F496552
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2211 | 710 | 4422 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_11851723|Ga0105248_118517232 |
| Length | 103 |
| Sequence | MMTSKSGFAKNLEDEVKKARFSEQQIIEIPKLAEAGTKVADLCRKHGISQWTFYQWRNKYGGMGVNEAKRLKELQEENRRLKKSVADQAFDVSALKEALHRKW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 7 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 28 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 90 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 92 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 107 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 108 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 111 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 112 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 121 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 122 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 126 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 128 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 129 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 130 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 146 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 147 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 148 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 149 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 150 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 151 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 152 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 164 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 170 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 171 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 172 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 174 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 175 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 176 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 177 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 261 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 263 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 266 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 270 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 271 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 272 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 273 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 274 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 275 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 277 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 282 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 284 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 285 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 286 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 287 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 288 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 289 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 290 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 291 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 292 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 293 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 294 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 295 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 296 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 297 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 298 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 299 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 300 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 301 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 302 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 303 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 304 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 305 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 306 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 307 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 308 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 309 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 310 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 311 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 312 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 313 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 314 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 315 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 316 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 317 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 318 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 319 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 320 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 321 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 322 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 323 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 324 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 325 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 326 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 327 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 328 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 329 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 330 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 331 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 332 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 333 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 334 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 335 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 336 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 337 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 338 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 339 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 340 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 341 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 342 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 343 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 344 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 345 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 346 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 347 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 348 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 349 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 350 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 351 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 352 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 353 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 354 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 355 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 356 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 357 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 358 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 359 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 360 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 361 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 362 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 363 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 364 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 365 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 366 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 367 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 368 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 369 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 370 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 371 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 372 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 373 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 374 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 375 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 376 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 377 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 378 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 379 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 380 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 381 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 382 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 383 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 384 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 385 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 386 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 387 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 388 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 389 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 390 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 391 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 392 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 393 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 394 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 395 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 396 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 397 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 398 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 399 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 400 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 401 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 402 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 403 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 404 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 405 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 406 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 407 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 408 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 409 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 410 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 411 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 412 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 413 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 414 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 415 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 416 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 417 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 418 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 419 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 420 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 421 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 422 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 423 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 424 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 425 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 516 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 517 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 518 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 519 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 520 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 521 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 522 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 523 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 524 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 525 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 526 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 527 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 528 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 529 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 530 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 531 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 532 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 533 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 534 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 535 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 536 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 537 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 538 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 539 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 540 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 541 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 543 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 544 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 545 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 546 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 547 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 548 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 549 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 550 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 552 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 553 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 554 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 555 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 556 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 557 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 558 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 559 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 560 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 561 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 562 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 563 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 564 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 565 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 566 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 567 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 568 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 569 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 570 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 571 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 572 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 573 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 574 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 575 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 576 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 577 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 578 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 579 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 580 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 581 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 582 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 583 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 584 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 585 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 586 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 587 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 588 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 589 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 590 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 591 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 593 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 594 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 595 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 596 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 597 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 598 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 599 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 600 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 601 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 602 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 603 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 604 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 605 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 606 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 607 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 608 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 609 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 610 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 611 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 612 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 613 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 614 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 615 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 616 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 617 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 618 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 619 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 625 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 626 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 627 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 628 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 629 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 630 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 631 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 632 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 633 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 634 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 635 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 636 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 637 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 638 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 639 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 640 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 641 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 642 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 643 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 644 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 645 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 646 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 647 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 648 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 649 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 650 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 651 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 652 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 653 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 654 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 655 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 656 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 657 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 658 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 659 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 660 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 661 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 662 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 663 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 664 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 665 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 666 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 667 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 668 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 669 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 670 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 671 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 672 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 673 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 674 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 675 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 676 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 677 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 678 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 679 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 680 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 681 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 682 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 683 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 684 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 685 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 686 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 687 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 688 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 689 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 690 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 691 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 692 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 693 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 694 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 695 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 696 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 697 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 698 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 699 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 700 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 701 | 2906610324 | |||
| 702 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 703 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 704 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 705 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 706 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 707 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 708 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 709 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 710 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.51 |
| Metatranscriptomes | 0.36 |
| Isolates | 3.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.12 |
| Nodule | 1.72 |
| Rhizoplane | 5.11 |
| Rhizosphere | 83.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105248_11851723 | 3300009177 | Bacteria | 685 |
| 2 | CNAas_1002737 | 3300000532 | Bacteria | 1220 |
| 3 | JGI24747J21853_1019306 | 3300001978 | Bacteria | 735 |
| 4 | JGI24740J21852_10154184 | 3300001979 | Bacteria | 570 |
| 5 | JGI24750J21931_1008344 | 3300002070 | Bacteria | 1316 |
| 6 | JGI24750J21931_1049781 | 3300002070 | Bacteria | 652 |
| 7 | JGI24748J21848_1007479 | 3300002074 | Bacteria | 1280 |
| 8 | JGI24748J21848_1021846 | 3300002074 | Bacteria | 774 |
| 9 | JGI24749J21850_1010864 | 3300002076 | Bacteria | 1278 |
| 10 | JGI24749J21850_1045135 | 3300002076 | Bacteria | 650 |
| 11 | JGI24744J21845_10026855 | 3300002077 | Bacteria | 1115 |
| 12 | JGI24033J26618_1035970 | 3300002155 | Bacteria | 679 |
| 13 | JGI24034J26672_10011309 | 3300002239 | Bacteria | 1336 |
| 14 | JGI24742J22300_10015481 | 3300002244 | Bacteria | 1282 |
| 15 | JGI24742J22300_10015711 | 3300002244 | Bacteria | 1274 |
| 16 | JGI24751J29686_10099474 | 3300002459 | Bacteria | 607 |
| 17 | JGI24751J29686_10101126 | 3300002459 | Bacteria | 602 |
| 18 | JGI25150J39212_1015910 | 3300002774 | Bacteria | 1244 |
| 19 | JGI25159J45721_1022579 | 3300002987 | Bacteria | 1160 |
| 20 | rootH2_10023835 | 3300003320 | Bacteria | 11613 |
| 21 | rootH2_10077013 | 3300003320 | Bacteria | 1067 |
| 22 | rootL2_10232720 | 3300003322 | Bacteria | 7199 |
| 23 | rootH1_10054396 | 3300003323 | Bacteria | 2203 |
| 24 | rootH1_10156375 | 3300003323 | Bacteria | 5110 |
| 25 | JGI25160J50197_1089346 | 3300003354 | Bacteria | 561 |
| 26 | Ga0006562J51391_1021829 | 3300003578 | Bacteria | 1000 |
| 27 | Ga0055526_1023784 | 3300003771 | Bacteria | 2032 |
| 28 | Ga0055526_1029595 | 3300003771 | Bacteria | 1621 |
| 29 | Ga0055537_1016604 | 3300003773 | Bacteria | 1240 |
| 30 | Ga0055524_1071201 | 3300003775 | Bacteria | 669 |
| 31 | Ga0055524_1071265 | 3300003775 | Bacteria | 669 |
| 32 | Ga0055536_1059387 | 3300003781 | Bacteria | 798 |
| 33 | Ga0055534_1017639 | 3300003784 | Bacteria | 1259 |
| 34 | Ga0055528_1065723 | 3300003790 | Bacteria | 669 |
| 35 | Ga0055528_1065782 | 3300003790 | Bacteria | 669 |
| 36 | Ga0055530_10035639 | 3300003791 | Bacteria | 1260 |
| 37 | Ga0058692_1001917 | 3300003856 | Bacteria | 7270 |
| 38 | JGI25405J52794_10024828 | 3300003911 | Bacteria | 1226 |
| 39 | Ga0065712_10780520 | 3300005290 | Bacteria | 518 |
| 40 | Ga0065715_10015161 | 3300005293 | Bacteria | 3052 |
| 41 | Ga0070658_10124014 | 3300005327 | Bacteria | 2149 |
| 42 | Ga0070658_10858739 | 3300005327 | Bacteria | 789 |
