1000763001 309
1042 3300005356 Ga0070674_100002607 Ga0070674_1000026076 309
1043 3300005356 Ga0070674_100147287 Ga0070674_1001472872 309
1044 3300005364 Ga0070673_100000665 Ga0070673_1000006658 309
1045 3300005364 Ga0070673_100064059 Ga0070673_1000640592 309
1046 3300005365 Ga0070688_100025047 Ga0070688_1000250472 309
1047 3300005366 Ga0070659_100002948 Ga0070659_1000029488 309
1048 3300005367 Ga0070667_100504026 Ga0070667_1005040261 309
1049 3300005434 Ga0070709_10001787 Ga0070709_1000178710 309
1050 3300005435 Ga0070714_100025805 Ga0070714_1000258056 309
1051 3300005436 Ga0070713_100220835 Ga0070713_1002208352 309
1052 3300005436 Ga0070713_100330564 Ga0070713_1003305642 309
1053 3300005437 Ga0070710_10022175 Ga0070710_100221754 309
1054 3300005438 Ga0070701_10009176 Ga0070701_100091765 309
1055 3300005439 Ga0070711_100001062 Ga0070711_1000010626 309
1056 3300005440 Ga0070705_100003865 Ga0070705_1000038652 309
1057 3300005441 Ga0070700_100376077 Ga0070700_1003760771 309
1058 3300005444 Ga0070694_100000649 Ga0070694_1000006495 309
1059 3300005444 Ga0070694_100047299 Ga0070694_1000472992 309
1060 3300005455 Ga0070663_100000021 Ga0070663_10000002125 309
1061 3300005457 Ga0070662_100002178 Ga0070662_1000021788 309
1062 3300005459 Ga0068867_100103397 Ga0068867_1001033971 309
1063 3300005459 Ga0068867_100200676 Ga0068867_1002006762 309
1064 3300005530 Ga0070679_100086334 Ga0070679_1000863343 309
1065 3300005536 Ga0070697_100191576 Ga0070697_1001915762 309
1066 3300005539 Ga0068853_100194550 Ga0068853_1001945502 309
1067 3300005543 Ga0070672_100086203 Ga0070672_1000862033 309
1068 3300005545 Ga0070695_100001734 Ga0070695_1000017344 309
1069 3300005545 Ga0070695_100008191 Ga0070695_1000081912 309
1070 3300005546 Ga0070696_100001310 Ga0070696_1000013109 309
1071 3300005547 Ga0070693_100002021 Ga0070693_1000020215 309
1072 3300005548 Ga0070665_100622941 Ga0070665_1006229411 309
1073 3300005549 Ga0070704_100065953 Ga0070704_1000659533 309
1074 3300005563 Ga0068855_100093856 Ga0068855_1000938564 309
1075 3300005563 Ga0068855_100409977 Ga0068855_1004099772 309
1076 3300005564 Ga0070664_100000021 Ga0070664_10000002125 309
1077 3300005564 Ga0070664_100008621 Ga0070664_1000086216 309
1078 3300005577 Ga0068857_100005420 Ga0068857_1000054202 309
1079 3300005577 Ga0068857_100036924 Ga0068857_1000369245 309
1080 3300005578 Ga0068854_100000011 Ga0068854_10000001135 309
1081 3300005578 Ga0068854_100003863 Ga0068854_1000038638 309
1082 3300005614 Ga0068856_100000645 Ga0068856_10000064526 309
1083 3300005616 Ga0068852_100036124 Ga0068852_1000361244 309
1084 3300005616 Ga0068852_100051059 Ga0068852_1000510594 309
1085 3300005617 Ga0068859_100012949 Ga0068859_1000129494 309
1086 3300005617 Ga0068859_100030307 Ga0068859_1000303072 309
1087 3300005618 Ga0068864_100004366 Ga0068864_1000043668 309
1088 3300005718 Ga0068866_10026345 Ga0068866_100263452 309
1089 3300005719 Ga0068861_100003021 Ga0068861_1000030213 309
1090 3300005719 Ga0068861_100285928 Ga0068861_1002859282 309
1091 3300005841 Ga0068863_100026988 Ga0068863_1000269884 309
1092 3300005841 Ga0068863_100053159 Ga0068863_1000531594 309
1093 3300005842 Ga0068858_100014113 Ga0068858_1000141136 309
1094 3300005842 Ga0068858_100041756 Ga0068858_1000417563 309
1095 3300005842 Ga0068858_100308801 Ga0068858_1003088012 309
1096 3300005843 Ga0068860_100029109 Ga0068860_1000291095 309
1097 3300005843 Ga0068860_100293748 Ga0068860_1002937482 309
1098 3300005844 Ga0068862_100005032 Ga0068862_1000050323 309
1099 3300005844 Ga0068862_100260433 Ga0068862_1002604332 309
1100 3300005937 Ga0081455_10000678 Ga0081455_1000067826 309
1101 3300005937 Ga0081455_10003638 Ga0081455_1000363814 309
1102 3300005937 Ga0081455_10116121 Ga0081455_101161212 309
1103 3300006028 Ga0070717_10449823 Ga0070717_104498232 309
1104 3300006042 Ga0075368_10018336 Ga0075368_100183362 309
1105 3300006042 Ga0075368_10042087 Ga0075368_100420872 309
1106 3300006051 Ga0075364_10054632 Ga0075364_100546323 309
1107 3300006051 Ga0075364_10057771 Ga0075364_100577712 309
1108 3300006051 Ga0075364_10258432 Ga0075364_102584322 309
1109 3300006163 Ga0070715_10000506 Ga0070715_100005069 309
1110 3300006173 Ga0070716_100006056 Ga0070716_1000060565 309
1111 3300006175 Ga0070712_100002932 Ga0070712_1000029328 309
1112 3300006178 Ga0075367_10000448 Ga0075367_1000044811 309
1113 3300006178 Ga0075367_10002073 Ga0075367_1000207310 309
1114 3300006195 Ga0075366_10009106 Ga0075366_100091065 309
1115 3300006237 Ga0097621_100012497 Ga0097621_1000124975 309
1116 3300006358 Ga0068871_100045140 Ga0068871_1000451402 309
1117 3300006844 Ga0075428_100001444 Ga0075428_1000014448 309
1118 3300006844 Ga0075428_100010157 Ga0075428_1000101576 309
1119 3300006844 Ga0075428_100083890 Ga0075428_1000838903 309
1120 3300006846 Ga0075430_100143839 Ga0075430_1001438392 309
1121 3300006847 Ga0075431_100000004 Ga0075431_10000000425 309
1122 3300006847 Ga0075431_100001945 Ga0075431_1000019454 309
1123 3300006847 Ga0075431_100039758 Ga0075431_1000397585 309
1124 3300006847 Ga0075431_100081418 Ga0075431_1000814183 309
1125 3300006847 Ga0075431_100152214 Ga0075431_1001522142 309
1126 3300006852 Ga0075433_10080279 Ga0075433_100802792 309
1127 3300006871 Ga0075434_100020745 Ga0075434_1000207454 309
1128 3300006871 Ga0075434_100089483 Ga0075434_1000894832 309
1129 3300006871 Ga0075434_100681426 Ga0075434_1006814261 309
1130 3300006880 Ga0075429_100005048 Ga0075429_10000504811 309
1131 3300006880 Ga0075429_100029221 Ga0075429_1000292213 309
1132 3300006881 Ga0068865_100003704 Ga0068865_1000037042 309
1133 3300006931 Ga0097620_100012950 Ga0097620_1000129504 309
1134 3300006931 Ga0097620_100030307 Ga0097620_1000303072 309
1135 3300006942 Ga0099824_1017617 Ga0099824_10176175 309
1136 3300006943 Ga0099822_1002963 Ga0099822_100296321 309
1137 3300009093 Ga0105240_10028302 Ga0105240_100283027 309
1138 3300009093 Ga0105240_10064092 Ga0105240_100640925 309
1139 3300009093 Ga0105240_10136404 Ga0105240_101364043 309
1140 3300009094 Ga0111539_10000593 Ga0111539_1000059331 309
1141 3300009094 Ga0111539_10028808 Ga0111539_100288084 309
1142 3300009094 Ga0111539_10077376 Ga0111539_100773763 309
1143 3300009094 Ga0111539_10102595 Ga0111539_101025953 309
1144 3300009094 Ga0111539_10158986 Ga0111539_101589863 309
1145 3300009098 Ga0105245_10007375 Ga0105245_100073758 309
1146 3300009101 Ga0105247_10001538 Ga0105247_100015388 309
1147 3300009147 Ga0114129_10000582 Ga0114129_1000058229 309
1148 3300009147 Ga0114129_10046243 Ga0114129_100462435 309
1149 3300009147 Ga0114129_10660461 Ga0114129_106604612 309
1150 3300009148 Ga0105243_10007162 Ga0105243_100071626 309
1151 3300009174 Ga0105241_10003482 Ga0105241_100034825 309
1152 3300009176 Ga0105242_10038990 Ga0105242_100389903 309
1153 3300009177 Ga0105248_10011746 Ga0105248_100117462 309
1154 3300009177 Ga0105248_10038670 Ga0105248_100386702 309
1155 3300009545 Ga0105237_10028586 Ga0105237_100285863 309
1156 3300009553 Ga0105249_10010037 Ga0105249_100100372 309
1157 3300009553 Ga0105249_10085541 Ga0105249_100855414 309
1158 3300010375 Ga0105239_10034226 Ga0105239_100342266 309
1159 3300011119 Ga0105246_10008790 Ga0105246_100087905 309
1160 3300011119 Ga0105246_10226807 Ga0105246_102268072 309
1161 3300013100 Ga0157373_10019018 Ga0157373_100190185 309
1162 3300013100 Ga0157373_10239531 Ga0157373_102395312 309
1163 3300013102 Ga0157371_10000072 Ga0157371_1000007272 309
1164 3300013102 Ga0157371_10030194 Ga0157371_100301944 309
1165 3300013102 Ga0157371_10212814 Ga0157371_102128142 309
1166 3300013104 Ga0157370_10015394 Ga0157370_100153943 309
1167 3300013105 Ga0157369_10009534 Ga0157369_100095348 309
1168 3300013105 Ga0157369_10041328 Ga0157369_100413285 309
1169 3300013306 Ga0163162_10016503 Ga0163162_100165032 309
1170 3300014326 Ga0157380_10058635 Ga0157380_100586352 309
1171 3300014326 Ga0157380_10162170 Ga0157380_101621702 309
1172 3300014969 Ga0157376_10000775 Ga0157376_100007756 309
1173 3300014969 Ga0157376_10134798 Ga0157376_101347982 309
1174 3300015261 Ga0182006_1002237 Ga0182006_10022375 309
1175 3300017792 Ga0163161_10019776 Ga0163161_100197763 309
1176 3300020610 Ga0154015_1708714 Ga0154015_17087143 309
1177 3300025224 Ga0209784_101379 Ga0209784_1013793 309
1178 3300025225 Ga0209566_103054 Ga0209566_1030542 309
1179 3300025226 Ga0209674_102329 Ga0209674_1023292 309
1180 3300025228 Ga0209672_101368 Ga0209672_1013682 309
1181 3300025229 Ga0209147_100015 Ga0209147_10001573 309
1182 3300025242 Ga0209258_100021 Ga0209258_10002173 309
1183 3300025254 Ga0209148_1002896 Ga0209148_10028963 309
1184 3300025256 Ga0209759_1001806 Ga0209759_10018067 309
1185 3300025272 Ga0209455_1000028 Ga0209455_100002873 309
1186 3300025272 Ga0209455_1000299 Ga0209455_100029917 309
1187 3300025297 Ga0209758_1002030 Ga0209758_100203021 309
1188 3300025303 Ga0209051_1002343 Ga0209051_10023432 309
1189 3300025898 Ga0207692_10012990 Ga0207692_100129905 309
1190 3300025901 Ga0207688_10032402 Ga0207688_100324023 309
1191 3300025906 Ga0207699_10055544 Ga0207699_100555443 309
1192 3300025909 Ga0207705_10087317 Ga0207705_100873172 309
1193 3300025913 Ga0207695_10001875 Ga0207695_1000187510 309
1194 3300025915 Ga0207693_10001182 Ga0207693_1000118224 309
1195 3300025915 Ga0207693_10189055 Ga0207693_101890552 309
1196 3300025916 Ga0207663_10010046 Ga0207663_100100463 309
1197 3300025919 Ga0207657_10007391 Ga0207657_100073913 309
1198 3300025919 Ga0207657_10009870 Ga0207657_1000987010 309
1199 3300025920 Ga0207649_10002957 Ga0207649_100029577 309
1200 3300025921 Ga0207652_10078015 Ga0207652_100780152 309
1201 3300025923 Ga0207681_10030327 Ga0207681_100303274 309
1202 3300025924 Ga0207694_10028904 Ga0207694_100289045 309
1203 3300025924 Ga0207694_10423131 Ga0207694_104231311 309
1204 3300025925 Ga0207650_10019097 Ga0207650_100190972 309
1205 3300025927 Ga0207687_10015685 Ga0207687_100156854 309
1206 3300025927 Ga0207687_10356981 Ga0207687_103569812 309
1207 3300025928 Ga0207700_10079033 Ga0207700_100790332 309
1208 3300025932 Ga0207690_10155495 Ga0207690_101554952 309
1209 3300025933 Ga0207706_10005330 Ga0207706_100053306 309
1210 3300025933 Ga0207706_10126349 Ga0207706_101263492 309
1211 3300025933 Ga0207706_10178034 Ga0207706_101780342 309
1212 3300025934 Ga0207686_10061425 Ga0207686_100614252 309
1213 3300025935 Ga0207709_10037131 Ga0207709_100371312 309
1214 3300025937 Ga0207669_10003445 Ga0207669_100034453 309
1215 3300025937 Ga0207669_10125193 Ga0207669_101251932 309
1216 3300025939 Ga0207665_10011736 Ga0207665_100117365 309
1217 3300025940 Ga0207691_10017646 Ga0207691_100176466 309
1218 3300025940 Ga0207691_10096853 Ga0207691_100968532 309
1219 3300025941 Ga0207711_10006466 Ga0207711_100064662 309
1220 3300025942 Ga0207689_10030494 Ga0207689_100304942 309
1221 3300025942 Ga0207689_10126425 Ga0207689_101264252 309
1222 3300025945 Ga0207679_10021303 Ga0207679_100213033 309
1223 3300025949 Ga0207667_10030515 Ga0207667_100305157 309
1224 3300025960 Ga0207651_10222048 Ga0207651_102220482 309
1225 3300025961 Ga0207712_10056537 Ga0207712_100565373 309
1226 3300025961 Ga0207712_10180966 Ga0207712_101809662 309
1227 3300025972 Ga0207668_10048640 Ga0207668_100486403 309
1228 3300025981 Ga0207640_10000012 Ga0207640_1000001233 309
1229 3300025981 Ga0207640_10064903 Ga0207640_100649033 309
1230 3300025981 Ga0207640_10102421 Ga0207640_101024212 309
1231 3300025986 Ga0207658_10064787 Ga0207658_100647872 309
1232 3300026023 Ga0207677_10011508 Ga0207677_100115085 309
1233 3300026023 Ga0207677_10064421 Ga0207677_100644212 309
1234 3300026035 Ga0207703_10010241 Ga0207703_100102418 309
1235 3300026035 Ga0207703_10050654 Ga0207703_100506543 309
1236 3300026088 Ga0207641_10018681 Ga0207641_100186816 309
1237 3300026089 Ga0207648_10025816 Ga0207648_100258164 309
1238 3300026095 Ga0207676_10005003 Ga0207676_100050038 309
1239 3300026116 Ga0207674_10017132 Ga0207674_100171322 309
1240 3300026116 Ga0207674_10034261 Ga0207674_100342612 309
1241 3300026118 Ga0207675_100358800 Ga0207675_1003588002 309
1242 3300026142 Ga0207698_10127582 Ga0207698_101275821 309
1243 3300026142 Ga0207698_10154784 Ga0207698_101547842 309
1244 3300027357 Ga0209589_1000018 Ga0209589_100001821 309
1245 3300027361 Ga0209489_100026 Ga0209489_10002621 309
1246 3300027363 Ga0209700_100035 Ga0209700_10003521 309
1247 3300027866 Ga0209813_10001858 Ga0209813_100018583 309
1248 3300027907 Ga0207428_10004141 Ga0207428_1000414110 309
1249 3300027907 Ga0207428_10007925 Ga0207428_100079255 309
1250 3300027907 Ga0207428_10012221 Ga0207428_100122212 309
1251 3300028379 Ga0268266_10013888 Ga0268266_100138884 309
1252 3300028379 Ga0268266_10329741 Ga0268266_103297412 309
1253 3300028380 Ga0268265_10003744 Ga0268265_100037449 309
1254 3300028381 Ga0268264_10174224 Ga0268264_101742242 309
1255 3300028577 Ga0265318_10023738 Ga0265318_100237382 309
1256 3300031238 Ga0265332_10001311 Ga0265332_1000131111 309
1257 3300031242 Ga0265329_10015969 Ga0265329_100159692 309
1258 3300031247 Ga0265340_10003441 Ga0265340_100034413 309
1259 3300031249 Ga0265339_10004703 Ga0265339_100047039 309
1260 3300031250 Ga0265331_10122127 Ga0265331_101221272 309
1261 3300031344 Ga0265316_10077815 Ga0265316_100778153 309
1262 3300031711 Ga0265314_10046476 Ga0265314_100464763 309
1263 3300031712 Ga0265342_10000287 Ga0265342_100002877 309
1264 3300031728 Ga0316578_10070343 Ga0316578_100703432 309
1265 3300031731 Ga0307405_10023129 Ga0307405_100231292 309
1266 3300031852 Ga0307410_10054673 Ga0307410_100546732 309
1267 3300031911 Ga0307412_10132078 Ga0307412_101320782 309
1268 3300032005 Ga0307411_10184887 Ga0307411_101848872 309
1269 3300032133 Ga0316583_10019034 Ga0316583_100190342 309
1270 3300035112 Ga0373932_0040184 Ga0373932_0040184_321_1265 309
1271 3300035113 Ga0373936_0059670 Ga0373936_0059670_518_1483 309
1272 3300035207 Ga0373942_0025850 Ga0373942_0025850_267_1211 309
1273 3300035241 Ga0373961_0005322 Ga0373961_0005322_1161_2105 309
1274 3300035242 Ga0373962_0047522 Ga0373962_0047522_94_1038 309
1275 3300035691 Ga0373931_0001154 Ga0373931_0001154_8289_9233 309
1276 3300035691 Ga0373931_0027768 Ga0373931_0027768_299_1243 309
1277 3300035691 Ga0373931_0065645 Ga0373931_0065645_390_1352 309
1278 3300035691 Ga0373931_0081569 Ga0373931_0081569_412_1347 309
1279 3300035695 Ga0373927_0087588 Ga0373927_0087588_50_994 309
1280 3300036401 Ga0373937_0232530 Ga0373937_0232530_130_1086 309
1281 3300036712 Ga0316584_0019941 Ga0316584_0019941_977_1936 309
1282 3300037068 Ga0373925_0005692 Ga0373925_0005692_8224_9168 309
1283 3300037312 Ga0395899_0121147 Ga0395899_0121147_392_1363 309
1284 3300037418 Ga0395900_0007211 Ga0395900_0007211_5791_6762 309
1285 3300037418 Ga0395900_0109689 Ga0395900_0109689_1815_2756 309
1286 3300037471 Ga0395905_0001000 Ga0395905_0001000_35210_36151 309
1287 3300038443 Ga0395901_0192631 Ga0395901_0192631_614_1558 309
1288 3300039447 Ga0436361_1122840 Ga0436361_1122840_2472_3410 309
1289 3300042876 Ga0451577_0302490 Ga0451577_0302490_76_1038 309
1290 3300044694 Ga0466963_0145732 Ga0466963_0145732_665_1594 309
1291 3300046491 Ga0495584_0088635 Ga0495584_0088635_38_982 309
1292 3300046511 Ga0495608_0071872 Ga0495608_0071872_1132_2088 309
1293 3300046517 Ga0495630_0061243 Ga0495630_0061243_1282_2220 309
1294 3300046615 Ga0495656_0073267 Ga0495656_0073267_207_1142 309
1295 3300046616 Ga0495668_0058775 Ga0495668_0058775_183_1121 309
1296 3300046794 Ga0495589_0080033 Ga0495589_0080033_101_1039 309
1297 3300047317 Ga0495604_0087410 Ga0495604_0087410_12_968 309
1298 3300047319 Ga0495674_0461575 Ga0495674_0461575_25_981 309
1299 3300047320 Ga0495672_0196517 Ga0495672_0196517_34_993 309
1300 3300047322 Ga0495680_0187623 Ga0495680_0187623_219_1175 309
1301 3300048090 Ga0495615_0010946 Ga0495615_0010946_727_1692 309
1302 3300048905 Ga0496102_0039412 Ga0496102_0039412_159_1100 309
1303 3300048905 Ga0496102_0201507 Ga0496102_0201507_344_1291 309
1304 3300048906 Ga0496103_0021222 Ga0496103_0021222_1825_2784 309
1305 3300048907 Ga0496104_0015806 Ga0496104_0015806_390_1331 309
1306 3300048907 Ga0496104_0018542 Ga0496104_0018542_1115_2062 309
1307 3300048908 Ga0496105_0080610 Ga0496105_0080610_1618_2559 309
1308 3300048908 Ga0496105_0124592 Ga0496105_0124592_74_1018 309
1309 3300048909 Ga0496106_0007682 Ga0496106_0007682_130_1071 309
1310 3300048909 Ga0496106_0126633 Ga0496106_0126633_171_1121 309
1311 3300048910 Ga0496107_0032488 Ga0496107_0032488_2007_2957 309
1312 3300048910 Ga0496107_0110025 Ga0496107_0110025_807_1742 309
1313 3300048911 Ga0496108_0012179 Ga0496108_0012179_3541_4482 309
1314 3300048911 Ga0496108_0020612 Ga0496108_0020612_1199_2146 309
1315 3300048911 Ga0496108_0042331 Ga0496108_0042331_1479_2429 309
1316 3300048911 Ga0496108_0076816 Ga0496108_0076816_1322_2263 309
1317 3300048912 Ga0496109_0003961 Ga0496109_0003961_2689_3633 309
1318 3300048912 Ga0496109_0030741 Ga0496109_0030741_2708_3655 309
1319 3300048912 Ga0496109_0072844 Ga0496109_0072844_1101_2042 309
1320 3300048913 Ga0496110_0001450 Ga0496110_0001450_13637_14581 309
1321 3300048913 Ga0496110_0004413 Ga0496110_0004413_5165_6112 309
1322 3300048913 Ga0496110_0006332 Ga0496110_0006332_983_1924 309
1323 3300048914 Ga0496111_0014553 Ga0496111_0014553_1962_2909 309
1324 3300048914 Ga0496111_0018730 Ga0496111_0018730_1156_2097 309
1325 3300048914 Ga0496111_0052514 Ga0496111_0052514_491_1441 309
1326 3300048915 Ga0496112_0031693 Ga0496112_0031693_1030_1971 309
1327 3300048915 Ga0496112_0034957 Ga0496112_0034957_3519_4460 309
1328 3300048915 Ga0496112_0040952 Ga0496112_0040952_1837_2784 309
1329 3300048915 Ga0496112_0110623 Ga0496112_0110623_1038_1988 309
1330 3300048915 Ga0496112_0266396 Ga0496112_0266396_97_1041 309
1331 3300048916 Ga0496113_0016626 Ga0496113_0016626_3411_4355 309
1332 3300048916 Ga0496113_0016768 Ga0496113_0016768_3130_4077 309
1333 3300048917 Ga0496114_0005270 Ga0496114_0005270_7899_8840 309
1334 3300048919 Ga0496116_0000887 Ga0496116_0000887_11965_12909 309
1335 3300048920 Ga0496117_0017537 Ga0496117_0017537_3097_4041 309
1336 3300048921 Ga0496118_0026254 Ga0496118_0026254_1904_2848 309
1337 3300048928 Ga0496125_0029890 Ga0496125_0029890_1737_2681 309
1338 3300048929 Ga0496126_0060274 Ga0496126_0060274_1805_2749 309
1339 3300048929 Ga0496126_0136521 Ga0496126_0136521_134_1081 309
1340 3300049568 Ga0501031_0034444 Ga0501031_0034444_1547_2491 309
1341 3300049570 Ga0501033_0000304 Ga0501033_0000304_26480_27487 309
1342 3300049570 Ga0501033_0004330 Ga0501033_0004330_9388_10362 309
1343 3300049570 Ga0501033_0053089 Ga0501033_0053089_797_1801 309
1344 3300049571 Ga0501034_0312038 Ga0501034_0312038_492_1421 309
1345 3300049571 Ga0501034_0523169 Ga0501034_0523169_74_1048 309
1346 3300049573 Ga0501037_0000154 Ga0501037_0000154_44343_45350 309
1347 3300049573 Ga0501037_0005109 Ga0501037_0005109_7595_8539 309
1348 3300049574 Ga0501038_0000129 Ga0501038_0000129_31462_32391 309
1349 3300049574 Ga0501038_0021125 Ga0501038_0021125_91_1098 309
1350 3300049574 Ga0501038_0124946 Ga0501038_0124946_1016_1951 309
1351 3300049575 Ga0501039_0012490 Ga0501039_0012490_4333_5268 309
1352 3300049577 Ga0501041_0030312 Ga0501041_0030312_1530_2465 309
1353 3300049578 Ga0501042_0029591 Ga0501042_0029591_1367_2302 309
1354 3300049579 Ga0501043_0000007 Ga0501043_0000007_37154_38161 309
1355 3300049581 Ga0501047_0186846 Ga0501047_0186846_466_1404 309
1356 3300049581 Ga0501047_0274392 Ga0501047_0274392_303_1307 309
1357 3300049582 Ga0501048_0036812 Ga0501048_0036812_109_1044 309
1358 3300049583 Ga0501067_0156874 Ga0501067_0156874_176_1108 309
1359 3300049584 Ga0501068_0006700 Ga0501068_0006700_3294_4247 309
1360 3300049584 Ga0501068_0059908 Ga0501068_0059908_89_1024 309
1361 3300049585 Ga0501069_0000027 Ga0501069_0000027_68052_69059 309
1362 3300049586 Ga0501070_0000650 Ga0501070_0000650_27859_28866 309
1363 3300049586 Ga0501070_0023230 Ga0501070_0023230_4020_5027 309
1364 3300049586 Ga0501070_0031603 Ga0501070_0031603_2561_3535 309