| 43 | Ga0070658_11107294 | 3300005327 | Bacteria | 689 |
| 44 | Ga0070658_11608920 | 3300005327 | Bacteria | 563 |
| 45 | Ga0070676_10051740 | 3300005328 | Bacteria | 2412 |
| 46 | Ga0070676_10068180 | 3300005328 | Bacteria | 2129 |
| 47 | Ga0070676_10154730 | 3300005328 | Bacteria | 1471 |
| 48 | Ga0070676_10501380 | 3300005328 | Bacteria | 862 |
| 49 | Ga0070676_10544907 | 3300005328 | Bacteria | 830 |
| 50 | Ga0070676_11147935 | 3300005328 | Bacteria | 589 |
| 51 | Ga0070683_100082772 | 3300005329 | Bacteria | 3006 |
| 52 | Ga0070683_100282219 | 3300005329 | Bacteria | 1579 |
| 53 | Ga0070683_100321487 | 3300005329 | Bacteria | 1473 |
| 54 | Ga0070683_100395674 | 3300005329 | Bacteria | 1317 |
| 55 | Ga0070683_100785927 | 3300005329 | Bacteria | 912 |
| 56 | Ga0070683_101159199 | 3300005329 | Bacteria | 742 |
| 57 | Ga0070683_101541339 | 3300005329 | Bacteria | 639 |
| 58 | Ga0070690_100096765 | 3300005330 | Bacteria | 1951 |
| 59 | Ga0070690_100108055 | 3300005330 | Bacteria | 1852 |
| 60 | Ga0070690_100280899 | 3300005330 | Bacteria | 1188 |
| 61 | Ga0070690_100355078 | 3300005330 | Bacteria | 1065 |
| 62 | Ga0070690_100556223 | 3300005330 | Bacteria | 866 |
| 63 | Ga0070690_101393984 | 3300005330 | Bacteria | 564 |
| 64 | Ga0070690_101536822 | 3300005330 | Bacteria | 538 |
| 65 | Ga0070670_100187330 | 3300005331 | Bacteria | 1797 |
| 66 | Ga0070670_100225720 | 3300005331 | Bacteria | 1630 |
| 67 | Ga0070670_100280892 | 3300005331 | Bacteria | 1454 |
| 68 | Ga0070670_100422453 | 3300005331 | Bacteria | 1179 |
| 69 | Ga0070670_101554017 | 3300005331 | Unclassified | 608 |
| 70 | Ga0070670_101924988 | 3300005331 | Bacteria | 545 |
| 71 | Ga0070677_10082651 | 3300005333 | Bacteria | 1378 |
| 72 | Ga0070677_10096451 | 3300005333 | Bacteria | 1295 |
| 73 | Ga0070677_10291468 | 3300005333 | Bacteria | 826 |
| 74 | Ga0070677_10661396 | 3300005333 | Bacteria | 585 |
| 75 | Ga0070677_10814696 | 3300005333 | Bacteria | 534 |
| 76 | Ga0068869_100541730 | 3300005334 | Bacteria | 976 |
| 77 | Ga0068869_101324623 | 3300005334 | Bacteria | 636 |
| 78 | Ga0068869_101360188 | 3300005334 | Bacteria | 628 |
| 79 | Ga0070666_10342575 | 3300005335 | Bacteria | 1068 |
| 80 | Ga0070666_10422167 | 3300005335 | Bacteria | 960 |
| 81 | Ga0070666_10561302 | 3300005335 | Bacteria | 831 |
| 82 | Ga0070666_10749516 | 3300005335 | Bacteria | 718 |
| 83 | Ga0070666_10949497 | 3300005335 | Bacteria | 637 |
| 84 | Ga0070680_100246940 | 3300005336 | Bacteria | 1509 |
| 85 | Ga0070680_100374091 | 3300005336 | Bacteria | 1212 |
| 86 | Ga0070680_101531973 | 3300005336 | Bacteria | 577 |
| 87 | Ga0070682_100138542 | 3300005337 | Bacteria | 1656 |
| 88 | Ga0070682_100186969 | 3300005337 | Bacteria | 1452 |
| 89 | Ga0070682_100303170 | 3300005337 | Bacteria | 1173 |
| 90 | Ga0070682_100389439 | 3300005337 | Bacteria | 1051 |
| 91 | Ga0070682_100511241 | 3300005337 | Bacteria | 932 |
| 92 | Ga0070682_100910926 | 3300005337 | Bacteria | 723 |
| 93 | Ga0070682_101129308 | 3300005337 | Bacteria | 658 |
| 94 | Ga0068868_100239665 | 3300005338 | Bacteria | 1523 |
| 95 | Ga0068868_100438758 | 3300005338 | Bacteria | 1133 |
| 96 | Ga0068868_101104804 | 3300005338 | Bacteria | 730 |
| 97 | Ga0070660_100138296 | 3300005339 | Bacteria | 1952 |
| 98 | Ga0070660_100226383 | 3300005339 | Bacteria | 1521 |
| 99 | Ga0070660_100255987 | 3300005339 | Bacteria | 1428 |
| 100 | Ga0070660_100281025 | 3300005339 | Bacteria | 1362 |
| 101 | Ga0070660_101018482 | 3300005339 | Bacteria | 700 |
| 102 | Ga0070689_100131776 | 3300005340 | Bacteria | 2005 |
| 103 | Ga0070689_100182518 | 3300005340 | Bacteria | 1705 |
| 104 | Ga0070689_100237098 | 3300005340 | Bacteria | 1501 |
| 105 | Ga0070689_100263329 | 3300005340 | Bacteria | 1425 |
| 106 | Ga0070689_100307645 | 3300005340 | Bacteria | 1321 |
| 107 | Ga0070691_10087471 | 3300005341 | Bacteria | 1532 |
| 108 | Ga0070691_10548290 | 3300005341 | Bacteria | 675 |
| 109 | Ga0070691_10775764 | 3300005341 | Bacteria | 582 |
| 110 | Ga0070687_100154356 | 3300005343 | Bacteria | 1351 |
| 111 | Ga0070687_100215447 | 3300005343 | Bacteria | 1173 |
| 112 | Ga0070687_100246019 | 3300005343 | Bacteria | 1108 |
| 113 | Ga0070687_100834874 | 3300005343 | Bacteria | 656 |
| 114 | Ga0070661_100215295 | 3300005344 | Bacteria | 1472 |
| 115 | Ga0070661_100428724 | 3300005344 | Bacteria | 1049 |
| 116 | Ga0070661_101393085 | 3300005344 | Bacteria | 590 |
| 117 | Ga0070692_11256858 | 3300005345 | Bacteria | 529 |
| 118 | Ga0070668_100036900 | 3300005347 | Bacteria | 3730 |
| 119 | Ga0070668_100202767 | 3300005347 | Bacteria | 1629 |
| 120 | Ga0070668_100223535 | 3300005347 | Bacteria | 1554 |
| 121 | Ga0070668_100432266 | 3300005347 | Bacteria | 1129 |
| 122 | Ga0070668_100622872 | 3300005347 | Bacteria | 946 |
| 123 | Ga0070668_100710920 | 3300005347 | Bacteria | 887 |
| 124 | Ga0070668_100939626 | 3300005347 | Bacteria | 775 |
| 125 | Ga0070668_101563063 | 3300005347 | Bacteria | 604 |
| 126 | Ga0070668_101824250 | 3300005347 | Unclassified | 559 |
| 127 | Ga0070669_100139543 | 3300005353 | Bacteria | 1867 |
| 128 | Ga0070669_100264300 | 3300005353 | Bacteria | 1374 |
| 129 | Ga0070669_100800123 | 3300005353 | Bacteria | 801 |
| 130 | Ga0070669_101880248 | 3300005353 | Bacteria | 523 |
| 131 | Ga0070675_100257815 | 3300005354 | Bacteria | 1527 |
| 132 | Ga0070675_100441898 | 3300005354 | Bacteria | 1165 |
| 133 | Ga0070675_100886082 | 3300005354 | Bacteria | 817 |
| 134 | Ga0070675_101004375 | 3300005354 | Bacteria | 766 |
| 135 | Ga0070675_101416461 | 3300005354 | Bacteria | 641 |
| 136 | Ga0070675_101612126 | 3300005354 | Bacteria | 599 |
| 137 | Ga0070675_101801909 | 3300005354 | Bacteria | 565 |
| 138 | Ga0070671_100155121 | 3300005355 | Bacteria | 1934 |
| 139 | Ga0070671_100159025 | 3300005355 | Bacteria | 1909 |
| 140 | Ga0070671_101369437 | 3300005355 | Bacteria | 625 |
| 141 | Ga0070671_101739141 | 3300005355 | Bacteria | 554 |
| 142 | Ga0070674_100178188 | 3300005356 | Bacteria | 1626 |
| 143 | Ga0070674_100211510 | 3300005356 | Bacteria | 1503 |
| 144 | Ga0070674_100269575 | 3300005356 | Bacteria | 1345 |
| 145 | Ga0070674_100280377 | 3300005356 | Bacteria | 1321 |
| 146 | Ga0070674_100284263 | 3300005356 | Bacteria | 1312 |
| 147 | Ga0070674_100992231 | 3300005356 | Bacteria | 736 |
| 148 | Ga0070674_101829734 | 3300005356 | Bacteria | 551 |
| 149 | Ga0070673_100218792 | 3300005364 | Bacteria | 1647 |
| 150 | Ga0070673_100249840 | 3300005364 | Bacteria | 1545 |
| 151 | Ga0070673_100695017 | 3300005364 | Bacteria | 934 |
| 152 | Ga0070673_100981672 | 3300005364 | Bacteria | 786 |
| 153 | Ga0070688_100059557 | 3300005365 | Bacteria | 2408 |
| 154 | Ga0070688_100238065 | 3300005365 | Bacteria | 1290 |
| 155 | Ga0070688_100321332 | 3300005365 | Bacteria | 1125 |
| 156 | Ga0070688_100369152 | 3300005365 | Bacteria | 1055 |
| 157 | Ga0070688_101665974 | 3300005365 | Bacteria | 522 |
| 158 | Ga0070659_100291239 | 3300005366 | Bacteria | 1360 |
| 159 | Ga0070659_100315096 | 3300005366 | Bacteria | 1307 |
| 160 | Ga0070659_100414742 | 3300005366 | Bacteria | 1138 |
| 161 | Ga0070659_101375429 | 3300005366 | Bacteria | 627 |
| 162 | Ga0070667_100056812 | 3300005367 | Bacteria | 3306 |
| 163 | Ga0070667_100394719 | 3300005367 | Bacteria | 1258 |
| 164 | Ga0070667_100817664 | 3300005367 | Bacteria | 865 |
| 165 | Ga0070667_100869401 | 3300005367 | Bacteria | 839 |
| 166 | Ga0070703_10050110 | 3300005406 | Bacteria | 1332 |
| 167 | Ga0070709_10007373 | 3300005434 | Bacteria | 6026 |
| 168 | Ga0070709_10183406 | 3300005434 | Bacteria | 1471 |
| 169 | Ga0070709_10211288 | 3300005434 | Bacteria | 1379 |
| 170 | Ga0070709_10480528 | 3300005434 | Bacteria | 941 |
| 171 | Ga0070709_10989269 | 3300005434 | Bacteria | 669 |
| 172 | Ga0070709_11005027 | 3300005434 | Bacteria | 664 |
| 173 | Ga0070709_11514537 | 3300005434 | Bacteria | 545 |
| 174 | Ga0070714_100039508 | 3300005435 | Bacteria | 3973 |
| 175 | Ga0070714_100103084 | 3300005435 | Bacteria | 2516 |
| 176 | Ga0070714_100214295 | 3300005435 | Bacteria | 1767 |
| 177 | Ga0070714_100278380 | 3300005435 | Bacteria | 1554 |
| 178 | Ga0070714_100321287 | 3300005435 | Bacteria | 1447 |
| 179 | Ga0070714_100345328 | 3300005435 | Bacteria | 1397 |
| 180 | Ga0070714_100350934 | 3300005435 | Bacteria | 1385 |
| 181 | Ga0070714_100354790 | 3300005435 | Bacteria | 1378 |
| 182 | Ga0070714_101002269 | 3300005435 | Bacteria | 813 |
| 183 | Ga0070714_101192174 | 3300005435 | Bacteria | 743 |
| 184 | Ga0070714_101322109 | 3300005435 | Bacteria | 704 |
| 185 | Ga0070714_102114060 | 3300005435 | Bacteria | 549 |
| 186 | Ga0070714_102200768 | 3300005435 | Bacteria | 537 |
| 187 | Ga0070713_100253604 | 3300005436 | Bacteria | 1605 |
| 188 | Ga0070713_100262123 | 3300005436 | Bacteria | 1580 |
| 189 | Ga0070713_100264595 | 3300005436 | Bacteria | 1573 |
| 190 | Ga0070713_100374415 | 3300005436 | Bacteria | 1325 |
| 191 | Ga0070713_100375535 | 3300005436 | Bacteria | 1323 |
| 192 | Ga0070713_100483323 | 3300005436 | Bacteria | 1167 |
| 193 | Ga0070713_100570730 | 3300005436 | Bacteria | 1073 |
| 194 | Ga0070713_100787429 | 3300005436 | Bacteria | 911 |
| 195 | Ga0070713_101095290 | 3300005436 | Bacteria | 770 |
| 196 | Ga0070713_101121674 | 3300005436 | Bacteria | 760 |
| 197 | Ga0070713_101210100 | 3300005436 | Unclassified | 731 |
| 198 | Ga0070713_101222213 | 3300005436 | Bacteria | 727 |
| 199 | Ga0070713_101748095 | 3300005436 | Bacteria | 604 |
| 200 | Ga0070713_102120998 | 3300005436 | Unclassified | 545 |
| 201 | Ga0070710_10042070 | 3300005437 | Bacteria | 2525 |
| 202 | Ga0070710_10099555 | 3300005437 | Bacteria | 1729 |
| 203 | Ga0070710_10152482 | 3300005437 | Bacteria | 1426 |
| 204 | Ga0070710_10225805 | 3300005437 | Bacteria | 1193 |
| 205 | Ga0070710_10618977 | 3300005437 | Bacteria | 755 |
| 206 | Ga0070710_11101183 | 3300005437 | Unclassified | 583 |
| 207 | Ga0070701_10031901 | 3300005438 | Bacteria | 2618 |
| 208 | Ga0070701_11352137 | 3300005438 | Bacteria | 511 |
| 209 | Ga0070711_100135248 | 3300005439 | Bacteria | 1841 |
| 210 | Ga0070711_100259873 | 3300005439 | Bacteria | 1365 |
| 211 | Ga0070711_100361775 | 3300005439 | Bacteria | 1169 |
| 212 | Ga0070711_100534772 | 3300005439 | Bacteria | 970 |
| 213 | Ga0070711_100728846 | 3300005439 | Bacteria | 836 |
| 214 | Ga0070711_101076548 | 3300005439 | Bacteria | 692 |
| 215 | Ga0070711_101366900 | 3300005439 | Unclassified | 616 |
| 216 | Ga0070711_101784635 | 3300005439 | Bacteria | 540 |
| 217 | Ga0070705_100530233 | 3300005440 | Bacteria | 899 |
| 218 | Ga0070700_100093317 | 3300005441 | Bacteria | 1968 |
| 219 | Ga0070700_100211477 | 3300005441 | Bacteria | 1369 |
| 220 | Ga0070700_100256618 | 3300005441 | Bacteria | 1257 |
| 221 | Ga0070700_100393429 | 3300005441 | Bacteria | 1040 |
| 222 | Ga0070694_100270217 | 3300005444 | Bacteria | 1293 |
| 223 | Ga0070694_100315366 | 3300005444 | Bacteria | 1202 |
| 224 | Ga0070708_100221416 | 3300005445 | Bacteria | 1775 |
| 225 | Ga0070708_100485897 | 3300005445 | Bacteria | 1165 |
| 226 | Ga0070708_101029774 | 3300005445 | Bacteria | 772 |
| 227 | Ga0070708_101368530 | 3300005445 | Bacteria | 660 |
| 228 | Ga0070708_101620701 | 3300005445 | Bacteria | 602 |
| 229 | Ga0070663_100062297 | 3300005455 | Bacteria | 2688 |
| 230 | Ga0070663_100194381 | 3300005455 | Bacteria | 1581 |
| 231 | Ga0070663_100224723 | 3300005455 | Bacteria | 1475 |
| 232 | Ga0070663_100275601 | 3300005455 | Bacteria | 1339 |
| 233 | Ga0070663_100357689 | 3300005455 | Bacteria | 1184 |
| 234 | Ga0070663_100381793 | 3300005455 | Bacteria | 1148 |
| 235 | Ga0070663_100558775 | 3300005455 | Bacteria | 957 |
| 236 | Ga0070663_101009936 | 3300005455 | Bacteria | 724 |
| 237 | Ga0070663_101230295 | 3300005455 | Unclassified | 659 |
| 238 | Ga0070663_101750475 | 3300005455 | Bacteria | 556 |
| 239 | Ga0070678_100067725 | 3300005456 | Bacteria | 2658 |
| 240 | Ga0070678_100163166 | 3300005456 | Bacteria | 1808 |
| 241 | Ga0070678_100238069 | 3300005456 | Bacteria | 1520 |
| 242 | Ga0070678_100360294 | 3300005456 | Bacteria | 1253 |
| 243 | Ga0070678_100472704 | 3300005456 | Bacteria | 1102 |
| 244 | Ga0070678_100984417 | 3300005456 | Bacteria | 774 |
| 245 | Ga0070662_100164042 | 3300005457 | Bacteria | 1740 |
| 246 | Ga0070662_100227482 | 3300005457 | Bacteria | 1491 |
| 247 | Ga0070662_100313889 | 3300005457 | Bacteria | 1277 |
| 248 | Ga0070662_100352041 | 3300005457 | Bacteria | 1207 |
| 249 | Ga0070662_100471016 | 3300005457 | Bacteria | 1045 |
| 250 | Ga0070662_100939296 | 3300005457 | Bacteria | 739 |
| 251 | Ga0070681_10064911 | 3300005458 | Bacteria | 3621 |
| 252 | Ga0070681_10218494 | 3300005458 | Bacteria | 1822 |
| 253 | Ga0070681_10231301 | 3300005458 | Bacteria | 1763 |
| 254 | Ga0070681_10249129 | 3300005458 | Bacteria | 1689 |
| 255 | Ga0070681_10290308 | 3300005458 | Bacteria | 1545 |
| 256 | Ga0070681_10584768 | 3300005458 | Bacteria | 1031 |
| 257 | Ga0070681_11005594 | 3300005458 | Bacteria | 754 |
| 258 | Ga0068867_100159997 | 3300005459 | Bacteria | 1775 |
| 259 | Ga0068867_100164031 | 3300005459 | Bacteria | 1754 |
| 260 | Ga0068867_100327321 | 3300005459 | Bacteria | 1271 |
| 261 | Ga0068867_100732032 | 3300005459 | Bacteria | 876 |
| 262 | Ga0068867_101511345 | 3300005459 | Bacteria | 625 |
| 263 | Ga0068867_102278151 | 3300005459 | Bacteria | 515 |
| 264 | Ga0070685_10108330 | 3300005466 | Bacteria | 1707 |
| 265 | Ga0070685_10311014 | 3300005466 | Bacteria | 1065 |
| 266 | Ga0070685_10914670 | 3300005466 | Bacteria | 654 |
| 267 | Ga0070706_100061903 | 3300005467 | Bacteria | 3457 |
| 268 | Ga0070706_100448732 | 3300005467 | Bacteria | 1200 |
| 269 | Ga0070706_101340202 | 3300005467 | Bacteria | 656 |
| 270 | Ga0070707_100212441 | 3300005468 | Bacteria | 1885 |
| 271 | Ga0070707_100310197 | 3300005468 | Bacteria | 1533 |
| 272 | Ga0070707_100489432 | 3300005468 | Bacteria | 1191 |
| 273 | Ga0070698_100126881 | 3300005471 | Bacteria | 2508 |
| 274 | Ga0070698_100294574 | 3300005471 | Bacteria | 1554 |
| 275 | Ga0070698_100299611 | 3300005471 | Bacteria | 1538 |
| 276 | Ga0070698_100380620 | 3300005471 | Bacteria | 1344 |
| 277 | Ga0070698_101714401 | 3300005471 | Bacteria | 581 |
| 278 | Ga0070699_100083325 | 3300005518 | Bacteria | 2789 |
| 279 | Ga0070699_100385025 | 3300005518 | Unclassified | 1266 |
| 280 | Ga0070699_100813820 | 3300005518 | Bacteria | 855 |
| 281 | Ga0070699_101052286 | 3300005518 | Bacteria | 746 |
| 282 | Ga0070699_101214851 | 3300005518 | Bacteria | 691 |
| 283 | Ga0070679_100015955 | 3300005530 | Bacteria | 7232 |
| 284 | Ga0070679_100325124 | 3300005530 | Bacteria | 1487 |
| 285 | Ga0070679_101583424 | 3300005530 | Bacteria | 603 |
| 286 | Ga0070684_100334507 | 3300005535 | Bacteria | 1392 |
| 287 | Ga0070684_100429803 | 3300005535 | Bacteria | 1219 |
| 288 | Ga0070684_100662915 | 3300005535 | Bacteria | 972 |
| 289 | Ga0070684_101362088 | 3300005535 | Unclassified | 668 |
| 290 | Ga0070684_101536390 | 3300005535 | Bacteria | 628 |
| 291 | Ga0070684_101862982 | 3300005535 | Bacteria | 568 |
| 292 | Ga0070684_102197908 | 3300005535 | Bacteria | 521 |
| 293 | Ga0070684_102330390 | 3300005535 | Bacteria | 505 |
| 294 | Ga0070697_100143250 | 3300005536 | Bacteria | 2011 |
| 295 | Ga0070697_100186018 | 3300005536 | Bacteria | 1761 |
| 296 | Ga0070697_100344910 | 3300005536 | Bacteria | 1285 |
| 297 | Ga0070697_100449806 | 3300005536 | Bacteria | 1122 |
| 298 | Ga0068853_100253025 | 3300005539 | Bacteria | 1617 |
| 299 | Ga0068853_100300369 | 3300005539 | Bacteria | 1484 |
| 300 | Ga0068853_100338471 | 3300005539 | Bacteria | 1398 |
| 301 | Ga0068853_100403701 | 3300005539 | Bacteria | 1279 |
| 302 | Ga0068853_100537465 | 3300005539 | Bacteria | 1106 |
| 303 | Ga0068853_100610392 | 3300005539 | Bacteria | 1036 |
| 304 | Ga0068853_101981645 | 3300005539 | Bacteria | 565 |
| 305 | Ga0070672_100182458 | 3300005543 | Bacteria | 1749 |
| 306 | Ga0070672_100187632 | 3300005543 | Bacteria | 1725 |
| 307 | Ga0070672_100190547 | 3300005543 | Bacteria | 1712 |
| 308 | Ga0070672_100209362 | 3300005543 | Bacteria | 1633 |
| 309 | Ga0070672_100234742 | 3300005543 | Bacteria | 1541 |
| 310 | Ga0070672_100359123 | 3300005543 | Bacteria | 1243 |
| 311 | Ga0070672_100862265 | 3300005543 | Bacteria | 799 |
| 312 | Ga0070672_102088004 | 3300005543 | Bacteria | 511 |
| 313 | Ga0070686_100094323 | 3300005544 | Bacteria | 2008 |
| 314 | Ga0070686_100239382 | 3300005544 | Bacteria | 1320 |
| 315 | Ga0070686_100243742 | 3300005544 | Bacteria | 1310 |
| 316 | Ga0070686_100317851 | 3300005544 | Bacteria | 1160 |
| 317 | Ga0070686_100342371 | 3300005544 | Bacteria | 1121 |
| 318 | Ga0070686_100678797 | 3300005544 | Bacteria | 819 |
| 319 | Ga0070686_101740701 | 3300005544 | Bacteria | 530 |
| 320 | Ga0070695_100178255 | 3300005545 | Bacteria | 1504 |
| 321 | Ga0070696_101015122 | 3300005546 | Bacteria | 694 |
| 322 | Ga0070696_101518869 | 3300005546 | Bacteria | 574 |
| 323 | Ga0070693_100146738 | 3300005547 | Bacteria | 1490 |
| 324 | Ga0070693_101405532 | 3300005547 | Bacteria | 543 |
| 325 | Ga0070665_100031069 | 3300005548 | Bacteria | 5375 |
| 326 | Ga0070665_100272951 | 3300005548 | Bacteria | 1693 |
| 327 | Ga0070665_100319662 | 3300005548 | Bacteria | 1556 |
| 328 | Ga0070665_100486099 | 3300005548 | Bacteria | 1245 |
| 329 | Ga0070665_100675686 | 3300005548 | Bacteria | 1046 |
| 330 | Ga0070665_100740737 | 3300005548 | Bacteria | 996 |
| 331 | Ga0070665_101868720 | 3300005548 | Bacteria | 607 |
| 332 | Ga0070665_102063509 | 3300005548 | Bacteria | 575 |
| 333 | Ga0070704_100133025 | 3300005549 | Bacteria | 1931 |
| 334 | Ga0070704_100383689 | 3300005549 | Bacteria | 1194 |
| 335 | Ga0070704_100823641 | 3300005549 | Bacteria | 831 |
| 336 | Ga0070704_101774355 | 3300005549 | Bacteria | 571 |
| 337 | Ga0068855_100051034 | 3300005563 | Bacteria | 4873 |
| 338 | Ga0068855_100500011 | 3300005563 | Bacteria | 1321 |
| 339 | Ga0068855_100694257 | 3300005563 | Bacteria | 1090 |
| 340 | Ga0068855_101241199 | 3300005563 | Bacteria | 773 |
| 341 | Ga0068855_102485872 | 3300005563 | Bacteria | 515 |
| 342 | Ga0070664_100050384 | 3300005564 | Bacteria | 3523 |
| 343 | Ga0070664_100092878 | 3300005564 | Bacteria | 2614 |
| 344 | Ga0070664_101120037 | 3300005564 | Bacteria | 742 |
| 345 | Ga0070664_101491894 | 3300005564 | Bacteria | 640 |
| 346 | Ga0070664_101837897 | 3300005564 | Bacteria | 575 |
| 347 | Ga0070664_102017298 | 3300005564 | Bacteria | 547 |
| 348 | Ga0070664_102367342 | 3300005564 | Bacteria | 504 |
| 349 | Ga0068857_101089966 | 3300005577 | Bacteria | 771 |
| 350 | Ga0068857_101184017 | 3300005577 | Bacteria | 740 |
| 351 | Ga0068857_101189980 | 3300005577 | Bacteria | 738 |
| 352 | Ga0068857_101729938 | 3300005577 | Bacteria | 611 |
| 353 | Ga0068854_100043543 | 3300005578 | Bacteria | 3183 |
| 354 | Ga0068854_100187797 | 3300005578 | Bacteria | 1618 |
| 355 | Ga0068854_101455686 | 3300005578 | Bacteria | 621 |
| 356 | Ga0068854_102200645 | 3300005578 | Bacteria | 510 |
| 357 | Ga0068856_100085585 | 3300005614 | Bacteria | 3132 |
| 358 | Ga0068856_100203240 | 3300005614 | Bacteria | 1996 |
| 359 | Ga0068856_100313694 | 3300005614 | Bacteria | 1586 |
| 360 | Ga0068856_100319130 | 3300005614 | Bacteria | 1571 |
| 361 | Ga0068856_100493371 | 3300005614 | Bacteria | 1245 |
| 362 | Ga0068856_100897353 | 3300005614 | Bacteria | 905 |
| 363 | Ga0068856_101008967 | 3300005614 | Unclassified | 851 |
| 364 | Ga0068856_101061294 | 3300005614 | Bacteria | 828 |
| 365 | Ga0068856_101397130 | 3300005614 | Bacteria | 715 |
| 366 | Ga0068856_101698958 | 3300005614 | Bacteria | 644 |
| 367 | Ga0068856_101946195 | 3300005614 | Bacteria | 599 |
| 368 | Ga0068856_102170796 | 3300005614 | Bacteria | 564 |
| 369 | Ga0068856_102240363 | 3300005614 | Bacteria | 555 |
| 370 | Ga0070702_100122363 | 3300005615 | Bacteria | 1631 |
| 371 | Ga0070702_100135966 | 3300005615 | Bacteria | 1559 |
| 372 | Ga0070702_100206725 | 3300005615 | Bacteria | 1303 |
| 373 | Ga0070702_100449184 | 3300005615 | Bacteria | 935 |
| 374 | Ga0070702_100649177 | 3300005615 | Bacteria | 798 |
| 375 | Ga0070702_101587332 | 3300005615 | Bacteria | 541 |
| 376 | Ga0068852_100507673 | 3300005616 | Bacteria | 1201 |
| 377 | Ga0068852_100707716 | 3300005616 | Bacteria | 1018 |
| 378 | Ga0068852_100812394 | 3300005616 | Bacteria | 949 |
| 379 | Ga0068859_100475036 | 3300005617 | Bacteria | 1346 |
| 380 | Ga0068859_100526729 | 3300005617 | Bacteria | 1277 |
| 381 | Ga0068859_101242091 | 3300005617 | Bacteria | 821 |
| 382 | Ga0068864_100310363 | 3300005618 | Bacteria | 1479 |
| 383 | Ga0068864_100342258 | 3300005618 | Bacteria | 1409 |
| 384 | Ga0068864_100708233 | 3300005618 | Bacteria | 984 |
| 385 | Ga0068864_101001942 | 3300005618 | Bacteria | 829 |
| 386 | Ga0068864_101360730 | 3300005618 | Bacteria | 711 |
| 387 | Ga0068866_10064864 | 3300005718 | Bacteria | 1908 |
| 388 | Ga0068866_10077897 | 3300005718 | Bacteria | 1772 |
| 389 | Ga0068866_10167903 | 3300005718 | Bacteria | 1286 |
| 390 | Ga0068866_10602677 | 3300005718 | Bacteria | 742 |
| 391 | Ga0068866_10717140 | 3300005718 | Bacteria | 687 |
| 392 | Ga0068861_100265764 | 3300005719 | Bacteria | 1471 |
| 393 | Ga0068861_100286171 | 3300005719 | Bacteria | 1421 |
| 394 | Ga0068861_100447604 | 3300005719 | Bacteria | 1157 |
| 395 | Ga0068870_10126480 | 3300005840 | Bacteria | 1479 |
| 396 | Ga0068870_11409466 | 3300005840 | Bacteria | 511 |
| 397 | Ga0068863_100277736 | 3300005841 | Bacteria | 1622 |
| 398 | Ga0068863_100342412 | 3300005841 | Bacteria | 1455 |
| 399 | Ga0068863_100393305 | 3300005841 | Bacteria | 1355 |
| 400 | Ga0068863_102444477 | 3300005841 | Bacteria | 532 |
| 401 | Ga0068858_100130658 | 3300005842 | Bacteria | 2355 |
| 402 | Ga0068858_100220190 | 3300005842 | Bacteria | 1797 |
| 403 | Ga0068858_100320711 | 3300005842 | Bacteria | 1481 |
| 404 | Ga0068858_100472340 | 3300005842 | Bacteria | 1210 |
| 405 | Ga0068860_100168570 | 3300005843 | Bacteria | 2115 |
| 406 | Ga0068860_100371272 | 3300005843 | Bacteria | 1411 |
| 407 | Ga0068860_100449053 | 3300005843 | Bacteria | 1282 |
| 408 | Ga0068860_102792641 | 3300005843 | Bacteria | 506 |
| 409 | Ga0068862_100805172 | 3300005844 | Bacteria | 918 |
| 410 | Ga0068862_101738404 | 3300005844 | Unclassified | 632 |
| 411 | Ga0068862_101869816 | 3300005844 | Bacteria | 610 |
| 412 | Ga0081455_10046286 | 3300005937 | Bacteria | 3776 |
| 413 | Ga0081455_10250741 | 3300005937 | Bacteria | 1295 |
| 414 | Ga0081540_1017006 | 3300005983 | Bacteria | 4521 |
| 415 | Ga0081540_1074102 | 3300005983 | Bacteria | 1561 |
| 416 | Ga0081540_1086022 | 3300005983 | Bacteria | 1398 |
| 417 | Ga0081539_10114267 | 3300005985 | Bacteria | 1353 |
| 418 | Ga0070717_10213997 | 3300006028 | Bacteria | 1692 |
| 419 | Ga0070717_10221698 | 3300006028 | Bacteria | 1662 |
| 420 | Ga0070717_10256053 | 3300006028 | Bacteria | 1547 |
| 421 | Ga0070717_10367959 | 3300006028 | Bacteria | 1288 |
| 422 | Ga0070717_10417560 | 3300006028 | Bacteria | 1207 |
| 423 | Ga0070717_10421593 | 3300006028 | Bacteria | 1200 |
| 424 | Ga0070717_10495798 | 3300006028 | Bacteria | 1103 |
| 425 | Ga0070717_11202727 | 3300006028 | Bacteria | 690 |
| 426 | Ga0070717_11769542 | 3300006028 | Bacteria | 559 |
| 427 | Ga0075365_10727129 | 3300006038 | Bacteria | 701 |
| 428 | Ga0075368_10329634 | 3300006042 | Bacteria | 662 |
| 429 | Ga0075368_10391967 | 3300006042 | Bacteria | 609 |
| 430 | Ga0075368_10508771 | 3300006042 | Bacteria | 538 |
| 431 | Ga0075364_10145535 | 3300006051 | Bacteria | 1595 |
| 432 | Ga0070715_10031823 | 3300006163 | Bacteria | 2144 |
| 433 | Ga0070715_10087313 | 3300006163 | Bacteria | 1428 |
| 434 | Ga0070715_10131844 | 3300006163 | Bacteria | 1204 |
| 435 | Ga0070715_10135376 | 3300006163 | Bacteria | 1190 |
| 436 | Ga0070716_100130300 | 3300006173 | Bacteria | 1589 |
| 437 | Ga0070716_100152675 | 3300006173 | Bacteria | 1487 |
| 438 | Ga0070716_100165240 | 3300006173 | Bacteria | 1438 |
| 439 | Ga0070716_100187164 | 3300006173 | Bacteria | 1365 |
| 440 | Ga0070716_100240877 | 3300006173 | Bacteria | 1226 |
| 441 | Ga0070716_101216022 | 3300006173 | Bacteria | 606 |
| 442 | Ga0070716_101818830 | 3300006173 | Bacteria | 505 |
| 443 | Ga0070712_100113774 | 3300006175 | Bacteria | 2024 |
| 444 | Ga0070712_100124070 | 3300006175 | Bacteria | 1947 |
| 445 | Ga0070712_100140936 | 3300006175 | Bacteria | 1840 |
| 446 | Ga0070712_100196704 | 3300006175 | Bacteria | 1581 |
| 447 | Ga0070712_100300126 | 3300006175 | Bacteria | 1300 |
| 448 | Ga0070712_100362005 | 3300006175 | Bacteria | 1190 |
| 449 | Ga0070712_100670037 | 3300006175 | Bacteria | 883 |
| 450 | Ga0070712_101854711 | 3300006175 | Unclassified | 528 |
| 451 | Ga0075362_10343762 | 3300006177 | Bacteria | 746 |
| 452 | Ga0075366_10317694 | 3300006195 | Bacteria | 954 |
| 453 | Ga0075366_11028025 | 3300006195 | Bacteria | 514 |
| 454 | Ga0097621_100165706 | 3300006237 | Bacteria | 1902 |
| 455 | Ga0097621_100353795 | 3300006237 | Bacteria | 1307 |
| 456 | Ga0097621_100509307 | 3300006237 | Bacteria | 1091 |
| 457 | Ga0097621_101134455 | 3300006237 | Bacteria | 735 |
| 458 | Ga0097621_101213405 | 3300006237 | Bacteria | 711 |
| 459 | Ga0097621_101624450 | 3300006237 | Bacteria | 615 |
| 460 | Ga0075370_10018351 | 3300006353 | Bacteria | 3796 |
| 461 | Ga0075370_10398210 | 3300006353 | Bacteria | 826 |
| 462 | Ga0075370_10479554 | 3300006353 | Bacteria | 750 |
| 463 | Ga0068871_100223343 | 3300006358 | Bacteria | 1633 |
| 464 | Ga0068871_100418847 | 3300006358 | Bacteria | 1196 |
| 465 | Ga0068871_100503616 | 3300006358 | Bacteria | 1092 |
| 466 | Ga0068871_100678043 | 3300006358 | Bacteria | 943 |
| 467 | Ga0068871_100984709 | 3300006358 | Bacteria | 785 |
| 468 | Ga0068871_101200222 | 3300006358 | Bacteria | 712 |
| 469 | Ga0068871_101320802 | 3300006358 | Bacteria | 679 |
| 470 | Ga0068871_101455426 | 3300006358 | Bacteria | 647 |
| 471 | Ga0068871_102181991 | 3300006358 | Bacteria | 528 |
| 472 | Ga0075431_100243693 | 3300006847 | Bacteria | 1828 |
| 473 | Ga0075433_10211151 | 3300006852 | Bacteria | 1725 |
| 474 | Ga0075434_100342412 | 3300006871 | Bacteria | 1516 |
| 475 | Ga0075429_100291936 | 3300006880 | Bacteria | 1428 |
| 476 | Ga0075429_101882346 | 3300006880 | Unclassified | 518 |
| 477 | Ga0068865_100117360 | 3300006881 | Bacteria | 1972 |
| 478 | Ga0068865_100147778 | 3300006881 | Bacteria | 1779 |
| 479 | Ga0068865_100278151 | 3300006881 | Bacteria | 1331 |
| 480 | Ga0068865_100337672 | 3300006881 | Bacteria | 1217 |
| 481 | Ga0068865_101921967 | 3300006881 | Unclassified | 536 |
| 482 | Ga0075436_100655350 | 3300006914 | Bacteria | 776 |
| 483 | Ga0075436_100791819 | 3300006914 | Bacteria | 705 |
| 484 | Ga0097620_100475015 | 3300006931 | Bacteria | 1346 |
| 485 | Ga0097620_100526695 | 3300006931 | Bacteria | 1277 |
| 486 | Ga0097620_101241979 | 3300006931 | Bacteria | 821 |
| 487 | Ga0099824_1009340 | 3300006942 | Bacteria | 12111 |
| 488 | Ga0099824_1016446 | 3300006942 | Bacteria | 6698 |
| 489 | Ga0075435_100204931 | 3300007076 | Bacteria | 1672 |
| 490 | Ga0075435_100743455 | 3300007076 | Bacteria | 853 |
| 491 | Ga0075435_100972674 | 3300007076 | Bacteria | 741 |
| 492 | Ga0099795_10058949 | 3300007788 | Bacteria | 1419 |
| 493 | Ga0099795_10155021 | 3300007788 | Bacteria | 941 |
| 494 | Ga0105251_10280255 | 3300009011 | Bacteria | 754 |
| 495 | Ga0105250_10000799 | 3300009092 | Bacteria | 18969 |
| 496 | Ga0105250_10385126 | 3300009092 | Bacteria | 619 |
| 497 | Ga0105240_10005524 | 3300009093 | Bacteria | 18841 |
| 498 | Ga0105240_10210513 | 3300009093 | Bacteria | 2272 |
| 499 | Ga0105240_10318713 | 3300009093 | Bacteria | 1773 |
| 500 | Ga0105240_10338378 | 3300009093 | Bacteria | 1710 |
| 501 | Ga0105240_10537827 | 3300009093 | Bacteria | 1294 |
| 502 | Ga0105240_10595819 | 3300009093 | Bacteria | 1217 |
| 503 | Ga0105240_11860274 | 3300009093 | Bacteria | 627 |
| 504 | Ga0105240_12489691 | 3300009093 | Bacteria | 535 |
| 505 | Ga0111539_11092854 | 3300009094 | Bacteria | 927 |
| 506 | Ga0111539_12530640 | 3300009094 | Bacteria | 595 |
| 507 | Ga0111539_12566513 | 3300009094 | Bacteria | 591 |
| 508 | Ga0105245_10162924 | 3300009098 | Bacteria | 2117 |
| 509 | Ga0105245_10255495 | 3300009098 | Bacteria | 1704 |
| 510 | Ga0105245_10264317 | 3300009098 | Bacteria | 1676 |
| 511 | Ga0105245_10732320 | 3300009098 | Bacteria | 1024 |
| 512 | Ga0105245_10873742 | 3300009098 | Bacteria | 940 |
| 513 | Ga0105245_11170307 | 3300009098 | Bacteria | 816 |
| 514 | Ga0105245_11539172 | 3300009098 | Bacteria | 716 |
| 515 | Ga0105245_12935186 | 3300009098 | Bacteria | 529 |
| 516 | Ga0105245_13045481 | 3300009098 | Bacteria | 519 |
| 517 | Ga0105247_10080414 | 3300009101 | Bacteria | 2053 |
| 518 | Ga0105247_10235613 | 3300009101 | Bacteria | 1245 |
| 519 | Ga0105247_10741872 | 3300009101 | Bacteria | 743 |
| 520 | Ga0105247_10982490 | 3300009101 | Bacteria | 658 |
| 521 | Ga0105247_11534054 | 3300009101 | Bacteria | 544 |
| 522 | Ga0105247_11672637 | 3300009101 | Bacteria | 525 |
| 523 | Ga0105243_10211452 | 3300009148 | Bacteria | 1708 |
| 524 | Ga0105243_10214752 | 3300009148 | Bacteria | 1696 |
| 525 | Ga0105243_10227350 | 3300009148 | Bacteria | 1653 |
| 526 | Ga0105243_11918131 | 3300009148 | Bacteria | 625 |
| 527 | Ga0105241_10371674 | 3300009174 | Bacteria | 1247 |
| 528 | Ga0105241_10450330 | 3300009174 | Bacteria | 1138 |
| 529 | Ga0105241_10454709 | 3300009174 | Bacteria | 1133 |
| 530 | Ga0105241_10591647 | 3300009174 | Bacteria | 1001 |
| 531 | Ga0105241_11053265 | 3300009174 | Bacteria | 764 |
| 532 | Ga0105241_11148391 | 3300009174 | Bacteria | 733 |
| 533 | Ga0105241_11732412 | 3300009174 | Bacteria | 608 |
| 534 | Ga0105241_11817377 | 3300009174 | Bacteria | 595 |
| 535 | Ga0105241_12085585 | 3300009174 | Bacteria | 560 |
| 536 | Ga0105241_12186897 | 3300009174 | Bacteria | 548 |
| 537 | Ga0105241_12365259 | 3300009174 | Bacteria | 530 |
| 538 | Ga0105242_10277795 | 3300009176 | Bacteria | 1520 |
| 539 | Ga0105242_10342528 | 3300009176 | Bacteria | 1378 |
| 540 | Ga0105242_10626926 | 3300009176 | Bacteria | 1042 |
| 541 | Ga0105242_11212483 | 3300009176 | Bacteria | 774 |
| 542 | Ga0105242_11536460 | 3300009176 | Bacteria | 697 |
| 543 | Ga0105248_10250825 | 3300009177 | Bacteria | 1992 |
| 544 | Ga0105248_10426812 | 3300009177 | Bacteria | 1493 |
| 545 | Ga0105248_10539679 | 3300009177 | Bacteria | 1315 |
| 546 | Ga0105248_11904624 | 3300009177 | Bacteria | 675 |
| 547 | Ga0105237_10002325 | 3300009545 | Bacteria | 23594 |
| 548 | Ga0105237_10077160 | 3300009545 | Bacteria | 3322 |
| 549 | Ga0105237_10161389 | 3300009545 | Bacteria | 2240 |
| 550 | Ga0105237_10228725 | 3300009545 | Bacteria | 1860 |
| 551 | Ga0105237_10288352 | 3300009545 | Bacteria | 1644 |
| 552 | Ga0105237_10313926 | 3300009545 | Bacteria | 1571 |
| 553 | Ga0105237_10313963 | 3300009545 | Bacteria | 1571 |
| 554 | Ga0105238_10001477 | 3300009551 | Bacteria | 23596 |
| 555 | Ga0105238_10108713 | 3300009551 | Bacteria | 2754 |
| 556 | Ga0105238_10169393 | 3300009551 | Bacteria | 2160 |
| 557 | Ga0105238_10194298 | 3300009551 | Bacteria | 2005 |
| 558 | Ga0105238_10241180 | 3300009551 | Bacteria | 1785 |
| 559 | Ga0105238_10280974 | 3300009551 | Bacteria | 1646 |
| 560 | Ga0105238_10308182 | 3300009551 | Bacteria | 1568 |
| 561 | Ga0105238_10434339 | 3300009551 | Bacteria | 1309 |
| 562 | Ga0105238_10988673 | 3300009551 | Bacteria | 862 |
| 563 | Ga0105238_11867698 | 3300009551 | Bacteria | 633 |
| 564 | Ga0105238_11889836 | 3300009551 | Bacteria | 630 |
| 565 | Ga0105249_10279021 | 3300009553 | Bacteria | 1668 |
| 566 | Ga0105249_11410582 | 3300009553 | Bacteria | 768 |
| 567 | Ga0105249_13109832 | 3300009553 | Bacteria | 533 |
| 568 | Ga0099796_10417279 | 3300010159 | Bacteria | 591 |
| 569 | Ga0105239_10002458 | 3300010375 | Bacteria | 23596 |
| 570 | Ga0105239_10148167 | 3300010375 | Bacteria | 2619 |
| 571 | Ga0105239_10191792 | 3300010375 | Bacteria | 2287 |
| 572 | Ga0105239_10237594 | 3300010375 | Bacteria | 2045 |
| 573 | Ga0105239_10339523 | 3300010375 | Bacteria | 1695 |
| 574 | Ga0105239_10403074 | 3300010375 | Bacteria | 1548 |
| 575 | Ga0105239_10490795 | 3300010375 | Bacteria | 1396 |
| 576 | Ga0105239_10937353 | 3300010375 | Bacteria | 994 |
| 577 | Ga0105239_11058836 | 3300010375 | Bacteria | 933 |
| 578 | Ga0105239_11528944 | 3300010375 | Bacteria | 771 |
| 579 | Ga0105239_11709873 | 3300010375 | Bacteria | 728 |
| 580 | Ga0105239_12204231 | 3300010375 | Bacteria | 641 |
| 581 | Ga0105246_10164959 | 3300011119 | Bacteria | 1691 |
| 582 | Ga0105246_10175189 | 3300011119 | Bacteria | 1646 |
| 583 | Ga0105246_10216814 | 3300011119 | Bacteria | 1497 |
| 584 | Ga0105246_10255355 | 3300011119 | Bacteria | 1393 |
| 585 | Ga0105246_10380041 | 3300011119 | Bacteria | 1167 |
| 586 | Ga0105246_10449422 | 3300011119 | Bacteria | 1083 |
| 587 | Ga0105246_10470500 | 3300011119 | Bacteria | 1061 |
| 588 | Ga0105246_10802564 | 3300011119 | Bacteria | 835 |
| 589 | Ga0105246_10839763 | 3300011119 | Bacteria | 818 |
| 590 | Ga0105246_11198592 | 3300011119 | Bacteria | 699 |
| 591 | Ga0105246_11240966 | 3300011119 | Bacteria | 688 |
| 592 | Ga0157346_1025154 | 3300012480 | Bacteria | 547 |
| 593 | Ga0157343_1015045 | 3300012488 | Bacteria | 642 |
| 594 | Ga0157313_1013363 | 3300012503 | Bacteria | 744 |
| 595 | Ga0157324_1030636 | 3300012506 | Unclassified | 607 |
| 596 | Ga0157342_1056773 | 3300012507 | Bacteria | 565 |
| 597 | Ga0157326_1006887 | 3300012513 | Unclassified | 1221 |
| 598 | Ga0157326_1010884 | 3300012513 | Bacteria | 1019 |
| 599 | Ga0157338_1008242 | 3300012515 | Bacteria | 1007 |
| 600 | Ga0157373_10228363 | 3300013100 | Bacteria | 1314 |
| 601 | Ga0157373_10256574 | 3300013100 | Bacteria | 1237 |
| 602 | Ga0157373_10538742 | 3300013100 | Bacteria | 846 |
| 603 | Ga0157373_10543279 | 3300013100 | Bacteria | 842 |
| 604 | Ga0157371_10142781 | 3300013102 | Bacteria | 1705 |
| 605 | Ga0157371_10151617 | 3300013102 | Bacteria | 1653 |
| 606 | Ga0157371_10647374 | 3300013102 | Bacteria | 788 |
| 607 | Ga0157371_11129763 | 3300013102 | Bacteria | 602 |
| 608 | Ga0157371_11183827 | 3300013102 | Bacteria | 588 |
| 609 | Ga0157370_10003645 | 3300013104 | Bacteria | 18003 |
| 610 | Ga0157370_10087500 | 3300013104 | Bacteria | 2926 |
| 611 | Ga0157370_10137061 | 3300013104 | Bacteria | 2281 |
| 612 | Ga0157370_10194609 | 3300013104 | Bacteria | 1882 |
| 613 | Ga0157370_10218349 | 3300013104 | Bacteria | 1766 |
| 614 | Ga0157370_10229388 | 3300013104 | Bacteria | 1719 |
| 615 | Ga0157370_10392962 | 3300013104 | Bacteria | 1277 |
| 616 | Ga0157370_11468934 | 3300013104 | Bacteria | 613 |
| 617 | Ga0157369_10439753 | 3300013105 | Bacteria | 1351 |
| 618 | Ga0157369_10683316 | 3300013105 | Bacteria | 1058 |
| 619 | Ga0157369_10684448 | 3300013105 | Bacteria | 1056 |
| 620 | Ga0157369_10928643 | 3300013105 | Unclassified | 892 |
| 621 | Ga0157369_11167075 | 3300013105 | Bacteria | 786 |
| 622 | Ga0157369_12455171 | 3300013105 | Bacteria | 528 |
| 623 | Ga0157374_10205120 | 3300013296 | Bacteria | 1932 |
| 624 | Ga0157374_10340397 | 3300013296 | Bacteria | 1489 |
| 625 | Ga0157374_10402091 | 3300013296 | Bacteria | 1366 |
| 626 | Ga0157374_10488770 | 3300013296 | Bacteria | 1234 |
| 627 | Ga0157374_10492328 | 3300013296 | Bacteria | 1230 |
| 628 | Ga0157374_12024923 | 3300013296 | Bacteria | 602 |
| 629 | Ga0157374_12669957 | 3300013296 | Bacteria | 527 |
| 630 | Ga0157378_10183104 | 3300013297 | Bacteria | 1972 |
| 631 | Ga0157378_10248553 | 3300013297 | Bacteria | 1702 |
| 632 | Ga0157378_10278317 | 3300013297 | Bacteria | 1612 |
| 633 | Ga0157378_10538972 | 3300013297 | Bacteria | 1171 |
| 634 | Ga0157378_12066705 | 3300013297 | Bacteria | 620 |
| 635 | Ga0157378_12236339 | 3300013297 | Bacteria | 598 |
| 636 | Ga0163162_10446629 | 3300013306 | Bacteria | 1425 |
| 637 | Ga0163162_10490939 | 3300013306 | Bacteria | 1359 |
| 638 | Ga0163162_10648610 | 3300013306 | Bacteria | 1179 |
| 639 | Ga0163162_11516500 | 3300013306 | Bacteria | 764 |
| 640 | Ga0163162_12557983 | 3300013306 | Bacteria | 587 |
| 641 | Ga0157372_10096001 | 3300013307 | Bacteria | 3378 |
| 642 | Ga0157372_10248543 | 3300013307 | Bacteria | 2064 |
| 643 | Ga0157372_10285442 | 3300013307 | Bacteria | 1919 |
| 644 | Ga0157372_11486835 | 3300013307 | Unclassified | 780 |
| 645 | Ga0157372_11503054 | 3300013307 | Bacteria | 776 |
| 646 | Ga0157372_12394250 | 3300013307 | Bacteria | 606 |
| 647 | Ga0157375_10135124 | 3300013308 | Bacteria | 2589 |
| 648 | Ga0157375_10279253 | 3300013308 | Bacteria | 1833 |
| 649 | Ga0157375_10841589 | 3300013308 | Bacteria | 1064 |
| 650 | Ga0157375_11548773 | 3300013308 | Bacteria | 783 |
| 651 | Ga0157375_12765557 | 3300013308 | Bacteria | 587 |
| 652 | Ga0157375_12772079 | 3300013308 | Bacteria | 586 |
| 653 | Ga0157375_13329664 | 3300013308 | Bacteria | 535 |
| 654 | Ga0163163_10305487 | 3300014325 | Bacteria | 1643 |
| 655 | Ga0163163_10358160 | 3300014325 | Bacteria | 1515 |
| 656 | Ga0163163_10420491 | 3300014325 | Bacteria | 1395 |
| 657 | Ga0163163_10467213 | 3300014325 | Bacteria | 1322 |
| 658 | Ga0163163_10840308 | 3300014325 | Bacteria | 982 |
| 659 | Ga0163163_11432692 | 3300014325 | Bacteria | 752 |
| 660 | Ga0163163_11553042 | 3300014325 | Bacteria | 723 |
| 661 | Ga0157380_10152291 | 3300014326 | Bacteria | 2001 |
| 662 | Ga0157380_10287587 | 3300014326 | Bacteria | 1508 |
| 663 | Ga0157380_10837023 | 3300014326 | Bacteria | 941 |
| 664 | Ga0157380_10909983 | 3300014326 | Bacteria | 906 |
| 665 | Ga0157380_11205758 | 3300014326 | Bacteria | 801 |
| 666 | Ga0157380_11544303 | 3300014326 | Bacteria | 718 |
| 667 | Ga0157380_12020281 | 3300014326 | Bacteria | 638 |
| 668 | Ga0182008_10058226 | 3300014497 | Bacteria | 1908 |
| 669 | Ga0182008_10089955 | 3300014497 | Bacteria | 1513 |
| 670 | Ga0182008_10094018 | 3300014497 | Bacteria | 1479 |
| 671 | Ga0157377_10092504 | 3300014745 | Bacteria | 1788 |
| 672 | Ga0157377_10157434 | 3300014745 | Bacteria | 1410 |
| 673 | Ga0157377_10163505 | 3300014745 | Bacteria | 1386 |
| 674 | Ga0157377_10333969 | 3300014745 | Bacteria | 1011 |
| 675 | Ga0157379_10254372 | 3300014968 | Bacteria | 1595 |
| 676 | Ga0157379_10364947 | 3300014968 | Bacteria | 1324 |
| 677 | Ga0157379_10588349 | 3300014968 | Bacteria | 1038 |
| 678 | Ga0157379_10818022 | 3300014968 | Bacteria | 880 |
| 679 | Ga0157379_11852373 | 3300014968 | Bacteria | 594 |
| 680 | Ga0157379_11921807 | 3300014968 | Bacteria | 583 |
| 681 | Ga0157376_10158083 | 3300014969 | Bacteria | 2052 |
| 682 | Ga0157376_10318166 | 3300014969 | Bacteria | 1479 |
| 683 | Ga0157376_10457277 | 3300014969 | Bacteria | 1246 |
| 684 | Ga0157376_11076190 | 3300014969 | Bacteria | 829 |
| 685 | Ga0157376_12250386 | 3300014969 | Bacteria | 584 |
| 686 | Ga0157376_12726615 | 3300014969 | Bacteria | 534 |
| 687 | Ga0163161_10140339 | 3300017792 | Bacteria | 1830 |
| 688 | Ga0163161_10200841 | 3300017792 | Bacteria | 1536 |
| 689 | Ga0163161_10221297 | 3300017792 | Bacteria | 1466 |
| 690 | Ga0163161_10229481 | 3300017792 | Bacteria | 1440 |
| 691 | Ga0163161_11086041 | 3300017792 | Bacteria | 687 |
| 692 | Ga0206353_10492261 | 3300020082 | Bacteria | 567 |
| 693 | Ga0213874_10087750 | 3300021377 | Bacteria | 1017 |
| 694 | Ga0213876_10151516 | 3300021384 | Bacteria | 1233 |
| 695 | Ga0213875_10060072 | 3300021388 | Bacteria | 1778 |
| 696 | Ga0213875_10079298 | 3300021388 | Bacteria | 1531 |
| 697 | Ga0224712_10012275 | 3300022467 | Unclassified | 2689 |
| 698 | Ga0224570_103029 | 3300022730 | Bacteria | 1084 |
| 699 | Ga0224571_102319 | 3300022734 | Bacteria | 1211 |
| 700 | Ga0224572_1022032 | 3300024225 | Bacteria | 1224 |
| 701 | Ga0228598_1023645 | 3300024227 | Bacteria | 1209 |
| 702 | Ga0207425_1001721 | 3300025245 | Bacteria | 8673 |
| 703 | Ga0207425_1013102 | 3300025245 | Bacteria | 1924 |
| 704 | Ga0209129_1000851 | 3300025258 | Bacteria | 19126 |
| 705 | Ga0209129_1014578 | 3300025258 | Bacteria | 1668 |
| 706 | Ga0209565_1024149 | 3300025263 | Bacteria | 1240 |
| 707 | Ga0207666_1007976 | 3300025271 | Bacteria | 1406 |
| 708 | Ga0209673_1000840 | 3300025273 | Bacteria | 40156 |
| 709 | Ga0209673_1044027 | 3300025273 | Bacteria | 1240 |
| 710 | Ga0209130_1026745 | 3300025284 | Bacteria | 1234 |
| 711 | Ga0209675_1002336 | 3300025291 | Bacteria | 9791 |
| 712 | Ga0209675_1031273 | 3300025291 | Bacteria | 1260 |
| 713 | Ga0209676_1018913 | 3300025292 | Bacteria | 2386 |
| 714 | Ga0209025_1002528 | 3300025294 | Bacteria | 19126 |
| 715 | Ga0209025_1053563 | 3300025294 | Bacteria | 1581 |
| 716 | Ga0209564_1040623 | 3300025295 | Bacteria | 1260 |
| 717 | Ga0209758_1001161 | 3300025297 | Bacteria | 33607 |
| 718 | Ga0209758_1001517 | 3300025297 | Bacteria | 26909 |
| 719 | Ga0209050_1053254 | 3300025298 | Bacteria | 1007 |
| 720 | Ga0209256_1000555 | 3300025299 | Bacteria | 53550 |
| 721 | Ga0209256_1007286 | 3300025299 | Bacteria | 5512 |
| 722 | Ga0207426_1003336 | 3300025302 | Bacteria | 8859 |
| 723 | Ga0207426_1010449 | 3300025302 | Bacteria | 3599 |
| 724 | Ga0207697_10042901 | 3300025315 | Bacteria | 1859 |
| 725 | Ga0207697_10111556 | 3300025315 | Bacteria | 1171 |
| 726 | Ga0207656_10504475 | 3300025321 | Bacteria | 614 |
| 727 | Ga0207713_1181430 | 3300025735 | Bacteria | 657 |
| 728 | Ga0207653_10035981 | 3300025885 | Bacteria | 1612 |
| 729 | Ga0207682_10009832 | 3300025893 | Bacteria | 3762 |
| 730 | Ga0207682_10094199 | 3300025893 | Bacteria | 1302 |
| 731 | Ga0207682_10193832 | 3300025893 | Bacteria | 932 |
| 732 | Ga0207692_10113333 | 3300025898 | Bacteria | 1507 |
| 733 | Ga0207692_10139866 | 3300025898 | Bacteria | 1376 |
| 734 | Ga0207692_10239028 | 3300025898 | Bacteria | 1084 |
| 735 | Ga0207692_10569542 | 3300025898 | Bacteria | 725 |
| 736 | Ga0207642_10133397 | 3300025899 | Bacteria | 1299 |
| 737 | Ga0207642_10151695 | 3300025899 | Bacteria | 1234 |
| 738 | Ga0207642_10368377 | 3300025899 | Bacteria | 852 |
| 739 | Ga0207710_10107702 | 3300025900 | Bacteria | 1321 |
| 740 | Ga0207710_10186777 | 3300025900 | Bacteria | 1019 |
| 741 | Ga0207710_10263464 | 3300025900 | Bacteria | 864 |
| 742 | Ga0207688_10003840 | 3300025901 | Bacteria | 8198 |
| 743 | Ga0207688_10165826 | 3300025901 | Bacteria | 1311 |
| 744 | Ga0207688_10290156 | 3300025901 | Bacteria | 998 |
| 745 | Ga0207688_10395461 | 3300025901 | Bacteria | 857 |
| 746 | Ga0207688_10418689 | 3300025901 | Bacteria | 832 |
| 747 | Ga0207688_10504161 | 3300025901 | Bacteria | 758 |
| 748 | Ga0207688_10598594 | 3300025901 | Bacteria | 695 |
| 749 | Ga0207680_10209454 | 3300025903 | Bacteria | 1332 |
| 750 | Ga0207680_10253007 | 3300025903 | Bacteria | 1217 |
| 751 | Ga0207680_10626768 | 3300025903 | Bacteria | 769 |
| 752 | Ga0207647_10504487 | 3300025904 | Bacteria | 674 |
| 753 | Ga0207647_10507191 | 3300025904 | Bacteria | 672 |
| 754 | Ga0207685_10058795 | 3300025905 | Bacteria | 1513 |
| 755 | Ga0207685_10067957 | 3300025905 | Bacteria | 1434 |
| 756 | Ga0207685_10346299 | 3300025905 | Bacteria | 748 |
| 757 | Ga0207685_10374677 | 3300025905 | Bacteria | 724 |
| 758 | Ga0207685_10410522 | 3300025905 | Bacteria | 696 |
| 759 | Ga0207699_10212055 | 3300025906 | Bacteria | 1318 |
| 760 | Ga0207699_10212691 | 3300025906 | Bacteria | 1316 |
| 761 | Ga0207699_10266796 | 3300025906 | Bacteria | 1185 |
| 762 | Ga0207699_10384311 | 3300025906 | Bacteria | 997 |
| 763 | Ga0207699_10469182 | 3300025906 | Bacteria | 905 |
| 764 | Ga0207699_11232896 | 3300025906 | Bacteria | 554 |
| 765 | Ga0207699_11295175 | 3300025906 | Bacteria | 539 |
| 766 | Ga0207645_10041875 | 3300025907 | Bacteria | 2931 |
| 767 | Ga0207645_10067656 | 3300025907 | Bacteria | 2283 |
| 768 | Ga0207645_10116851 | 3300025907 | Bacteria | 1730 |
| 769 | Ga0207645_10130830 | 3300025907 | Bacteria | 1633 |
| 770 | Ga0207645_10696626 | 3300025907 | Bacteria | 690 |
| 771 | Ga0207643_10089119 | 3300025908 | Bacteria | 1796 |
| 772 | Ga0207643_10463685 | 3300025908 | Bacteria | 807 |
| 773 | Ga0207643_10867273 | 3300025908 | Bacteria | 585 |
| 774 | Ga0207705_10562675 | 3300025909 | Bacteria | 886 |
| 775 | Ga0207684_10139016 | 3300025910 | Bacteria | 2087 |
| 776 | Ga0207684_10319531 | 3300025910 | Bacteria | 1338 |
| 777 | Ga0207684_10803481 | 3300025910 | Bacteria | 795 |
| 778 | Ga0207654_10211907 | 3300025911 | Bacteria | 1281 |
| 779 | Ga0207654_10589266 | 3300025911 | Bacteria | 793 |
| 780 | Ga0207654_10693515 | 3300025911 | Bacteria | 731 |
| 781 | Ga0207654_10758071 | 3300025911 | Bacteria | 699 |
| 782 | Ga0207654_10872713 | 3300025911 | Bacteria | 652 |
| 783 | Ga0207707_10087924 | 3300025912 | Bacteria | 2715 |
| 784 | Ga0207707_10281468 | 3300025912 | Bacteria | 1441 |
| 785 | Ga0207707_10817660 | 3300025912 | Bacteria | 775 |
| 786 | Ga0207707_10966096 | 3300025912 | Bacteria | 701 |
| 787 | Ga0207707_11427353 | 3300025912 | Bacteria | 551 |
| 788 | Ga0207695_10011275 | 3300025913 | Bacteria | 10836 |
| 789 | Ga0207695_10337086 | 3300025913 | Bacteria | 1396 |
| 790 | Ga0207695_10390859 | 3300025913 | Bacteria | 1276 |
| 791 | Ga0207695_10892567 | 3300025913 | Bacteria | 769 |
| 792 | Ga0207695_11411067 | 3300025913 | Bacteria | 577 |
| 793 | Ga0207671_10002412 | 3300025914 | Bacteria | 20034 |
| 794 | Ga0207671_10010604 | 3300025914 | Bacteria | 7587 |
| 795 | Ga0207671_10017611 | 3300025914 | Bacteria | 5501 |
| 796 | Ga0207671_10092670 | 3300025914 | Bacteria | 2278 |
| 797 | Ga0207671_10253897 | 3300025914 | Bacteria | 1382 |
| 798 | Ga0207671_10815258 | 3300025914 | Bacteria | 740 |
| 799 | Ga0207671_10888639 | 3300025914 | Bacteria | 705 |
| 800 | Ga0207671_11140280 | 3300025914 | Bacteria | 611 |
| 801 | Ga0207693_10131667 | 3300025915 | Bacteria | 1966 |
| 802 | Ga0207693_10152032 | 3300025915 | Bacteria | 1821 |
| 803 | Ga0207693_10172712 | 3300025915 | Bacteria | 1701 |
| 804 | Ga0207693_10211500 | 3300025915 | Bacteria | 1524 |
| 805 | Ga0207693_10264723 | 3300025915 | Bacteria | 1348 |
| 806 | Ga0207693_10289764 | 3300025915 | Bacteria | 1283 |
| 807 | Ga0207663_10140759 | 3300025916 | Bacteria | 1680 |
| 808 | Ga0207663_10176665 | 3300025916 | Bacteria | 1521 |
| 809 | Ga0207663_10179633 | 3300025916 | Bacteria | 1510 |
| 810 | Ga0207663_10270157 | 3300025916 | Bacteria | 1259 |
| 811 | Ga0207663_10277228 | 3300025916 | Bacteria | 1244 |
| 812 | Ga0207663_10284567 | 3300025916 | Bacteria | 1229 |
| 813 | Ga0207663_10288778 | 3300025916 | Bacteria | 1221 |
| 814 | Ga0207663_10710473 | 3300025916 | Bacteria | 796 |
| 815 | Ga0207660_10254332 | 3300025917 | Bacteria | 1387 |
| 816 | Ga0207660_10763277 | 3300025917 | Bacteria | 789 |
| 817 | Ga0207662_10102725 | 3300025918 | Bacteria | 1773 |
| 818 | Ga0207662_10142809 | 3300025918 | Bacteria | 1517 |
| 819 | Ga0207662_10299572 | 3300025918 | Bacteria | 1068 |
| 820 | Ga0207662_10517515 | 3300025918 | Bacteria | 823 |
| 821 | Ga0207657_10204864 | 3300025919 | Bacteria | 1585 |
| 822 | Ga0207657_10222470 | 3300025919 | Bacteria | 1512 |
| 823 | Ga0207657_10260248 | 3300025919 | Bacteria | 1381 |
| 824 | Ga0207657_10305613 | 3300025919 | Bacteria | 1259 |
| 825 | Ga0207657_10413884 | 3300025919 | Bacteria | 1060 |
| 826 | Ga0207657_11265032 | 3300025919 | Bacteria | 559 |
| 827 | Ga0207649_10260032 | 3300025920 | Bacteria | 1254 |
| 828 | Ga0207649_10319870 | 3300025920 | Bacteria | 1140 |
| 829 | Ga0207649_10470202 | 3300025920 | Bacteria | 952 |
| 830 | Ga0207652_10056697 | 3300025921 | Bacteria | 3373 |
| 831 | Ga0207652_10372605 | 3300025921 | Bacteria | 1289 |
| 832 | Ga0207652_10396381 | 3300025921 | Bacteria | 1246 |
| 833 | Ga0207652_10407288 | 3300025921 | Bacteria | 1227 |
| 834 | Ga0207652_10661110 | 3300025921 | Bacteria | 934 |
| 835 | Ga0207652_10666606 | 3300025921 | Bacteria | 930 |
| 836 | Ga0207652_10919769 | 3300025921 | Bacteria | 772 |
| 837 | Ga0207652_11729162 | 3300025921 | Bacteria | 530 |
| 838 | Ga0207646_10330389 | 3300025922 | Unclassified | 1377 |
| 839 | Ga0207646_10400095 | 3300025922 | Bacteria | 1240 |
| 840 | Ga0207646_10546967 | 3300025922 | Bacteria | 1041 |
| 841 | Ga0207681_10160831 | 3300025923 | Bacteria | 1692 |
| 842 | Ga0207681_10291784 | 3300025923 | Bacteria | 1287 |
| 843 | Ga0207681_10940650 | 3300025923 | Bacteria | 724 |
| 844 | Ga0207694_10000851 | 3300025924 | Bacteria | 27152 |
| 845 | Ga0207694_10147646 | 3300025924 | Bacteria | 1893 |
| 846 | Ga0207694_10153299 | 3300025924 | Bacteria | 1857 |
| 847 | Ga0207694_10205127 | 3300025924 | Bacteria | 1605 |
| 848 | Ga0207694_10284265 | 3300025924 | Bacteria | 1359 |
| 849 | Ga0207694_10298116 | 3300025924 | Bacteria | 1327 |
| 850 | Ga0207694_10409025 | 3300025924 | Bacteria | 1129 |
| 851 | Ga0207694_10878642 | 3300025924 | Bacteria | 758 |
| 852 | Ga0207694_11339674 | 3300025924 | Bacteria | 605 |
| 853 | Ga0207650_10297956 | 3300025925 | Bacteria | 1316 |
| 854 | Ga0207650_10324024 | 3300025925 | Bacteria | 1262 |
| 855 | Ga0207650_11236417 | 3300025925 | Bacteria | 636 |
| 856 | Ga0207659_10171827 | 3300025926 | Bacteria | 1710 |