1365 3300049586 Ga0501070_0048508 Ga0501070_0048508_2427_3371 309
1366 3300049587 Ga0501071_0059676 Ga0501071_0059676_981_1916 309
1367 3300049588 Ga0501072_0231670 Ga0501072_0231670_165_1100 309
1368 3300049589 Ga0501073_0002531 Ga0501073_0002531_8052_9005 309
1369 3300049589 Ga0501073_0005847 Ga0501073_0005847_1847_2779 309
1370 3300049590 Ga0501074_0000066 Ga0501074_0000066_18353_19360 309
1371 3300049590 Ga0501074_0011852 Ga0501074_0011852_2828_3781 309
1372 3300049590 Ga0501074_0072586 Ga0501074_0072586_1486_2421 309
1373 3300049592 Ga0501076_0033886 Ga0501076_0033886_1320_2255 309
1374 3300049593 Ga0501077_0000799 Ga0501077_0000799_10020_10955 309
1375 3300049593 Ga0501077_0003835 Ga0501077_0003835_8069_9022 309
1376 3300049741 Ga0501079_0003834 Ga0501079_0003834_8111_9064 309
1377 3300049742 Ga0501080_0000667 Ga0501080_0000667_20968_21975 309
1378 3300049742 Ga0501080_0002747 Ga0501080_0002747_3431_4405 309
1379 3300049742 Ga0501080_0003520 Ga0501080_0003520_6626_7579 309
1380 3300049742 Ga0501080_0021270 Ga0501080_0021270_2875_3882 309
1381 3300049742 Ga0501080_0260754 Ga0501080_0260754_186_1121 309
1382 3300049744 Ga0501083_0000012 Ga0501083_0000012_140351_141358 309
1383 3300049744 Ga0501083_0046988 Ga0501083_0046988_534_1466 309
1384 3300049744 Ga0501083_0209695 Ga0501083_0209695_202_1137 309
1385 3300049822 Ga0501035_0000073 Ga0501035_0000073_64653_65660 309
1386 3300049822 Ga0501035_0000806 Ga0501035_0000806_16036_17010 309
1387 3300049822 Ga0501035_0004944 Ga0501035_0004944_7187_8194 309
1388 3300049822 Ga0501035_0067200 Ga0501035_0067200_481_1425 309
1389 3300049822 Ga0501035_0252748 Ga0501035_0252748_297_1232 309
1390 3300049822 Ga0501035_0318459 Ga0501035_0318459_74_1078 309
1391 3300049823 Ga0501044_0000118 Ga0501044_0000118_57030_58037 309
1392 3300049823 Ga0501044_0015666 Ga0501044_0015666_4240_5244 309
1393 3300049823 Ga0501044_0025239 Ga0501044_0025239_980_1954 309
1394 3300049823 Ga0501044_0107349 Ga0501044_0107349_168_1175 309
1395 3300049824 Ga0501045_0009307 Ga0501045_0009307_4768_5703 309
1396 3300050490 nmdc:mga03n38_8992_c1 nmdc:mga03n38_8992_c1_381_1340 309
1397 3300050490 nmdc:mga03n38_9059_c1 nmdc:mga03n38_9059_c1_960_1904 309
1398 3300050491 nmdc:mga00v17_3731_c1 nmdc:mga00v17_3731_c1_2566_3510 309
1399 3300050491 nmdc:mga00v17_45806_c1 nmdc:mga00v17_45806_c1_922_1881 309
1400 3300050491 nmdc:mga00v17_71097_c1 nmdc:mga00v17_71097_c1_237_1205 309
1401 3300050492 nmdc:mga0yw44_2821_c1 nmdc:mga0yw44_2821_c1_5917_6876 309
1402 3300050493 nmdc:mga0k408_38558_c1 nmdc:mga0k408_38558_c1_342_1301 309
1403 3300050494 nmdc:mga06z11_1145_c1 nmdc:mga06z11_1145_c1_181_1125 309
1404 3300050494 nmdc:mga06z11_146699_c1 nmdc:mga06z11_146699_c1_63_1022 309
1405 3300050494 nmdc:mga06z11_1846_c1 nmdc:mga06z11_1846_c1_622_1593 309
1406 3300050494 nmdc:mga06z11_50293_c1 nmdc:mga06z11_50293_c1_686_1645 309
1407 3300050495 nmdc:mga04h51_1364_c1 nmdc:mga04h51_1364_c1_728_1672 309
1408 3300050496 nmdc:mga07m45_15551_c1 nmdc:mga07m45_15551_c1_1318_2277 309
1409 3300050496 nmdc:mga07m45_93113_c1 nmdc:mga07m45_93113_c1_459_1403 309
1410 3300050507 nmdc:mga05p37_143860_c1 nmdc:mga05p37_143860_c1_1172_2104 309
1411 3300050507 nmdc:mga05p37_234893_c1 nmdc:mga05p37_234893_c1_1045_1980 309
1412 3300050507 nmdc:mga05p37_409778_c1 nmdc:mga05p37_409778_c1_414_1349 309
1413 3300050507 nmdc:mga05p37_40_c1 nmdc:mga05p37_40_c1_27857_28795 309
1414 3300050507 nmdc:mga05p37_97690_c1 nmdc:mga05p37_97690_c1_147_1088 309
1415 3300050508 nmdc:mga09592_42573_c1 nmdc:mga09592_42573_c1_895_1836 309
1416 3300050508 nmdc:mga09592_47664_c1 nmdc:mga09592_47664_c1_844_1791 309
1417 3300050510 nmdc:mga06r32_119_c1 nmdc:mga06r32_119_c1_15812_16750 309
1418 3300050510 nmdc:mga06r32_58526_c1 nmdc:mga06r32_58526_c1_347_1291 309
1419 3300050510 nmdc:mga06r32_7788_c1 nmdc:mga06r32_7788_c1_5850_6797 309
1420 3300050511 nmdc:mga08y16_60474_c1 nmdc:mga08y16_60474_c1_1698_2630 309
1421 3300050511 nmdc:mga08y16_636_c1 nmdc:mga08y16_636_c1_12608_13546 309
1422 3300050512 nmdc:mga0n895_181899_c1 nmdc:mga0n895_181899_c1_1054_1998 309
1423 3300050512 nmdc:mga0n895_258545_c1 nmdc:mga0n895_258545_c1_90_1022 309
1424 3300050512 nmdc:mga0n895_29685_c1 nmdc:mga0n895_29685_c1_3314_4246 309
1425 3300050512 nmdc:mga0n895_547773_c1 nmdc:mga0n895_547773_c1_174_1109 309
1426 3300050512 nmdc:mga0n895_55201_c1 nmdc:mga0n895_55201_c1_483_1424 309
1427 3300050513 nmdc:mga0rr50_15874_c1 nmdc:mga0rr50_15874_c1_433_1374 309
1428 3300050515 nmdc:mga0a205_44889_c1 nmdc:mga0a205_44889_c1_916_1857 309
1429 3300050516 nmdc:mga0sz30_22936_c1 nmdc:mga0sz30_22936_c1_953_1924 309
1430 3300053093 Ga0500651_0018718 Ga0500651_0018718_2594_3538 309
1431 3300053094 Ga0500566_0000554 Ga0500566_0000554_6012_6956 309
1432 3300053096 Ga0500641_0006722 Ga0500641_0006722_1879_2850 309
1433 3300053117 Ga0500593_009994 Ga0500593_009994_1610_2563 309
1434 3300053119 Ga0500595_000540 Ga0500595_000540_1466_2410 309
1435 3300053122 Ga0500608_003545 Ga0500608_003545_1701_2645 309
1436 3300053131 Ga0500652_000016 Ga0500652_000016_24093_25058 309
1437 3300053136 Ga0500559_0000985 Ga0500559_0000985_15921_16865 309
1438 3300053139 Ga0500568_0000002 Ga0500568_0000002_74509_75462 309
1439 3300053177 Ga0500636_0004010 Ga0500636_0004010_2659_3603 309
1440 3300053177 Ga0500636_0035683 Ga0500636_0035683_1077_2042 309
1441 3300053178 Ga0500637_0010125 Ga0500637_0010125_2912_3976 309
1442 3300054114 Ga0501084_0007053 Ga0501084_0007053_8088_9041 309
1443 3300054114 Ga0501084_0416045 Ga0501084_0416045_10_942 309
1444 iso_pu_bacteria 2599185178 2599447568 309
1445 iso_pu_bacteria 2899803654 2899806438 309
1446 iso_pu_bacteria 2900577576 2900578114 309
1447 iso_pu_bacteria 2928058823 2928060944 309
1448 iso_pu_bacteria 8001845381 8001848755 309
1449 3300005336 Ga0070680_100011559 Ga0070680_1000115596 310
1450 3300005339 Ga0070660_100001961 Ga0070660_1000019616 310
1451 3300005435 Ga0070714_100033001 Ga0070714_1000330012 310
1452 3300005458 Ga0070681_10087478 Ga0070681_100874782 310
1453 3300005563 Ga0068855_100017545 Ga0068855_1000175457 310
1454 3300005563 Ga0068855_100105815 Ga0068855_1001058152 310
1455 3300005578 Ga0068854_100068033 Ga0068854_1000680331 310
1456 3300005616 Ga0068852_100083940 Ga0068852_1000839402 310
1457 3300005616 Ga0068852_100182071 Ga0068852_1001820712 310
1458 3300013102 Ga0157371_10243078 Ga0157371_102430781 310
1459 3300013307 Ga0157372_10152833 Ga0157372_101528332 310
1460 3300025909 Ga0207705_10062714 Ga0207705_100627142 310
1461 3300025919 Ga0207657_10005707 Ga0207657_100057076 310
1462 3300025921 Ga0207652_10033930 Ga0207652_100339303 310
1463 3300025929 Ga0207664_10022395 Ga0207664_100223954 310
1464 3300025949 Ga0207667_10123301 Ga0207667_101233012 310
1465 3300025981 Ga0207640_10060368 Ga0207640_100603683 310
1466 3300031711 Ga0265314_10014192 Ga0265314_100141924 310
1467 3300031712 Ga0265342_10002165 Ga0265342_1000216511 310
1468 3300031712 Ga0265342_10046924 Ga0265342_100469243 310
1469 3300044684 Ga0466966_0048070 Ga0466966_0048070_1557_2489 310
1470 3300044694 Ga0466963_0020354 Ga0466963_0020354_3171_4103 310
1471 3300045049 Ga0466959_0153074 Ga0466959_0153074_480_1412 310
1472 3300045976 Ga0466967_0202584 Ga0466967_0202584_823_1755 310
1473 3300049581 Ga0501047_0022017 Ga0501047_0022017_824_1756 310
1474 3300049823 Ga0501044_0011013 Ga0501044_0011013_1059_1991 310
1475 3300005329 Ga0070683_100022026 Ga0070683_1000220262 311
1476 3300005434 Ga0070709_10206494 Ga0070709_102064942 311
1477 3300005436 Ga0070713_100244279 Ga0070713_1002442792 311
1478 3300005518 Ga0070699_100203864 Ga0070699_1002038642 311
1479 3300005563 Ga0068855_100079069 Ga0068855_1000790693 311
1480 3300005937 Ga0081455_10000930 Ga0081455_1000093031 311
1481 3300006028 Ga0070717_10361401 Ga0070717_103614012 311
1482 3300006175 Ga0070712_100015569 Ga0070712_1000155695 311
1483 3300006846 Ga0075430_100188731 Ga0075430_1001887312 311
1484 3300006847 Ga0075431_100249100 Ga0075431_1002491002 311
1485 3300006871 Ga0075434_100293557 Ga0075434_1002935572 311
1486 3300006880 Ga0075429_100053077 Ga0075429_1000530773 311
1487 3300007076 Ga0075435_100208391 Ga0075435_1002083912 311
1488 3300009147 Ga0114129_10020239 Ga0114129_100202399 311
1489 3300013307 Ga0157372_10085368 Ga0157372_100853682 311
1490 3300025922 Ga0207646_10440132 Ga0207646_104401322 311
1491 3300025928 Ga0207700_10043817 Ga0207700_100438172 311
1492 3300025929 Ga0207664_10195694 Ga0207664_101956942 311
1493 3300031241 Ga0265325_10026904 Ga0265325_100269043 311
1494 3300031249 Ga0265339_10002938 Ga0265339_100029389 311
1495 3300031344 Ga0265316_10078231 Ga0265316_100782312 311
1496 3300031595 Ga0265313_10005622 Ga0265313_100056226 311
1497 3300035111 Ga0373923_0080762 Ga0373923_0080762_421_1374 311
1498 3300035113 Ga0373936_0015050 Ga0373936_0015050_1528_2481 311
1499 3300035117 Ga0373953_0014939 Ga0373953_0014939_828_1769 311
1500 3300035118 Ga0373954_0085357 Ga0373954_0085357_101_1042 311
1501 3300035119 Ga0373956_0059014 Ga0373956_0059014_689_1630 311
1502 3300035120 Ga0373957_0051938 Ga0373957_0051938_297_1238 311
1503 3300035171 Ga0373946_0002566 Ga0373946_0002566_3143_4096 311
1504 3300035172 Ga0373955_0002082 Ga0373955_0002082_3137_4078 311
1505 3300035692 Ga0373935_0012773 Ga0373935_0012773_2358_3311 311
1506 3300035695 Ga0373927_0063141 Ga0373927_0063141_1405_2358 311
1507 3300035725 Ga0373947_0029213 Ga0373947_0029213_1381_2334 311
1508 3300036401 Ga0373937_0020661 Ga0373937_0020661_2389_3330 311
1509 3300036401 Ga0373937_0348384 Ga0373937_0348384_81_1022 311
1510 3300037068 Ga0373925_0112537 Ga0373925_0112537_251_1204 311
1511 3300037466 Ga0395898_0583043 Ga0395898_0583043_49_990 311
1512 3300039437 Ga0436365_1111496 Ga0436365_1111496_599_1546 311
1513 3300046455 Ga0495603_0076891 Ga0495603_0076891_105_1058 311
1514 3300046461 Ga0495641_0008922 Ga0495641_0008922_2425_3378 311
1515 3300046475 Ga0495639_0041666 Ga0495639_0041666_946_1899 311