| 857 | Ga0207659_10267539 | 3300025926 | Bacteria | 1393 |
| 858 | Ga0207659_10516471 | 3300025926 | Bacteria | 1012 |
| 859 | Ga0207659_10898641 | 3300025926 | Bacteria | 761 |
| 860 | Ga0207659_11086915 | 3300025926 | Bacteria | 688 |
| 861 | Ga0207687_10257203 | 3300025927 | Bacteria | 1391 |
| 862 | Ga0207687_10330903 | 3300025927 | Bacteria | 1236 |
| 863 | Ga0207687_11323095 | 3300025927 | Bacteria | 619 |
| 864 | Ga0207687_11337395 | 3300025927 | Bacteria | 616 |
| 865 | Ga0207687_11622563 | 3300025927 | Bacteria | 555 |
| 866 | Ga0207700_10201475 | 3300025928 | Bacteria | 1677 |
| 867 | Ga0207700_10207089 | 3300025928 | Bacteria | 1656 |
| 868 | Ga0207700_10317494 | 3300025928 | Bacteria | 1349 |
| 869 | Ga0207700_10322369 | 3300025928 | Bacteria | 1339 |
| 870 | Ga0207700_10329868 | 3300025928 | Bacteria | 1324 |
| 871 | Ga0207700_10361196 | 3300025928 | Bacteria | 1266 |
| 872 | Ga0207700_10386904 | 3300025928 | Bacteria | 1224 |
| 873 | Ga0207700_10407354 | 3300025928 | Bacteria | 1192 |
| 874 | Ga0207700_10448468 | 3300025928 | Bacteria | 1137 |
| 875 | Ga0207700_10525939 | 3300025928 | Bacteria | 1048 |
| 876 | Ga0207700_11619884 | 3300025928 | Bacteria | 572 |
| 877 | Ga0207700_11994693 | 3300025928 | Unclassified | 507 |
| 878 | Ga0207664_10037599 | 3300025929 | Bacteria | 3748 |
| 879 | Ga0207664_10205174 | 3300025929 | Bacteria | 1703 |
| 880 | Ga0207664_10355697 | 3300025929 | Bacteria | 1297 |
| 881 | Ga0207664_10369341 | 3300025929 | Bacteria | 1272 |
| 882 | Ga0207664_10693569 | 3300025929 | Bacteria | 916 |
| 883 | Ga0207664_10707014 | 3300025929 | Bacteria | 906 |
| 884 | Ga0207664_10830825 | 3300025929 | Bacteria | 831 |
| 885 | Ga0207664_11997895 | 3300025929 | Bacteria | 503 |
| 886 | Ga0207644_10167343 | 3300025931 | Bacteria | 1713 |
| 887 | Ga0207644_10221296 | 3300025931 | Bacteria | 1500 |
| 888 | Ga0207644_10358937 | 3300025931 | Bacteria | 1185 |
| 889 | Ga0207690_10312900 | 3300025932 | Bacteria | 1232 |
| 890 | Ga0207690_10491467 | 3300025932 | Bacteria | 992 |
| 891 | Ga0207690_10849208 | 3300025932 | Bacteria | 756 |
| 892 | Ga0207706_10100179 | 3300025933 | Bacteria | 2549 |
| 893 | Ga0207706_10239068 | 3300025933 | Bacteria | 1588 |
| 894 | Ga0207706_10270446 | 3300025933 | Bacteria | 1483 |
| 895 | Ga0207706_10291406 | 3300025933 | Bacteria | 1423 |
| 896 | Ga0207686_10242961 | 3300025934 | Bacteria | 1311 |
| 897 | Ga0207686_10281992 | 3300025934 | Bacteria | 1227 |
| 898 | Ga0207686_10292778 | 3300025934 | Bacteria | 1206 |
| 899 | Ga0207686_10330084 | 3300025934 | Bacteria | 1142 |
| 900 | Ga0207709_10220865 | 3300025935 | Bacteria | 1367 |
| 901 | Ga0207709_10246699 | 3300025935 | Bacteria | 1302 |
| 902 | Ga0207709_10873923 | 3300025935 | Bacteria | 729 |
| 903 | Ga0207670_10133751 | 3300025936 | Bacteria | 1821 |
| 904 | Ga0207670_10139473 | 3300025936 | Bacteria | 1786 |
| 905 | Ga0207670_10267118 | 3300025936 | Bacteria | 1328 |
| 906 | Ga0207670_10290602 | 3300025936 | Bacteria | 1277 |
| 907 | Ga0207670_11192350 | 3300025936 | Bacteria | 644 |
| 908 | Ga0207669_10124742 | 3300025937 | Bacteria | 1756 |
| 909 | Ga0207669_10256842 | 3300025937 | Bacteria | 1304 |
| 910 | Ga0207669_10328392 | 3300025937 | Bacteria | 1173 |
| 911 | Ga0207669_11344675 | 3300025937 | Bacteria | 607 |
| 912 | Ga0207704_10134008 | 3300025938 | Bacteria | 1721 |
| 913 | Ga0207704_10306240 | 3300025938 | Bacteria | 1219 |
| 914 | Ga0207704_11323653 | 3300025938 | Bacteria | 616 |
| 915 | Ga0207704_11422251 | 3300025938 | Bacteria | 594 |
| 916 | Ga0207665_10097283 | 3300025939 | Bacteria | 2049 |
| 917 | Ga0207665_10150074 | 3300025939 | Bacteria | 1669 |
| 918 | Ga0207665_10214346 | 3300025939 | Bacteria | 1408 |
| 919 | Ga0207665_10215973 | 3300025939 | Bacteria | 1403 |
| 920 | Ga0207665_10246177 | 3300025939 | Bacteria | 1319 |
| 921 | Ga0207665_10293118 | 3300025939 | Bacteria | 1214 |
| 922 | Ga0207665_10303648 | 3300025939 | Bacteria | 1194 |
| 923 | Ga0207665_10623470 | 3300025939 | Bacteria | 843 |
| 924 | Ga0207665_10710720 | 3300025939 | Bacteria | 790 |
| 925 | Ga0207691_10104040 | 3300025940 | Bacteria | 2531 |
| 926 | Ga0207691_10282428 | 3300025940 | Bacteria | 1428 |
| 927 | Ga0207691_10298557 | 3300025940 | Bacteria | 1384 |
| 928 | Ga0207691_10321342 | 3300025940 | Bacteria | 1327 |
| 929 | Ga0207691_10457161 | 3300025940 | Bacteria | 1086 |
| 930 | Ga0207691_10679832 | 3300025940 | Bacteria | 869 |
| 931 | Ga0207691_10905904 | 3300025940 | Bacteria | 738 |
| 932 | Ga0207691_11671032 | 3300025940 | Unclassified | 516 |
| 933 | Ga0207711_10258076 | 3300025941 | Bacteria | 1601 |
| 934 | Ga0207711_10312963 | 3300025941 | Bacteria | 1450 |
| 935 | Ga0207711_11605656 | 3300025941 | Bacteria | 594 |
| 936 | Ga0207689_10394720 | 3300025942 | Bacteria | 1153 |
| 937 | Ga0207689_10466223 | 3300025942 | Bacteria | 1057 |
| 938 | Ga0207689_11118141 | 3300025942 | Bacteria | 664 |
| 939 | Ga0207689_11367775 | 3300025942 | Bacteria | 594 |
| 940 | Ga0207661_10281765 | 3300025944 | Bacteria | 1486 |
| 941 | Ga0207661_10374692 | 3300025944 | Bacteria | 1287 |
| 942 | Ga0207661_10785828 | 3300025944 | Bacteria | 876 |
| 943 | Ga0207661_10939054 | 3300025944 | Bacteria | 797 |
| 944 | Ga0207661_11026479 | 3300025944 | Bacteria | 759 |
| 945 | Ga0207679_10230678 | 3300025945 | Bacteria | 1563 |
| 946 | Ga0207679_10292638 | 3300025945 | Bacteria | 1400 |
| 947 | Ga0207679_11064970 | 3300025945 | Bacteria | 742 |
| 948 | Ga0207679_11850841 | 3300025945 | Bacteria | 551 |
| 949 | Ga0207679_12054514 | 3300025945 | Bacteria | 520 |
| 950 | Ga0207679_12193354 | 3300025945 | Bacteria | 501 |
| 951 | Ga0207667_10041069 | 3300025949 | Bacteria | 4921 |
| 952 | Ga0207667_10250756 | 3300025949 | Bacteria | 1811 |
| 953 | Ga0207667_10392789 | 3300025949 | Bacteria | 1413 |
| 954 | Ga0207667_10661222 | 3300025949 | Bacteria | 1050 |
| 955 | Ga0207667_10831251 | 3300025949 | Bacteria | 919 |
| 956 | Ga0207667_11140523 | 3300025949 | Bacteria | 761 |
| 957 | Ga0207667_11511583 | 3300025949 | Bacteria | 642 |
| 958 | Ga0207651_10042818 | 3300025960 | Bacteria | 3017 |
| 959 | Ga0207651_10233546 | 3300025960 | Bacteria | 1495 |
| 960 | Ga0207651_10311586 | 3300025960 | Bacteria | 1312 |
| 961 | Ga0207651_10358793 | 3300025960 | Bacteria | 1229 |
| 962 | Ga0207651_10426339 | 3300025960 | Bacteria | 1133 |
| 963 | Ga0207712_10304803 | 3300025961 | Bacteria | 1309 |
| 964 | Ga0207712_10840430 | 3300025961 | Bacteria | 809 |
| 965 | Ga0207668_10150768 | 3300025972 | Bacteria | 1799 |
| 966 | Ga0207668_10302427 | 3300025972 | Bacteria | 1320 |
| 967 | Ga0207668_10621936 | 3300025972 | Bacteria | 942 |
| 968 | Ga0207668_11353453 | 3300025972 | Bacteria | 641 |
| 969 | Ga0207668_11471879 | 3300025972 | Bacteria | 614 |
| 970 | Ga0207668_11589497 | 3300025972 | Unclassified | 590 |
| 971 | Ga0207640_10025526 | 3300025981 | Bacteria | 3578 |
| 972 | Ga0207640_10032794 | 3300025981 | Bacteria | 3223 |
| 973 | Ga0207640_10177424 | 3300025981 | Bacteria | 1594 |
| 974 | Ga0207640_10466204 | 3300025981 | Bacteria | 1044 |
| 975 | Ga0207658_10337190 | 3300025986 | Bacteria | 1309 |
| 976 | Ga0207658_10359124 | 3300025986 | Bacteria | 1270 |
| 977 | Ga0207658_10883535 | 3300025986 | Bacteria | 813 |
| 978 | Ga0207658_11845578 | 3300025986 | Bacteria | 551 |
| 979 | Ga0207677_10467255 | 3300026023 | Bacteria | 1084 |
| 980 | Ga0207677_10542916 | 3300026023 | Bacteria | 1012 |
| 981 | Ga0207677_10929366 | 3300026023 | Bacteria | 785 |
| 982 | Ga0207677_11578395 | 3300026023 | Bacteria | 607 |
| 983 | Ga0207703_10074166 | 3300026035 | Bacteria | 2817 |
| 984 | Ga0207703_10298665 | 3300026035 | Bacteria | 1468 |
| 985 | Ga0207703_10523474 | 3300026035 | Bacteria | 1116 |
| 986 | Ga0207703_10573814 | 3300026035 | Bacteria | 1065 |
| 987 | Ga0207639_10336648 | 3300026041 | Bacteria | 1344 |
| 988 | Ga0207639_10341581 | 3300026041 | Bacteria | 1335 |
| 989 | Ga0207639_10372405 | 3300026041 | Bacteria | 1280 |
| 990 | Ga0207639_10374102 | 3300026041 | Bacteria | 1278 |
| 991 | Ga0207639_10959512 | 3300026041 | Bacteria | 800 |
| 992 | Ga0207639_11077418 | 3300026041 | Bacteria | 753 |
| 993 | Ga0207639_11126253 | 3300026041 | Bacteria | 736 |
| 994 | Ga0207639_12038794 | 3300026041 | Bacteria | 535 |
| 995 | Ga0207678_10170907 | 3300026067 | Bacteria | 1856 |
| 996 | Ga0207678_10179889 | 3300026067 | Bacteria | 1806 |
| 997 | Ga0207678_10643863 | 3300026067 | Bacteria | 931 |
| 998 | Ga0207678_10658453 | 3300026067 | Bacteria | 920 |
| 999 | Ga0207678_11309088 | 3300026067 | Bacteria | 641 |
| 1000 | Ga0207708_10142385 | 3300026075 | Bacteria | 1882 |
| 1001 | Ga0207708_10143340 | 3300026075 | Bacteria | 1876 |
| 1002 | Ga0207708_10153255 | 3300026075 | Bacteria | 1816 |
| 1003 | Ga0207708_10489822 | 3300026075 | Bacteria | 1029 |
| 1004 | Ga0207708_10586199 | 3300026075 | Bacteria | 943 |
| 1005 | Ga0207708_10676365 | 3300026075 | Bacteria | 880 |
| 1006 | Ga0207702_10293980 | 3300026078 | Bacteria | 1540 |
| 1007 | Ga0207702_10419228 | 3300026078 | Bacteria | 1294 |
| 1008 | Ga0207702_10437262 | 3300026078 | Bacteria | 1267 |
| 1009 | Ga0207702_10496339 | 3300026078 | Bacteria | 1189 |
| 1010 | Ga0207702_10581159 | 3300026078 | Bacteria | 1098 |
| 1011 | Ga0207702_10649515 | 3300026078 | Bacteria | 1037 |
| 1012 | Ga0207702_10650872 | 3300026078 | Bacteria | 1036 |
| 1013 | Ga0207702_10760332 | 3300026078 | Bacteria | 957 |
| 1014 | Ga0207702_10919483 | 3300026078 | Bacteria | 867 |
| 1015 | Ga0207702_10958549 | 3300026078 | Bacteria | 848 |
| 1016 | Ga0207702_11273605 | 3300026078 | Bacteria | 729 |
| 1017 | Ga0207702_11275879 | 3300026078 | Bacteria | 729 |
| 1018 | Ga0207702_11471140 | 3300026078 | Bacteria | 675 |
| 1019 | Ga0207702_11610888 | 3300026078 | Bacteria | 642 |
| 1020 | Ga0207641_10246215 | 3300026088 | Bacteria | 1668 |
| 1021 | Ga0207641_10407527 | 3300026088 | Bacteria | 1306 |
| 1022 | Ga0207641_10818450 | 3300026088 | Bacteria | 922 |
| 1023 | Ga0207641_11334841 | 3300026088 | Bacteria | 718 |
| 1024 | Ga0207648_10105951 | 3300026089 | Bacteria | 2467 |
| 1025 | Ga0207648_10172230 | 3300026089 | Bacteria | 1914 |
| 1026 | Ga0207648_10797957 | 3300026089 | Bacteria | 879 |
| 1027 | Ga0207648_11244504 | 3300026089 | Bacteria | 699 |
| 1028 | Ga0207648_11332059 | 3300026089 | Bacteria | 675 |
| 1029 | Ga0207676_10205442 | 3300026095 | Bacteria | 1743 |
| 1030 | Ga0207676_10431972 | 3300026095 | Bacteria | 1237 |
| 1031 | Ga0207676_10938154 | 3300026095 | Bacteria | 850 |
| 1032 | Ga0207676_11266247 | 3300026095 | Bacteria | 732 |
| 1033 | Ga0207674_10047869 | 3300026116 | Bacteria | 4380 |
| 1034 | Ga0207674_10518034 | 3300026116 | Bacteria | 1152 |
| 1035 | Ga0207674_10553421 | 3300026116 | Bacteria | 1111 |
| 1036 | Ga0207674_10681070 | 3300026116 | Bacteria | 993 |
| 1037 | Ga0207674_10822058 | 3300026116 | Bacteria | 896 |
| 1038 | Ga0207675_100214846 | 3300026118 | Bacteria | 1851 |
| 1039 | Ga0207675_100394894 | 3300026118 | Bacteria | 1362 |
| 1040 | Ga0207675_100414728 | 3300026118 | Bacteria | 1329 |
| 1041 | Ga0207683_10063437 | 3300026121 | Bacteria | 3255 |
| 1042 | Ga0207683_10195897 | 3300026121 | Bacteria | 1836 |
| 1043 | Ga0207683_10406104 | 3300026121 | Bacteria | 1253 |
| 1044 | Ga0207683_11078746 | 3300026121 | Bacteria | 745 |
| 1045 | Ga0207698_10403965 | 3300026142 | Bacteria | 1306 |
| 1046 | Ga0207698_10698405 | 3300026142 | Bacteria | 1009 |
| 1047 | Ga0207698_10723852 | 3300026142 | Bacteria | 992 |
| 1048 | Ga0207698_10818550 | 3300026142 | Bacteria | 935 |
| 1049 | Ga0207698_10931457 | 3300026142 | Bacteria | 877 |
| 1050 | Ga0207698_12147514 | 3300026142 | Bacteria | 572 |
| 1051 | Ga0209389_1000192 | 3300027296 | Bacteria | 45530 |
| 1052 | Ga0209389_1080073 | 3300027296 | Bacteria | 1586 |
| 1053 | Ga0209371_1002705 | 3300027312 | Bacteria | 9578 |
| 1054 | Ga0209371_1006726 | 3300027312 | Bacteria | 4188 |
| 1055 | Ga0209489_100397 | 3300027361 | Bacteria | 78711 |
| 1056 | Ga0209998_10217517 | 3300027717 | Bacteria | 502 |
| 1057 | Ga0209974_10076738 | 3300027876 | Bacteria | 1145 |
| 1058 | Ga0265356_1007901 | 3300028017 | Bacteria | 1218 |
| 1059 | Ga0265356_1019577 | 3300028017 | Bacteria | 732 |
| 1060 | Ga0265356_1036310 | 3300028017 | Bacteria | 540 |
| 1061 | Ga0268266_10303467 | 3300028379 | Bacteria | 1490 |
| 1062 | Ga0268266_10306718 | 3300028379 | Bacteria | 1482 |
| 1063 | Ga0268266_10356965 | 3300028379 | Bacteria | 1374 |
| 1064 | Ga0268266_10495033 | 3300028379 | Bacteria | 1166 |
| 1065 | Ga0268265_10317836 | 3300028380 | Bacteria | 1409 |
| 1066 | Ga0268265_11191156 | 3300028380 | Bacteria | 759 |
| 1067 | Ga0268265_11204619 | 3300028380 | Bacteria | 755 |
| 1068 | Ga0268264_10325575 | 3300028381 | Bacteria | 1455 |
| 1069 | Ga0268264_10368347 | 3300028381 | Bacteria | 1372 |
| 1070 | Ga0268264_10406041 | 3300028381 | Bacteria | 1310 |
| 1071 | Ga0268264_10427688 | 3300028381 | Bacteria | 1278 |
| 1072 | Ga0268264_10865924 | 3300028381 | Bacteria | 905 |
| 1073 | Ga0265326_10049984 | 3300028558 | Bacteria | 1184 |
| 1074 | Ga0265319_1158520 | 3300028563 | Bacteria | 699 |
| 1075 | Ga0265334_10064030 | 3300028573 | Bacteria | 1381 |
| 1076 | Ga0265334_10076067 | 3300028573 | Bacteria | 1243 |
| 1077 | Ga0265334_10086860 | 3300028573 | Bacteria | 1146 |
| 1078 | Ga0265318_10001985 | 3300028577 | Bacteria | 11359 |
| 1079 | Ga0265318_10070123 | 3300028577 | Bacteria | 1299 |
| 1080 | Ga0265318_10075889 | 3300028577 | Bacteria | 1243 |
| 1081 | Ga0265318_10202234 | 3300028577 | Bacteria | 726 |
| 1082 | Ga0265322_10249122 | 3300028654 | Bacteria | 510 |
| 1083 | Ga0307515_10042604 | 3300028794 | Bacteria | 7093 |
| 1084 | Ga0307515_10103410 | 3300028794 | Bacteria | 3414 |
| 1085 | Ga0265338_10263345 | 3300028800 | Bacteria | 1266 |
| 1086 | Ga0265338_10273330 | 3300028800 | Bacteria | 1237 |
| 1087 | Ga0265338_10939467 | 3300028800 | Bacteria | 587 |
| 1088 | Ga0268256_1001745 | 3300030500 | Bacteria | 12286 |
| 1089 | Ga0268256_1006802 | 3300030500 | Bacteria | 4188 |
| 1090 | Ga0265762_1007147 | 3300030760 | Bacteria | 1992 |
| 1091 | Ga0265765_1048822 | 3300030879 | Bacteria | 577 |
| 1092 | Ga0265771_1004795 | 3300031010 | Bacteria | 836 |
| 1093 | Ga0265760_10047101 | 3300031090 | Bacteria | 1294 |
| 1094 | Ga0265760_10106150 | 3300031090 | Bacteria | 891 |
| 1095 | Ga0265330_10015058 | 3300031235 | Bacteria | 3581 |
| 1096 | Ga0265330_10072655 | 3300031235 | Bacteria | 1487 |
| 1097 | Ga0265330_10080198 | 3300031235 | Bacteria | 1406 |
| 1098 | Ga0265330_10087350 | 3300031235 | Bacteria | 1340 |
| 1099 | Ga0265332_10063520 | 3300031238 | Bacteria | 1577 |
| 1100 | Ga0265332_10090311 | 3300031238 | Bacteria | 1295 |
| 1101 | Ga0265332_10103138 | 3300031238 | Bacteria | 1202 |
| 1102 | Ga0265332_10161183 | 3300031238 | Bacteria | 937 |
| 1103 | Ga0265328_10048948 | 3300031239 | Bacteria | 1552 |
| 1104 | Ga0265328_10057540 | 3300031239 | Bacteria | 1427 |
| 1105 | Ga0265328_10079784 | 3300031239 | Bacteria | 1206 |
| 1106 | Ga0265328_10091235 | 3300031239 | Bacteria | 1125 |
| 1107 | Ga0265320_10041934 | 3300031240 | Bacteria | 2273 |
| 1108 | Ga0265320_10080033 | 3300031240 | Bacteria | 1526 |
| 1109 | Ga0265320_10103775 | 3300031240 | Bacteria | 1307 |
| 1110 | Ga0265320_10112585 | 3300031240 | Bacteria | 1245 |
| 1111 | Ga0265320_10364802 | 3300031240 | Bacteria | 638 |
| 1112 | Ga0265325_10000470 | 3300031241 | Bacteria | 29219 |
| 1113 | Ga0265325_10054640 | 3300031241 | Bacteria | 2043 |
| 1114 | Ga0265325_10122415 | 3300031241 | Bacteria | 1252 |
| 1115 | Ga0265325_10128642 | 3300031241 | Bacteria | 1214 |
| 1116 | Ga0265325_10433513 | 3300031241 | Bacteria | 573 |
| 1117 | Ga0265325_10531146 | 3300031241 | Bacteria | 509 |
| 1118 | Ga0265329_10029038 | 3300031242 | Bacteria | 1810 |
| 1119 | Ga0265329_10049337 | 3300031242 | Bacteria | 1341 |
| 1120 | Ga0265329_10073789 | 3300031242 | Bacteria | 1079 |
| 1121 | Ga0265340_10011622 | 3300031247 | Bacteria | 4673 |
| 1122 | Ga0265340_10062318 | 3300031247 | Bacteria | 1781 |
| 1123 | Ga0265340_10070416 | 3300031247 | Bacteria | 1659 |
| 1124 | Ga0265340_10102395 | 3300031247 | Bacteria | 1329 |
| 1125 | Ga0265340_10167316 | 3300031247 | Bacteria | 997 |
| 1126 | Ga0265340_10249564 | 3300031247 | Bacteria | 791 |
| 1127 | Ga0265339_10135113 | 3300031249 | Bacteria | 1258 |
| 1128 | Ga0265339_10135652 | 3300031249 | Bacteria | 1255 |
| 1129 | Ga0265339_10136538 | 3300031249 | Bacteria | 1250 |
| 1130 | Ga0265339_10353019 | 3300031249 | Bacteria | 693 |
| 1131 | Ga0265331_10081048 | 3300031250 | Bacteria | 1507 |
| 1132 | Ga0265331_10095015 | 3300031250 | Bacteria | 1375 |
| 1133 | Ga0265331_10138324 | 3300031250 | Bacteria | 1108 |
| 1134 | Ga0265331_10178527 | 3300031250 | Bacteria | 959 |
| 1135 | Ga0265331_10430736 | 3300031250 | Bacteria | 592 |
| 1136 | Ga0265316_10166360 | 3300031344 | Bacteria | 1647 |
| 1137 | Ga0265316_10225778 | 3300031344 | Bacteria | 1380 |
| 1138 | Ga0265316_10264059 | 3300031344 | Bacteria | 1261 |
| 1139 | Ga0265316_10272434 | 3300031344 | Bacteria | 1238 |
| 1140 | Ga0265316_10295259 | 3300031344 | Bacteria | 1181 |
| 1141 | Ga0265316_10979554 | 3300031344 | Bacteria | 589 |
| 1142 | Ga0265316_11239844 | 3300031344 | Bacteria | 516 |
| 1143 | Ga0307513_10159534 | 3300031456 | Bacteria | 2150 |
| 1144 | Ga0307513_10309001 | 3300031456 | Bacteria | 1344 |
| 1145 | Ga0307513_10344740 | 3300031456 | Bacteria | 1239 |
| 1146 | Ga0307513_10347567 | 3300031456 | Bacteria | 1232 |
| 1147 | Ga0307509_10133310 | 3300031507 | Bacteria | 2435 |
| 1148 | Ga0307408_100215213 | 3300031548 | Bacteria | 1564 |
| 1149 | Ga0307408_100255173 | 3300031548 | Bacteria | 1448 |
| 1150 | Ga0307408_100324833 | 3300031548 | Bacteria | 1297 |
| 1151 | Ga0307408_101669679 | 3300031548 | Bacteria | 606 |
| 1152 | Ga0307408_102218182 | 3300031548 | Bacteria | 531 |
| 1153 | Ga0307408_102444453 | 3300031548 | Bacteria | 507 |
| 1154 | Ga0265313_10076729 | 3300031595 | Bacteria | 1526 |
| 1155 | Ga0265313_10109435 | 3300031595 | Bacteria | 1216 |
| 1156 | Ga0265313_10110736 | 3300031595 | Bacteria | 1207 |
| 1157 | Ga0307508_10428770 | 3300031616 | Bacteria | 914 |
| 1158 | Ga0316579_10420320 | 3300031691 | Bacteria | 646 |
| 1159 | Ga0265314_10041671 | 3300031711 | Bacteria | 3283 |
| 1160 | Ga0265314_10124768 | 3300031711 | Bacteria | 1614 |
| 1161 | Ga0265314_10218619 | 3300031711 | Bacteria | 1113 |
| 1162 | Ga0265314_10306169 | 3300031711 | Bacteria | 889 |
| 1163 | Ga0265342_10065842 | 3300031712 | Bacteria | 2122 |
| 1164 | Ga0265342_10075554 | 3300031712 | Bacteria | 1954 |
| 1165 | Ga0265342_10127927 | 3300031712 | Bacteria | 1425 |
| 1166 | Ga0265342_10225795 | 3300031712 | Bacteria | 1007 |
| 1167 | Ga0316576_10239741 | 3300031727 | Bacteria | 1363 |
| 1168 | Ga0316576_10241589 | 3300031727 | Bacteria | 1357 |
| 1169 | Ga0316578_10148389 | 3300031728 | Bacteria | 1413 |
| 1170 | Ga0307405_10389182 | 3300031731 | Bacteria | 1088 |
| 1171 | Ga0307405_10566048 | 3300031731 | Bacteria | 922 |
| 1172 | Ga0307405_11357174 | 3300031731 | Bacteria | 620 |
| 1173 | Ga0307405_11421853 | 3300031731 | Bacteria | 607 |
| 1174 | Ga0307405_11549831 | 3300031731 | Bacteria | 583 |
| 1175 | Ga0307410_10292516 | 3300031852 | Bacteria | 1282 |
| 1176 | Ga0307406_10216268 | 3300031901 | Bacteria | 1421 |
| 1177 | Ga0307406_11027229 | 3300031901 | Bacteria | 708 |
| 1178 | Ga0307407_10327409 | 3300031903 | Bacteria | 1077 |
| 1179 | Ga0307412_10085052 | 3300031911 | Bacteria | 2197 |
| 1180 | Ga0307412_10275288 | 3300031911 | Bacteria | 1319 |
| 1181 | Ga0307412_10374009 | 3300031911 | Bacteria | 1151 |
| 1182 | Ga0307412_10709552 | 3300031911 | Bacteria | 864 |
| 1183 | Ga0307412_10727655 | 3300031911 | Bacteria | 854 |
| 1184 | Ga0307412_11312075 | 3300031911 | Bacteria | 652 |
| 1185 | Ga0307409_100409749 | 3300031995 | Bacteria | 1297 |
| 1186 | Ga0307409_100616228 | 3300031995 | Bacteria | 1075 |
| 1187 | Ga0307416_100268704 | 3300032002 | Bacteria | 1672 |
| 1188 | Ga0307416_100323152 | 3300032002 | Bacteria | 1546 |
| 1189 | Ga0307416_100409499 | 3300032002 | Bacteria | 1396 |
| 1190 | Ga0307416_100529230 | 3300032002 | Bacteria | 1248 |
| 1191 | Ga0307416_101939398 | 3300032002 | Bacteria | 692 |
| 1192 | Ga0307416_103795019 | 3300032002 | Bacteria | 506 |
| 1193 | Ga0307414_10364651 | 3300032004 | Bacteria | 1244 |
| 1194 | Ga0307414_10686141 | 3300032004 | Unclassified | 926 |
| 1195 | Ga0307411_10182162 | 3300032005 | Bacteria | 1595 |
| 1196 | Ga0307411_10306328 | 3300032005 | Bacteria | 1276 |
| 1197 | Ga0307411_10734723 | 3300032005 | Bacteria | 863 |
| 1198 | Ga0307411_11491439 | 3300032005 | Bacteria | 621 |
| 1199 | Ga0307415_100758863 | 3300032126 | Bacteria | 881 |
| 1200 | Ga0307415_100808608 | 3300032126 | Bacteria | 856 |
| 1201 | Ga0307415_101193386 | 3300032126 | Bacteria | 717 |
| 1202 | Ga0307415_101643232 | 3300032126 | Bacteria | 618 |
| 1203 | Ga0307507_10148326 | 3300033179 | Bacteria | 1774 |
| 1204 | Ga0307510_10090852 | 3300033180 | Bacteria | 2898 |
| 1205 | Ga0307510_10218789 | 3300033180 | Bacteria | 1418 |
| 1206 | Ga0373930_0025313 | 3300034816 | Bacteria | 1190 |
| 1207 | Ga0373950_0077527 | 3300034818 | Bacteria | 689 |
| 1208 | Ga0373958_0010738 | 3300034819 | Bacteria | 1533 |
| 1209 | Ga0373959_0020412 | 3300034820 | Bacteria | 1264 |
| 1210 | Ga0373938_0001426 | 3300034957 | Bacteria | 3828 |
| 1211 | Ga0373938_0130541 | 3300034957 | Bacteria | 655 |
| 1212 | Ga0373926_0034160 | 3300035083 | Bacteria | 1799 |
| 1213 | Ga0373926_0068678 | 3300035083 | Bacteria | 1299 |
| 1214 | Ga0373929_0026404 | 3300035085 | Bacteria | 1213 |
| 1215 | Ga0373934_0040018 | 3300035086 | Bacteria | 1848 |
| 1216 | Ga0373940_0048280 | 3300035088 | Bacteria | 1189 |
| 1217 | Ga0373940_0222946 | 3300035088 | Bacteria | 627 |
| 1218 | Ga0373940_0307663 | 3300035088 | Bacteria | 547 |
| 1219 | Ga0373944_0004086 | 3300035089 | Bacteria | 3786 |
| 1220 | Ga0373944_0062771 | 3300035089 | Bacteria | 1195 |
| 1221 | Ga0373944_0073109 | 3300035089 | Bacteria | 1120 |
| 1222 | Ga0373944_0368231 | 3300035089 | Bacteria | 549 |
| 1223 | Ga0373949_0038456 | 3300035090 | Bacteria | 1167 |
| 1224 | Ga0373951_0027396 | 3300035091 | Bacteria | 1331 |
| 1225 | Ga0373951_0037788 | 3300035091 | Bacteria | 1156 |
| 1226 | Ga0373951_0235748 | 3300035091 | Bacteria | 545 |
| 1227 | Ga0373923_0014805 | 3300035111 | Bacteria | 2936 |
| 1228 | Ga0373923_0107546 | 3300035111 | Bacteria | 1235 |
| 1229 | Ga0373923_0210712 | 3300035111 | Bacteria | 901 |
| 1230 | Ga0373936_0071846 | 3300035113 | Bacteria | 1427 |
| 1231 | Ga0373936_0326230 | 3300035113 | Bacteria | 696 |
| 1232 | Ga0373936_0585638 | 3300035113 | Bacteria | 523 |
| 1233 | Ga0373939_0010117 | 3300035114 | Bacteria | 2350 |
| 1234 | Ga0373939_0458280 | 3300035114 | Bacteria | 538 |
| 1235 | Ga0373941_0039099 | 3300035115 | Bacteria | 1456 |
| 1236 | Ga0373945_0028673 | 3300035116 | Bacteria | 1951 |
| 1237 | Ga0373945_0067182 | 3300035116 | Bacteria | 1349 |
| 1238 | Ga0373945_0069441 | 3300035116 | Bacteria | 1330 |
| 1239 | Ga0373945_0121367 | 3300035116 | Bacteria | 1039 |
| 1240 | Ga0373953_0020810 | 3300035117 | Bacteria | 2454 |
| 1241 | Ga0373954_0102373 | 3300035118 | Bacteria | 1382 |
| 1242 | Ga0373956_0041225 | 3300035119 | Bacteria | 2049 |
| 1243 | Ga0373956_0581112 | 3300035119 | Bacteria | 535 |
| 1244 | Ga0373957_0051489 | 3300035120 | Bacteria | 1575 |
| 1245 | Ga0373957_0358587 | 3300035120 | Bacteria | 623 |
| 1246 | Ga0373960_0002462 | 3300035121 | Bacteria | 4159 |
| 1247 | Ga0373960_0280893 | 3300035121 | Bacteria | 614 |
| 1248 | Ga0373960_0329935 | 3300035121 | Bacteria | 574 |
| 1249 | Ga0373943_0024217 | 3300035170 | Bacteria | 2829 |
| 1250 | Ga0373943_0182958 | 3300035170 | Bacteria | 1153 |
| 1251 | Ga0373943_0385367 | 3300035170 | Bacteria | 807 |
| 1252 | Ga0373946_0374942 | 3300035171 | Bacteria | 715 |
| 1253 | Ga0373946_0747046 | 3300035171 | Bacteria | 513 |
| 1254 | Ga0373946_0774150 | 3300035171 | Bacteria | 504 |
| 1255 | Ga0373955_0291763 | 3300035172 | Bacteria | 983 |
| 1256 | Ga0373955_0540394 | 3300035172 | Bacteria | 713 |
| 1257 | Ga0373942_0016107 | 3300035207 | Bacteria | 1830 |
| 1258 | Ga0373942_0049827 | 3300035207 | Bacteria | 1170 |
| 1259 | Ga0373961_0069794 | 3300035241 | Bacteria | 1084 |
| 1260 | Ga0316574_0379218 | 3300035398 | Bacteria | 892 |
| 1261 | Ga0316574_0533956 | 3300035398 | Unclassified | 729 |
| 1262 | Ga0316574_0661307 | 3300035398 | Bacteria | 643 |
| 1263 | Ga0373924_0018083 | 3300035410 | Bacteria | 2713 |
| 1264 | Ga0373924_0037517 | 3300035410 | Bacteria | 1973 |
| 1265 | Ga0373931_0107722 | 3300035691 | Bacteria | 1576 |
| 1266 | Ga0373931_0738751 | 3300035691 | Bacteria | 652 |
| 1267 | Ga0373931_0739457 | 3300035691 | Bacteria | 652 |
| 1268 | Ga0373931_0953070 | 3300035691 | Bacteria | 579 |
| 1269 | Ga0373935_0189880 | 3300035692 | Bacteria | 1414 |
| 1270 | Ga0373935_0258508 | 3300035692 | Bacteria | 1220 |
| 1271 | Ga0373935_0271051 | 3300035692 | Bacteria | 1193 |
| 1272 | Ga0373935_0630585 | 3300035692 | Bacteria | 785 |
| 1273 | Ga0373935_0702300 | 3300035692 | Bacteria | 744 |
| 1274 | Ga0373935_0779448 | 3300035692 | Bacteria | 705 |
| 1275 | Ga0373935_1261808 | 3300035692 | Bacteria | 551 |
| 1276 | Ga0373927_0108408 | 3300035695 | Bacteria | 1809 |
| 1277 | Ga0373927_0116777 | 3300035695 | Bacteria | 1740 |
| 1278 | Ga0373927_0194092 | 3300035695 | Bacteria | 1332 |
| 1279 | Ga0373927_0229413 | 3300035695 | Bacteria | 1220 |
| 1280 | Ga0373933_0195094 | 3300035724 | Bacteria | 1294 |
| 1281 | Ga0373947_0146162 | 3300035725 | Bacteria | 1520 |
| 1282 | Ga0373947_0154034 | 3300035725 | Bacteria | 1482 |
| 1283 | Ga0373947_0169552 | 3300035725 | Bacteria | 1415 |
| 1284 | Ga0373947_0175028 | 3300035725 | Bacteria | 1394 |
| 1285 | Ga0373947_0227152 | 3300035725 | Bacteria | 1228 |
| 1286 | Ga0373947_0716735 | 3300035725 | Bacteria | 682 |
| 1287 | Ga0373937_0289081 | 3300036401 | Bacteria | 1548 |
| 1288 | Ga0373937_0382347 | 3300036401 | Bacteria | 1335 |
| 1289 | Ga0373937_0390445 | 3300036401 | Bacteria | 1320 |
| 1290 | Ga0316582_0250181 | 3300036647 | Bacteria | 1214 |
| 1291 | Ga0316584_1062113 | 3300036712 | Bacteria | 539 |
| 1292 | Ga0316584_1062273 | 3300036712 | Unclassified | 539 |
| 1293 | Ga0373925_0026850 | 3300037068 | Bacteria | 4215 |
| 1294 | Ga0373925_0052739 | 3300037068 | Bacteria | 3039 |
| 1295 | Ga0373925_0240883 | 3300037068 | Bacteria | 1448 |
| 1296 | Ga0373925_0290833 | 3300037068 | Bacteria | 1317 |
| 1297 | Ga0373925_1686490 | 3300037068 | Bacteria | 517 |
| 1298 | Ga0373925_1715268 | 3300037068 | Bacteria | 513 |
| 1299 | Ga0395900_0747076 | 3300037418 | Bacteria | 909 |
| 1300 | Ga0395900_1210458 | 3300037418 | Bacteria | 671 |
| 1301 | Ga0395900_1756391 | 3300037418 | Bacteria | 531 |
| 1302 | Ga0395898_0060463 | 3300037466 | Bacteria | 3682 |
| 1303 | Ga0395898_0348393 | 3300037466 | Bacteria | 1412 |
| 1304 | Ga0395898_1444344 | 3300037466 | Bacteria | 615 |
| 1305 | Ga0395905_0484243 | 3300037471 | Unclassified | 1137 |
| 1306 | Ga0436364_0255320 | 3300037853 | Bacteria | 578 |
| 1307 | Ga0436364_0541898 | 3300037853 | Bacteria | 566 |
| 1308 | Ga0436364_0554499 | 3300037853 | Bacteria | 1947 |
| 1309 | Ga0436364_0726935 | 3300037853 | Bacteria | 1697 |
| 1310 | Ga0436364_0963528 | 3300037853 | Bacteria | 1194 |
| 1311 | Ga0436364_1483246 | 3300037853 | Bacteria | 3752 |
| 1312 | Ga0395901_0456402 | 3300038443 | Bacteria | 1306 |
| 1313 | Ga0395901_1102178 | 3300038443 | Bacteria | 764 |
| 1314 | Ga0395901_2039156 | 3300038443 | Bacteria | 519 |
| 1315 | Ga0436365_0532529 | 3300039437 | Bacteria | 917 |
| 1316 | Ga0436365_0966114 | 3300039437 | Bacteria | 1454 |
| 1317 | Ga0436365_1020445 | 3300039437 | Bacteria | 705 |
| 1318 | Ga0436365_1131554 | 3300039437 | Bacteria | 1482 |
| 1319 | Ga0436365_1388600 | 3300039437 | Bacteria | 809 |
| 1320 | Ga0436365_1925217 | 3300039437 | Bacteria | 653 |
| 1321 | Ga0436360_0429478 | 3300039438 | Bacteria | 589 |
| 1322 | Ga0436360_0770642 | 3300039438 | Bacteria | 661 |
| 1323 | Ga0436360_0832524 | 3300039438 | Bacteria | 1704 |
| 1324 | Ga0436360_1128830 | 3300039438 | Bacteria | 512 |
| 1325 | Ga0436360_1166796 | 3300039438 | Bacteria | 1550 |
| 1326 | Ga0436361_0044025 | 3300039447 | Bacteria | 593 |
| 1327 | Ga0436361_0671466 | 3300039447 | Bacteria | 541 |
| 1328 | Ga0436361_0697198 | 3300039447 | Bacteria | 621 |
| 1329 | Ga0436361_0948409 | 3300039447 | Bacteria | 559 |
| 1330 | Ga0436361_0985371 | 3300039447 | Bacteria | 726 |
| 1331 | Ga0436363_0018834 | 3300039450 | Bacteria | 1611 |
| 1332 | Ga0436363_0817356 | 3300039450 | Bacteria | 584 |
| 1333 | Ga0436363_1001204 | 3300039450 | Bacteria | 914 |
| 1334 | Ga0436362_0016536 | 3300039453 | Bacteria | 614 |
| 1335 | Ga0436362_0376050 | 3300039453 | Bacteria | 532 |
| 1336 | Ga0436362_0926788 | 3300039453 | Bacteria | 1182 |
| 1337 | Ga0439436_0033996 | 3300041404 | Bacteria | 1474 |
| 1338 | Ga0439436_0123331 | 3300041404 | Bacteria | 725 |
| 1339 | Ga0439439_0036586 | 3300041406 | Bacteria | 1263 |
| 1340 | Ga0439447_027919 | 3300041407 | Bacteria | 1437 |
| 1341 | Ga0439453_0017139 | 3300041408 | Bacteria | 1270 |
| 1342 | Ga0439453_0062135 | 3300041408 | Bacteria | 775 |
| 1343 | Ga0439461_0008144 | 3300041410 | Bacteria | 1872 |
| 1344 | Ga0439465_0000081 | 3300041413 | Bacteria | 20876 |
| 1345 | Ga0451787_087122 | 3300041441 | Bacteria | 608 |
| 1346 | Ga0451789_1080748 | 3300041443 | Bacteria | 689 |
| 1347 | Ga0451791_0659445 | 3300041451 | Bacteria | 561 |
| 1348 | Ga0451791_0973324 | 3300041451 | Bacteria | 741 |
| 1349 | Ga0451791_1087098 | 3300041451 | Bacteria | 508 |
| 1350 | Ga0451791_1201354 | 3300041451 | Bacteria | 552 |
| 1351 | Ga0451791_1361698 | 3300041451 | Bacteria | 681 |
| 1352 | Ga0451797_1582856 | 3300041453 | Bacteria | 721 |
| 1353 | Ga0451795_0150957 | 3300041456 | Bacteria | 536 |
| 1354 | Ga0451795_1073768 | 3300041456 | Bacteria | 1576 |
| 1355 | Ga0451798_0233393 | 3300041458 | Bacteria | 592 |
| 1356 | Ga0451798_0687350 | 3300041458 | Bacteria | 795 |
| 1357 | Ga0451800_0467117 | 3300041459 | Bacteria | 565 |
| 1358 | Ga0451800_0478560 | 3300041459 | Bacteria | 1342 |
| 1359 | Ga0451800_0514837 | 3300041459 | Bacteria | 558 |
| 1360 | Ga0451800_1567732 | 3300041459 | Bacteria | 709 |
| 1361 | Ga0451802_0651888 | 3300041460 | Bacteria | 714 |
| 1362 | Ga0451802_1912908 | 3300041460 | Bacteria | 925 |
| 1363 | Ga0451804_0438673 | 3300041463 | Bacteria | 801 |
| 1364 | Ga0451807_0289057 | 3300041486 | Bacteria | 703 |
| 1365 | Ga0451807_1300876 | 3300041486 | Bacteria | 745 |
| 1366 | Ga0451833_0920853 | 3300041491 | Bacteria | 839 |
| 1367 | Ga0451833_1273368 | 3300041491 | Bacteria | 714 |
| 1368 | Ga0451835_1138368 | 3300041492 | Bacteria | 767 |
| 1369 | Ga0451835_1260456 | 3300041492 | Bacteria | 590 |
| 1370 | Ga0451837_0538533 | 3300041494 | Bacteria | 729 |
| 1371 | Ga0451837_1753977 | 3300041494 | Bacteria | 717 |
| 1372 | Ga0451841_0245237 | 3300041498 | Bacteria | 847 |
| 1373 | Ga0451845_0067126 | 3300041501 | Bacteria | 1194 |
| 1374 | Ga0451845_0626369 | 3300041501 | Bacteria | 706 |
| 1375 | Ga0451847_0954509 | 3300041503 | Bacteria | 575 |
| 1376 | Ga0451849_1486900 | 3300041505 | Bacteria | 1502 |
| 1377 | Ga0451851_0617812 | 3300041507 | Bacteria | 640 |
| 1378 | Ga0451843_0028691 | 3300041509 | Bacteria | 732 |
| 1379 | Ga0451843_1612071 | 3300041509 | Bacteria | 578 |
| 1380 | Ga0451853_0025403 | 3300041512 | Bacteria | 505 |
| 1381 | Ga0451853_1048281 | 3300041512 | Bacteria | 1355 |
| 1382 | Ga0451853_3365647 | 3300041512 | Bacteria | 580 |
| 1383 | Ga0439441_021140 | 3300042001 | Bacteria | 1198 |
| 1384 | Ga0439448_0059925 | 3300042005 | Bacteria | 1257 |
| 1385 | Ga0439448_0103011 | 3300042005 | Bacteria | 971 |
| 1386 | Ga0439432_253793 | 3300042006 | Bacteria | 504 |
| 1387 | Ga0439449_0154125 | 3300042007 | Bacteria | 857 |
| 1388 | Ga0439451_031816 | 3300042009 | Bacteria | 1060 |
| 1389 | Ga0439452_031173 | 3300042010 | Bacteria | 1309 |
| 1390 | Ga0439454_009771 | 3300042011 | Bacteria | 1252 |
| 1391 | Ga0439457_028826 | 3300042014 | Bacteria | 1229 |
| 1392 | Ga0439462_0031121 | 3300042015 | Bacteria | 1412 |
| 1393 | Ga0439462_0035441 | 3300042015 | Bacteria | 1326 |
| 1394 | Ga0450914_005632 | 3300042118 | Bacteria | 1068 |
| 1395 | Ga0450898_016660 | 3300042134 | Bacteria | 1256 |
| 1396 | Ga0450903_064932 | 3300042138 | Bacteria | 528 |
| 1397 | Ga0439446_0051970 | 3300042156 | Bacteria | 1225 |
| 1398 | Ga0439446_0125999 | 3300042156 | Bacteria | 828 |
| 1399 | Ga0450909_086486 | 3300042185 | Bacteria | 511 |
| 1400 | Ga0439434_0027544 | 3300042435 | Bacteria | 1718 |
| 1401 | Ga0439435_0032471 | 3300042436 | Bacteria | 1424 |
| 1402 | Ga0439444_0016557 | 3300042437 | Bacteria | 1257 |
| 1403 | Ga0439444_0134282 | 3300042437 | Bacteria | 587 |
| 1404 | Ga0439459_0000106 | 3300042438 | Bacteria | 7783 |
| 1405 | Ga0439459_0000690 | 3300042438 | Bacteria | 4605 |
| 1406 | Ga0439459_0151550 | 3300042438 | Bacteria | 606 |
| 1407 | Ga0439459_0187706 | 3300042438 | Bacteria | 558 |
| 1408 | Ga0439464_0042650 | 3300042439 | Bacteria | 1296 |
| 1409 | Ga0439460_0051046 | 3300042461 | Bacteria | 1240 |
| 1410 | Ga0450893_0092695 | 3300042532 | Bacteria | 608 |
| 1411 | Ga0451577_0039329 | 3300042876 | Bacteria | 4251 |
| 1412 | Ga0451577_0089653 | 3300042876 | Bacteria | 2744 |
| 1413 | Ga0451577_0207422 | 3300042876 | Bacteria | 1770 |
| 1414 | Ga0451577_0340359 | 3300042876 | Bacteria | 1360 |
| 1415 | Ga0439440_0201111 | 3300042993 | Bacteria | 591 |
| 1416 | Ga0466969_0120383 | 3300044656 | Bacteria | 1222 |
| 1417 | Ga0453683_0036678 | 3300044673 | Bacteria | 3085 |
| 1418 | Ga0453683_0070373 | 3300044673 | Bacteria | 2188 |
| 1419 | Ga0453683_0166036 | 3300044673 | Bacteria | 1397 |
| 1420 | Ga0453683_0308001 | 3300044673 | Bacteria | 1014 |
| 1421 | Ga0466965_0248141 | 3300044683 | Bacteria | 954 |
| 1422 | Ga0466966_0191340 | 3300044684 | Bacteria | 1239 |
| 1423 | Ga0466966_0832149 | 3300044684 | Bacteria | 556 |
| 1424 | Ga0466961_0177888 | 3300044693 | Bacteria | 1321 |
| 1425 | Ga0466963_0136281 | 3300044694 | Bacteria | 1698 |
| 1426 | Ga0466964_0106656 | 3300044706 | Bacteria | 1243 |
| 1427 | Ga0466964_0796220 | 3300044706 | Bacteria | 534 |
| 1428 | Ga0453684_0092963 | 3300044712 | Bacteria | 3716 |
| 1429 | Ga0453684_0134912 | 3300044712 | Bacteria | 2957 |
| 1430 | Ga0453684_1552583 | 3300044712 | Bacteria | 681 |
| 1431 | Ga0466971_0078765 | 3300044719 | Bacteria | 1501 |
| 1432 | Ga0466968_0077765 | 3300044735 | Bacteria | 1453 |
| 1433 | Ga0466970_0132543 | 3300044765 | Bacteria | 1369 |
| 1434 | Ga0466970_0163103 | 3300044765 | Bacteria | 1233 |
| 1435 | Ga0466957_0102406 | 3300044842 | Bacteria | 1806 |
| 1436 | Ga0466957_0212421 | 3300044842 | Bacteria | 1274 |
| 1437 | Ga0466957_0226723 | 3300044842 | Bacteria | 1235 |
| 1438 | Ga0451576_0009749 | 3300045051 | Bacteria | 11104 |
| 1439 | Ga0451576_0125849 | 3300045051 | Bacteria | 2670 |
| 1440 | Ga0451576_1865451 | 3300045051 | Bacteria | 621 |
| 1441 | Ga0451576_2330833 | 3300045051 | Bacteria | 548 |
| 1442 | Ga0466958_0176781 | 3300045836 | Bacteria | 1353 |
| 1443 | Ga0466958_0230737 | 3300045836 | Bacteria | 1182 |
| 1444 | Ga0466967_0367160 | 3300045976 | Bacteria | 1395 |
| 1445 | Ga0466967_0512709 | 3300045976 | Bacteria | 1178 |
| 1446 | Ga0466967_0536351 | 3300045976 | Bacteria | 1151 |
| 1447 | Ga0466967_0596187 | 3300045976 | Bacteria | 1090 |
| 1448 | Ga0466967_2171523 | 3300045976 | Bacteria | 551 |
| 1449 | Ga0495627_044618 | 3300046453 | Bacteria | 1353 |
| 1450 | Ga0495592_0218003 | 3300046454 | Bacteria | 1277 |
| 1451 | Ga0495592_0320842 | 3300046454 | Bacteria | 1001 |
| 1452 | Ga0495603_0121147 | 3300046455 | Bacteria | 1524 |
| 1453 | Ga0495603_0176565 | 3300046455 | Bacteria | 1236 |
| 1454 | Ga0495603_0261788 | 3300046455 | Bacteria | 995 |
| 1455 | Ga0495590_0053109 | 3300046457 | Bacteria | 1415 |
| 1456 | Ga0495590_0088863 | 3300046457 | Bacteria | 1092 |
| 1457 | Ga0495590_0239992 | 3300046457 | Bacteria | 672 |
| 1458 | Ga0495591_034336 | 3300046458 | Bacteria | 1494 |
| 1459 | Ga0495629_0103686 | 3300046459 | Bacteria | 1984 |
| 1460 | Ga0495629_0248371 | 3300046459 | Bacteria | 1224 |
| 1461 | Ga0495629_0254649 | 3300046459 | Bacteria | 1207 |
| 1462 | Ga0495638_0002512 | 3300046460 | Bacteria | 14916 |
| 1463 | Ga0495638_0043353 | 3300046460 | Bacteria | 2838 |
| 1464 | Ga0495641_0050797 | 3300046461 | Bacteria | 1895 |
| 1465 | Ga0495641_0088208 | 3300046461 | Bacteria | 1387 |
| 1466 | Ga0495641_0094513 | 3300046461 | Bacteria | 1335 |
| 1467 | Ga0495641_0257827 | 3300046461 | Bacteria | 784 |
| 1468 | Ga0495651_0124442 | 3300046462 | Bacteria | 1889 |
| 1469 | Ga0495651_0305320 | 3300046462 | Bacteria | 1066 |
| 1470 | Ga0495653_0123480 | 3300046463 | Bacteria | 1842 |
| 1471 | Ga0495653_0222661 | 3300046463 | Bacteria | 1267 |
| 1472 | Ga0495653_0457003 | 3300046463 | Bacteria | 802 |
| 1473 | Ga0495580_0388956 | 3300046472 | Bacteria | 941 |
| 1474 | Ga0495582_0208256 | 3300046473 | Bacteria | 1117 |
| 1475 | Ga0495582_0267446 | 3300046473 | Bacteria | 981 |
| 1476 | Ga0495605_0109124 | 3300046474 | Bacteria | 1264 |
| 1477 | Ga0495605_0140644 | 3300046474 | Bacteria | 1083 |
| 1478 | Ga0495639_0055704 | 3300046475 | Bacteria | 1804 |
| 1479 | Ga0495639_0101308 | 3300046475 | Bacteria | 1360 |
| 1480 | Ga0495639_0110429 | 3300046475 | Bacteria | 1304 |
| 1481 | Ga0495639_0128793 | 3300046475 | Bacteria | 1210 |
| 1482 | Ga0495639_0244154 | 3300046475 | Bacteria | 887 |
| 1483 | Ga0495662_0112644 | 3300046476 | Bacteria | 1333 |
| 1484 | Ga0495662_0181763 | 3300046476 | Bacteria | 1036 |
| 1485 | Ga0495662_0196052 | 3300046476 | Bacteria | 995 |
| 1486 | Ga0495664_0020887 | 3300046477 | Bacteria | 3780 |
| 1487 | Ga0495664_0183508 | 3300046477 | Bacteria | 1268 |
| 1488 | Ga0495664_0272202 | 3300046477 | Bacteria | 1023 |
| 1489 | Ga0495664_0276046 | 3300046477 | Bacteria | 1015 |
| 1490 | Ga0495584_0136449 | 3300046491 | Bacteria | 1245 |
| 1491 | Ga0495584_0137515 | 3300046491 | Bacteria | 1240 |
| 1492 | Ga0495585_0108637 | 3300046492 | Bacteria | 1477 |
| 1493 | Ga0495594_0092562 | 3300046499 | Bacteria | 1695 |
| 1494 | Ga0495594_0129438 | 3300046499 | Bacteria | 1429 |
| 1495 | Ga0495594_0142752 | 3300046499 | Bacteria | 1358 |
| 1496 | Ga0495594_0332694 | 3300046499 | Bacteria | 865 |
| 1497 | Ga0495594_0428073 | 3300046499 | Bacteria | 752 |
| 1498 | Ga0495594_0872343 | 3300046499 | Bacteria | 506 |
| 1499 | Ga0495607_0109479 | 3300046501 | Bacteria | 1467 |
| 1500 | Ga0495607_0168099 | 3300046501 | Bacteria | 1109 |
| 1501 | Ga0495583_0304742 | 3300046506 | Bacteria | 633 |
| 1502 | Ga0495606_0151522 | 3300046507 | Bacteria | 1360 |
| 1503 | Ga0495606_0166696 | 3300046507 | Bacteria | 1281 |
| 1504 | Ga0495606_0177129 | 3300046507 | Bacteria | 1232 |
| 1505 | Ga0495608_0190310 | 3300046511 | Bacteria | 1295 |
| 1506 | Ga0495608_0249375 | 3300046511 | Bacteria | 1107 |
| 1507 | Ga0495610_0335753 | 3300046512 | Bacteria | 573 |
| 1508 | Ga0495616_0041790 | 3300046513 | Bacteria | 2337 |
| 1509 | Ga0495618_0171691 | 3300046514 | Bacteria | 1379 |
| 1510 | Ga0495618_0487064 | 3300046514 | Bacteria | 745 |
| 1511 | Ga0495618_0749040 | 3300046514 | Bacteria | 572 |
| 1512 | Ga0495620_0074838 | 3300046515 | Bacteria | 1379 |
| 1513 | Ga0495620_0080985 | 3300046515 | Bacteria | 1313 |
| 1514 | Ga0495620_0175124 | 3300046515 | Bacteria | 831 |
| 1515 | Ga0495620_0189164 | 3300046515 | Bacteria | 794 |
| 1516 | Ga0495628_0274870 | 3300046516 | Bacteria | 1252 |
| 1517 | Ga0495628_0282733 | 3300046516 | Bacteria | 1231 |
| 1518 | Ga0495628_0404820 | 3300046516 | Bacteria | 996 |
| 1519 | Ga0495628_0833781 | 3300046516 | Bacteria | 643 |
| 1520 | Ga0495630_0058711 | 3300046517 | Bacteria | 2884 |
| 1521 | Ga0495630_0264249 | 3300046517 | Bacteria | 1314 |
| 1522 | Ga0495630_0266217 | 3300046517 | Bacteria | 1309 |
| 1523 | Ga0495630_0298618 | 3300046517 | Bacteria | 1231 |
| 1524 | Ga0495631_0009052 | 3300046518 | Bacteria | 4987 |
| 1525 | Ga0495631_0025621 | 3300046518 | Bacteria | 2714 |
| 1526 | Ga0495632_0076925 | 3300046519 | Bacteria | 1596 |
| 1527 | Ga0495632_0379423 | 3300046519 | Bacteria | 619 |
| 1528 | Ga0495632_0493262 | 3300046519 | Bacteria | 529 |
| 1529 | Ga0495637_0058375 | 3300046520 | Bacteria | 1590 |
| 1530 | Ga0495643_0131453 | 3300046522 | Bacteria | 1256 |
| 1531 | Ga0495643_0138615 | 3300046522 | Bacteria | 1215 |
| 1532 | Ga0495643_0139789 | 3300046522 | Bacteria | 1209 |
| 1533 | Ga0495643_0159805 | 3300046522 | Bacteria | 1109 |
| 1534 | Ga0495643_0216664 | 3300046522 | Bacteria | 910 |
| 1535 | Ga0495644_0281749 | 3300046523 | Bacteria | 648 |
| 1536 | Ga0495648_0071391 | 3300046524 | Bacteria | 2013 |
| 1537 | Ga0495648_0212217 | 3300046524 | Bacteria | 961 |
| 1538 | Ga0495663_0055302 | 3300046525 | Bacteria | 1237 |
| 1539 | Ga0495666_0089783 | 3300046526 | Bacteria | 1450 |
| 1540 | Ga0495666_0104088 | 3300046526 | Bacteria | 1336 |
| 1541 | Ga0495666_0278285 | 3300046526 | Bacteria | 759 |
| 1542 | Ga0495652_0137051 | 3300046529 | Bacteria | 1930 |
| 1543 | Ga0495652_0217572 | 3300046529 | Bacteria | 1437 |
| 1544 | Ga0495652_0248676 | 3300046529 | Bacteria | 1319 |
| 1545 | Ga0495665_0390327 | 3300046531 | Bacteria | 706 |
| 1546 | Ga0495640_0178474 | 3300046533 | Bacteria | 1354 |
| 1547 | Ga0495640_0192539 | 3300046533 | Bacteria | 1295 |
| 1548 | Ga0495640_0208420 | 3300046533 | Bacteria | 1236 |
| 1549 | Ga0495586_0111523 | 3300046535 | Bacteria | 1522 |
| 1550 | Ga0495586_0115396 | 3300046535 | Bacteria | 1497 |
| 1551 | Ga0495586_0133551 | 3300046535 | Bacteria | 1390 |
| 1552 | Ga0495587_0064421 | 3300046536 | Bacteria | 2141 |
| 1553 | Ga0495587_0320450 | 3300046536 | Bacteria | 866 |
| 1554 | Ga0495598_0285669 | 3300046537 | Bacteria | 620 |
| 1555 | Ga0495609_0083751 | 3300046538 | Bacteria | 1392 |
| 1556 | Ga0495621_0067002 | 3300046539 | Bacteria | 1314 |
| 1557 | Ga0495597_0116550 | 3300046542 | Bacteria | 1116 |
| 1558 | Ga0495597_0176638 | 3300046542 | Bacteria | 865 |
| 1559 | Ga0495645_0161545 | 3300046543 | Bacteria | 1548 |
| 1560 | Ga0495645_0627371 | 3300046543 | Bacteria | 659 |
| 1561 | Ga0495645_0842658 | 3300046543 | Bacteria | 547 |
| 1562 | Ga0495622_0129437 | 3300046557 | Bacteria | 1150 |
| 1563 | Ga0495633_0072529 | 3300046558 | Bacteria | 1605 |
| 1564 | Ga0495667_0114054 | 3300046559 | Bacteria | 1746 |
| 1565 | Ga0495667_0207252 | 3300046559 | Bacteria | 1253 |
| 1566 | Ga0495656_0046619 | 3300046615 | Bacteria | 1834 |
| 1567 | Ga0495668_0034180 | 3300046616 | Bacteria | 2854 |
| 1568 | Ga0495668_0079381 | 3300046616 | Bacteria | 1801 |
| 1569 | Ga0495634_0005027 | 3300046642 | Bacteria | 10210 |
| 1570 | Ga0495634_0126300 | 3300046642 | Bacteria | 1634 |
| 1571 | Ga0495634_0179009 | 3300046642 | Bacteria | 1328 |
| 1572 | Ga0495634_0198450 | 3300046642 | Bacteria | 1247 |
| 1573 | Ga0495611_0093745 | 3300046648 | Bacteria | 1389 |
| 1574 | Ga0495611_0103386 | 3300046648 | Bacteria | 1324 |
| 1575 | Ga0495625_0173962 | 3300046660 | Bacteria | 1436 |
| 1576 | Ga0495625_0176598 | 3300046660 | Bacteria | 1423 |
| 1577 | Ga0495625_0695161 | 3300046660 | Bacteria | 601 |
| 1578 | Ga0495635_0073937 | 3300046663 | Bacteria | 2334 |
| 1579 | Ga0495635_0264822 | 3300046663 | Bacteria | 1157 |
| 1580 | Ga0495659_0078894 | 3300046664 | Bacteria | 1246 |
| 1581 | Ga0495661_0254294 | 3300046665 | Bacteria | 895 |
| 1582 | Ga0495588_0099748 | 3300046674 | Bacteria | 1525 |
| 1583 | Ga0495588_0135876 | 3300046674 | Bacteria | 1298 |
| 1584 | Ga0495588_0141263 | 3300046674 | Bacteria | 1272 |
| 1585 | Ga0495657_0088566 | 3300046675 | Bacteria | 1989 |
| 1586 | Ga0495657_0208578 | 3300046675 | Bacteria | 1188 |
| 1587 | Ga0495657_0263738 | 3300046675 | Bacteria | 1034 |
| 1588 | Ga0495599_0153044 | 3300046678 | Bacteria | 1427 |
| 1589 | Ga0495599_0404590 | 3300046678 | Bacteria | 812 |
| 1590 | Ga0495646_0136216 | 3300046680 | Bacteria | 1377 |
| 1591 | Ga0495647_0078824 | 3300046681 | Bacteria | 1332 |
| 1592 | Ga0495647_0113124 | 3300046681 | Bacteria | 1134 |
| 1593 | Ga0495658_0157971 | 3300046683 | Bacteria | 1396 |
| 1594 | Ga0495658_0191218 | 3300046683 | Bacteria | 1273 |
| 1595 | Ga0495658_0800410 | 3300046683 | Bacteria | 603 |
| 1596 | Ga0495658_1088838 | 3300046683 | Bacteria | 509 |
| 1597 | Ga0495669_0046029 | 3300046684 | Bacteria | 1946 |
| 1598 | Ga0495613_0216801 | 3300046689 | Bacteria | 1344 |
| 1599 | Ga0495613_0255437 | 3300046689 | Bacteria | 1222 |
| 1600 | Ga0495613_0306445 | 3300046689 | Bacteria | 1098 |
| 1601 | Ga0495624_0083237 | 3300046690 | Bacteria | 1979 |
| 1602 | Ga0495624_0149607 | 3300046690 | Bacteria | 1428 |
| 1603 | Ga0495624_0183716 | 3300046690 | Bacteria | 1273 |
| 1604 | Ga0495624_0431070 | 3300046690 | Bacteria | 790 |
| 1605 | Ga0495624_0737741 | 3300046690 | Bacteria | 584 |
| 1606 | Ga0495670_0118969 | 3300046691 | Bacteria | 1371 |
| 1607 | Ga0495671_0057755 | 3300046692 | Bacteria | 1920 |
| 1608 | Ga0495671_0321379 | 3300046692 | Bacteria | 743 |
| 1609 | Ga0495649_0149467 | 3300046694 | Bacteria | 1227 |
| 1610 | Ga0495589_0192540 | 3300046794 | Bacteria | 964 |
| 1611 | Ga0495600_0116786 | 3300046809 | Bacteria | 1736 |
| 1612 | Ga0495600_0163077 | 3300046809 | Bacteria | 1440 |
| 1613 | Ga0495660_0117219 | 3300046810 | Bacteria | 1351 |
| 1614 | Ga0495581_0179350 | 3300047315 | Bacteria | 1238 |
| 1615 | Ga0495581_0186413 | 3300047315 | Bacteria | 1213 |
| 1616 | Ga0495581_0219426 | 3300047315 | Bacteria | 1112 |
| 1617 | Ga0495604_0195988 | 3300047317 | Bacteria | 1404 |
| 1618 | Ga0495604_0233857 | 3300047317 | Bacteria | 1259 |
| 1619 | Ga0495604_0518072 | 3300047317 | Bacteria | 772 |
| 1620 | Ga0495604_0909157 | 3300047317 | Bacteria | 549 |
| 1621 | Ga0495604_1051096 | 3300047317 | Bacteria | 502 |
| 1622 | Ga0495674_0001495 | 3300047319 | Bacteria | 22929 |
| 1623 | Ga0495674_0083380 | 3300047319 | Bacteria | 2740 |
| 1624 | Ga0495674_0253868 | 3300047319 | Bacteria | 1446 |
| 1625 | Ga0495674_0294083 | 3300047319 | Bacteria | 1327 |
| 1626 | Ga0495674_0787984 | 3300047319 | Bacteria | 740 |
| 1627 | Ga0495672_0220057 | 3300047320 | Bacteria | 938 |
| 1628 | Ga0495676_0192804 | 3300047321 | Bacteria | 1420 |
| 1629 | Ga0495676_0237430 | 3300047321 | Bacteria | 1249 |
| 1630 | Ga0495676_0261802 | 3300047321 | Bacteria | 1176 |
| 1631 | Ga0495680_0205135 | 3300047322 | Bacteria | 1413 |
| 1632 | Ga0495680_0252133 | 3300047322 | Bacteria | 1250 |
| 1633 | Ga0495683_0122063 | 3300047323 | Bacteria | 1235 |
| 1634 | Ga0495683_0123013 | 3300047323 | Bacteria | 1230 |
| 1635 | Ga0495683_0269253 | 3300047323 | Bacteria | 741 |
| 1636 | Ga0495675_0137558 | 3300047444 | Bacteria | 1515 |
| 1637 | Ga0495677_0346313 | 3300047445 | Bacteria | 586 |
| 1638 | Ga0495673_0119671 | 3300047469 | Bacteria | 1044 |
| 1639 | Ga0495673_0307484 | 3300047469 | Bacteria | 567 |
| 1640 | Ga0495673_0350496 | 3300047469 | Bacteria | 521 |
| 1641 | Ga0495681_0339473 | 3300047470 | Bacteria | 573 |
| 1642 | Ga0495684_0195905 | 3300047471 | Bacteria | 1491 |
| 1643 | Ga0495684_0748373 | 3300047471 | Bacteria | 643 |
| 1644 | Ga0495686_0004864 | 3300047472 | Bacteria | 10834 |
| 1645 | Ga0495686_0165831 | 3300047472 | Bacteria | 1288 |
| 1646 | Ga0495686_0571846 | 3300047472 | Bacteria | 588 |
| 1647 | Ga0495593_0052820 | 3300047673 | Bacteria | 2146 |
| 1648 | Ga0495593_0065174 | 3300047673 | Bacteria | 1900 |
| 1649 | Ga0495593_0145160 | 3300047673 | Bacteria | 1201 |
| 1650 | Ga0495593_0169992 | 3300047673 | Bacteria | 1099 |
| 1651 | Ga0495602_0152712 | 3300048088 | Bacteria | 1812 |
| 1652 | Ga0495602_0400510 | 3300048088 | Bacteria | 979 |
| 1653 | Ga0495602_0628017 | 3300048088 | Bacteria | 736 |
| 1654 | Ga0495602_1087087 | 3300048088 | Bacteria | 525 |
| 1655 | Ga0495614_0629626 | 3300048089 | Bacteria | 516 |
| 1656 | Ga0495626_0102073 | 3300048091 | Bacteria | 1249 |
| 1657 | Ga0496100_0026554 | 3300048903 | Bacteria | 3551 |
| 1658 | Ga0496100_0206815 | 3300048903 | Bacteria | 1433 |
| 1659 | Ga0496100_0273644 | 3300048903 | Bacteria | 1256 |
| 1660 | Ga0496100_0405239 | 3300048903 | Bacteria | 1039 |
| 1661 | Ga0496100_0439162 | 3300048903 | Bacteria | 999 |
| 1662 | Ga0496100_1556724 | 3300048903 | Bacteria | 522 |
| 1663 | Ga0496101_0013716 | 3300048904 | Bacteria | 5435 |
| 1664 | Ga0496101_0150392 | 3300048904 | Bacteria | 1780 |
| 1665 | Ga0496101_0207169 | 3300048904 | Bacteria | 1518 |
| 1666 | Ga0496101_0237315 | 3300048904 | Bacteria | 1418 |
| 1667 | Ga0496101_0255668 | 3300048904 | Bacteria | 1365 |
| 1668 | Ga0496101_0284191 | 3300048904 | Bacteria | 1294 |
| 1669 | Ga0496101_0436141 | 3300048904 | Bacteria | 1033 |
| 1670 | Ga0496101_0644601 | 3300048904 | Bacteria | 837 |
| 1671 | Ga0496102_0133290 | 3300048905 | Bacteria | 2327 |