1516 3300046476 Ga0495662_0166719 Ga0495662_0166719_86_1039 311
1517 3300046491 Ga0495584_0032213 Ga0495584_0032213_1122_2075 311
1518 3300046499 Ga0495594_0014978 Ga0495594_0014978_2973_3926 311
1519 3300046520 Ga0495637_0044942 Ga0495637_0044942_417_1370 311
1520 3300046525 Ga0495663_0038871 Ga0495663_0038871_129_1082 311
1521 3300046537 Ga0495598_0002157 Ga0495598_0002157_2678_3631 311
1522 3300046539 Ga0495621_0049713 Ga0495621_0049713_511_1464 311
1523 3300046615 Ga0495656_0007105 Ga0495656_0007105_1897_2850 311
1524 3300046681 Ga0495647_0003893 Ga0495647_0003893_1703_2656 311
1525 3300046689 Ga0495613_0204140 Ga0495613_0204140_405_1358 311
1526 3300046691 Ga0495670_0044346 Ga0495670_0044346_669_1622 311
1527 3300047315 Ga0495581_0028543 Ga0495581_0028543_1338_2291 311
1528 3300047319 Ga0495674_0250035 Ga0495674_0250035_334_1287 311
1529 3300047321 Ga0495676_0029215 Ga0495676_0029215_1895_2848 311
1530 3300048907 Ga0496104_0047741 Ga0496104_0047741_1480_2421 311
1531 3300048909 Ga0496106_0158851 Ga0496106_0158851_333_1274 311
1532 3300048912 Ga0496109_0081537 Ga0496109_0081537_1318_2259 311
1533 3300048913 Ga0496110_0023924 Ga0496110_0023924_499_1440 311
1534 3300048917 Ga0496114_0033841 Ga0496114_0033841_1336_2277 311
1535 3300049571 Ga0501034_0002292 Ga0501034_0002292_947_1882 311
1536 3300049572 Ga0501036_0000609 Ga0501036_0000609_8227_9162 311
1537 3300049573 Ga0501037_0007550 Ga0501037_0007550_4583_5518 311
1538 3300049574 Ga0501038_0040225 Ga0501038_0040225_2478_3413 311
1539 3300049579 Ga0501043_0002387 Ga0501043_0002387_6471_7406 311
1540 3300049580 Ga0501046_0022708 Ga0501046_0022708_526_1461 311
1541 3300049581 Ga0501047_0000228 Ga0501047_0000228_20839_21774 311
1542 3300049581 Ga0501047_0078034 Ga0501047_0078034_994_1956 311
1543 3300049582 Ga0501048_0000467 Ga0501048_0000467_20839_21774 311
1544 3300049586 Ga0501070_0003235 Ga0501070_0003235_4571_5506 311
1545 3300049588 Ga0501072_0157212 Ga0501072_0157212_674_1609 311
1546 3300049589 Ga0501073_0068394 Ga0501073_0068394_1295_2257 311
1547 3300049590 Ga0501074_0005965 Ga0501074_0005965_2274_3209 311
1548 3300049742 Ga0501080_0000112 Ga0501080_0000112_49399_50334 311
1549 3300049744 Ga0501083_0026421 Ga0501083_0026421_2648_3583 311
1550 3300049823 Ga0501044_0006265 Ga0501044_0006265_5843_6778 311
1551 3300050507 nmdc:mga05p37_114306_c1 nmdc:mga05p37_114306_c1_2189_3130 311
1552 3300050507 nmdc:mga05p37_26709_c1 nmdc:mga05p37_26709_c1_2568_3509 311
1553 3300050508 nmdc:mga09592_69574_c1 nmdc:mga09592_69574_c1_1386_2327 311
1554 3300050509 nmdc:mga0qj67_201_c1 nmdc:mga0qj67_201_c1_10437_11384 311
1555 3300050509 nmdc:mga0qj67_83082_c1 nmdc:mga0qj67_83082_c1_23_964 311
1556 3300050510 nmdc:mga06r32_123807_c1 nmdc:mga06r32_123807_c1_1559_2500 311
1557 3300050512 nmdc:mga0n895_219702_c1 nmdc:mga0n895_219702_c1_106_1047 311
1558 3300050513 nmdc:mga0rr50_365400_c1 nmdc:mga0rr50_365400_c1_158_1099 311
1559 2209111006 2214739650 2213746842 312
1560 3300000042 ARSoilYngRDRAFT_c00409 ARSoilYngRDRAFT_004095 312
1561 3300000043 ARcpr5yngRDRAFT_c000424 ARcpr5yngRDRAFT_0004244 312
1562 3300000044 ARSoilOldRDRAFT_c000395 ARSoilOldRDRAFT_0003955 312
1563 3300000045 ARCol0oldRDRAFT_c00662 ARCol0oldRDRAFT_006622 312
1564 3300000652 ARCol0yngRDRAFT_1000418 ARCol0yngRDRAFT_10004184 312
1565 3300001989 JGI24739J22299_10000164 JGI24739J22299_1000016419 312
1566 3300001990 JGI24737J22298_10007907 JGI24737J22298_100079072 312
1567 3300001990 JGI24737J22298_10008240 JGI24737J22298_100082403 312
1568 3300002070 JGI24750J21931_1001632 JGI24750J21931_10016323 312
1569 3300002073 JGI24745J21846_1000369 JGI24745J21846_10003692 312
1570 3300002074 JGI24748J21848_1000318 JGI24748J21848_10003183 312
1571 3300002075 JGI24738J21930_10000112 JGI24738J21930_1000011215 312
1572 3300002076 JGI24749J21850_1000411 JGI24749J21850_10004112 312
1573 3300002155 JGI24033J26618_1003093 JGI24033J26618_10030932 312
1574 3300002239 JGI24034J26672_10001354 JGI24034J26672_100013543 312
1575 3300002244 JGI24742J22300_10005491 JGI24742J22300_100054912 312
1576 3300005290 Ga0065712_10086243 Ga0065712_100862432 312
1577 3300005293 Ga0065715_10160425 Ga0065715_101604252 312
1578 3300005328 Ga0070676_10000755 Ga0070676_1000075512 312
1579 3300005329 Ga0070683_100000376 Ga0070683_10000037627 312
1580 3300005329 Ga0070683_100194441 Ga0070683_1001944412 312
1581 3300005330 Ga0070690_100001711 Ga0070690_1000017113 312
1582 3300005331 Ga0070670_100004417 Ga0070670_1000044172 312
1583 3300005331 Ga0070670_100222829 Ga0070670_1002228291 312
1584 3300005333 Ga0070677_10001502 Ga0070677_100015023 312
1585 3300005334 Ga0068869_100000523 Ga0068869_10000052316 312
1586 3300005335 Ga0070666_10087063 Ga0070666_100870632 312
1587 3300005336 Ga0070680_100007212 Ga0070680_1000072123 312
1588 3300005337 Ga0070682_100000141 Ga0070682_10000014121 312
1589 3300005337 Ga0070682_100212912 Ga0070682_1002129122 312
1590 3300005338 Ga0068868_100251374 Ga0068868_1002513741 312
1591 3300005339 Ga0070660_100002574 Ga0070660_1000025748 312
1592 3300005339 Ga0070660_100276028 Ga0070660_1002760282 312
1593 3300005340 Ga0070689_100003974 Ga0070689_1000039748 312
1594 3300005340 Ga0070689_100028408 Ga0070689_1000284084 312
1595 3300005341 Ga0070691_10000190 Ga0070691_100001903 312
1596 3300005343 Ga0070687_100000212 Ga0070687_10000021211 312
1597 3300005343 Ga0070687_100026519 Ga0070687_1000265193 312
1598 3300005344 Ga0070661_100000242 Ga0070661_10000024248 312
1599 3300005345 Ga0070692_10005286 Ga0070692_100052864 312
1600 3300005347 Ga0070668_100016022 Ga0070668_1000160225 312
1601 3300005347 Ga0070668_100118247 Ga0070668_1001182473 312
1602 3300005353 Ga0070669_100000593 Ga0070669_10000059325 312
1603 3300005353 Ga0070669_100064881 Ga0070669_1000648813 312
1604 3300005354 Ga0070675_100000165 Ga0070675_10000016537 312
1605 3300005354 Ga0070675_100021102 Ga0070675_1000211023 312
1606 3300005355 Ga0070671_100010995 Ga0070671_1000109957 312
1607 3300005355 Ga0070671_100044105 Ga0070671_1000441052 312
1608 3300005356 Ga0070674_100000450 Ga0070674_10000045016 312
1609 3300005356 Ga0070674_100083494 Ga0070674_1000834942 312
1610 3300005364 Ga0070673_100001190 Ga0070673_10000119013 312
1611 3300005365 Ga0070688_100002746 Ga0070688_1000027464 312
1612 3300005365 Ga0070688_100023504 Ga0070688_1000235045 312
1613 3300005365 Ga0070688_100042800 Ga0070688_1000428003 312
1614 3300005366 Ga0070659_100000988 Ga0070659_1000009889 312
1615 3300005367 Ga0070667_100000759 Ga0070667_1000007595 312
1616 3300005434 Ga0070709_10003620 Ga0070709_100036207 312
1617 3300005435 Ga0070714_100079218 Ga0070714_1000792182 312
1618 3300005436 Ga0070713_100002939 Ga0070713_1000029394 312
1619 3300005436 Ga0070713_100010515 Ga0070713_1000105158 312
1620 3300005437 Ga0070710_10016270 Ga0070710_100162702 312
1621 3300005438 Ga0070701_10032675 Ga0070701_100326752 312
1622 3300005439 Ga0070711_100043413 Ga0070711_1000434133 312
1623 3300005439 Ga0070711_100060365 Ga0070711_1000603653 312
1624 3300005440 Ga0070705_100032729 Ga0070705_1000327292 312
1625 3300005441 Ga0070700_100000364 Ga0070700_10000036411 312
1626 3300005441 Ga0070700_100066395 Ga0070700_1000663953 312
1627 3300005444 Ga0070694_100001077 Ga0070694_10000107716 312
1628 3300005444 Ga0070694_100073966 Ga0070694_1000739662 312
1629 3300005445 Ga0070708_100038832 Ga0070708_1000388324 312
1630 3300005455 Ga0070663_100000417 Ga0070663_10000041716 312
1631 3300005455 Ga0070663_100012645 Ga0070663_1000126455 312
1632 3300005455 Ga0070663_100167727 Ga0070663_1001677272 312
1633 3300005456 Ga0070678_100001012 Ga0070678_1000010126 312
1634 3300005457 Ga0070662_100000796 Ga0070662_1000007967 312
1635 3300005458 Ga0070681_10002475 Ga0070681_100024756 312
1636 3300005458 Ga0070681_10016649 Ga0070681_100166497 312
1637 3300005458 Ga0070681_10136554 Ga0070681_101365543 312
1638 3300005458 Ga0070681_10257766 Ga0070681_102577661 312
1639 3300005459 Ga0068867_100009775 Ga0068867_1000097756 312
1640 3300005466 Ga0070685_10000547 Ga0070685_1000054713 312
1641 3300005466 Ga0070685_10040869 Ga0070685_100408692 312
1642 3300005518 Ga0070699_100210654 Ga0070699_1002106542 312
1643 3300005530 Ga0070679_100010894 Ga0070679_1000108947 312
1644 3300005530 Ga0070679_100017764 Ga0070679_1000177643 312
1645 3300005530 Ga0070679_100024204 Ga0070679_1000242045 312
1646 3300005535 Ga0070684_100000755 Ga0070684_10000075516 312
1647 3300005535 Ga0070684_100089433 Ga0070684_1000894332 312
1648 3300005535 Ga0070684_100339739 Ga0070684_1003397392 312
1649 3300005536 Ga0070697_100242034 Ga0070697_1002420342 312
1650 3300005539 Ga0068853_100000483 Ga0068853_10000048312 312
1651 3300005539 Ga0068853_100417435 Ga0068853_1004174352 312
1652 3300005543 Ga0070672_100000527 Ga0070672_10000052716 312
1653 3300005544 Ga0070686_100002014 Ga0070686_10000201411 312
1654 3300005544 Ga0070686_100021984 Ga0070686_1000219843 312
1655 3300005544 Ga0070686_100024116 Ga0070686_1000241165 312
1656 3300005545 Ga0070695_100003705 Ga0070695_1000037059 312
1657 3300005545 Ga0070695_100012588 Ga0070695_1000125882 312
1658 3300005546 Ga0070696_100006474 Ga0070696_1000064742 312
1659 3300005546 Ga0070696_100007364 Ga0070696_1000073647 312
1660 3300005546 Ga0070696_100040533 Ga0070696_1000405332 312
1661 3300005547 Ga0070693_100000199 Ga0070693_10000019911 312
1662 3300005547 Ga0070693_100013889 Ga0070693_1000138895 312
1663 3300005547 Ga0070693_100066424 Ga0070693_1000664242 312
1664 3300005548 Ga0070665_100205626 Ga0070665_1002056262 312
1665 3300005549 Ga0070704_100000987 Ga0070704_1000009872 312
1666 3300005549 Ga0070704_100010219 Ga0070704_1000102195 312
1667 3300005563 Ga0068855_100004444 Ga0068855_1000044447 312
1668 3300005563 Ga0068855_100285978 Ga0068855_1002859782 312
1669 3300005564 Ga0070664_100000895 Ga0070664_1000008959 312
1670 3300005564 Ga0070664_100006659 Ga0070664_1000066599 312
1671 3300005577 Ga0068857_100001816 Ga0068857_10000181612 312