| 1672 | Ga0496102_0227055 | 3300048905 | Bacteria | 1760 |
| 1673 | Ga0496102_0262179 | 3300048905 | Bacteria | 1629 |
| 1674 | Ga0496102_0289600 | 3300048905 | Bacteria | 1543 |
| 1675 | Ga0496102_0373274 | 3300048905 | Bacteria | 1342 |
| 1676 | Ga0496102_0388194 | 3300048905 | Bacteria | 1313 |
| 1677 | Ga0496102_0436784 | 3300048905 | Bacteria | 1229 |
| 1678 | Ga0496102_0745184 | 3300048905 | Bacteria | 902 |
| 1679 | Ga0496102_1392947 | 3300048905 | Bacteria | 620 |
| 1680 | Ga0496103_0007755 | 3300048906 | Bacteria | 6383 |
| 1681 | Ga0496103_0162551 | 3300048906 | Bacteria | 1432 |
| 1682 | Ga0496103_0200421 | 3300048906 | Bacteria | 1283 |
| 1683 | Ga0496103_0208364 | 3300048906 | Bacteria | 1257 |
| 1684 | Ga0496103_0738672 | 3300048906 | Bacteria | 623 |
| 1685 | Ga0496103_0789900 | 3300048906 | Bacteria | 599 |
| 1686 | Ga0496104_0302886 | 3300048907 | Bacteria | 1510 |
| 1687 | Ga0496104_0394902 | 3300048907 | Bacteria | 1295 |
| 1688 | Ga0496104_0411536 | 3300048907 | Bacteria | 1264 |
| 1689 | Ga0496104_0417735 | 3300048907 | Bacteria | 1253 |
| 1690 | Ga0496104_0774124 | 3300048907 | Unclassified | 866 |
| 1691 | Ga0496104_1761888 | 3300048907 | Bacteria | 522 |
| 1692 | Ga0496105_0253724 | 3300048908 | Bacteria | 1424 |
| 1693 | Ga0496105_0304495 | 3300048908 | Bacteria | 1280 |
| 1694 | Ga0496105_0363906 | 3300048908 | Bacteria | 1153 |
| 1695 | Ga0496105_0442735 | 3300048908 | Bacteria | 1026 |
| 1696 | Ga0496105_0643499 | 3300048908 | Bacteria | 819 |
| 1697 | Ga0496105_0928200 | 3300048908 | Bacteria | 655 |
| 1698 | Ga0496106_0008196 | 3300048909 | Bacteria | 7723 |
| 1699 | Ga0496106_0008640 | 3300048909 | Bacteria | 7538 |
| 1700 | Ga0496106_0197488 | 3300048909 | Bacteria | 1600 |
| 1701 | Ga0496106_0212744 | 3300048909 | Bacteria | 1540 |
| 1702 | Ga0496106_0232986 | 3300048909 | Bacteria | 1471 |
| 1703 | Ga0496106_0284267 | 3300048909 | Bacteria | 1325 |
| 1704 | Ga0496106_0339907 | 3300048909 | Bacteria | 1205 |
| 1705 | Ga0496107_0028081 | 3300048910 | Bacteria | 3998 |
| 1706 | Ga0496107_0199932 | 3300048910 | Bacteria | 1485 |
| 1707 | Ga0496107_0297028 | 3300048910 | Bacteria | 1202 |
| 1708 | Ga0496107_0315459 | 3300048910 | Bacteria | 1163 |
| 1709 | Ga0496107_0397707 | 3300048910 | Bacteria | 1025 |
| 1710 | Ga0496108_0323092 | 3300048911 | Bacteria | 1345 |
| 1711 | Ga0496108_0699809 | 3300048911 | Bacteria | 879 |
| 1712 | Ga0496108_0880357 | 3300048911 | Bacteria | 769 |
| 1713 | Ga0496109_0041208 | 3300048912 | Bacteria | 4184 |
| 1714 | Ga0496109_0389822 | 3300048912 | Bacteria | 1316 |
| 1715 | Ga0496109_1020796 | 3300048912 | Bacteria | 765 |
| 1716 | Ga0496110_0276414 | 3300048913 | Bacteria | 1529 |
| 1717 | Ga0496110_0329841 | 3300048913 | Bacteria | 1390 |
| 1718 | Ga0496110_0345976 | 3300048913 | Bacteria | 1354 |
| 1719 | Ga0496110_0347121 | 3300048913 | Bacteria | 1352 |
| 1720 | Ga0496110_0379246 | 3300048913 | Bacteria | 1288 |
| 1721 | Ga0496110_1687317 | 3300048913 | Bacteria | 544 |
| 1722 | Ga0496111_0223857 | 3300048914 | Bacteria | 1398 |
| 1723 | Ga0496111_0269719 | 3300048914 | Bacteria | 1262 |
| 1724 | Ga0496111_0367103 | 3300048914 | Bacteria | 1065 |
| 1725 | Ga0496111_0959515 | 3300048914 | Bacteria | 614 |
| 1726 | Ga0496112_0401425 | 3300048915 | Bacteria | 1310 |
| 1727 | Ga0496112_0412018 | 3300048915 | Bacteria | 1290 |
| 1728 | Ga0496112_0631657 | 3300048915 | Bacteria | 1001 |
| 1729 | Ga0496112_1011898 | 3300048915 | Bacteria | 751 |
| 1730 | Ga0496113_0351147 | 3300048916 | Bacteria | 1183 |
| 1731 | Ga0496113_0381662 | 3300048916 | Bacteria | 1131 |
| 1732 | Ga0496113_0444134 | 3300048916 | Bacteria | 1042 |
| 1733 | Ga0496113_0618161 | 3300048916 | Bacteria | 867 |
| 1734 | Ga0496114_0001685 | 3300048917 | Bacteria | 16766 |
| 1735 | Ga0496114_0220819 | 3300048917 | Bacteria | 1663 |
| 1736 | Ga0496114_0347574 | 3300048917 | Bacteria | 1311 |
| 1737 | Ga0496114_0373830 | 3300048917 | Bacteria | 1261 |
| 1738 | Ga0496114_0423391 | 3300048917 | Bacteria | 1179 |
| 1739 | Ga0496114_0536349 | 3300048917 | Bacteria | 1034 |
| 1740 | Ga0496114_1091680 | 3300048917 | Bacteria | 683 |
| 1741 | Ga0496115_0076611 | 3300048918 | Bacteria | 2718 |
| 1742 | Ga0496115_0176716 | 3300048918 | Bacteria | 1765 |
| 1743 | Ga0496115_0266288 | 3300048918 | Bacteria | 1409 |
| 1744 | Ga0496115_0281725 | 3300048918 | Bacteria | 1364 |
| 1745 | Ga0496115_0290789 | 3300048918 | Bacteria | 1340 |
| 1746 | Ga0496115_0330471 | 3300048918 | Bacteria | 1245 |
| 1747 | Ga0496116_0092087 | 3300048919 | Bacteria | 1840 |
| 1748 | Ga0496117_0016248 | 3300048920 | Bacteria | 6290 |
| 1749 | Ga0496117_0549801 | 3300048920 | Bacteria | 550 |
| 1750 | Ga0496118_0003921 | 3300048921 | Bacteria | 18212 |
| 1751 | Ga0496118_0005006 | 3300048921 | Bacteria | 15309 |
| 1752 | Ga0496118_0066028 | 3300048921 | Bacteria | 2643 |
| 1753 | Ga0496119_0087479 | 3300048922 | Bacteria | 1778 |
| 1754 | Ga0496119_0158176 | 3300048922 | Bacteria | 1207 |
| 1755 | Ga0496119_0249964 | 3300048922 | Bacteria | 894 |
| 1756 | Ga0496121_0000476 | 3300048924 | Bacteria | 78015 |
| 1757 | Ga0496121_0006084 | 3300048924 | Bacteria | 15185 |
| 1758 | Ga0496121_0020936 | 3300048924 | Bacteria | 6436 |
| 1759 | Ga0496121_0124621 | 3300048924 | Bacteria | 1939 |
| 1760 | Ga0496121_0662306 | 3300048924 | Bacteria | 634 |
| 1761 | Ga0496121_0696532 | 3300048924 | Bacteria | 612 |
| 1762 | Ga0496122_0000283 | 3300048925 | Bacteria | 113402 |
| 1763 | Ga0496122_0004099 | 3300048925 | Bacteria | 18459 |
| 1764 | Ga0496122_0087657 | 3300048925 | Bacteria | 2137 |
| 1765 | Ga0496122_0187791 | 3300048925 | Bacteria | 1224 |
| 1766 | Ga0496123_0000231 | 3300048926 | Bacteria | 113369 |
| 1767 | Ga0496123_0035623 | 3300048926 | Bacteria | 3543 |
| 1768 | Ga0496123_0061121 | 3300048926 | Bacteria | 2423 |
| 1769 | Ga0496123_0149555 | 3300048926 | Bacteria | 1262 |
| 1770 | Ga0496124_0000312 | 3300048927 | Bacteria | 89996 |
| 1771 | Ga0496124_0000907 | 3300048927 | Bacteria | 47809 |
| 1772 | Ga0496124_0013510 | 3300048927 | Bacteria | 7966 |
| 1773 | Ga0496124_0055068 | 3300048927 | Bacteria | 3364 |
| 1774 | Ga0496124_0069437 | 3300048927 | Bacteria | 2925 |
| 1775 | Ga0496124_0319733 | 3300048927 | Bacteria | 1112 |
| 1776 | Ga0496125_0079779 | 3300048928 | Bacteria | 2508 |
| 1777 | Ga0496125_0318112 | 3300048928 | Bacteria | 945 |
| 1778 | Ga0496126_0007244 | 3300048929 | Bacteria | 12196 |
| 1779 | Ga0496126_0077872 | 3300048929 | Bacteria | 2939 |
| 1780 | Ga0496126_0087925 | 3300048929 | Bacteria | 2738 |
| 1781 | Ga0496126_0093482 | 3300048929 | Bacteria | 2640 |
| 1782 | Ga0496126_0116424 | 3300048929 | Bacteria | 2323 |
| 1783 | Ga0496126_0260512 | 3300048929 | Bacteria | 1442 |
| 1784 | Ga0496126_0314267 | 3300048929 | Bacteria | 1289 |
| 1785 | Ga0496126_0747877 | 3300048929 | Bacteria | 755 |
| 1786 | Ga0496126_1230397 | 3300048929 | Unclassified | 549 |
| 1787 | Ga0495682_0024737 | 3300049460 | Bacteria | 2237 |
| 1788 | Ga0495682_0308087 | 3300049460 | Bacteria | 558 |
| 1789 | Ga0501290_002163 | 3300049513 | Bacteria | 2560 |
| 1790 | Ga0501291_012107 | 3300049514 | Bacteria | 1255 |
| 1791 | Ga0501292_011533 | 3300049515 | Bacteria | 1338 |
| 1792 | Ga0501297_003309 | 3300049520 | Bacteria | 1598 |
| 1793 | Ga0501299_010759 | 3300049522 | Bacteria | 1533 |
| 1794 | Ga0501300_012715 | 3300049523 | Bacteria | 1226 |
| 1795 | Ga0501300_015106 | 3300049523 | Bacteria | 1128 |
| 1796 | Ga0501301_005144 | 3300049524 | Unclassified | 950 |
| 1797 | Ga0501303_000456 | 3300049526 | Bacteria | 3233 |
| 1798 | Ga0501031_0042997 | 3300049568 | Bacteria | 2949 |
| 1799 | Ga0501031_0187223 | 3300049568 | Bacteria | 1352 |
| 1800 | Ga0501031_0224307 | 3300049568 | Bacteria | 1223 |
| 1801 | Ga0501031_0294730 | 3300049568 | Bacteria | 1051 |
| 1802 | Ga0501031_0637556 | 3300049568 | Bacteria | 685 |
| 1803 | Ga0501032_0005248 | 3300049569 | Bacteria | 9638 |
| 1804 | Ga0501032_0157886 | 3300049569 | Bacteria | 1489 |
| 1805 | Ga0501032_0261284 | 3300049569 | Bacteria | 1122 |
| 1806 | Ga0501032_0482849 | 3300049569 | Bacteria | 792 |
| 1807 | Ga0501032_0675125 | 3300049569 | Bacteria | 655 |
| 1808 | Ga0501033_0003930 | 3300049570 | Bacteria | 12056 |
| 1809 | Ga0501033_0006647 | 3300049570 | Bacteria | 9043 |
| 1810 | Ga0501033_0058533 | 3300049570 | Bacteria | 2846 |
| 1811 | Ga0501033_0196932 | 3300049570 | Bacteria | 1440 |
| 1812 | Ga0501033_0210910 | 3300049570 | Bacteria | 1385 |
| 1813 | Ga0501033_0229707 | 3300049570 | Bacteria | 1318 |
| 1814 | Ga0501033_0279538 | 3300049570 | Bacteria | 1178 |
| 1815 | Ga0501033_0453406 | 3300049570 | Bacteria | 890 |
| 1816 | Ga0501033_0758861 | 3300049570 | Bacteria | 657 |
| 1817 | Ga0501034_0012031 | 3300049571 | Bacteria | 8944 |
| 1818 | Ga0501034_0018190 | 3300049571 | Bacteria | 7209 |
| 1819 | Ga0501034_0018287 | 3300049571 | Bacteria | 7188 |
| 1820 | Ga0501034_0078724 | 3300049571 | Bacteria | 3300 |
| 1821 | Ga0501034_0276118 | 3300049571 | Bacteria | 1620 |
| 1822 | Ga0501034_0374074 | 3300049571 | Bacteria | 1350 |
| 1823 | Ga0501034_0394074 | 3300049571 | Bacteria | 1308 |
| 1824 | Ga0501034_0409826 | 3300049571 | Bacteria | 1277 |
| 1825 | Ga0501034_0435498 | 3300049571 | Bacteria | 1230 |
| 1826 | Ga0501034_0452087 | 3300049571 | Bacteria | 1202 |
| 1827 | Ga0501034_0453937 | 3300049571 | Bacteria | 1199 |
| 1828 | Ga0501034_0478568 | 3300049571 | Bacteria | 1161 |
| 1829 | Ga0501034_1217086 | 3300049571 | Bacteria | 631 |
| 1830 | Ga0501036_0003926 | 3300049572 | Bacteria | 11944 |
| 1831 | Ga0501036_0040536 | 3300049572 | Bacteria | 3938 |
| 1832 | Ga0501036_0070148 | 3300049572 | Bacteria | 2963 |
| 1833 | Ga0501036_0206756 | 3300049572 | Bacteria | 1650 |
| 1834 | Ga0501036_0224572 | 3300049572 | Bacteria | 1576 |
| 1835 | Ga0501036_0347329 | 3300049572 | Bacteria | 1239 |
| 1836 | Ga0501036_0360201 | 3300049572 | Bacteria | 1214 |
| 1837 | Ga0501036_0417502 | 3300049572 | Bacteria | 1119 |
| 1838 | Ga0501036_0893015 | 3300049572 | Bacteria | 729 |
| 1839 | Ga0501037_0009503 | 3300049573 | Bacteria | 7135 |
| 1840 | Ga0501037_0060761 | 3300049573 | Bacteria | 2756 |
| 1841 | Ga0501037_0100313 | 3300049573 | Bacteria | 2090 |
| 1842 | Ga0501037_0151115 | 3300049573 | Bacteria | 1659 |
| 1843 | Ga0501037_0210791 | 3300049573 | Bacteria | 1370 |
| 1844 | Ga0501037_0297924 | 3300049573 | Bacteria | 1120 |
| 1845 | Ga0501037_0729778 | 3300049573 | Bacteria | 657 |
| 1846 | Ga0501038_0212787 | 3300049574 | Bacteria | 1545 |
| 1847 | Ga0501038_0233687 | 3300049574 | Bacteria | 1462 |
| 1848 | Ga0501038_0278808 | 3300049574 | Bacteria | 1316 |
| 1849 | Ga0501038_0302303 | 3300049574 | Bacteria | 1255 |
| 1850 | Ga0501038_0356840 | 3300049574 | Bacteria | 1137 |
| 1851 | Ga0501038_0506120 | 3300049574 | Bacteria | 923 |
| 1852 | Ga0501038_0890210 | 3300049574 | Bacteria | 657 |
| 1853 | Ga0501038_0964018 | 3300049574 | Bacteria | 627 |
| 1854 | Ga0501039_0237723 | 3300049575 | Bacteria | 1432 |
| 1855 | Ga0501039_0408793 | 3300049575 | Bacteria | 1066 |
| 1856 | Ga0501039_0417692 | 3300049575 | Bacteria | 1053 |
| 1857 | Ga0501040_0047584 | 3300049576 | Bacteria | 2928 |
| 1858 | Ga0501040_0158049 | 3300049576 | Bacteria | 1601 |
| 1859 | Ga0501041_0114858 | 3300049577 | Bacteria | 1671 |
| 1860 | Ga0501042_0154610 | 3300049578 | Bacteria | 1654 |
| 1861 | Ga0501042_0461124 | 3300049578 | Bacteria | 922 |
| 1862 | Ga0501043_0008514 | 3300049579 | Bacteria | 8078 |
| 1863 | Ga0501043_0011933 | 3300049579 | Bacteria | 6798 |
| 1864 | Ga0501043_0158651 | 3300049579 | Bacteria | 1768 |
| 1865 | Ga0501043_0251336 | 3300049579 | Bacteria | 1362 |
| 1866 | Ga0501043_0275616 | 3300049579 | Bacteria | 1290 |
| 1867 | Ga0501043_0389839 | 3300049579 | Bacteria | 1053 |
| 1868 | Ga0501043_0694927 | 3300049579 | Bacteria | 743 |
| 1869 | Ga0501043_0853655 | 3300049579 | Bacteria | 655 |
| 1870 | Ga0501043_0958920 | 3300049579 | Bacteria | 611 |
| 1871 | Ga0501046_0085149 | 3300049580 | Bacteria | 2437 |
| 1872 | Ga0501046_0131819 | 3300049580 | Bacteria | 1895 |
| 1873 | Ga0501046_0136599 | 3300049580 | Bacteria | 1857 |
| 1874 | Ga0501046_0182480 | 3300049580 | Bacteria | 1568 |
| 1875 | Ga0501046_0232506 | 3300049580 | Bacteria | 1361 |
| 1876 | Ga0501046_0566742 | 3300049580 | Bacteria | 808 |
| 1877 | Ga0501046_0642967 | 3300049580 | Bacteria | 750 |
| 1878 | Ga0501046_1102730 | 3300049580 | Bacteria | 548 |
| 1879 | Ga0501047_0000871 | 3300049581 | Bacteria | 30824 |
| 1880 | Ga0501047_0007264 | 3300049581 | Bacteria | 10411 |
| 1881 | Ga0501047_0046350 | 3300049581 | Bacteria | 4201 |
| 1882 | Ga0501047_0077786 | 3300049581 | Bacteria | 3190 |
| 1883 | Ga0501047_0141276 | 3300049581 | Bacteria | 2286 |
| 1884 | Ga0501047_0264368 | 3300049581 | Bacteria | 1567 |
| 1885 | Ga0501047_0460159 | 3300049581 | Bacteria | 1101 |
| 1886 | Ga0501047_0612786 | 3300049581 | Bacteria | 909 |
| 1887 | Ga0501047_0875985 | 3300049581 | Bacteria | 711 |
| 1888 | Ga0501048_0153706 | 3300049582 | Bacteria | 1627 |
| 1889 | Ga0501048_0197090 | 3300049582 | Bacteria | 1427 |
| 1890 | Ga0501048_0207595 | 3300049582 | Bacteria | 1389 |
| 1891 | Ga0501048_0240900 | 3300049582 | Bacteria | 1283 |
| 1892 | Ga0501048_0262756 | 3300049582 | Bacteria | 1226 |
| 1893 | Ga0501048_0333703 | 3300049582 | Bacteria | 1080 |
| 1894 | Ga0501048_1378230 | 3300049582 | Bacteria | 507 |
| 1895 | Ga0501067_0007394 | 3300049583 | Bacteria | 6102 |
| 1896 | Ga0501067_0094222 | 3300049583 | Bacteria | 1662 |
| 1897 | Ga0501067_0181747 | 3300049583 | Bacteria | 1171 |
| 1898 | Ga0501067_0184014 | 3300049583 | Bacteria | 1163 |
| 1899 | Ga0501067_0290608 | 3300049583 | Bacteria | 910 |
| 1900 | Ga0501067_0398778 | 3300049583 | Bacteria | 767 |
| 1901 | Ga0501067_0788631 | 3300049583 | Bacteria | 535 |
| 1902 | Ga0501068_0032654 | 3300049584 | Bacteria | 3095 |
| 1903 | Ga0501068_0128338 | 3300049584 | Bacteria | 1584 |
| 1904 | Ga0501068_0133172 | 3300049584 | Bacteria | 1555 |
| 1905 | Ga0501068_0142359 | 3300049584 | Bacteria | 1503 |
| 1906 | Ga0501068_0191421 | 3300049584 | Bacteria | 1295 |
| 1907 | Ga0501068_0286001 | 3300049584 | Bacteria | 1054 |
| 1908 | Ga0501068_0294585 | 3300049584 | Bacteria | 1038 |
| 1909 | Ga0501068_0468489 | 3300049584 | Bacteria | 816 |
| 1910 | Ga0501068_0608742 | 3300049584 | Bacteria | 712 |
| 1911 | Ga0501068_1179622 | 3300049584 | Bacteria | 507 |
| 1912 | Ga0501069_0052068 | 3300049585 | Bacteria | 2279 |
| 1913 | Ga0501069_0100280 | 3300049585 | Bacteria | 1643 |
| 1914 | Ga0501069_0132567 | 3300049585 | Bacteria | 1427 |
| 1915 | Ga0501069_0137949 | 3300049585 | Bacteria | 1398 |
| 1916 | Ga0501069_0147779 | 3300049585 | Bacteria | 1349 |
| 1917 | Ga0501069_0153209 | 3300049585 | Bacteria | 1325 |
| 1918 | Ga0501069_0157826 | 3300049585 | Bacteria | 1305 |
| 1919 | Ga0501069_0359817 | 3300049585 | Bacteria | 858 |
| 1920 | Ga0501069_0661500 | 3300049585 | Bacteria | 629 |
| 1921 | Ga0501070_0004207 | 3300049586 | Bacteria | 12374 |
| 1922 | Ga0501070_0019671 | 3300049586 | Bacteria | 5661 |
| 1923 | Ga0501070_0104408 | 3300049586 | Bacteria | 2343 |
| 1924 | Ga0501070_0144794 | 3300049586 | Bacteria | 1961 |
| 1925 | Ga0501070_0250350 | 3300049586 | Bacteria | 1449 |
| 1926 | Ga0501070_0264484 | 3300049586 | Bacteria | 1405 |
| 1927 | Ga0501070_0267208 | 3300049586 | Bacteria | 1397 |
| 1928 | Ga0501070_0303880 | 3300049586 | Bacteria | 1299 |
| 1929 | Ga0501070_0346429 | 3300049586 | Bacteria | 1206 |
| 1930 | Ga0501070_0473861 | 3300049586 | Bacteria | 1007 |
| 1931 | Ga0501070_0478785 | 3300049586 | Bacteria | 1001 |
| 1932 | Ga0501070_0580424 | 3300049586 | Bacteria | 895 |
| 1933 | Ga0501070_0901138 | 3300049586 | Bacteria | 690 |
| 1934 | Ga0501071_0056312 | 3300049587 | Bacteria | 2839 |
| 1935 | Ga0501071_0145173 | 3300049587 | Bacteria | 1768 |
| 1936 | Ga0501071_0248402 | 3300049587 | Bacteria | 1342 |
| 1937 | Ga0501071_0507777 | 3300049587 | Bacteria | 925 |
| 1938 | Ga0501072_0331229 | 3300049588 | Bacteria | 1209 |
| 1939 | Ga0501072_0877459 | 3300049588 | Bacteria | 701 |
| 1940 | Ga0501072_0890574 | 3300049588 | Bacteria | 695 |
| 1941 | Ga0501073_0009716 | 3300049589 | Bacteria | 7085 |
| 1942 | Ga0501073_0039852 | 3300049589 | Bacteria | 3327 |
| 1943 | Ga0501073_0052370 | 3300049589 | Bacteria | 2858 |
| 1944 | Ga0501073_0126391 | 3300049589 | Bacteria | 1772 |
| 1945 | Ga0501073_0127091 | 3300049589 | Bacteria | 1767 |
| 1946 | Ga0501073_0187241 | 3300049589 | Bacteria | 1432 |
| 1947 | Ga0501073_0215075 | 3300049589 | Bacteria | 1328 |
| 1948 | Ga0501073_0228273 | 3300049589 | Bacteria | 1286 |
| 1949 | Ga0501073_0322388 | 3300049589 | Bacteria | 1066 |
| 1950 | Ga0501073_0330941 | 3300049589 | Bacteria | 1051 |
| 1951 | Ga0501074_0003848 | 3300049590 | Bacteria | 10682 |
| 1952 | Ga0501074_0031110 | 3300049590 | Bacteria | 3867 |
| 1953 | Ga0501074_0162839 | 3300049590 | Bacteria | 1593 |
| 1954 | Ga0501074_0176743 | 3300049590 | Bacteria | 1523 |
| 1955 | Ga0501074_0211620 | 3300049590 | Bacteria | 1381 |
| 1956 | Ga0501074_0306959 | 3300049590 | Bacteria | 1127 |
| 1957 | Ga0501074_0409578 | 3300049590 | Bacteria | 961 |
| 1958 | Ga0501074_0983014 | 3300049590 | Bacteria | 593 |
| 1959 | Ga0501074_1114326 | 3300049590 | Bacteria | 554 |
| 1960 | Ga0501075_0253977 | 3300049591 | Bacteria | 1340 |
| 1961 | Ga0501075_0289658 | 3300049591 | Bacteria | 1247 |
| 1962 | Ga0501075_0766317 | 3300049591 | Unclassified | 734 |
| 1963 | Ga0501075_1265879 | 3300049591 | Unclassified | 559 |
| 1964 | Ga0501076_0149267 | 3300049592 | Bacteria | 1901 |
| 1965 | Ga0501076_0255439 | 3300049592 | Bacteria | 1434 |
| 1966 | Ga0501076_0270772 | 3300049592 | Bacteria | 1391 |
| 1967 | Ga0501076_0319768 | 3300049592 | Bacteria | 1273 |
| 1968 | Ga0501076_1489989 | 3300049592 | Bacteria | 556 |
| 1969 | Ga0501077_0191137 | 3300049593 | Bacteria | 1300 |
| 1970 | Ga0501077_0504840 | 3300049593 | Bacteria | 775 |
| 1971 | Ga0501206_008985 | 3300049653 | Bacteria | 1325 |
| 1972 | Ga0501207_017112 | 3300049654 | Bacteria | 1129 |
| 1973 | Ga0501207_094430 | 3300049654 | Unclassified | 592 |
| 1974 | Ga0501217_029043 | 3300049661 | Bacteria | 1350 |
| 1975 | Ga0501222_044291 | 3300049662 | Bacteria | 639 |
| 1976 | Ga0501223_001599 | 3300049663 | Bacteria | 5214 |
| 1977 | Ga0501224_003560 | 3300049664 | Bacteria | 2180 |
| 1978 | Ga0501235_020919 | 3300049669 | Bacteria | 1453 |
| 1979 | Ga0501242_058278 | 3300049674 | Bacteria | 582 |
| 1980 | Ga0501243_080789 | 3300049675 | Bacteria | 632 |
| 1981 | Ga0501249_008312 | 3300049679 | Bacteria | 2154 |
| 1982 | Ga0501253_035166 | 3300049683 | Bacteria | 979 |
| 1983 | Ga0501257_140500 | 3300049686 | Unclassified | 659 |
| 1984 | Ga0501259_018031 | 3300049688 | Unclassified | 1229 |
| 1985 | Ga0501221_092574 | 3300049704 | Bacteria | 741 |
| 1986 | Ga0501079_0236393 | 3300049741 | Bacteria | 1427 |
| 1987 | Ga0501079_0266410 | 3300049741 | Bacteria | 1339 |
| 1988 | Ga0501079_0283211 | 3300049741 | Bacteria | 1296 |
| 1989 | Ga0501079_0336290 | 3300049741 | Bacteria | 1183 |
| 1990 | Ga0501079_0359761 | 3300049741 | Bacteria | 1140 |
| 1991 | Ga0501079_0890373 | 3300049741 | Bacteria | 701 |
| 1992 | Ga0501080_0029683 | 3300049742 | Bacteria | 5089 |
| 1993 | Ga0501080_0093232 | 3300049742 | Bacteria | 2796 |
| 1994 | Ga0501080_0152621 | 3300049742 | Bacteria | 2134 |
| 1995 | Ga0501080_0351650 | 3300049742 | Bacteria | 1330 |
| 1996 | Ga0501080_0362097 | 3300049742 | Bacteria | 1308 |
| 1997 | Ga0501080_0411182 | 3300049742 | Bacteria | 1216 |
| 1998 | Ga0501080_0487863 | 3300049742 | Bacteria | 1102 |
| 1999 | Ga0501080_0527277 | 3300049742 | Bacteria | 1053 |
| 2000 | Ga0501080_0807315 | 3300049742 | Bacteria | 822 |
| 2001 | Ga0501080_1372695 | 3300049742 | Bacteria | 603 |
| 2002 | Ga0501080_1659446 | 3300049742 | Bacteria | 540 |
| 2003 | Ga0501081_0049115 | 3300049743 | Bacteria | 2904 |
| 2004 | Ga0501081_0330800 | 3300049743 | Bacteria | 1121 |
| 2005 | Ga0501083_0052551 | 3300049744 | Bacteria | 2737 |
| 2006 | Ga0501083_0091803 | 3300049744 | Bacteria | 2004 |
| 2007 | Ga0501083_0122975 | 3300049744 | Bacteria | 1702 |
| 2008 | Ga0501083_0209832 | 3300049744 | Bacteria | 1270 |
| 2009 | Ga0501083_0277836 | 3300049744 | Bacteria | 1089 |
| 2010 | Ga0501083_0327228 | 3300049744 | Bacteria | 996 |
| 2011 | Ga0501083_0347540 | 3300049744 | Bacteria | 964 |
| 2012 | Ga0501083_0548255 | 3300049744 | Bacteria | 752 |
| 2013 | Ga0501262_001134 | 3300049759 | Bacteria | 3024 |
| 2014 | Ga0501263_020663 | 3300049760 | Unclassified | 884 |
| 2015 | Ga0501266_013527 | 3300049763 | Bacteria | 1063 |
| 2016 | Ga0501268_013370 | 3300049765 | Bacteria | 1325 |
| 2017 | Ga0501271_043772 | 3300049768 | Unclassified | 590 |
| 2018 | Ga0501282_000529 | 3300049778 | Bacteria | 4520 |
| 2019 | Ga0501283_012729 | 3300049779 | Bacteria | 1268 |
| 2020 | Ga0501035_0009620 | 3300049822 | Bacteria | 8990 |
| 2021 | Ga0501035_0081675 | 3300049822 | Bacteria | 2852 |
| 2022 | Ga0501035_0133888 | 3300049822 | Bacteria | 2159 |
| 2023 | Ga0501035_0160257 | 3300049822 | Bacteria | 1948 |
| 2024 | Ga0501035_0176522 | 3300049822 | Bacteria | 1842 |
| 2025 | Ga0501035_0194310 | 3300049822 | Bacteria | 1743 |
| 2026 | Ga0501035_0196283 | 3300049822 | Bacteria | 1733 |
| 2027 | Ga0501035_0248552 | 3300049822 | Bacteria | 1511 |
| 2028 | Ga0501035_0569952 | 3300049822 | Bacteria | 925 |
| 2029 | Ga0501035_0645723 | 3300049822 | Bacteria | 858 |
| 2030 | Ga0501035_1340629 | 3300049822 | Bacteria | 550 |
| 2031 | Ga0501044_0019807 | 3300049823 | Bacteria | 7188 |
| 2032 | Ga0501044_0095123 | 3300049823 | Bacteria | 3002 |
| 2033 | Ga0501044_0130311 | 3300049823 | Bacteria | 2509 |
| 2034 | Ga0501044_0218051 | 3300049823 | Bacteria | 1859 |
| 2035 | Ga0501044_0284531 | 3300049823 | Bacteria | 1586 |
| 2036 | Ga0501044_0331436 | 3300049823 | Bacteria | 1445 |
| 2037 | Ga0501044_0349886 | 3300049823 | Bacteria | 1397 |
| 2038 | Ga0501044_0351835 | 3300049823 | Bacteria | 1392 |
| 2039 | Ga0501044_0372952 | 3300049823 | Bacteria | 1343 |
| 2040 | Ga0501044_0384319 | 3300049823 | Bacteria | 1318 |
| 2041 | Ga0501044_0549905 | 3300049823 | Bacteria | 1051 |
| 2042 | Ga0501044_0647803 | 3300049823 | Bacteria | 946 |
| 2043 | Ga0501044_1249745 | 3300049823 | Bacteria | 610 |
| 2044 | Ga0501044_1454529 | 3300049823 | Bacteria | 550 |
| 2045 | Ga0501044_1501762 | 3300049823 | Bacteria | 539 |
| 2046 | Ga0501045_0135952 | 3300049824 | Bacteria | 1827 |
| 2047 | Ga0501045_0159364 | 3300049824 | Bacteria | 1679 |
| 2048 | Ga0501045_1103343 | 3300049824 | Bacteria | 580 |
| 2049 | Ga0501045_1347057 | 3300049824 | Bacteria | 519 |
| 2050 | Ga0501212_056318 | 3300049851 | Unclassified | 673 |
| 2051 | Ga0501226_000708 | 3300049853 | Bacteria | 4512 |
| 2052 | Ga0501226_001034 | 3300049853 | Bacteria | 3618 |
| 2053 | Ga0501226_008827 | 3300049853 | Bacteria | 1124 |
| 2054 | nmdc:mga03n38_422580_c1 | 3300050490 | Bacteria | 737 |
| 2055 | nmdc:mga00v17_1034712_c1 | 3300050491 | Bacteria | 516 |
| 2056 | nmdc:mga00v17_1039400_c1 | 3300050491 | Bacteria | 514 |
| 2057 | nmdc:mga00v17_134419_c2 | 3300050491 | Bacteria | 1104 |
| 2058 | nmdc:mga00v17_151397_c1 | 3300050491 | Bacteria | 1491 |
| 2059 | nmdc:mga0yw44_217286_c1 | 3300050492 | Bacteria | 1266 |
| 2060 | nmdc:mga0yw44_696900_c1 | 3300050492 | Bacteria | 690 |
| 2061 | nmdc:mga0k408_870450_c1 | 3300050493 | Bacteria | 523 |
| 2062 | nmdc:mga06z11_1031203_c1 | 3300050494 | Bacteria | 501 |
| 2063 | nmdc:mga06z11_149914_c1 | 3300050494 | Bacteria | 1325 |
| 2064 | nmdc:mga06z11_30542_c1 | 3300050494 | Bacteria | 2608 |
| 2065 | nmdc:mga07m45_582228_c1 | 3300050496 | Bacteria | 646 |
| 2066 | nmdc:mga09592_377565_c1 | 3300050508 | Bacteria | 1226 |
| 2067 | nmdc:mga06r32_225414_c1 | 3300050510 | Bacteria | 1863 |
| 2068 | nmdc:mga08y16_1987945_c1 | 3300050511 | Bacteria | 531 |
| 2069 | nmdc:mga08y16_432759_c1 | 3300050511 | Bacteria | 1343 |
| 2070 | nmdc:mga0n895_302608_c1 | 3300050512 | Bacteria | 1621 |
| 2071 | nmdc:mga0n895_339760_c1 | 3300050512 | Bacteria | 1521 |
| 2072 | nmdc:mga0rr50_1166683_c1 | 3300050513 | Bacteria | 655 |
| 2073 | nmdc:mga0rr50_1519982_c1 | 3300050513 | Bacteria | 566 |
| 2074 | nmdc:mga0rr50_233574_c1 | 3300050513 | Bacteria | 1522 |
| 2075 | nmdc:mga0rr50_796287_c1 | 3300050513 | Bacteria | 806 |
| 2076 | nmdc:mga0rr50_798963_c1 | 3300050513 | Bacteria | 805 |
| 2077 | nmdc:mga08x19_232809_c1 | 3300050514 | Bacteria | 1268 |