1672 3300005578 Ga0068854_100001666 Ga0068854_1000016665 312
1673 3300005614 Ga0068856_100001538 Ga0068856_1000015385 312
1674 3300005614 Ga0068856_100085686 Ga0068856_1000856864 312
1675 3300005615 Ga0070702_100001415 Ga0070702_1000014156 312
1676 3300005616 Ga0068852_100002972 Ga0068852_10000297211 312
1677 3300005616 Ga0068852_100137926 Ga0068852_1001379262 312
1678 3300005617 Ga0068859_100013486 Ga0068859_1000134863 312
1679 3300005617 Ga0068859_100032539 Ga0068859_1000325393 312
1680 3300005618 Ga0068864_100000227 Ga0068864_10000022756 312
1681 3300005618 Ga0068864_100161358 Ga0068864_1001613583 312
1682 3300005718 Ga0068866_10003190 Ga0068866_100031903 312
1683 3300005719 Ga0068861_100005060 Ga0068861_1000050608 312
1684 3300005834 Ga0068851_10036970 Ga0068851_100369702 312
1685 3300005840 Ga0068870_10000155 Ga0068870_100001559 312
1686 3300005841 Ga0068863_100000495 Ga0068863_10000049530 312
1687 3300005841 Ga0068863_100028778 Ga0068863_1000287784 312
1688 3300005842 Ga0068858_100000783 Ga0068858_10000078327 312
1689 3300005842 Ga0068858_100023775 Ga0068858_1000237752 312
1690 3300005843 Ga0068860_100022860 Ga0068860_1000228602 312
1691 3300005843 Ga0068860_100028377 Ga0068860_1000283773 312
1692 3300005843 Ga0068860_100081388 Ga0068860_1000813884 312
1693 3300005844 Ga0068862_100020393 Ga0068862_1000203934 312
1694 3300005937 Ga0081455_10000204 Ga0081455_1000020484 312
1695 3300005937 Ga0081455_10006948 Ga0081455_100069488 312
1696 3300005937 Ga0081455_10041301 Ga0081455_100413014 312
1697 3300005983 Ga0081540_1029769 Ga0081540_10297695 312
1698 3300006028 Ga0070717_10006465 Ga0070717_100064656 312
1699 3300006028 Ga0070717_10173632 Ga0070717_101736322 312
1700 3300006058 Ga0075432_10000464 Ga0075432_100004645 312
1701 3300006163 Ga0070715_10005760 Ga0070715_100057605 312
1702 3300006173 Ga0070716_100003033 Ga0070716_1000030336 312
1703 3300006173 Ga0070716_100192187 Ga0070716_1001921872 312
1704 3300006173 Ga0070716_100213925 Ga0070716_1002139252 312
1705 3300006175 Ga0070712_100341756 Ga0070712_1003417561 312
1706 3300006237 Ga0097621_100000010 Ga0097621_10000001033 312
1707 3300006237 Ga0097621_100089391 Ga0097621_1000893912 312
1708 3300006237 Ga0097621_100121279 Ga0097621_1001212793 312
1709 3300006358 Ga0068871_100000034 Ga0068871_10000003438 312
1710 3300006358 Ga0068871_100011248 Ga0068871_1000112483 312
1711 3300006358 Ga0068871_100151675 Ga0068871_1001516752 312
1712 3300006844 Ga0075428_100016761 Ga0075428_1000167616 312
1713 3300006844 Ga0075428_100232697 Ga0075428_1002326972 312
1714 3300006846 Ga0075430_100005590 Ga0075430_1000055906 312
1715 3300006846 Ga0075430_100070585 Ga0075430_1000705853 312
1716 3300006847 Ga0075431_100004052 Ga0075431_1000040528 312
1717 3300006852 Ga0075433_10000774 Ga0075433_1000077418 312
1718 3300006852 Ga0075433_10009145 Ga0075433_100091455 312
1719 3300006852 Ga0075433_10098099 Ga0075433_100980993 312
1720 3300006871 Ga0075434_100001700 Ga0075434_1000017008 312
1721 3300006871 Ga0075434_100005910 Ga0075434_1000059106 312
1722 3300006871 Ga0075434_100120172 Ga0075434_1001201722 312
1723 3300006880 Ga0075429_100007130 Ga0075429_1000071306 312
1724 3300006881 Ga0068865_100000230 Ga0068865_10000023020 312
1725 3300006931 Ga0097620_100013487 Ga0097620_1000134873 312
1726 3300006931 Ga0097620_100032540 Ga0097620_1000325404 312
1727 3300007076 Ga0075435_100018036 Ga0075435_1000180364 312
1728 3300007076 Ga0075435_100024146 Ga0075435_1000241464 312
1729 3300009011 Ga0105251_10009243 Ga0105251_100092432 312
1730 3300009036 Ga0105244_10140441 Ga0105244_101404412 312
1731 3300009092 Ga0105250_10075623 Ga0105250_100756231 312
1732 3300009093 Ga0105240_10032653 Ga0105240_100326537 312
1733 3300009094 Ga0111539_10000932 Ga0111539_100009327 312
1734 3300009094 Ga0111539_10002162 Ga0111539_1000216211 312
1735 3300009094 Ga0111539_10010377 Ga0111539_100103776 312
1736 3300009098 Ga0105245_10000258 Ga0105245_1000025822 312
1737 3300009098 Ga0105245_10084954 Ga0105245_100849542 312
1738 3300009098 Ga0105245_10149302 Ga0105245_101493022 312
1739 3300009101 Ga0105247_10002128 Ga0105247_100021287 312
1740 3300009147 Ga0114129_10026350 Ga0114129_100263504 312
1741 3300009148 Ga0105243_10000846 Ga0105243_100008467 312
1742 3300009148 Ga0105243_10013532 Ga0105243_100135322 312
1743 3300009148 Ga0105243_10031832 Ga0105243_100318324 312
1744 3300009174 Ga0105241_10002261 Ga0105241_1000226111 312
1745 3300009174 Ga0105241_10052670 Ga0105241_100526704 312
1746 3300009176 Ga0105242_10000037 Ga0105242_1000003751 312
1747 3300009176 Ga0105242_10009393 Ga0105242_100093933 312
1748 3300009176 Ga0105242_10072671 Ga0105242_100726712 312
1749 3300009177 Ga0105248_10000744 Ga0105248_100007446 312
1750 3300009177 Ga0105248_10014815 Ga0105248_100148154 312
1751 3300009177 Ga0105248_10097121 Ga0105248_100971212 312
1752 3300009177 Ga0105248_10131174 Ga0105248_101311743 312
1753 3300009545 Ga0105237_10041135 Ga0105237_100411355 312
1754 3300009545 Ga0105237_10121585 Ga0105237_101215853 312
1755 3300009545 Ga0105237_10204747 Ga0105237_102047472 312
1756 3300009553 Ga0105249_10000209 Ga0105249_1000020942 312
1757 3300009553 Ga0105249_10018811 Ga0105249_100188114 312
1758 3300010375 Ga0105239_10206985 Ga0105239_102069852 312
1759 3300010375 Ga0105239_10371495 Ga0105239_103714952 312
1760 3300011119 Ga0105246_10002021 Ga0105246_100020217 312
1761 3300011119 Ga0105246_10044594 Ga0105246_100445942 312
1762 3300011119 Ga0105246_10064206 Ga0105246_100642061 312
1763 3300013102 Ga0157371_10008348 Ga0157371_100083484 312
1764 3300013104 Ga0157370_10038246 Ga0157370_100382462 312
1765 3300013296 Ga0157374_10229166 Ga0157374_102291662 312
1766 3300013296 Ga0157374_10334180 Ga0157374_103341802 312
1767 3300013297 Ga0157378_10001580 Ga0157378_1000158022 312
1768 3300013297 Ga0157378_10068904 Ga0157378_100689042 312
1769 3300013297 Ga0157378_10114386 Ga0157378_101143862 312
1770 3300013306 Ga0163162_10001677 Ga0163162_1000167716 312
1771 3300013306 Ga0163162_10017229 Ga0163162_100172293 312
1772 3300013307 Ga0157372_10006418 Ga0157372_100064189 312
1773 3300013308 Ga0157375_10000263 Ga0157375_1000026346 312
1774 3300013308 Ga0157375_10050465 Ga0157375_100504654 312
1775 3300014326 Ga0157380_10000294 Ga0157380_1000029411 312
1776 3300014745 Ga0157377_10001222 Ga0157377_100012222 312
1777 3300014968 Ga0157379_10002453 Ga0157379_100024537 312
1778 3300014968 Ga0157379_10287997 Ga0157379_102879972 312
1779 3300014968 Ga0157379_10561289 Ga0157379_105612892 312
1780 3300014969 Ga0157376_10000342 Ga0157376_1000034228 312
1781 3300017792 Ga0163161_10000523 Ga0163161_1000052314 312
1782 3300017792 Ga0163161_10006061 Ga0163161_100060612 312
1783 3300017792 Ga0163161_10078438 Ga0163161_100784382 312
1784 3300021384 Ga0213876_10007213 Ga0213876_100072136 312
1785 3300025271 Ga0207666_1000010 Ga0207666_100001016 312
1786 3300025290 Ga0207673_1000265 Ga0207673_10002655 312
1787 3300025315 Ga0207697_10000186 Ga0207697_1000018622 312
1788 3300025315 Ga0207697_10003939 Ga0207697_100039396 312
1789 3300025321 Ga0207656_10016141 Ga0207656_100161413 312
1790 3300025885 Ga0207653_10006329 Ga0207653_100063295 312
1791 3300025893 Ga0207682_10000123 Ga0207682_1000012334 312
1792 3300025898 Ga0207692_10137747 Ga0207692_101377472 312
1793 3300025899 Ga0207642_10024721 Ga0207642_100247212 312
1794 3300025900 Ga0207710_10002765 Ga0207710_100027657 312
1795 3300025900 Ga0207710_10016457 Ga0207710_100164572 312
1796 3300025901 Ga0207688_10000889 Ga0207688_1000088912 312
1797 3300025901 Ga0207688_10030347 Ga0207688_100303472 312
1798 3300025903 Ga0207680_10001117 Ga0207680_100011175 312
1799 3300025904 Ga0207647_10046161 Ga0207647_100461612 312
1800 3300025906 Ga0207699_10003769 Ga0207699_100037696 312
1801 3300025906 Ga0207699_10043874 Ga0207699_100438742 312
1802 3300025906 Ga0207699_10183013 Ga0207699_101830132 312
1803 3300025907 Ga0207645_10000023 Ga0207645_1000002320 312
1804 3300025907 Ga0207645_10228600 Ga0207645_102286002 312
1805 3300025908 Ga0207643_10000007 Ga0207643_1000000711 312
1806 3300025911 Ga0207654_10006607 Ga0207654_100066072 312
1807 3300025911 Ga0207654_10056535 Ga0207654_100565352 312
1808 3300025912 Ga0207707_10002015 Ga0207707_100020155 312
1809 3300025912 Ga0207707_10038893 Ga0207707_100388934 312
1810 3300025912 Ga0207707_10063342 Ga0207707_100633422 312
1811 3300025914 Ga0207671_10053873 Ga0207671_100538733 312
1812 3300025915 Ga0207693_10020341 Ga0207693_100203415 312
1813 3300025915 Ga0207693_10062939 Ga0207693_100629393 312
1814 3300025917 Ga0207660_10000393 Ga0207660_1000039322 312
1815 3300025918 Ga0207662_10000136 Ga0207662_1000013627 312
1816 3300025918 Ga0207662_10041037 Ga0207662_100410372 312
1817 3300025919 Ga0207657_10002615 Ga0207657_1000261520 312
1818 3300025919 Ga0207657_10035478 Ga0207657_100354783 312
1819 3300025919 Ga0207657_10084082 Ga0207657_100840822 312
1820 3300025919 Ga0207657_10222897 Ga0207657_102228972 312
1821 3300025920 Ga0207649_10000434 Ga0207649_100004348 312
1822 3300025921 Ga0207652_10001720 Ga0207652_100017208 312
1823 3300025921 Ga0207652_10078596 Ga0207652_100785962 312
1824 3300025923 Ga0207681_10000273 Ga0207681_1000027334 312
1825 3300025925 Ga0207650_10001932 Ga0207650_100019325 312
1826 3300025925 Ga0207650_10228230 Ga0207650_102282302 312
1827 3300025926 Ga0207659_10000097 Ga0207659_1000009722 312
1828 3300025926 Ga0207659_10045817 Ga0207659_100458172 312
1829 3300025927 Ga0207687_10001031 Ga0207687_100010315 312
1830 3300025927 Ga0207687_10159802 Ga0207687_101598022 312
1831 3300025927 Ga0207687_10311939 Ga0207687_103119392 312
1832 3300025928 Ga0207700_10042358 Ga0207700_100423583 312
1833 3300025929 Ga0207664_10045298 Ga0207664_100452982 312
1834 3300025931 Ga0207644_10003263 Ga0207644_100032639 312
1835 3300025931 Ga0207644_10005450 Ga0207644_100054507 312
1836 3300025932 Ga0207690_10000962 Ga0207690_1000096212 312
1837 3300025932 Ga0207690_10058526 Ga0207690_100585261 312