| 2078 | nmdc:mga0a205_181601_c1 | 3300050515 | Bacteria | 1998 |
| 2079 | Ga0495601_0191242 | 3300053077 | Bacteria | 1337 |
| 2080 | Ga0495601_0191747 | 3300053077 | Bacteria | 1335 |
| 2081 | Ga0495601_0313586 | 3300053077 | Bacteria | 1021 |
| 2082 | Ga0495601_0360455 | 3300053077 | Bacteria | 945 |
| 2083 | Ga0495601_1007270 | 3300053077 | Unclassified | 524 |
| 2084 | Ga0495612_0078028 | 3300053078 | Bacteria | 1388 |
| 2085 | Ga0495612_0597991 | 3300053078 | Bacteria | 510 |
| 2086 | Ga0495655_0020494 | 3300053083 | Bacteria | 1484 |
| 2087 | Ga0495595_0101138 | 3300053084 | Bacteria | 1391 |
| 2088 | Ga0495595_0113859 | 3300053084 | Bacteria | 1313 |
| 2089 | Ga0495595_0317060 | 3300053084 | Bacteria | 785 |
| 2090 | Ga0495619_0109636 | 3300053085 | Bacteria | 1885 |
| 2091 | Ga0495619_0168624 | 3300053085 | Bacteria | 1513 |
| 2092 | Ga0495619_0239089 | 3300053085 | Bacteria | 1258 |
| 2093 | Ga0500578_0138896 | 3300053086 | Bacteria | 1520 |
| 2094 | Ga0500646_0022176 | 3300053090 | Unclassified | 1697 |
| 2095 | Ga0500566_0008223 | 3300053094 | Bacteria | 6176 |
| 2096 | Ga0500650_0109508 | 3300053098 | Bacteria | 1289 |
| 2097 | Ga0500558_068157 | 3300053106 | Bacteria | 1473 |
| 2098 | Ga0500562_025143 | 3300053108 | Bacteria | 1557 |
| 2099 | Ga0500569_020710 | 3300053109 | Bacteria | 1729 |
| 2100 | Ga0500572_092276 | 3300053111 | Bacteria | 960 |
| 2101 | Ga0500594_0045313 | 3300053118 | Bacteria | 1219 |
| 2102 | Ga0500594_0158061 | 3300053118 | Unclassified | 731 |
| 2103 | Ga0500595_025654 | 3300053119 | Bacteria | 2040 |
| 2104 | Ga0500614_246496 | 3300053123 | Bacteria | 557 |
| 2105 | Ga0500628_025556 | 3300053129 | Unclassified | 1236 |
| 2106 | Ga0500642_0262637 | 3300053130 | Bacteria | 790 |
| 2107 | Ga0500658_0006423 | 3300053134 | Bacteria | 4361 |
| 2108 | Ga0500658_0039664 | 3300053134 | Bacteria | 1883 |
| 2109 | Ga0500559_0107805 | 3300053136 | Bacteria | 1288 |
| 2110 | Ga0500568_0145071 | 3300053139 | Bacteria | 879 |
| 2111 | Ga0500577_0372171 | 3300053142 | Bacteria | 625 |
| 2112 | Ga0500586_035469 | 3300053145 | Bacteria | 1668 |
| 2113 | Ga0500588_0167673 | 3300053146 | Unclassified | 802 |
| 2114 | Ga0500604_0006346 | 3300053151 | Bacteria | 3126 |
| 2115 | Ga0500616_0081831 | 3300053153 | Bacteria | 1621 |
| 2116 | Ga0500616_0128429 | 3300053153 | Bacteria | 1200 |
| 2117 | Ga0500616_0169140 | 3300053153 | Bacteria | 994 |
| 2118 | Ga0500627_0081787 | 3300053158 | Bacteria | 1440 |
| 2119 | Ga0500627_0318400 | 3300053158 | Bacteria | 676 |
| 2120 | Ga0500636_0164114 | 3300053177 | Bacteria | 1208 |
| 2121 | Ga0500636_0302320 | 3300053177 | Bacteria | 787 |
| 2122 | Ga0500611_018656 | 3300053727 | Bacteria | 1283 |
| 2123 | Ga0500645_051354 | 3300053730 | Bacteria | 1203 |
| 2124 | Ga0500645_103754 | 3300053730 | Bacteria | 801 |
| 2125 | Ga0500596_005955 | 3300053735 | Bacteria | 2101 |
| 2126 | Ga0500587_044374 | 3300053739 | Bacteria | 645 |
| 2127 | Ga0501084_0020392 | 3300054114 | Bacteria | 5528 |
| 2128 | Ga0501084_0416242 | 3300054114 | Bacteria | 1136 |
| 2129 | Ga0501084_0508209 | 3300054114 | Bacteria | 1018 |
| 2130 | Ga0501084_0841112 | 3300054114 | Bacteria | 772 |
| 2131 | Ga0501084_1196443 | 3300054114 | Bacteria | 637 |
| 2132 | Ga0501082_0379787 | 3300060353 | Bacteria | 1233 |
| 2133 | Ga0501082_0798703 | 3300060353 | Bacteria | 825 |
| 2134 | Ga0501082_0914199 | 3300060353 | Bacteria | 767 |
| 2135 | Ga0466962_0114097 | 3300061719 | Bacteria | 1301 |
| 2136 | Ga0530510_0138411 | 3300061734 | Bacteria | 1793 |
| 2137 | Ga0530510_0180204 | 3300061734 | Bacteria | 1566 |
| 2138 | Ga0530510_0843003 | 3300061734 | Unclassified | 700 |
| 2139 | 2510893835 | 2510461076 | Bacteria | 8618824 |
| 2140 | 2513577259 | 2513237085 | Bacteria | 7695351 |
| 2141 | 2513581453 | 2513237085 | Bacteria | 7695351 |
| 2142 | 2513707018 | 2513237102 | Bacteria | 7703324 |
| 2143 | 2513720658 | 2513237104 | Bacteria | 10034502 |
| 2144 | 2513930638 | 2513237146 | Bacteria | 7166346 |
| 2145 | 2585169661 | 2582581283 | Bacteria | 6030556 |
| 2146 | 2599336066 | 2599185156 | Bacteria | 5403036 |
| 2147 | 2599722235 | 2599185236 | Bacteria | 6875203 |
| 2148 | 2617380036 | 2617270741 | Bacteria | 8201522 |
| 2149 | 2644191438 | 2643221634 | Bacteria | 6705461 |
| 2150 | 2644493881 | 2643221688 | Bacteria | 5260751 |
| 2151 | 2719383372 | 2718217927 | Bacteria | 6972593 |
| 2152 | 2719383454 | 2718217927 | Bacteria | 6972593 |
| 2153 | 2719383536 | 2718217927 | Bacteria | 6972593 |
| 2154 | 2719383582 | 2718217927 | Bacteria | 6972593 |
| 2155 | 2719383689 | 2718217927 | Bacteria | 6972593 |
| 2156 | 2719384468 | 2718217927 | Bacteria | 6972593 |
| 2157 | 2721399385 | 2718218423 | Bacteria | 6438183 |
| 2158 | 2724038198 | 2721755809 | Bacteria | 6438790 |
| 2159 | 2738723763 | 2738541277 | Bacteria | 7458140 |
| 2160 | 2739037615 | 2738541333 | Bacteria | 7106503 |
| 2161 | 2739284494 | 2738543019 | Bacteria | 7459457 |
| 2162 | 2748017038 | 2747842501 | Bacteria | 5293829 |
| 2163 | 2748017498 | 2747842501 | Bacteria | 5293829 |
| 2164 | 2753461395 | 2751185821 | Bacteria | 6189929 |
| 2165 | 2766063961 | 2765235942 | Bacteria | 7445910 |
| 2166 | 2776266503 | 2775506901 | Bacteria | 9631051 |
| 2167 | 2776268344 | 2775506902 | Bacteria | 6208009 |
| 2168 | 2793331764 | 2791355261 | Bacteria | 6661293 |
| 2169 | 2824618783 | 2824617872 | Bacteria | 8814715 |
| 2170 | 2824628889 | 2824626560 | Bacteria | 8813858 |
| 2171 | 2824638400 | 2824635225 | Bacteria | 8785348 |
| 2172 | 2824647582 | 2824644064 | Bacteria | 8743947 |
| 2173 | 2824717702 | 2824714736 | Bacteria | 8717648 |
| 2174 | 2824725991 | 2824723954 | Bacteria | 8758240 |
| 2175 | 2842083805 | 2842077413 | Bacteria | 6508645 |
| 2176 | 2842211484 | 2842205361 | Bacteria | 6340321 |
| 2177 | 2842284938 | 2842278818 | Bacteria | 6340002 |
| 2178 | 2842311084 | 2842304105 | Bacteria | 7023636 |
| 2179 | 2842316309 | 2842311132 | Bacteria | 6616990 |
| 2180 | 2842402383 | 2842395702 | Bacteria | 6780583 |
| 2181 | 2842454507 | 2842447887 | Bacteria | 6754142 |
| 2182 | 2842927522 | 2842922631 | Bacteria | 5824079 |
| 2183 | 2854911494 | 2854911287 | Bacteria | 5582813 |
| 2184 | 2857533423 | 2857531043 | Bacteria | 6754041 |
| 2185 | 2881369912 | 2881364244 | Bacteria | 7710352 |
| 2186 | 2885197662 | 2885192300 | Bacteria | 5882526 |
| 2187 | 2885371719 | 2885366525 | Bacteria | 8326213 |
| 2188 | 2885375810 | 2885374607 | Bacteria | 8927485 |
| 2189 | 2894238267 | 2894232714 | Bacteria | 8834183 |
| 2190 | 2899849594 | 2899845264 | Bacteria | 5672268 |
| 2191 | 2904480462 | 2904479285 | Bacteria | 5073931 |
| 2192 | 2904482114 | 2904479285 | Bacteria | 5073931 |
| 2193 | 2904483661 | 2904479285 | Bacteria | 5073931 |
| 2194 | 2906614864 | |||
| 2195 | 2906615356 | |||
| 2196 | 2906615643 | |||
| 2197 | 2906618289 | |||
| 2198 | 2915651348 | 2915650412 | Bacteria | 4288180 |
| 2199 | 2919124275 | 2919119836 | Bacteria | 5208557 |
| 2200 | 2919124354 | 2919119836 | Bacteria | 5208557 |
| 2201 | 2919679068 | 2919675420 | Bacteria | 3969095 |
| 2202 | 2928972420 | 2928968154 | Bacteria | 4633371 |
| 2203 | 3005451794 | 3005445848 | Bacteria | 6906074 |
| 2204 | 8005276592 | 8005275841 | Bacteria | 6929066 |
| 2205 | 8005276677 | 8005275841 | Bacteria | 6929066 |
| 2206 | 8005276763 | 8005275841 | Bacteria | 6929066 |
| 2207 | 8005276807 | 8005275841 | Bacteria | 6929066 |
| 2208 | 8005276909 | 8005275841 | Bacteria | 6929066 |
| 2209 | 8019648901 | 8019648815 | Bacteria | 10014479 |
| 2210 | 8019687826 | 8019678201 | Bacteria | 8863603 |
| 2211 | 8057881260 | 8057874678 | Bacteria | 7494653 |
| 2212 | Ga0105248_11851723 | |||
| 2213 | CNAas_1002737 | |||
| 2214 | JGI24747J21853_1019306 | |||
| 2215 | JGI24740J21852_10154184 | |||
| 2216 | JGI24750J21931_1008344 | |||
| 2217 | JGI24750J21931_1049781 | |||
| 2218 | JGI24748J21848_1007479 | |||
| 2219 | JGI24748J21848_1021846 | |||
| 2220 | JGI24749J21850_1010864 | |||
| 2221 | JGI24749J21850_1045135 | |||
| 2222 | JGI24744J21845_10026855 | |||
| 2223 | JGI24033J26618_1035970 | |||
| 2224 | JGI24034J26672_10011309 | |||
| 2225 | JGI24742J22300_10015481 | |||
| 2226 | JGI24742J22300_10015711 | |||
| 2227 | JGI24751J29686_10099474 | |||
| 2228 | JGI24751J29686_10101126 | |||
| 2229 | JGI25150J39212_1015910 | |||
| 2230 | JGI25159J45721_1022579 | |||
| 2231 | rootH2_10023835 | |||
| 2232 | rootH2_10077013 | |||
| 2233 | rootL2_10232720 | |||
| 2234 | rootH1_10054396 | |||
| 2235 | rootH1_10156375 | |||
| 2236 | JGI25160J50197_1089346 | |||
| 2237 | Ga0006562J51391_1021829 | |||
| 2238 | Ga0055526_1023784 | |||
| 2239 | Ga0055526_1029595 | |||
| 2240 | Ga0055537_1016604 | |||
| 2241 | Ga0055524_1071201 | |||
| 2242 | Ga0055524_1071265 | |||
| 2243 | Ga0055536_1059387 | |||
| 2244 | Ga0055534_1017639 | |||
| 2245 | Ga0055528_1065723 | |||
| 2246 | Ga0055528_1065782 | |||
| 2247 | Ga0055530_10035639 | |||
| 2248 | Ga0058692_1001917 | |||
| 2249 | JGI25405J52794_10024828 | |||
| 2250 | Ga0065712_10780520 | |||
| 2251 | Ga0065715_10015161 | |||
| 2252 | Ga0070658_10124014 | |||
| 2253 | Ga0070658_10858739 | |||
| 2254 | Ga0070658_11107294 | |||
| 2255 | Ga0070658_11608920 | |||
| 2256 | Ga0070676_10051740 | |||
| 2257 | Ga0070676_10068180 | |||
| 2258 | Ga0070676_10154730 | |||
| 2259 | Ga0070676_10501380 | |||
| 2260 | Ga0070676_10544907 | |||
| 2261 | Ga0070676_11147935 | |||
| 2262 | Ga0070683_100082772 | |||
| 2263 | Ga0070683_100282219 | |||
| 2264 | Ga0070683_100321487 | |||
| 2265 | Ga0070683_100395674 | |||
| 2266 | Ga0070683_100785927 | |||
| 2267 | Ga0070683_101159199 | |||
| 2268 | Ga0070683_101541339 | |||
| 2269 | Ga0070690_100096765 | |||
| 2270 | Ga0070690_100108055 | |||
| 2271 | Ga0070690_100280899 | |||
| 2272 | Ga0070690_100355078 | |||
| 2273 | Ga0070690_100556223 | |||
| 2274 | Ga0070690_101393984 | |||
| 2275 | Ga0070690_101536822 | |||
| 2276 | Ga0070670_100187330 | |||
| 2277 | Ga0070670_100225720 | |||
| 2278 | Ga0070670_100280892 | |||
| 2279 | Ga0070670_100422453 | |||
| 2280 | Ga0070670_101554017 | |||
| 2281 | Ga0070670_101924988 | |||
| 2282 | Ga0070677_10082651 | |||
| 2283 | Ga0070677_10096451 | |||
| 2284 | Ga0070677_10291468 | |||
| 2285 | Ga0070677_10661396 | |||
| 2286 | Ga0070677_10814696 | |||
| 2287 | Ga0068869_100541730 | |||
| 2288 | Ga0068869_101324623 | |||
| 2289 | Ga0068869_101360188 | |||
| 2290 | Ga0070666_10342575 | |||
| 2291 | Ga0070666_10422167 | |||
| 2292 | Ga0070666_10561302 | |||
| 2293 | Ga0070666_10749516 | |||
| 2294 | Ga0070666_10949497 | |||
| 2295 | Ga0070680_100246940 | |||
| 2296 | Ga0070680_100374091 | |||
| 2297 | Ga0070680_101531973 | |||
| 2298 | Ga0070682_100138542 | |||
| 2299 | Ga0070682_100186969 | |||
| 2300 | Ga0070682_100303170 | |||
| 2301 | Ga0070682_100389439 | |||
| 2302 | Ga0070682_100511241 | |||
| 2303 | Ga0070682_100910926 | |||
| 2304 | Ga0070682_101129308 | |||
| 2305 | Ga0068868_100239665 | |||
| 2306 | Ga0068868_100438758 | |||
| 2307 | Ga0068868_101104804 | |||
| 2308 | Ga0070660_100138296 | |||
| 2309 | Ga0070660_100226383 | |||
| 2310 | Ga0070660_100255987 | |||
| 2311 | Ga0070660_100281025 | |||
| 2312 | Ga0070660_101018482 | |||
| 2313 | Ga0070689_100131776 | |||
| 2314 | Ga0070689_100182518 | |||
| 2315 | Ga0070689_100237098 | |||
| 2316 | Ga0070689_100263329 | |||
| 2317 | Ga0070689_100307645 | |||
| 2318 | Ga0070691_10087471 | |||
| 2319 | Ga0070691_10548290 | |||
| 2320 | Ga0070691_10775764 | |||
| 2321 | Ga0070687_100154356 | |||
| 2322 | Ga0070687_100215447 | |||
| 2323 | Ga0070687_100246019 | |||
| 2324 | Ga0070687_100834874 | |||
| 2325 | Ga0070661_100215295 | |||
| 2326 | Ga0070661_100428724 | |||
| 2327 | Ga0070661_101393085 | |||
| 2328 | Ga0070692_11256858 | |||
| 2329 | Ga0070668_100036900 | |||
| 2330 | Ga0070668_100202767 | |||
| 2331 | Ga0070668_100223535 | |||
| 2332 | Ga0070668_100432266 | |||
| 2333 | Ga0070668_100622872 | |||
| 2334 | Ga0070668_100710920 | |||
| 2335 | Ga0070668_100939626 | |||
| 2336 | Ga0070668_101563063 | |||
| 2337 | Ga0070668_101824250 | |||
| 2338 | Ga0070669_100139543 | |||
| 2339 | Ga0070669_100264300 | |||
| 2340 | Ga0070669_100800123 | |||
| 2341 | Ga0070669_101880248 | |||
| 2342 | Ga0070675_100257815 | |||
| 2343 | Ga0070675_100441898 | |||
| 2344 | Ga0070675_100886082 | |||
| 2345 | Ga0070675_101004375 | |||
| 2346 | Ga0070675_101416461 | |||
| 2347 | Ga0070675_101612126 | |||
| 2348 | Ga0070675_101801909 | |||
| 2349 | Ga0070671_100155121 | |||
| 2350 | Ga0070671_100159025 | |||
| 2351 | Ga0070671_101369437 | |||
| 2352 | Ga0070671_101739141 | |||
| 2353 | Ga0070674_100178188 | |||
| 2354 | Ga0070674_100211510 | |||
| 2355 | Ga0070674_100269575 | |||
| 2356 | Ga0070674_100280377 | |||
| 2357 | Ga0070674_100284263 | |||
| 2358 | Ga0070674_100992231 | |||
| 2359 | Ga0070674_101829734 | |||
| 2360 | Ga0070673_100218792 | |||
| 2361 | Ga0070673_100249840 | |||
| 2362 | Ga0070673_100695017 | |||
| 2363 | Ga0070673_100981672 | |||
| 2364 | Ga0070688_100059557 | |||
| 2365 | Ga0070688_100238065 | |||
| 2366 | Ga0070688_100321332 | |||
| 2367 | Ga0070688_100369152 | |||
| 2368 | Ga0070688_101665974 | |||
| 2369 | Ga0070659_100291239 | |||
| 2370 | Ga0070659_100315096 | |||
| 2371 | Ga0070659_100414742 | |||
| 2372 | Ga0070659_101375429 | |||
| 2373 | Ga0070667_100056812 | |||
| 2374 | Ga0070667_100394719 | |||
| 2375 | Ga0070667_100817664 | |||
| 2376 | Ga0070667_100869401 | |||
| 2377 | Ga0070703_10050110 | |||
| 2378 | Ga0070709_10007373 | |||
| 2379 | Ga0070709_10183406 | |||
| 2380 | Ga0070709_10211288 | |||
| 2381 | Ga0070709_10480528 | |||
| 2382 | Ga0070709_10989269 | |||
| 2383 | Ga0070709_11005027 | |||
| 2384 | Ga0070709_11514537 | |||
| 2385 | Ga0070714_100039508 | |||
| 2386 | Ga0070714_100103084 | |||
| 2387 | Ga0070714_100214295 | |||
| 2388 | Ga0070714_100278380 | |||
| 2389 | Ga0070714_100321287 | |||
| 2390 | Ga0070714_100345328 | |||
| 2391 | Ga0070714_100350934 | |||
| 2392 | Ga0070714_100354790 | |||
| 2393 | Ga0070714_101002269 | |||
| 2394 | Ga0070714_101192174 | |||
| 2395 | Ga0070714_101322109 | |||
| 2396 | Ga0070714_102114060 | |||
| 2397 | Ga0070714_102200768 | |||
| 2398 | Ga0070713_100253604 | |||
| 2399 | Ga0070713_100262123 | |||
| 2400 | Ga0070713_100264595 | |||
| 2401 | Ga0070713_100374415 | |||
| 2402 | Ga0070713_100375535 | |||
| 2403 | Ga0070713_100483323 | |||
| 2404 | Ga0070713_100570730 | |||
| 2405 | Ga0070713_100787429 | |||
| 2406 | Ga0070713_101095290 | |||
| 2407 | Ga0070713_101121674 | |||
| 2408 | Ga0070713_101210100 | |||
| 2409 | Ga0070713_101222213 | |||
| 2410 | Ga0070713_101748095 | |||
| 2411 | Ga0070713_102120998 | |||
| 2412 | Ga0070710_10042070 | |||
| 2413 | Ga0070710_10099555 | |||
| 2414 | Ga0070710_10152482 | |||
| 2415 | Ga0070710_10225805 | |||
| 2416 | Ga0070710_10618977 | |||
| 2417 | Ga0070710_11101183 | |||
| 2418 | Ga0070701_10031901 | |||
| 2419 | Ga0070701_11352137 | |||
| 2420 | Ga0070711_100135248 | |||
| 2421 | Ga0070711_100259873 | |||
| 2422 | Ga0070711_100361775 | |||
| 2423 | Ga0070711_100534772 | |||
| 2424 | Ga0070711_100728846 | |||
| 2425 | Ga0070711_101076548 | |||
| 2426 | Ga0070711_101366900 | |||
| 2427 | Ga0070711_101784635 | |||
| 2428 | Ga0070705_100530233 | |||
| 2429 | Ga0070700_100093317 | |||
| 2430 | Ga0070700_100211477 | |||
| 2431 | Ga0070700_100256618 | |||
| 2432 | Ga0070700_100393429 | |||
| 2433 | Ga0070694_100270217 | |||
| 2434 | Ga0070694_100315366 | |||
| 2435 | Ga0070708_100221416 | |||
| 2436 | Ga0070708_100485897 | |||
| 2437 | Ga0070708_101029774 | |||
| 2438 | Ga0070708_101368530 | |||
| 2439 | Ga0070708_101620701 | |||
| 2440 | Ga0070663_100062297 | |||
| 2441 | Ga0070663_100194381 | |||
| 2442 | Ga0070663_100224723 | |||
| 2443 | Ga0070663_100275601 | |||
| 2444 | Ga0070663_100357689 | |||
| 2445 | Ga0070663_100381793 | |||
| 2446 | Ga0070663_100558775 | |||
| 2447 | Ga0070663_101009936 | |||
| 2448 | Ga0070663_101230295 | |||
| 2449 | Ga0070663_101750475 | |||
| 2450 | Ga0070678_100067725 | |||
| 2451 | Ga0070678_100163166 | |||
| 2452 | Ga0070678_100238069 | |||
| 2453 | Ga0070678_100360294 | |||
| 2454 | Ga0070678_100472704 | |||
| 2455 | Ga0070678_100984417 | |||
| 2456 | Ga0070662_100164042 | |||
| 2457 | Ga0070662_100227482 | |||
| 2458 | Ga0070662_100313889 | |||
| 2459 | Ga0070662_100352041 | |||
| 2460 | Ga0070662_100471016 | |||
| 2461 | Ga0070662_100939296 | |||
| 2462 | Ga0070681_10064911 | |||
| 2463 | Ga0070681_10218494 | |||
| 2464 | Ga0070681_10231301 | |||
| 2465 | Ga0070681_10249129 | |||
| 2466 | Ga0070681_10290308 | |||
| 2467 | Ga0070681_10584768 | |||
| 2468 | Ga0070681_11005594 | |||
| 2469 | Ga0068867_100159997 | |||
| 2470 | Ga0068867_100164031 | |||
| 2471 | Ga0068867_100327321 | |||
| 2472 | Ga0068867_100732032 | |||
| 2473 | Ga0068867_101511345 | |||
| 2474 | Ga0068867_102278151 | |||
| 2475 | Ga0070685_10108330 | |||
| 2476 | Ga0070685_10311014 | |||
| 2477 | Ga0070685_10914670 | |||
| 2478 | Ga0070706_100061903 | |||
| 2479 | Ga0070706_100448732 | |||
| 2480 | Ga0070706_101340202 | |||
| 2481 | Ga0070707_100212441 | |||
| 2482 | Ga0070707_100310197 | |||
| 2483 | Ga0070707_100489432 | |||
| 2484 | Ga0070698_100126881 | |||
| 2485 | Ga0070698_100294574 | |||
| 2486 | Ga0070698_100299611 | |||
| 2487 | Ga0070698_100380620 | |||
| 2488 | Ga0070698_101714401 | |||
| 2489 | Ga0070699_100083325 | |||
| 2490 | Ga0070699_100385025 | |||
| 2491 | Ga0070699_100813820 | |||
| 2492 | Ga0070699_101052286 | |||
| 2493 | Ga0070699_101214851 | |||
| 2494 | Ga0070679_100015955 | |||
| 2495 | Ga0070679_100325124 | |||
| 2496 | Ga0070679_101583424 | |||
| 2497 | Ga0070684_100334507 | |||
| 2498 | Ga0070684_100429803 | |||
| 2499 | Ga0070684_100662915 | |||
| 2500 | Ga0070684_101362088 | |||
| 2501 | Ga0070684_101536390 | |||
| 2502 | Ga0070684_101862982 | |||
| 2503 | Ga0070684_102197908 | |||
| 2504 | Ga0070684_102330390 | |||
| 2505 | Ga0070697_100143250 | |||
| 2506 | Ga0070697_100186018 | |||
| 2507 | Ga0070697_100344910 | |||
| 2508 | Ga0070697_100449806 | |||
| 2509 | Ga0068853_100253025 | |||
| 2510 | Ga0068853_100300369 | |||
| 2511 | Ga0068853_100338471 | |||
| 2512 | Ga0068853_100403701 | |||
| 2513 | Ga0068853_100537465 | |||
| 2514 | Ga0068853_100610392 | |||
| 2515 | Ga0068853_101981645 | |||
| 2516 | Ga0070672_100182458 | |||
| 2517 | Ga0070672_100187632 | |||
| 2518 | Ga0070672_100190547 | |||
| 2519 | Ga0070672_100209362 | |||
| 2520 | Ga0070672_100234742 | |||
| 2521 | Ga0070672_100359123 | |||
| 2522 | Ga0070672_100862265 | |||
| 2523 | Ga0070672_102088004 | |||
| 2524 | Ga0070686_100094323 | |||
| 2525 | Ga0070686_100239382 | |||
| 2526 | Ga0070686_100243742 | |||
| 2527 | Ga0070686_100317851 | |||
| 2528 | Ga0070686_100342371 | |||
| 2529 | Ga0070686_100678797 | |||
| 2530 | Ga0070686_101740701 | |||
| 2531 | Ga0070695_100178255 | |||
| 2532 | Ga0070696_101015122 | |||
| 2533 | Ga0070696_101518869 | |||
| 2534 | Ga0070693_100146738 | |||
| 2535 | Ga0070693_101405532 | |||
| 2536 | Ga0070665_100031069 | |||
| 2537 | Ga0070665_100272951 | |||
| 2538 | Ga0070665_100319662 | |||
| 2539 | Ga0070665_100486099 | |||
| 2540 | Ga0070665_100675686 | |||
| 2541 | Ga0070665_100740737 | |||
| 2542 | Ga0070665_101868720 | |||
| 2543 | Ga0070665_102063509 | |||
| 2544 | Ga0070704_100133025 | |||
| 2545 | Ga0070704_100383689 | |||
| 2546 | Ga0070704_100823641 | |||
| 2547 | Ga0070704_101774355 | |||
| 2548 | Ga0068855_100051034 | |||
| 2549 | Ga0068855_100500011 | |||
| 2550 | Ga0068855_100694257 | |||
| 2551 | Ga0068855_101241199 | |||
| 2552 | Ga0068855_102485872 | |||
| 2553 | Ga0070664_100050384 | |||
| 2554 | Ga0070664_100092878 | |||
| 2555 | Ga0070664_101120037 | |||
| 2556 | Ga0070664_101491894 | |||
| 2557 | Ga0070664_101837897 | |||
| 2558 | Ga0070664_102017298 | |||
| 2559 | Ga0070664_102367342 | |||
| 2560 | Ga0068857_101089966 | |||
| 2561 | Ga0068857_101184017 | |||
| 2562 | Ga0068857_101189980 | |||
| 2563 | Ga0068857_101729938 | |||
| 2564 | Ga0068854_100043543 | |||
| 2565 | Ga0068854_100187797 | |||
| 2566 | Ga0068854_101455686 | |||
| 2567 | Ga0068854_102200645 | |||
| 2568 | Ga0068856_100085585 | |||
| 2569 | Ga0068856_100203240 | |||
| 2570 | Ga0068856_100313694 | |||
| 2571 | Ga0068856_100319130 | |||
| 2572 | Ga0068856_100493371 | |||
| 2573 | Ga0068856_100897353 | |||
| 2574 | Ga0068856_101008967 | |||
| 2575 | Ga0068856_101061294 | |||
| 2576 | Ga0068856_101397130 | |||
| 2577 | Ga0068856_101698958 | |||
| 2578 | Ga0068856_101946195 | |||
| 2579 | Ga0068856_102170796 | |||
| 2580 | Ga0068856_102240363 | |||
| 2581 | Ga0070702_100122363 | |||
| 2582 | Ga0070702_100135966 | |||
| 2583 | Ga0070702_100206725 | |||
| 2584 | Ga0070702_100449184 | |||
| 2585 | Ga0070702_100649177 | |||
| 2586 | Ga0070702_101587332 | |||
| 2587 | Ga0068852_100507673 | |||
| 2588 | Ga0068852_100707716 | |||
| 2589 | Ga0068852_100812394 | |||
| 2590 | Ga0068859_100475036 | |||
| 2591 | Ga0068859_100526729 | |||
| 2592 | Ga0068859_101242091 | |||
| 2593 | Ga0068864_100310363 | |||
| 2594 | Ga0068864_100342258 | |||
| 2595 | Ga0068864_100708233 | |||
| 2596 | Ga0068864_101001942 | |||
| 2597 | Ga0068864_101360730 | |||
| 2598 | Ga0068866_10064864 | |||
| 2599 | Ga0068866_10077897 | |||
| 2600 | Ga0068866_10167903 | |||
| 2601 | Ga0068866_10602677 | |||
| 2602 | Ga0068866_10717140 | |||
| 2603 | Ga0068861_100265764 | |||
| 2604 | Ga0068861_100286171 | |||
| 2605 | Ga0068861_100447604 | |||
| 2606 | Ga0068870_10126480 | |||
| 2607 | Ga0068870_11409466 | |||
| 2608 | Ga0068863_100277736 | |||
| 2609 | Ga0068863_100342412 | |||
| 2610 | Ga0068863_100393305 | |||
| 2611 | Ga0068863_102444477 | |||
| 2612 | Ga0068858_100130658 | |||
| 2613 | Ga0068858_100220190 | |||
| 2614 | Ga0068858_100320711 | |||
| 2615 | Ga0068858_100472340 | |||
| 2616 | Ga0068860_100168570 | |||
| 2617 | Ga0068860_100371272 | |||
| 2618 | Ga0068860_100449053 | |||
| 2619 | Ga0068860_102792641 | |||
| 2620 | Ga0068862_100805172 | |||
| 2621 | Ga0068862_101738404 | |||
| 2622 | Ga0068862_101869816 | |||
| 2623 | Ga0081455_10046286 | |||
| 2624 | Ga0081455_10250741 | |||
| 2625 | Ga0081540_1017006 | |||
| 2626 | Ga0081540_1074102 | |||
| 2627 | Ga0081540_1086022 | |||
| 2628 | Ga0081539_10114267 | |||
| 2629 | Ga0070717_10213997 | |||
| 2630 | Ga0070717_10221698 | |||
| 2631 | Ga0070717_10256053 | |||
| 2632 | Ga0070717_10367959 | |||
| 2633 | Ga0070717_10417560 | |||
| 2634 | Ga0070717_10421593 | |||
| 2635 | Ga0070717_10495798 | |||
| 2636 | Ga0070717_11202727 | |||
| 2637 | Ga0070717_11769542 | |||
| 2638 | Ga0075365_10727129 | |||
| 2639 | Ga0075368_10329634 | |||
| 2640 | Ga0075368_10391967 | |||
| 2641 | Ga0075368_10508771 | |||
| 2642 | Ga0075364_10145535 | |||
| 2643 | Ga0070715_10031823 | |||
| 2644 | Ga0070715_10087313 | |||
| 2645 | Ga0070715_10131844 | |||
| 2646 | Ga0070715_10135376 | |||
| 2647 | Ga0070716_100130300 | |||
| 2648 | Ga0070716_100152675 | |||
| 2649 | Ga0070716_100165240 | |||
| 2650 | Ga0070716_100187164 | |||
| 2651 | Ga0070716_100240877 | |||
| 2652 | Ga0070716_101216022 | |||
| 2653 | Ga0070716_101818830 | |||
| 2654 | Ga0070712_100113774 | |||
| 2655 | Ga0070712_100124070 | |||
| 2656 | Ga0070712_100140936 | |||
| 2657 | Ga0070712_100196704 | |||
| 2658 | Ga0070712_100300126 | |||
| 2659 | Ga0070712_100362005 | |||
| 2660 | Ga0070712_100670037 | |||
| 2661 | Ga0070712_101854711 | |||
| 2662 | Ga0075362_10343762 | |||
| 2663 | Ga0075366_10317694 | |||
| 2664 | Ga0075366_11028025 | |||
| 2665 | Ga0097621_100165706 | |||
| 2666 | Ga0097621_100353795 | |||
| 2667 | Ga0097621_100509307 | |||
| 2668 | Ga0097621_101134455 | |||
| 2669 | Ga0097621_101213405 | |||
| 2670 | Ga0097621_101624450 | |||
| 2671 | Ga0075370_10018351 | |||
| 2672 | Ga0075370_10398210 | |||
| 2673 | Ga0075370_10479554 | |||
| 2674 | Ga0068871_100223343 | |||
| 2675 | Ga0068871_100418847 | |||
| 2676 | Ga0068871_100503616 | |||
| 2677 | Ga0068871_100678043 | |||
| 2678 | Ga0068871_100984709 | |||
| 2679 | Ga0068871_101200222 | |||
| 2680 | Ga0068871_101320802 | |||
| 2681 | Ga0068871_101455426 | |||
| 2682 | Ga0068871_102181991 | |||
| 2683 | Ga0075431_100243693 | |||
| 2684 | Ga0075433_10211151 | |||
| 2685 | Ga0075434_100342412 | |||
| 2686 | Ga0075429_100291936 | |||
| 2687 | Ga0075429_101882346 | |||
| 2688 | Ga0068865_100117360 | |||
| 2689 | Ga0068865_100147778 | |||
| 2690 | Ga0068865_100278151 | |||
| 2691 | Ga0068865_100337672 | |||
| 2692 | Ga0068865_101921967 | |||
| 2693 | Ga0075436_100655350 | |||
| 2694 | Ga0075436_100791819 | |||