1838 3300025932 Ga0207690_10148504 Ga0207690_101485041 312
1839 3300025933 Ga0207706_10000867 Ga0207706_1000086720 312
1840 3300025933 Ga0207706_10023602 Ga0207706_100236025 312
1841 3300025933 Ga0207706_10118505 Ga0207706_101185052 312
1842 3300025934 Ga0207686_10002591 Ga0207686_100025918 312
1843 3300025934 Ga0207686_10020419 Ga0207686_100204192 312
1844 3300025935 Ga0207709_10007329 Ga0207709_100073293 312
1845 3300025935 Ga0207709_10040253 Ga0207709_100402532 312
1846 3300025936 Ga0207670_10000536 Ga0207670_1000053611 312
1847 3300025936 Ga0207670_10016232 Ga0207670_100162322 312
1848 3300025936 Ga0207670_10032250 Ga0207670_100322503 312
1849 3300025937 Ga0207669_10001135 Ga0207669_1000113511 312
1850 3300025937 Ga0207669_10083876 Ga0207669_100838762 312
1851 3300025938 Ga0207704_10000119 Ga0207704_1000011943 312
1852 3300025938 Ga0207704_10239576 Ga0207704_102395761 312
1853 3300025939 Ga0207665_10000417 Ga0207665_1000041731 312
1854 3300025939 Ga0207665_10039742 Ga0207665_100397424 312
1855 3300025939 Ga0207665_10082576 Ga0207665_100825762 312
1856 3300025940 Ga0207691_10000544 Ga0207691_1000054416 312
1857 3300025940 Ga0207691_10074625 Ga0207691_100746252 312
1858 3300025941 Ga0207711_10002468 Ga0207711_100024688 312
1859 3300025941 Ga0207711_10017097 Ga0207711_100170974 312
1860 3300025941 Ga0207711_10132100 Ga0207711_101321002 312
1861 3300025942 Ga0207689_10001743 Ga0207689_100017438 312
1862 3300025944 Ga0207661_10000785 Ga0207661_100007853 312
1863 3300025944 Ga0207661_10172158 Ga0207661_101721582 312
1864 3300025945 Ga0207679_10000029 Ga0207679_10000029187 312
1865 3300025945 Ga0207679_10082319 Ga0207679_100823192 312
1866 3300025949 Ga0207667_10016422 Ga0207667_100164227 312
1867 3300025960 Ga0207651_10000083 Ga0207651_1000008312 312
1868 3300025961 Ga0207712_10000471 Ga0207712_100004718 312
1869 3300025972 Ga0207668_10000862 Ga0207668_1000086211 312
1870 3300025972 Ga0207668_10153781 Ga0207668_101537812 312
1871 3300025972 Ga0207668_10166758 Ga0207668_101667582 312
1872 3300025981 Ga0207640_10003185 Ga0207640_100031858 312
1873 3300025986 Ga0207658_10002203 Ga0207658_1000220312 312
1874 3300025986 Ga0207658_10053843 Ga0207658_100538432 312
1875 3300026023 Ga0207677_10000992 Ga0207677_100009927 312
1876 3300026041 Ga0207639_10004451 Ga0207639_100044518 312
1877 3300026067 Ga0207678_10001568 Ga0207678_1000156811 312
1878 3300026067 Ga0207678_10045376 Ga0207678_100453763 312
1879 3300026067 Ga0207678_10310586 Ga0207678_103105862 312
1880 3300026075 Ga0207708_10002060 Ga0207708_1000206016 312
1881 3300026075 Ga0207708_10059728 Ga0207708_100597283 312
1882 3300026078 Ga0207702_10003639 Ga0207702_100036393 312
1883 3300026088 Ga0207641_10000510 Ga0207641_1000051011 312
1884 3300026088 Ga0207641_10020130 Ga0207641_100201303 312
1885 3300026089 Ga0207648_10002351 Ga0207648_1000235120 312
1886 3300026089 Ga0207648_10081627 Ga0207648_100816272 312
1887 3300026095 Ga0207676_10003788 Ga0207676_100037882 312
1888 3300026095 Ga0207676_10093462 Ga0207676_100934623 312
1889 3300026116 Ga0207674_10000608 Ga0207674_1000060816 312
1890 3300026116 Ga0207674_10557201 Ga0207674_105572012 312
1891 3300026118 Ga0207675_100000805 Ga0207675_10000080516 312
1892 3300026121 Ga0207683_10000082 Ga0207683_1000008254 312
1893 3300026121 Ga0207683_10015896 Ga0207683_100158968 312
1894 3300026121 Ga0207683_10126685 Ga0207683_101266852 312
1895 3300026142 Ga0207698_10000377 Ga0207698_1000037723 312
1896 3300027617 Ga0210002_1001863 Ga0210002_10018632 312
1897 3300027695 Ga0209966_1000761 Ga0209966_10007618 312
1898 3300027717 Ga0209998_10001920 Ga0209998_100019205 312
1899 3300027717 Ga0209998_10005097 Ga0209998_100050972 312
1900 3300027876 Ga0209974_10034036 Ga0209974_100340362 312
1901 3300027907 Ga0207428_10000124 Ga0207428_1000012492 312
1902 3300027907 Ga0207428_10000420 Ga0207428_1000042040 312
1903 3300027907 Ga0207428_10000703 Ga0207428_1000070337 312
1904 3300028379 Ga0268266_10012891 Ga0268266_100128917 312
1905 3300028379 Ga0268266_10079273 Ga0268266_100792733 312
1906 3300028380 Ga0268265_10001170 Ga0268265_1000117018 312
1907 3300028380 Ga0268265_10077901 Ga0268265_100779013 312
1908 3300028381 Ga0268264_10001878 Ga0268264_1000187816 312
1909 3300028381 Ga0268264_10112638 Ga0268264_101126382 312
1910 3300028800 Ga0265338_10177672 Ga0265338_101776722 312
1911 3300031238 Ga0265332_10063720 Ga0265332_100637202 312
1912 3300031241 Ga0265325_10000105 Ga0265325_1000010547 312
1913 3300031241 Ga0265325_10005654 Ga0265325_100056545 312
1914 3300031241 Ga0265325_10044264 Ga0265325_100442642 312
1915 3300031595 Ga0265313_10108941 Ga0265313_101089412 312
1916 3300031711 Ga0265314_10000279 Ga0265314_1000027957 312
1917 3300031711 Ga0265314_10118072 Ga0265314_101180722 312
1918 3300034816 Ga0373930_0000557 Ga0373930_0000557_1925_2863 312
1919 3300034816 Ga0373930_0006765 Ga0373930_0006765_104_1042 312
1920 3300034817 Ga0373948_0000160 Ga0373948_0000160_966_1904 312
1921 3300034817 Ga0373948_0012264 Ga0373948_0012264_324_1262 312
1922 3300034818 Ga0373950_0001396 Ga0373950_0001396_1373_2311 312
1923 3300034818 Ga0373950_0009406 Ga0373950_0009406_299_1237 312
1924 3300034819 Ga0373958_0001091 Ga0373958_0001091_1678_2616 312
1925 3300034819 Ga0373958_0004385 Ga0373958_0004385_888_1826 312
1926 3300034820 Ga0373959_0001344 Ga0373959_0001344_2013_2951 312
1927 3300034957 Ga0373938_0000092 Ga0373938_0000092_8882_9820 312
1928 3300034957 Ga0373938_0000725 Ga0373938_0000725_3667_4605 312
1929 3300035084 Ga0373928_0000404 Ga0373928_0000404_1770_2708 312
1930 3300035084 Ga0373928_0004133 Ga0373928_0004133_1371_2309 312
1931 3300035084 Ga0373928_0008191 Ga0373928_0008191_109_1047 312
1932 3300035085 Ga0373929_0000856 Ga0373929_0000856_3424_4362 312
1933 3300035086 Ga0373934_0013054 Ga0373934_0013054_810_1748 312
1934 3300035086 Ga0373934_0092341 Ga0373934_0092341_237_1175 312
1935 3300035088 Ga0373940_0000069 Ga0373940_0000069_9141_10079 312
1936 3300035089 Ga0373944_0000522 Ga0373944_0000522_5423_6361 312
1937 3300035089 Ga0373944_0003976 Ga0373944_0003976_2470_3408 312
1938 3300035090 Ga0373949_0002201 Ga0373949_0002201_2028_2966 312
1939 3300035090 Ga0373949_0003185 Ga0373949_0003185_988_1926 312
1940 3300035091 Ga0373951_0003116 Ga0373951_0003116_2114_3052 312
1941 3300035091 Ga0373951_0005474 Ga0373951_0005474_231_1169 312
1942 3300035091 Ga0373951_0008001 Ga0373951_0008001_65_1003 312
1943 3300035092 Ga0373952_0002122 Ga0373952_0002122_1664_2602 312
1944 3300035092 Ga0373952_0002777 Ga0373952_0002777_831_1769 312
1945 3300035111 Ga0373923_0000908 Ga0373923_0000908_5230_6168 312
1946 3300035112 Ga0373932_0000510 Ga0373932_0000510_3689_4627 312
1947 3300035112 Ga0373932_0001365 Ga0373932_0001365_319_1257 312
1948 3300035112 Ga0373932_0009934 Ga0373932_0009934_398_1336 312
1949 3300035113 Ga0373936_0013341 Ga0373936_0013341_628_1566 312
1950 3300035114 Ga0373939_0001165 Ga0373939_0001165_4706_5644 312
1951 3300035114 Ga0373939_0002803 Ga0373939_0002803_2165_3103 312
1952 3300035115 Ga0373941_0010323 Ga0373941_0010323_937_1875 312
1953 3300035116 Ga0373945_0000687 Ga0373945_0000687_5471_6409 312
1954 3300035116 Ga0373945_0014690 Ga0373945_0014690_1150_2088 312
1955 3300035117 Ga0373953_0068520 Ga0373953_0068520_257_1195 312
1956 3300035118 Ga0373954_0103123 Ga0373954_0103123_53_991 312
1957 3300035118 Ga0373954_0114970 Ga0373954_0114970_152_1090 312
1958 3300035119 Ga0373956_0017796 Ga0373956_0017796_237_1175 312
1959 3300035120 Ga0373957_0029482 Ga0373957_0029482_569_1519 312
1960 3300035120 Ga0373957_0031346 Ga0373957_0031346_273_1211 312
1961 3300035121 Ga0373960_0002095 Ga0373960_0002095_1514_2452 312
1962 3300035121 Ga0373960_0011297 Ga0373960_0011297_441_1379 312
1963 3300035170 Ga0373943_0009246 Ga0373943_0009246_3424_4362 312
1964 3300035170 Ga0373943_0029437 Ga0373943_0029437_1078_2016 312
1965 3300035171 Ga0373946_0029392 Ga0373946_0029392_565_1503 312
1966 3300035172 Ga0373955_0243423 Ga0373955_0243423_120_1058 312
1967 3300035207 Ga0373942_0001103 Ga0373942_0001103_1845_2783 312
1968 3300035207 Ga0373942_0001725 Ga0373942_0001725_1376_2314 312
1969 3300035207 Ga0373942_0009085 Ga0373942_0009085_467_1405 312
1970 3300035241 Ga0373961_0000636 Ga0373961_0000636_2031_2969 312
1971 3300035242 Ga0373962_0000974 Ga0373962_0000974_743_1681 312
1972 3300035242 Ga0373962_0007950 Ga0373962_0007950_276_1214 312
1973 3300035242 Ga0373962_0036726 Ga0373962_0036726_375_1313 312
1974 3300035410 Ga0373924_0042186 Ga0373924_0042186_454_1392 312
1975 3300035691 Ga0373931_0000186 Ga0373931_0000186_3629_4567 312
1976 3300035691 Ga0373931_0004674 Ga0373931_0004674_1682_2620 312
1977 3300035691 Ga0373931_0012507 Ga0373931_0012507_704_1642 312
1978 3300035691 Ga0373931_0032737 Ga0373931_0032737_1511_2449 312
1979 3300035692 Ga0373935_0026018 Ga0373935_0026018_1518_2468 312
1980 3300035692 Ga0373935_0034435 Ga0373935_0034435_2058_2996 312
1981 3300035695 Ga0373927_0071664 Ga0373927_0071664_155_1093 312
1982 3300035724 Ga0373933_0012736 Ga0373933_0012736_1850_2788 312
1983 3300035724 Ga0373933_0017609 Ga0373933_0017609_1412_2362 312
1984 3300035725 Ga0373947_0005091 Ga0373947_0005091_6691_7629 312
1985 3300035725 Ga0373947_0039335 Ga0373947_0039335_359_1297 312
1986 3300036401 Ga0373937_0011291 Ga0373937_0011291_3495_4433 312
1987 3300036401 Ga0373937_0020009 Ga0373937_0020009_1492_2430 312
1988 3300036401 Ga0373937_0062979 Ga0373937_0062979_2309_3259 312
1989 3300037068 Ga0373925_0007297 Ga0373925_0007297_458_1396 312
1990 3300037068 Ga0373925_0040062 Ga0373925_0040062_662_1600 312
1991 3300039437 Ga0436365_0176480 Ga0436365_0176480_273_1211 312
1992 3300039437 Ga0436365_0399377 Ga0436365_0399377_10284_11228 312
1993 3300039453 Ga0436362_0442315 Ga0436362_0442315_2106_3050 312
1994 3300042001 Ga0439441_013117 Ga0439441_013117_347_1285 312
1995 3300042439 Ga0439464_0011331 Ga0439464_0011331_1263_2201 312
1996 3300042461 Ga0439460_0016420 Ga0439460_0016420_341_1279 312
1997 3300044712 Ga0453684_0121340 Ga0453684_0121340_1174_2112 312
1998 3300045051 Ga0451576_0052484 Ga0451576_0052484_1821_2759 312
1999 3300046452 Ga0495617_017240 Ga0495617_017240_140_1078 312
2000 3300046454 Ga0495592_0001116 Ga0495592_0001116_3886_4824 312
2001 3300046454 Ga0495592_0008124 Ga0495592_0008124_227_1165 312
2002 3300046454 Ga0495592_0028640 Ga0495592_0028640_1544_2482 312
2003 3300046455 Ga0495603_0008589 Ga0495603_0008589_3723_4661 312
2004 3300046459 Ga0495629_0002067 Ga0495629_0002067_6258_7196 312
2005 3300046460 Ga0495638_0041088 Ga0495638_0041088_140_1111 312
2006 3300046461 Ga0495641_0021653 Ga0495641_0021653_1582_2520 312
2007 3300046461 Ga0495641_0097227 Ga0495641_0097227_271_1209 312
2008 3300046462 Ga0495651_0003892 Ga0495651_0003892_6814_7752 312
2009 3300046462 Ga0495651_0006050 Ga0495651_0006050_4562_5500 312
2010 3300046462 Ga0495651_0055830 Ga0495651_0055830_1463_2413 312
2011 3300046462 Ga0495651_0112691 Ga0495651_0112691_512_1450 312
2012 3300046463 Ga0495653_0010574 Ga0495653_0010574_1431_2369 312
2013 3300046472 Ga0495580_0021831 Ga0495580_0021831_1679_2617 312
2014 3300046472 Ga0495580_0030249 Ga0495580_0030249_1727_2665 312
2015 3300046473 Ga0495582_0001705 Ga0495582_0001705_9554_10492 312
2016 3300046473 Ga0495582_0004472 Ga0495582_0004472_3615_4553 312
2017 3300046473 Ga0495582_0012581 Ga0495582_0012581_499_1437 312
2018 3300046475 Ga0495639_0041465 Ga0495639_0041465_937_1875 312
2019 3300046476 Ga0495662_0009334 Ga0495662_0009334_1899_2837 312
2020 3300046477 Ga0495664_0001609 Ga0495664_0001609_1956_2894 312
2021 3300046477 Ga0495664_0032556 Ga0495664_0032556_819_1757 312
2022 3300046477 Ga0495664_0079246 Ga0495664_0079246_870_1808 312
2023 3300046492 Ga0495585_0003281 Ga0495585_0003281_6585_7523 312
2024 3300046499 Ga0495594_0017444 Ga0495594_0017444_1890_2828 312
2025 3300046499 Ga0495594_0022175 Ga0495594_0022175_359_1297 312
2026 3300046499 Ga0495594_0061423 Ga0495594_0061423_1035_1973 312
2027 3300046501 Ga0495607_0014759 Ga0495607_0014759_707_1645 312
2028 3300046511 Ga0495608_0022714 Ga0495608_0022714_2227_3165 312
2029 3300046511 Ga0495608_0083554 Ga0495608_0083554_221_1159 312
2030 3300046511 Ga0495608_0103461 Ga0495608_0103461_107_1057 312
2031 3300046514 Ga0495618_0021418 Ga0495618_0021418_1435_2373 312
2032 3300046516 Ga0495628_0002046 Ga0495628_0002046_11631_12569 312
2033 3300046516 Ga0495628_0087099 Ga0495628_0087099_731_1669 312
2034 3300046516 Ga0495628_0122491 Ga0495628_0122491_527_1465 312
2035 3300046517 Ga0495630_0144694 Ga0495630_0144694_689_1627 312
2036 3300046517 Ga0495630_0358191 Ga0495630_0358191_73_1011 312
2037 3300046526 Ga0495666_0044622 Ga0495666_0044622_546_1484 312
2038 3300046529 Ga0495652_0011016 Ga0495652_0011016_667_1605 312
2039 3300046529 Ga0495652_0113148 Ga0495652_0113148_885_1823 312
2040 3300046529 Ga0495652_0130273 Ga0495652_0130273_691_1629 312
2041 3300046529 Ga0495652_0133415 Ga0495652_0133415_304_1242 312
2042 3300046531 Ga0495665_0021898 Ga0495665_0021898_1150_2088 312
2043 3300046531 Ga0495665_0035715 Ga0495665_0035715_1662_2600 312
2044 3300046533 Ga0495640_0053962 Ga0495640_0053962_612_1550 312
2045 3300046533 Ga0495640_0201372 Ga0495640_0201372_154_1092 312
2046 3300046535 Ga0495586_0026239 Ga0495586_0026239_1598_2536 312
2047 3300046536 Ga0495587_0006079 Ga0495587_0006079_772_1710 312
2048 3300046536 Ga0495587_0020228 Ga0495587_0020228_1072_2010 312
2049 3300046536 Ga0495587_0028702 Ga0495587_0028702_1489_2439 312
2050 3300046538 Ga0495609_0043864 Ga0495609_0043864_454_1392 312
2051 3300046543 Ga0495645_0001781 Ga0495645_0001781_12307_13245 312
2052 3300046557 Ga0495622_0012353 Ga0495622_0012353_535_1473 312
2053 3300046558 Ga0495633_0020888 Ga0495633_0020888_909_1847 312
2054 3300046559 Ga0495667_0002342 Ga0495667_0002342_6408_7346 312
2055 3300046559 Ga0495667_0027911 Ga0495667_0027911_736_1674 312
2056 3300046615 Ga0495656_0001283 Ga0495656_0001283_726_1664 312
2057 3300046642 Ga0495634_0124886 Ga0495634_0124886_305_1243 312
2058 3300046648 Ga0495611_0017651 Ga0495611_0017651_926_1864 312
2059 3300046663 Ga0495635_0000736 Ga0495635_0000736_12706_13644 312
2060 3300046663 Ga0495635_0045100 Ga0495635_0045100_28_966 312
2061 3300046663 Ga0495635_0092251 Ga0495635_0092251_662_1600 312
2062 3300046663 Ga0495635_0256111 Ga0495635_0256111_198_1148 312
2063 3300046664 Ga0495659_0003459 Ga0495659_0003459_1399_2337 312
2064 3300046664 Ga0495659_0112603 Ga0495659_0112603_95_1033 312
2065 3300046674 Ga0495588_0018157 Ga0495588_0018157_2097_3035 312
2066 3300046674 Ga0495588_0046290 Ga0495588_0046290_294_1232 312
2067 3300046675 Ga0495657_0007642 Ga0495657_0007642_1548_2486 312
2068 3300046675 Ga0495657_0259047 Ga0495657_0259047_61_999 312
2069 3300046678 Ga0495599_0002064 Ga0495599_0002064_6589_7527 312
2070 3300046678 Ga0495599_0002943 Ga0495599_0002943_7010_7948 312
2071 3300046678 Ga0495599_0003364 Ga0495599_0003364_7154_8092 312
2072 3300046679 Ga0495623_0002286 Ga0495623_0002286_7054_7992 312
2073 3300046679 Ga0495623_0033924 Ga0495623_0033924_392_1330 312
2074 3300046680 Ga0495646_0000229 Ga0495646_0000229_576_1514 312
2075 3300046680 Ga0495646_0048957 Ga0495646_0048957_54_992 312
2076 3300046681 Ga0495647_0003818 Ga0495647_0003818_578_1516 312
2077 3300046681 Ga0495647_0004269 Ga0495647_0004269_1848_2786 312
2078 3300046681 Ga0495647_0012633 Ga0495647_0012633_1538_2476 312
2079 3300046683 Ga0495658_0001370 Ga0495658_0001370_5261_6199 312
2080 3300046684 Ga0495669_0036431 Ga0495669_0036431_638_1576 312
2081 3300046689 Ga0495613_0006674 Ga0495613_0006674_4066_5004 312
2082 3300046690 Ga0495624_0051697 Ga0495624_0051697_1607_2545 312
2083 3300046691 Ga0495670_0009490 Ga0495670_0009490_3552_4490 312
2084 3300046794 Ga0495589_0089633 Ga0495589_0089633_309_1247 312
2085 3300046809 Ga0495600_0003589 Ga0495600_0003589_2889_3827 312
2086 3300046809 Ga0495600_0066578 Ga0495600_0066578_752_1702 312
2087 3300046809 Ga0495600_0079822 Ga0495600_0079822_845_1783 312
2088 3300047315 Ga0495581_0005348 Ga0495581_0005348_4483_5421 312
2089 3300047315 Ga0495581_0026915 Ga0495581_0026915_1516_2454 312
2090 3300047317 Ga0495604_0009381 Ga0495604_0009381_1819_2757 312
2091 3300047317 Ga0495604_0044756 Ga0495604_0044756_1943_2881 312
2092 3300047317 Ga0495604_0062749 Ga0495604_0062749_604_1542 312
2093 3300047319 Ga0495674_0030389 Ga0495674_0030389_2105_3043 312
2094 3300047319 Ga0495674_0154887 Ga0495674_0154887_508_1446 312
2095 3300047321 Ga0495676_0041609 Ga0495676_0041609_2215_3153 312
2096 3300047321 Ga0495676_0133369 Ga0495676_0133369_525_1463 312
2097 3300047321 Ga0495676_0137445 Ga0495676_0137445_763_1701 312
2098 3300047322 Ga0495680_0005567 Ga0495680_0005567_1445_2383 312
2099 3300047322 Ga0495680_0029672 Ga0495680_0029672_572_1510 312
2100 3300047322 Ga0495680_0032425 Ga0495680_0032425_2590_3540 312
2101 3300047322 Ga0495680_0047393 Ga0495680_0047393_1563_2501 312
2102 3300047444 Ga0495675_0013037 Ga0495675_0013037_3848_4786 312
2103 3300047444 Ga0495675_0096788 Ga0495675_0096788_837_1787 312
2104 3300047471 Ga0495684_0009067 Ga0495684_0009067_448_1386 312
2105 3300047673 Ga0495593_0046470 Ga0495593_0046470_581_1519 312
2106 3300047673 Ga0495593_0055527 Ga0495593_0055527_169_1107 312
2107 3300047673 Ga0495593_0104015 Ga0495593_0104015_475_1413 312
2108 3300048088 Ga0495602_0006950 Ga0495602_0006950_10894_11832 312
2109 3300048088 Ga0495602_0064697 Ga0495602_0064697_1412_2362 312
2110 3300048088 Ga0495602_0269817 Ga0495602_0269817_169_1107 312
2111 3300048903 Ga0496100_0000057 Ga0496100_0000057_6490_7428 312
2112 3300048903 Ga0496100_0020943 Ga0496100_0020943_614_1552 312
2113 3300048903 Ga0496100_0053690 Ga0496100_0053690_1312_2250 312
2114 3300048904 Ga0496101_0001297 Ga0496101_0001297_10378_11316 312
2115 3300048904 Ga0496101_0088770 Ga0496101_0088770_436_1374 312
2116 3300048904 Ga0496101_0103103 Ga0496101_0103103_920_1858 312
2117 3300048905 Ga0496102_0001628 Ga0496102_0001628_14182_15120 312
2118 3300048905 Ga0496102_0018224 Ga0496102_0018224_1624_2562 312
2119 3300048905 Ga0496102_0086231 Ga0496102_0086231_1686_2624 312
2120 3300048905 Ga0496102_0221596 Ga0496102_0221596_38_976 312
2121 3300048906 Ga0496103_0003173 Ga0496103_0003173_5488_6426 312
2122 3300048906 Ga0496103_0011059 Ga0496103_0011059_1698_2636 312
2123 3300048906 Ga0496103_0077381 Ga0496103_0077381_996_1934 312
2124 3300048906 Ga0496103_0095398 Ga0496103_0095398_19_957 312
2125 3300048907 Ga0496104_0000473 Ga0496104_0000473_11031_11996 312
2126 3300048907 Ga0496104_0000658 Ga0496104_0000658_18918_19856 312
2127 3300048907 Ga0496104_0041108 Ga0496104_0041108_1636_2574 312
2128 3300048907 Ga0496104_0304674 Ga0496104_0304674_458_1396 312
2129 3300048908 Ga0496105_0003726 Ga0496105_0003726_3131_4069 312
2130 3300048908 Ga0496105_0021279 Ga0496105_0021279_1863_2801 312
2131 3300048908 Ga0496105_0036173 Ga0496105_0036173_2762_3727 312
2132 3300048908 Ga0496105_0092155 Ga0496105_0092155_821_1786 312
2133 3300048908 Ga0496105_0235320 Ga0496105_0235320_254_1192 312
2134 3300048908 Ga0496105_0257971 Ga0496105_0257971_337_1275 312
2135 3300048909 Ga0496106_0000518 Ga0496106_0000518_3629_4567 312
2136 3300048909 Ga0496106_0030675 Ga0496106_0030675_2420_3358 312
2137 3300048909 Ga0496106_0050012 Ga0496106_0050012_1904_2842 312
2138 3300048909 Ga0496106_0233352 Ga0496106_0233352_191_1129 312
2139 3300048910 Ga0496107_0001129 Ga0496107_0001129_10378_11316 312
2140 3300048910 Ga0496107_0005941 Ga0496107_0005941_5565_6503 312
2141 3300048910 Ga0496107_0043356 Ga0496107_0043356_2112_3050 312
2142 3300048911 Ga0496108_0003535 Ga0496108_0003535_11311_12249 312
2143 3300048911 Ga0496108_0004254 Ga0496108_0004254_945_1883 312
2144 3300048911 Ga0496108_0029895 Ga0496108_0029895_810_1748 312
2145 3300048911 Ga0496108_0037213 Ga0496108_0037213_369_1307 312
2146 3300048912 Ga0496109_0000390 Ga0496109_0000390_18551_19489 312
2147 3300048912 Ga0496109_0002432 Ga0496109_0002432_7627_8565 312
2148 3300048912 Ga0496109_0297222 Ga0496109_0297222_149_1087 312
2149 3300048912 Ga0496109_0435476 Ga0496109_0435476_75_1013 312
2150 3300048913 Ga0496110_0020927 Ga0496110_0020927_3078_4016 312
2151 3300048913 Ga0496110_0022934 Ga0496110_0022934_1882_2820 312
2152 3300048913 Ga0496110_0129990 Ga0496110_0129990_251_1189 312
2153 3300048913 Ga0496110_0152934 Ga0496110_0152934_373_1311 312
2154 3300048913 Ga0496110_0594489 Ga0496110_0594489_21_959 312
2155 3300048914 Ga0496111_0035239 Ga0496111_0035239_898_1836 312
2156 3300048914 Ga0496111_0056716 Ga0496111_0056716_992_1930 312
2157 3300048914 Ga0496111_0203775 Ga0496111_0203775_38_976 312
2158 3300048915 Ga0496112_0153816 Ga0496112_0153816_894_1832 312
2159 3300048915 Ga0496112_0243757 Ga0496112_0243757_662_1600 312
2160 3300048915 Ga0496112_0247172 Ga0496112_0247172_436_1374 312
2161 3300048916 Ga0496113_0030441 Ga0496113_0030441_231_1169 312
2162 3300048917 Ga0496114_0002944 Ga0496114_0002944_7735_8673 312
2163 3300048917 Ga0496114_0010304 Ga0496114_0010304_5216_6154 312
2164 3300048918 Ga0496115_0002786 Ga0496115_0002786_6911_7849 312
2165 3300048918 Ga0496115_0032489 Ga0496115_0032489_3136_4074 312
2166 3300048918 Ga0496115_0232048 Ga0496115_0232048_276_1214 312
2167 3300049568 Ga0501031_0100498 Ga0501031_0100498_580_1518 312
2168 3300049569 Ga0501032_0023752 Ga0501032_0023752_1477_2451 312
2169 3300049569 Ga0501032_0042861 Ga0501032_0042861_1539_2477 312
2170 3300049569 Ga0501032_0048692 Ga0501032_0048692_75_1013 312
2171 3300049570 Ga0501033_0013461 Ga0501033_0013461_2020_2994 312
2172 3300049570 Ga0501033_0172016 Ga0501033_0172016_316_1254 312
2173 3300049570 Ga0501033_0189613 Ga0501033_0189613_405_1343 312
2174 3300049571 Ga0501034_0000032 Ga0501034_0000032_188562_189500 312
2175 3300049571 Ga0501034_0010486 Ga0501034_0010486_4930_5868 312
2176 3300049571 Ga0501034_0022272 Ga0501034_0022272_470_1444 312
2177 3300049571 Ga0501034_0024348 Ga0501034_0024348_4273_5211 312
2178 3300049571 Ga0501034_0053749 Ga0501034_0053749_2569_3531 312
2179 3300049571 Ga0501034_0160351 Ga0501034_0160351_98_1036 312
2180 3300049571 Ga0501034_0199173 Ga0501034_0199173_560_1498 312
2181 3300049571 Ga0501034_0203301 Ga0501034_0203301_892_1842 312
2182 3300049571 Ga0501034_0214666 Ga0501034_0214666_536_1474 312
2183 3300049571 Ga0501034_0219246 Ga0501034_0219246_186_1160 312
2184 3300049571 Ga0501034_0310541 Ga0501034_0310541_127_1065 312
2185 3300049572 Ga0501036_0011664 Ga0501036_0011664_5305_6279 312
2186 3300049572 Ga0501036_0018617 Ga0501036_0018617_3413_4351 312
2187 3300049572 Ga0501036_0082138 Ga0501036_0082138_85_1023 312
2188 3300049573 Ga0501037_0007475 Ga0501037_0007475_6060_6998 312
2189 3300049573 Ga0501037_0044551 Ga0501037_0044551_2007_2945 312
2190 3300049573 Ga0501037_0045634 Ga0501037_0045634_1182_2156 312
2191 3300049573 Ga0501037_0140685 Ga0501037_0140685_373_1311 312
2192 3300049574 Ga0501038_0004895 Ga0501038_0004895_7935_8909 312
2193 3300049574 Ga0501038_0072882 Ga0501038_0072882_1856_2794 312
2194 3300049574 Ga0501038_0095153 Ga0501038_0095153_1393_2331 312
2195 3300049575 Ga0501039_0036821 Ga0501039_0036821_1538_2512 312
2196 3300049575 Ga0501039_0053438 Ga0501039_0053438_1312_2250 312
2197 3300049575 Ga0501039_0279886 Ga0501039_0279886_195_1133 312
2198 3300049579 Ga0501043_0008265 Ga0501043_0008265_3968_4906 312
2199 3300049579 Ga0501043_0026751 Ga0501043_0026751_2554_3492 312
2200 3300049579 Ga0501043_0290922 Ga0501043_0290922_235_1173 312
2201 3300049580 Ga0501046_0023608 Ga0501046_0023608_2132_3070 312
2202 3300049581 Ga0501047_0018542 Ga0501047_0018542_3183_4121 312
2203 3300049581 Ga0501047_0023967 Ga0501047_0023967_3192_4166 312
2204 3300049582 Ga0501048_0081862 Ga0501048_0081862_693_1631 312
2205 3300049584 Ga0501068_0026123 Ga0501068_0026123_1148_2086 312
2206 3300049584 Ga0501068_0050955 Ga0501068_0050955_868_1806 312
2207 3300049584 Ga0501068_0112359 Ga0501068_0112359_481_1455 312
2208 3300049586 Ga0501070_0012221 Ga0501070_0012221_737_1675 312
2209 3300049586 Ga0501070_0025188 Ga0501070_0025188_1730_2704 312
2210 3300049586 Ga0501070_0028311 Ga0501070_0028311_1262_2200 312
2211 3300049586 Ga0501070_0046778 Ga0501070_0046778_1456_2406 312
2212 3300049586 Ga0501070_0078473 Ga0501070_0078473_705_1643 312
2213 3300049586 Ga0501070_0129484 Ga0501070_0129484_1101_2075 312
2214 3300049586 Ga0501070_0194428 Ga0501070_0194428_564_1502 312
2215 3300049587 Ga0501071_0023874 Ga0501071_0023874_2059_2997 312
2216 3300049587 Ga0501071_0047759 Ga0501071_0047759_1951_2925 312
2217 3300049589 Ga0501073_0040645 Ga0501073_0040645_1112_2050 312
2218 3300049589 Ga0501073_0053525 Ga0501073_0053525_1178_2116 312
2219 3300049589 Ga0501073_0062948 Ga0501073_0062948_30_968 312
2220 3300049590 Ga0501074_0068958 Ga0501074_0068958_13_951 312
2221 3300049741 Ga0501079_0065427 Ga0501079_0065427_744_1682 312
2222 3300049742 Ga0501080_0010850 Ga0501080_0010850_3668_4606 312
2223 3300049742 Ga0501080_0011076 Ga0501080_0011076_3158_4096 312
2224 3300049742 Ga0501080_0078784 Ga0501080_0078784_922_1860 312
2225 3300049742 Ga0501080_0112526 Ga0501080_0112526_1509_2447 312
2226 3300049744 Ga0501083_0008454 Ga0501083_0008454_871_1821 312
2227 3300049744 Ga0501083_0064068 Ga0501083_0064068_766_1704 312
2228 3300049822 Ga0501035_0014779 Ga0501035_0014779_4323_5261 312
2229 3300049822 Ga0501035_0079606 Ga0501035_0079606_1404_2378 312
2230 3300049823 Ga0501044_0018005 Ga0501044_0018005_591_1529 312
2231 3300049823 Ga0501044_0083860 Ga0501044_0083860_2030_3004 312
2232 3300049823 Ga0501044_0278337 Ga0501044_0278337_173_1111 312
2233 3300050507 nmdc:mga05p37_30390_c1 nmdc:mga05p37_30390_c1_3379_4317 312
2234 3300050507 nmdc:mga05p37_45_c2 nmdc:mga05p37_45_c2_4069_5007 312
2235 3300050508 nmdc:mga09592_1055_c1 nmdc:mga09592_1055_c1_14186_15124 312
2236 3300050509 nmdc:mga0qj67_701_c1 nmdc:mga0qj67_701_c1_20804_21742 312
2237 3300050509 nmdc:mga0qj67_92191_c1 nmdc:mga0qj67_92191_c1_730_1707 312
2238 3300050510 nmdc:mga06r32_227_c1 nmdc:mga06r32_227_c1_3084_4022 312
2239 3300050511 nmdc:mga08y16_1134_c1 nmdc:mga08y16_1134_c1_20373_21311 312
2240 3300050511 nmdc:mga08y16_12172_c1 nmdc:mga08y16_12172_c1_6567_7505 312
2241 3300050511 nmdc:mga08y16_1989_c1 nmdc:mga08y16_1989_c1_15533_16471 312
2242 3300050512 nmdc:mga0n895_3165_c1 nmdc:mga0n895_3165_c1_5298_6236 312
2243 3300050512 nmdc:mga0n895_50_c1 nmdc:mga0n895_50_c1_63766_64704 312
2244 3300050512 nmdc:mga0n895_56040_c1 nmdc:mga0n895_56040_c1_2012_2950 312
2245 3300050513 nmdc:mga0rr50_2855_c1 nmdc:mga0rr50_2855_c1_2480_3418 312
2246 3300050514 nmdc:mga08x19_103273_c1 nmdc:mga08x19_103273_c1_213_1151 312
2247 3300050515 nmdc:mga0a205_110140_c1 nmdc:mga0a205_110140_c1_739_1677 312
2248 3300050515 nmdc:mga0a205_2228_c1 nmdc:mga0a205_2228_c1_4981_5919 312
2249 3300050515 nmdc:mga0a205_5479_c1 nmdc:mga0a205_5479_c1_5130_6068 312
2250 3300050515 nmdc:mga0a205_77964_c1 nmdc:mga0a205_77964_c1_749_1687 312
2251 3300053077 Ga0495601_0004041 Ga0495601_0004041_4754_5692 312
2252 3300053077 Ga0495601_0036691 Ga0495601_0036691_178_1116 312
2253 3300053078 Ga0495612_0007152 Ga0495612_0007152_3402_4340 312
2254 3300053078 Ga0495612_0017355 Ga0495612_0017355_1031_1969 312
2255 3300053084 Ga0495595_0000577 Ga0495595_0000577_9411_10349 312
2256 3300053084 Ga0495595_0002620 Ga0495595_0002620_1679_2617 312
2257 3300053084 Ga0495595_0003875 Ga0495595_0003875_1250_2188 312
2258 3300053084 Ga0495595_0005520 Ga0495595_0005520_231_1169 312
2259 3300053085 Ga0495619_0000260 Ga0495619_0000260_30138_31076 312
2260 3300053085 Ga0495619_0000655 Ga0495619_0000655_17183_18121 312
2261 3300053085 Ga0495619_0002796 Ga0495619_0002796_8287_9225 312
2262 3300053085 Ga0495619_0014245 Ga0495619_0014245_3954_4892 312
2263 3300053085 Ga0495619_0021429 Ga0495619_0021429_960_1910 312
2264 3300053085 Ga0495619_0118832 Ga0495619_0118832_476_1414 312
2265 3300053088 Ga0500644_0000301 Ga0500644_0000301_22928_23899 312
2266 3300053093 Ga0500651_0032130 Ga0500651_0032130_2205_3176 312
2267 3300053119 Ga0500595_000144 Ga0500595_000144_33853_34824 312
2268 3300053153 Ga0500616_0000006 Ga0500616_0000006_424701_425672 312
2269 3300053153 Ga0500616_0056913 Ga0500616_0056913_10_981 312
2270 3300053730 Ga0500645_000946 Ga0500645_000946_4873_5841 312
2271 3300054114 Ga0501084_0165007 Ga0501084_0165007_98_1036 312
2272 3300054114 Ga0501084_0372771 Ga0501084_0372771_190_1152 312
2273 3300060353 Ga0501082_0186482 Ga0501082_0186482_323_1273 312
2274 3300061734 Ga0530510_0086829 Ga0530510_0086829_1019_1984 312
2275 iso_pu_bacteria 2643221547 2643755556 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

75

217

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9412 7 225
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.9409 6 218
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9379 6 218
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9334 6 217
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9263 7 213
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9531 1 226 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9423 2 226 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9415 5 226 3.40.50.300
1vplA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9412 7 225 3.40.50.300
af_Q4CYV3_7_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.939 6 218 3.40.50.300
ID Description Score Start End GO Terms
AF-Q8VR06-F1-model_v4 Putative ABC transporter protein 0.9678 85 226 GO:0005524
GO:0016887
AF-A0A3B9BHG2-F1-model_v4 ABC transporter ATP-binding protein 0.9568 1 226 GO:0005524
GO:0016887
AF-A0A0R0D0B4-F1-model_v4 ABC transporter domain-containing protein 0.9566 8 222 GO:0005524
GO:0016887
AF-A0A520NVZ7-F1-model_v4 ABC transporter ATP-binding protein 0.9479 5 225 GO:0005524
GO:0016887
AF-A0A1W9SEJ8-F1-model_v4 ABC transporter domain-containing protein 0.9441 8 222 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
93.27 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map