| 2695 | Ga0097620_100475015 | |||
| 2696 | Ga0097620_100526695 | |||
| 2697 | Ga0097620_101241979 | |||
| 2698 | Ga0099824_1009340 | |||
| 2699 | Ga0099824_1016446 | |||
| 2700 | Ga0075435_100204931 | |||
| 2701 | Ga0075435_100743455 | |||
| 2702 | Ga0075435_100972674 | |||
| 2703 | Ga0099795_10058949 | |||
| 2704 | Ga0099795_10155021 | |||
| 2705 | Ga0105251_10280255 | |||
| 2706 | Ga0105250_10000799 | |||
| 2707 | Ga0105250_10385126 | |||
| 2708 | Ga0105240_10005524 | |||
| 2709 | Ga0105240_10210513 | |||
| 2710 | Ga0105240_10318713 | |||
| 2711 | Ga0105240_10338378 | |||
| 2712 | Ga0105240_10537827 | |||
| 2713 | Ga0105240_10595819 | |||
| 2714 | Ga0105240_11860274 | |||
| 2715 | Ga0105240_12489691 | |||
| 2716 | Ga0111539_11092854 | |||
| 2717 | Ga0111539_12530640 | |||
| 2718 | Ga0111539_12566513 | |||
| 2719 | Ga0105245_10162924 | |||
| 2720 | Ga0105245_10255495 | |||
| 2721 | Ga0105245_10264317 | |||
| 2722 | Ga0105245_10732320 | |||
| 2723 | Ga0105245_10873742 | |||
| 2724 | Ga0105245_11170307 | |||
| 2725 | Ga0105245_11539172 | |||
| 2726 | Ga0105245_12935186 | |||
| 2727 | Ga0105245_13045481 | |||
| 2728 | Ga0105247_10080414 | |||
| 2729 | Ga0105247_10235613 | |||
| 2730 | Ga0105247_10741872 | |||
| 2731 | Ga0105247_10982490 | |||
| 2732 | Ga0105247_11534054 | |||
| 2733 | Ga0105247_11672637 | |||
| 2734 | Ga0105243_10211452 | |||
| 2735 | Ga0105243_10214752 | |||
| 2736 | Ga0105243_10227350 | |||
| 2737 | Ga0105243_11918131 | |||
| 2738 | Ga0105241_10371674 | |||
| 2739 | Ga0105241_10450330 | |||
| 2740 | Ga0105241_10454709 | |||
| 2741 | Ga0105241_10591647 | |||
| 2742 | Ga0105241_11053265 | |||
| 2743 | Ga0105241_11148391 | |||
| 2744 | Ga0105241_11732412 | |||
| 2745 | Ga0105241_11817377 | |||
| 2746 | Ga0105241_12085585 | |||
| 2747 | Ga0105241_12186897 | |||
| 2748 | Ga0105241_12365259 | |||
| 2749 | Ga0105242_10277795 | |||
| 2750 | Ga0105242_10342528 | |||
| 2751 | Ga0105242_10626926 | |||
| 2752 | Ga0105242_11212483 | |||
| 2753 | Ga0105242_11536460 | |||
| 2754 | Ga0105248_10250825 | |||
| 2755 | Ga0105248_10426812 | |||
| 2756 | Ga0105248_10539679 | |||
| 2757 | Ga0105248_11904624 | |||
| 2758 | Ga0105237_10002325 | |||
| 2759 | Ga0105237_10077160 | |||
| 2760 | Ga0105237_10161389 | |||
| 2761 | Ga0105237_10228725 | |||
| 2762 | Ga0105237_10288352 | |||
| 2763 | Ga0105237_10313926 | |||
| 2764 | Ga0105237_10313963 | |||
| 2765 | Ga0105238_10001477 | |||
| 2766 | Ga0105238_10108713 | |||
| 2767 | Ga0105238_10169393 | |||
| 2768 | Ga0105238_10194298 | |||
| 2769 | Ga0105238_10241180 | |||
| 2770 | Ga0105238_10280974 | |||
| 2771 | Ga0105238_10308182 | |||
| 2772 | Ga0105238_10434339 | |||
| 2773 | Ga0105238_10988673 | |||
| 2774 | Ga0105238_11867698 | |||
| 2775 | Ga0105238_11889836 | |||
| 2776 | Ga0105249_10279021 | |||
| 2777 | Ga0105249_11410582 | |||
| 2778 | Ga0105249_13109832 | |||
| 2779 | Ga0099796_10417279 | |||
| 2780 | Ga0105239_10002458 | |||
| 2781 | Ga0105239_10148167 | |||
| 2782 | Ga0105239_10191792 | |||
| 2783 | Ga0105239_10237594 | |||
| 2784 | Ga0105239_10339523 | |||
| 2785 | Ga0105239_10403074 | |||
| 2786 | Ga0105239_10490795 | |||
| 2787 | Ga0105239_10937353 | |||
| 2788 | Ga0105239_11058836 | |||
| 2789 | Ga0105239_11528944 | |||
| 2790 | Ga0105239_11709873 | |||
| 2791 | Ga0105239_12204231 | |||
| 2792 | Ga0105246_10164959 | |||
| 2793 | Ga0105246_10175189 | |||
| 2794 | Ga0105246_10216814 | |||
| 2795 | Ga0105246_10255355 | |||
| 2796 | Ga0105246_10380041 | |||
| 2797 | Ga0105246_10449422 | |||
| 2798 | Ga0105246_10470500 | |||
| 2799 | Ga0105246_10802564 | |||
| 2800 | Ga0105246_10839763 | |||
| 2801 | Ga0105246_11198592 | |||
| 2802 | Ga0105246_11240966 | |||
| 2803 | Ga0157346_1025154 | |||
| 2804 | Ga0157343_1015045 | |||
| 2805 | Ga0157313_1013363 | |||
| 2806 | Ga0157324_1030636 | |||
| 2807 | Ga0157342_1056773 | |||
| 2808 | Ga0157326_1006887 | |||
| 2809 | Ga0157326_1010884 | |||
| 2810 | Ga0157338_1008242 | |||
| 2811 | Ga0157373_10228363 | |||
| 2812 | Ga0157373_10256574 | |||
| 2813 | Ga0157373_10538742 | |||
| 2814 | Ga0157373_10543279 | |||
| 2815 | Ga0157371_10142781 | |||
| 2816 | Ga0157371_10151617 | |||
| 2817 | Ga0157371_10647374 | |||
| 2818 | Ga0157371_11129763 | |||
| 2819 | Ga0157371_11183827 | |||
| 2820 | Ga0157370_10003645 | |||
| 2821 | Ga0157370_10087500 | |||
| 2822 | Ga0157370_10137061 | |||
| 2823 | Ga0157370_10194609 | |||
| 2824 | Ga0157370_10218349 | |||
| 2825 | Ga0157370_10229388 | |||
| 2826 | Ga0157370_10392962 | |||
| 2827 | Ga0157370_11468934 | |||
| 2828 | Ga0157369_10439753 | |||
| 2829 | Ga0157369_10683316 | |||
| 2830 | Ga0157369_10684448 | |||
| 2831 | Ga0157369_10928643 | |||
| 2832 | Ga0157369_11167075 | |||
| 2833 | Ga0157369_12455171 | |||
| 2834 | Ga0157374_10205120 | |||
| 2835 | Ga0157374_10340397 | |||
| 2836 | Ga0157374_10402091 | |||
| 2837 | Ga0157374_10488770 | |||
| 2838 | Ga0157374_10492328 | |||
| 2839 | Ga0157374_12024923 | |||
| 2840 | Ga0157374_12669957 | |||
| 2841 | Ga0157378_10183104 | |||
| 2842 | Ga0157378_10248553 | |||
| 2843 | Ga0157378_10278317 | |||
| 2844 | Ga0157378_10538972 | |||
| 2845 | Ga0157378_12066705 | |||
| 2846 | Ga0157378_12236339 | |||
| 2847 | Ga0163162_10446629 | |||
| 2848 | Ga0163162_10490939 | |||
| 2849 | Ga0163162_10648610 | |||
| 2850 | Ga0163162_11516500 | |||
| 2851 | Ga0163162_12557983 | |||
| 2852 | Ga0157372_10096001 | |||
| 2853 | Ga0157372_10248543 | |||
| 2854 | Ga0157372_10285442 | |||
| 2855 | Ga0157372_11486835 | |||
| 2856 | Ga0157372_11503054 | |||
| 2857 | Ga0157372_12394250 | |||
| 2858 | Ga0157375_10135124 | |||
| 2859 | Ga0157375_10279253 | |||
| 2860 | Ga0157375_10841589 | |||
| 2861 | Ga0157375_11548773 | |||
| 2862 | Ga0157375_12765557 | |||
| 2863 | Ga0157375_12772079 | |||
| 2864 | Ga0157375_13329664 | |||
| 2865 | Ga0163163_10305487 | |||
| 2866 | Ga0163163_10358160 | |||
| 2867 | Ga0163163_10420491 | |||
| 2868 | Ga0163163_10467213 | |||
| 2869 | Ga0163163_10840308 | |||
| 2870 | Ga0163163_11432692 | |||
| 2871 | Ga0163163_11553042 | |||
| 2872 | Ga0157380_10152291 | |||
| 2873 | Ga0157380_10287587 | |||
| 2874 | Ga0157380_10837023 | |||
| 2875 | Ga0157380_10909983 | |||
| 2876 | Ga0157380_11205758 | |||
| 2877 | Ga0157380_11544303 | |||
| 2878 | Ga0157380_12020281 | |||
| 2879 | Ga0182008_10058226 | |||
| 2880 | Ga0182008_10089955 | |||
| 2881 | Ga0182008_10094018 | |||
| 2882 | Ga0157377_10092504 | |||
| 2883 | Ga0157377_10157434 | |||
| 2884 | Ga0157377_10163505 | |||
| 2885 | Ga0157377_10333969 | |||
| 2886 | Ga0157379_10254372 | |||
| 2887 | Ga0157379_10364947 | |||
| 2888 | Ga0157379_10588349 | |||
| 2889 | Ga0157379_10818022 | |||
| 2890 | Ga0157379_11852373 | |||
| 2891 | Ga0157379_11921807 | |||
| 2892 | Ga0157376_10158083 | |||
| 2893 | Ga0157376_10318166 | |||
| 2894 | Ga0157376_10457277 | |||
| 2895 | Ga0157376_11076190 | |||
| 2896 | Ga0157376_12250386 | |||
| 2897 | Ga0157376_12726615 | |||
| 2898 | Ga0163161_10140339 | |||
| 2899 | Ga0163161_10200841 | |||
| 2900 | Ga0163161_10221297 | |||
| 2901 | Ga0163161_10229481 | |||
| 2902 | Ga0163161_11086041 | |||
| 2903 | Ga0206353_10492261 | |||
| 2904 | Ga0213874_10087750 | |||
| 2905 | Ga0213876_10151516 | |||
| 2906 | Ga0213875_10060072 | |||
| 2907 | Ga0213875_10079298 | |||
| 2908 | Ga0224712_10012275 | |||
| 2909 | Ga0224570_103029 | |||
| 2910 | Ga0224571_102319 | |||
| 2911 | Ga0224572_1022032 | |||
| 2912 | Ga0228598_1023645 | |||
| 2913 | Ga0207425_1001721 | |||
| 2914 | Ga0207425_1013102 | |||
| 2915 | Ga0209129_1000851 | |||
| 2916 | Ga0209129_1014578 | |||
| 2917 | Ga0209565_1024149 | |||
| 2918 | Ga0207666_1007976 | |||
| 2919 | Ga0209673_1000840 | |||
| 2920 | Ga0209673_1044027 | |||
| 2921 | Ga0209130_1026745 | |||
| 2922 | Ga0209675_1002336 | |||
| 2923 | Ga0209675_1031273 | |||
| 2924 | Ga0209676_1018913 | |||
| 2925 | Ga0209025_1002528 | |||
| 2926 | Ga0209025_1053563 | |||
| 2927 | Ga0209564_1040623 | |||
| 2928 | Ga0209758_1001161 | |||
| 2929 | Ga0209758_1001517 | |||
| 2930 | Ga0209050_1053254 | |||
| 2931 | Ga0209256_1000555 | |||
| 2932 | Ga0209256_1007286 | |||
| 2933 | Ga0207426_1003336 | |||
| 2934 | Ga0207426_1010449 | |||
| 2935 | Ga0207697_10042901 | |||
| 2936 | Ga0207697_10111556 | |||
| 2937 | Ga0207656_10504475 | |||
| 2938 | Ga0207713_1181430 | |||
| 2939 | Ga0207653_10035981 | |||
| 2940 | Ga0207682_10009832 | |||
| 2941 | Ga0207682_10094199 | |||
| 2942 | Ga0207682_10193832 | |||
| 2943 | Ga0207692_10113333 | |||
| 2944 | Ga0207692_10139866 | |||
| 2945 | Ga0207692_10239028 | |||
| 2946 | Ga0207692_10569542 | |||
| 2947 | Ga0207642_10133397 | |||
| 2948 | Ga0207642_10151695 | |||
| 2949 | Ga0207642_10368377 | |||
| 2950 | Ga0207710_10107702 | |||
| 2951 | Ga0207710_10186777 | |||
| 2952 | Ga0207710_10263464 | |||
| 2953 | Ga0207688_10003840 | |||
| 2954 | Ga0207688_10165826 | |||
| 2955 | Ga0207688_10290156 | |||
| 2956 | Ga0207688_10395461 | |||
| 2957 | Ga0207688_10418689 | |||
| 2958 | Ga0207688_10504161 | |||
| 2959 | Ga0207688_10598594 | |||
| 2960 | Ga0207680_10209454 | |||
| 2961 | Ga0207680_10253007 | |||
| 2962 | Ga0207680_10626768 | |||
| 2963 | Ga0207647_10504487 | |||
| 2964 | Ga0207647_10507191 | |||
| 2965 | Ga0207685_10058795 | |||
| 2966 | Ga0207685_10067957 | |||
| 2967 | Ga0207685_10346299 | |||
| 2968 | Ga0207685_10374677 | |||
| 2969 | Ga0207685_10410522 | |||
| 2970 | Ga0207699_10212055 | |||
| 2971 | Ga0207699_10212691 | |||
| 2972 | Ga0207699_10266796 | |||
| 2973 | Ga0207699_10384311 | |||
| 2974 | Ga0207699_10469182 | |||
| 2975 | Ga0207699_11232896 | |||
| 2976 | Ga0207699_11295175 | |||
| 2977 | Ga0207645_10041875 | |||
| 2978 | Ga0207645_10067656 | |||
| 2979 | Ga0207645_10116851 | |||
| 2980 | Ga0207645_10130830 | |||
| 2981 | Ga0207645_10696626 | |||
| 2982 | Ga0207643_10089119 | |||
| 2983 | Ga0207643_10463685 | |||
| 2984 | Ga0207643_10867273 | |||
| 2985 | Ga0207705_10562675 | |||
| 2986 | Ga0207684_10139016 | |||
| 2987 | Ga0207684_10319531 | |||
| 2988 | Ga0207684_10803481 | |||
| 2989 | Ga0207654_10211907 | |||
| 2990 | Ga0207654_10589266 | |||
| 2991 | Ga0207654_10693515 | |||
| 2992 | Ga0207654_10758071 | |||
| 2993 | Ga0207654_10872713 | |||
| 2994 | Ga0207707_10087924 | |||
| 2995 | Ga0207707_10281468 | |||
| 2996 | Ga0207707_10817660 | |||
| 2997 | Ga0207707_10966096 | |||
| 2998 | Ga0207707_11427353 | |||
| 2999 | Ga0207695_10011275 | |||
| 3000 | Ga0207695_10337086 | |||
| 3001 | Ga0207695_10390859 | |||
| 3002 | Ga0207695_10892567 | |||
| 3003 | Ga0207695_11411067 | |||
| 3004 | Ga0207671_10002412 | |||
| 3005 | Ga0207671_10010604 | |||
| 3006 | Ga0207671_10017611 | |||
| 3007 | Ga0207671_10092670 | |||
| 3008 | Ga0207671_10253897 | |||
| 3009 | Ga0207671_10815258 | |||
| 3010 | Ga0207671_10888639 | |||
| 3011 | Ga0207671_11140280 | |||
| 3012 | Ga0207693_10131667 | |||
| 3013 | Ga0207693_10152032 | |||
| 3014 | Ga0207693_10172712 | |||
| 3015 | Ga0207693_10211500 | |||
| 3016 | Ga0207693_10264723 | |||
| 3017 | Ga0207693_10289764 | |||
| 3018 | Ga0207663_10140759 | |||
| 3019 | Ga0207663_10176665 | |||
| 3020 | Ga0207663_10179633 | |||
| 3021 | Ga0207663_10270157 | |||
| 3022 | Ga0207663_10277228 | |||
| 3023 | Ga0207663_10284567 | |||
| 3024 | Ga0207663_10288778 | |||
| 3025 | Ga0207663_10710473 | |||
| 3026 | Ga0207660_10254332 | |||
| 3027 | Ga0207660_10763277 | |||
| 3028 | Ga0207662_10102725 | |||
| 3029 | Ga0207662_10142809 | |||
| 3030 | Ga0207662_10299572 | |||
| 3031 | Ga0207662_10517515 | |||
| 3032 | Ga0207657_10204864 | |||
| 3033 | Ga0207657_10222470 | |||
| 3034 | Ga0207657_10260248 | |||
| 3035 | Ga0207657_10305613 | |||
| 3036 | Ga0207657_10413884 | |||
| 3037 | Ga0207657_11265032 | |||
| 3038 | Ga0207649_10260032 | |||
| 3039 | Ga0207649_10319870 | |||
| 3040 | Ga0207649_10470202 | |||
| 3041 | Ga0207652_10056697 | |||
| 3042 | Ga0207652_10372605 | |||
| 3043 | Ga0207652_10396381 | |||
| 3044 | Ga0207652_10407288 | |||
| 3045 | Ga0207652_10661110 | |||
| 3046 | Ga0207652_10666606 | |||
| 3047 | Ga0207652_10919769 | |||
| 3048 | Ga0207652_11729162 | |||
| 3049 | Ga0207646_10330389 | |||
| 3050 | Ga0207646_10400095 | |||
| 3051 | Ga0207646_10546967 | |||
| 3052 | Ga0207681_10160831 | |||
| 3053 | Ga0207681_10291784 | |||
| 3054 | Ga0207681_10940650 | |||
| 3055 | Ga0207694_10000851 | |||
| 3056 | Ga0207694_10147646 | |||
| 3057 | Ga0207694_10153299 | |||
| 3058 | Ga0207694_10205127 | |||
| 3059 | Ga0207694_10284265 | |||
| 3060 | Ga0207694_10298116 | |||
| 3061 | Ga0207694_10409025 | |||
| 3062 | Ga0207694_10878642 | |||
| 3063 | Ga0207694_11339674 | |||
| 3064 | Ga0207650_10297956 | |||
| 3065 | Ga0207650_10324024 | |||
| 3066 | Ga0207650_11236417 | |||
| 3067 | Ga0207659_10171827 | |||
| 3068 | Ga0207659_10267539 | |||
| 3069 | Ga0207659_10516471 | |||
| 3070 | Ga0207659_10898641 | |||
| 3071 | Ga0207659_11086915 | |||
| 3072 | Ga0207687_10257203 | |||
| 3073 | Ga0207687_10330903 | |||
| 3074 | Ga0207687_11323095 | |||
| 3075 | Ga0207687_11337395 | |||
| 3076 | Ga0207687_11622563 | |||
| 3077 | Ga0207700_10201475 | |||
| 3078 | Ga0207700_10207089 | |||
| 3079 | Ga0207700_10317494 | |||
| 3080 | Ga0207700_10322369 | |||
| 3081 | Ga0207700_10329868 | |||
| 3082 | Ga0207700_10361196 | |||
| 3083 | Ga0207700_10386904 | |||
| 3084 | Ga0207700_10407354 | |||
| 3085 | Ga0207700_10448468 | |||
| 3086 | Ga0207700_10525939 | |||
| 3087 | Ga0207700_11619884 | |||
| 3088 | Ga0207700_11994693 | |||
| 3089 | Ga0207664_10037599 | |||
| 3090 | Ga0207664_10205174 | |||
| 3091 | Ga0207664_10355697 | |||
| 3092 | Ga0207664_10369341 | |||
| 3093 | Ga0207664_10693569 | |||
| 3094 | Ga0207664_10707014 | |||
| 3095 | Ga0207664_10830825 | |||
| 3096 | Ga0207664_11997895 | |||
| 3097 | Ga0207644_10167343 | |||
| 3098 | Ga0207644_10221296 | |||
| 3099 | Ga0207644_10358937 | |||
| 3100 | Ga0207690_10312900 | |||
| 3101 | Ga0207690_10491467 | |||
| 3102 | Ga0207690_10849208 | |||
| 3103 | Ga0207706_10100179 | |||
| 3104 | Ga0207706_10239068 | |||
| 3105 | Ga0207706_10270446 | |||
| 3106 | Ga0207706_10291406 | |||
| 3107 | Ga0207686_10242961 | |||
| 3108 | Ga0207686_10281992 | |||
| 3109 | Ga0207686_10292778 | |||
| 3110 | Ga0207686_10330084 | |||
| 3111 | Ga0207709_10220865 | |||
| 3112 | Ga0207709_10246699 | |||
| 3113 | Ga0207709_10873923 | |||
| 3114 | Ga0207670_10133751 | |||
| 3115 | Ga0207670_10139473 | |||
| 3116 | Ga0207670_10267118 | |||
| 3117 | Ga0207670_10290602 | |||
| 3118 | Ga0207670_11192350 | |||
| 3119 | Ga0207669_10124742 | |||
| 3120 | Ga0207669_10256842 | |||
| 3121 | Ga0207669_10328392 | |||
| 3122 | Ga0207669_11344675 | |||
| 3123 | Ga0207704_10134008 | |||
| 3124 | Ga0207704_10306240 | |||
| 3125 | Ga0207704_11323653 | |||
| 3126 | Ga0207704_11422251 | |||
| 3127 | Ga0207665_10097283 | |||
| 3128 | Ga0207665_10150074 | |||
| 3129 | Ga0207665_10214346 | |||
| 3130 | Ga0207665_10215973 | |||
| 3131 | Ga0207665_10246177 | |||
| 3132 | Ga0207665_10293118 | |||
| 3133 | Ga0207665_10303648 | |||
| 3134 | Ga0207665_10623470 | |||
| 3135 | Ga0207665_10710720 | |||
| 3136 | Ga0207691_10104040 | |||
| 3137 | Ga0207691_10282428 | |||
| 3138 | Ga0207691_10298557 | |||
| 3139 | Ga0207691_10321342 | |||
| 3140 | Ga0207691_10457161 | |||
| 3141 | Ga0207691_10679832 | |||
| 3142 | Ga0207691_10905904 | |||
| 3143 | Ga0207691_11671032 | |||
| 3144 | Ga0207711_10258076 | |||
| 3145 | Ga0207711_10312963 | |||
| 3146 | Ga0207711_11605656 | |||
| 3147 | Ga0207689_10394720 | |||
| 3148 | Ga0207689_10466223 | |||
| 3149 | Ga0207689_11118141 | |||
| 3150 | Ga0207689_11367775 | |||
| 3151 | Ga0207661_10281765 | |||
| 3152 | Ga0207661_10374692 | |||
| 3153 | Ga0207661_10785828 | |||
| 3154 | Ga0207661_10939054 | |||
| 3155 | Ga0207661_11026479 | |||
| 3156 | Ga0207679_10230678 | |||
| 3157 | Ga0207679_10292638 | |||
| 3158 | Ga0207679_11064970 | |||
| 3159 | Ga0207679_11850841 | |||
| 3160 | Ga0207679_12054514 | |||
| 3161 | Ga0207679_12193354 | |||
| 3162 | Ga0207667_10041069 | |||
| 3163 | Ga0207667_10250756 | |||
| 3164 | Ga0207667_10392789 | |||
| 3165 | Ga0207667_10661222 | |||
| 3166 | Ga0207667_10831251 | |||
| 3167 | Ga0207667_11140523 | |||
| 3168 | Ga0207667_11511583 | |||
| 3169 | Ga0207651_10042818 | |||
| 3170 | Ga0207651_10233546 | |||
| 3171 | Ga0207651_10311586 | |||
| 3172 | Ga0207651_10358793 | |||
| 3173 | Ga0207651_10426339 | |||
| 3174 | Ga0207712_10304803 | |||
| 3175 | Ga0207712_10840430 | |||
| 3176 | Ga0207668_10150768 | |||
| 3177 | Ga0207668_10302427 | |||
| 3178 | Ga0207668_10621936 | |||
| 3179 | Ga0207668_11353453 | |||
| 3180 | Ga0207668_11471879 | |||
| 3181 | Ga0207668_11589497 | |||
| 3182 | Ga0207640_10025526 | |||
| 3183 | Ga0207640_10032794 | |||
| 3184 | Ga0207640_10177424 | |||
| 3185 | Ga0207640_10466204 | |||
| 3186 | Ga0207658_10337190 | |||
| 3187 | Ga0207658_10359124 | |||
| 3188 | Ga0207658_10883535 | |||
| 3189 | Ga0207658_11845578 | |||
| 3190 | Ga0207677_10467255 | |||
| 3191 | Ga0207677_10542916 | |||
| 3192 | Ga0207677_10929366 | |||
| 3193 | Ga0207677_11578395 | |||
| 3194 | Ga0207703_10074166 | |||
| 3195 | Ga0207703_10298665 | |||
| 3196 | Ga0207703_10523474 | |||
| 3197 | Ga0207703_10573814 | |||
| 3198 | Ga0207639_10336648 | |||
| 3199 | Ga0207639_10341581 | |||
| 3200 | Ga0207639_10372405 | |||
| 3201 | Ga0207639_10374102 | |||
| 3202 | Ga0207639_10959512 | |||
| 3203 | Ga0207639_11077418 | |||
| 3204 | Ga0207639_11126253 | |||
| 3205 | Ga0207639_12038794 | |||
| 3206 | Ga0207678_10170907 | |||
| 3207 | Ga0207678_10179889 | |||
| 3208 | Ga0207678_10643863 | |||
| 3209 | Ga0207678_10658453 | |||
| 3210 | Ga0207678_11309088 | |||
| 3211 | Ga0207708_10142385 | |||
| 3212 | Ga0207708_10143340 | |||
| 3213 | Ga0207708_10153255 | |||
| 3214 | Ga0207708_10489822 | |||
| 3215 | Ga0207708_10586199 | |||
| 3216 | Ga0207708_10676365 | |||
| 3217 | Ga0207702_10293980 | |||
| 3218 | Ga0207702_10419228 | |||
| 3219 | Ga0207702_10437262 | |||
| 3220 | Ga0207702_10496339 | |||
| 3221 | Ga0207702_10581159 | |||
| 3222 | Ga0207702_10649515 | |||
| 3223 | Ga0207702_10650872 | |||
| 3224 | Ga0207702_10760332 | |||
| 3225 | Ga0207702_10919483 | |||
| 3226 | Ga0207702_10958549 | |||
| 3227 | Ga0207702_11273605 | |||
| 3228 | Ga0207702_11275879 | |||
| 3229 | Ga0207702_11471140 | |||
| 3230 | Ga0207702_11610888 | |||
| 3231 | Ga0207641_10246215 | |||
| 3232 | Ga0207641_10407527 | |||
| 3233 | Ga0207641_10818450 | |||
| 3234 | Ga0207641_11334841 | |||
| 3235 | Ga0207648_10105951 | |||
| 3236 | Ga0207648_10172230 | |||
| 3237 | Ga0207648_10797957 | |||
| 3238 | Ga0207648_11244504 | |||
| 3239 | Ga0207648_11332059 | |||
| 3240 | Ga0207676_10205442 | |||
| 3241 | Ga0207676_10431972 | |||
| 3242 | Ga0207676_10938154 | |||
| 3243 | Ga0207676_11266247 | |||
| 3244 | Ga0207674_10047869 | |||
| 3245 | Ga0207674_10518034 | |||
| 3246 | Ga0207674_10553421 | |||
| 3247 | Ga0207674_10681070 | |||
| 3248 | Ga0207674_10822058 | |||
| 3249 | Ga0207675_100214846 | |||
| 3250 | Ga0207675_100394894 | |||
| 3251 | Ga0207675_100414728 | |||
| 3252 | Ga0207683_10063437 | |||
| 3253 | Ga0207683_10195897 | |||
| 3254 | Ga0207683_10406104 | |||
| 3255 | Ga0207683_11078746 | |||
| 3256 | Ga0207698_10403965 | |||
| 3257 | Ga0207698_10698405 | |||
| 3258 | Ga0207698_10723852 | |||
| 3259 | Ga0207698_10818550 | |||
| 3260 | Ga0207698_10931457 | |||
| 3261 | Ga0207698_12147514 | |||
| 3262 | Ga0209389_1000192 | |||
| 3263 | Ga0209389_1080073 | |||
| 3264 | Ga0209371_1002705 | |||
| 3265 | Ga0209371_1006726 | |||
| 3266 | Ga0209489_100397 | |||
| 3267 | Ga0209998_10217517 | |||
| 3268 | Ga0209974_10076738 | |||
| 3269 | Ga0265356_1007901 | |||
| 3270 | Ga0265356_1019577 | |||
| 3271 | Ga0265356_1036310 | |||
| 3272 | Ga0268266_10303467 | |||
| 3273 | Ga0268266_10306718 | |||
| 3274 | Ga0268266_10356965 | |||
| 3275 | Ga0268266_10495033 | |||
| 3276 | Ga0268265_10317836 | |||
| 3277 | Ga0268265_11191156 | |||
| 3278 | Ga0268265_11204619 | |||
| 3279 | Ga0268264_10325575 | |||
| 3280 | Ga0268264_10368347 | |||
| 3281 | Ga0268264_10406041 | |||
| 3282 | Ga0268264_10427688 | |||
| 3283 | Ga0268264_10865924 | |||
| 3284 | Ga0265326_10049984 | |||
| 3285 | Ga0265319_1158520 | |||
| 3286 | Ga0265334_10064030 | |||
| 3287 | Ga0265334_10076067 | |||
| 3288 | Ga0265334_10086860 | |||
| 3289 | Ga0265318_10001985 | |||
| 3290 | Ga0265318_10070123 | |||
| 3291 | Ga0265318_10075889 | |||
| 3292 | Ga0265318_10202234 | |||
| 3293 | Ga0265322_10249122 | |||
| 3294 | Ga0307515_10042604 | |||
| 3295 | Ga0307515_10103410 | |||
| 3296 | Ga0265338_10263345 | |||
| 3297 | Ga0265338_10273330 | |||
| 3298 | Ga0265338_10939467 | |||
| 3299 | Ga0268256_1001745 | |||
| 3300 | Ga0268256_1006802 | |||
| 3301 | Ga0265762_1007147 | |||
| 3302 | Ga0265765_1048822 | |||
| 3303 | Ga0265771_1004795 | |||
| 3304 | Ga0265760_10047101 | |||
| 3305 | Ga0265760_10106150 | |||
| 3306 | Ga0265330_10015058 | |||
| 3307 | Ga0265330_10072655 | |||
| 3308 | Ga0265330_10080198 | |||
| 3309 | Ga0265330_10087350 | |||
| 3310 | Ga0265332_10063520 | |||
| 3311 | Ga0265332_10090311 | |||
| 3312 | Ga0265332_10103138 | |||
| 3313 | Ga0265332_10161183 | |||
| 3314 | Ga0265328_10048948 | |||
| 3315 | Ga0265328_10057540 | |||
| 3316 | Ga0265328_10079784 | |||
| 3317 | Ga0265328_10091235 | |||
| 3318 | Ga0265320_10041934 | |||
| 3319 | Ga0265320_10080033 | |||
| 3320 | Ga0265320_10103775 | |||
| 3321 | Ga0265320_10112585 | |||
| 3322 | Ga0265320_10364802 | |||
| 3323 | Ga0265325_10000470 | |||
| 3324 | Ga0265325_10054640 | |||
| 3325 | Ga0265325_10122415 | |||
| 3326 | Ga0265325_10128642 | |||
| 3327 | Ga0265325_10433513 | |||
| 3328 | Ga0265325_10531146 | |||
| 3329 | Ga0265329_10029038 | |||
| 3330 | Ga0265329_10049337 | |||
| 3331 | Ga0265329_10073789 | |||
| 3332 | Ga0265340_10011622 | |||
| 3333 | Ga0265340_10062318 | |||
| 3334 | Ga0265340_10070416 | |||
| 3335 | Ga0265340_10102395 | |||
| 3336 | Ga0265340_10167316 | |||
| 3337 | Ga0265340_10249564 | |||
| 3338 | Ga0265339_10135113 | |||
| 3339 | Ga0265339_10135652 | |||
| 3340 | Ga0265339_10136538 | |||
| 3341 | Ga0265339_10353019 | |||
| 3342 | Ga0265331_10081048 | |||
| 3343 | Ga0265331_10095015 | |||
| 3344 | Ga0265331_10138324 | |||
| 3345 | Ga0265331_10178527 | |||
| 3346 | Ga0265331_10430736 | |||
| 3347 | Ga0265316_10166360 | |||
| 3348 | Ga0265316_10225778 | |||
| 3349 | Ga0265316_10264059 | |||
| 3350 | Ga0265316_10272434 | |||
| 3351 | Ga0265316_10295259 | |||
| 3352 | Ga0265316_10979554 | |||
| 3353 | Ga0265316_11239844 | |||
| 3354 | Ga0307513_10159534 | |||
| 3355 | Ga0307513_10309001 | |||
| 3356 | Ga0307513_10344740 | |||
| 3357 | Ga0307513_10347567 | |||
| 3358 | Ga0307509_10133310 | |||
| 3359 | Ga0307408_100215213 | |||
| 3360 | Ga0307408_100255173 | |||
| 3361 | Ga0307408_100324833 | |||
| 3362 | Ga0307408_101669679 | |||
| 3363 | Ga0307408_102218182 | |||
| 3364 | Ga0307408_102444453 | |||
| 3365 | Ga0265313_10076729 | |||
| 3366 | Ga0265313_10109435 | |||
| 3367 | Ga0265313_10110736 | |||
| 3368 | Ga0307508_10428770 | |||
| 3369 | Ga0316579_10420320 | |||
| 3370 | Ga0265314_10041671 | |||
| 3371 | Ga0265314_10124768 | |||
| 3372 | Ga0265314_10218619 | |||
| 3373 | Ga0265314_10306169 | |||
| 3374 | Ga0265342_10065842 | |||
| 3375 | Ga0265342_10075554 | |||
| 3376 | Ga0265342_10127927 | |||
| 3377 | Ga0265342_10225795 | |||
| 3378 | Ga0316576_10239741 | |||
| 3379 | Ga0316576_10241589 | |||
| 3380 | Ga0316578_10148389 | |||
| 3381 | Ga0307405_10389182 | |||
| 3382 | Ga0307405_10566048 | |||
| 3383 | Ga0307405_11357174 | |||
| 3384 | Ga0307405_11421853 | |||
| 3385 | Ga0307405_11549831 | |||
| 3386 | Ga0307410_10292516 | |||
| 3387 | Ga0307406_10216268 | |||
| 3388 | Ga0307406_11027229 | |||
| 3389 | Ga0307407_10327409 | |||
| 3390 | Ga0307412_10085052 | |||
| 3391 | Ga0307412_10275288 | |||
| 3392 | Ga0307412_10374009 | |||
| 3393 | Ga0307412_10709552 | |||
| 3394 | Ga0307412_10727655 | |||
| 3395 | Ga0307412_11312075 | |||
| 3396 | Ga0307409_100409749 | |||
| 3397 | Ga0307409_100616228 | |||
| 3398 | Ga0307416_100268704 | |||
| 3399 | Ga0307416_100323152 | |||
| 3400 | Ga0307416_100409499 | |||
| 3401 | Ga0307416_100529230 | |||
| 3402 | Ga0307416_101939398 | |||
| 3403 | Ga0307416_103795019 | |||
| 3404 | Ga0307414_10364651 | |||
| 3405 | Ga0307414_10686141 | |||
| 3406 | Ga0307411_10182162 | |||
| 3407 | Ga0307411_10306328 | |||
| 3408 | Ga0307411_10734723 | |||
| 3409 | Ga0307411_11491439 | |||
| 3410 | Ga0307415_100758863 | |||
| 3411 | Ga0307415_100808608 | |||
| 3412 | Ga0307415_101193386 | |||
| 3413 | Ga0307415_101643232 | |||
| 3414 | Ga0307507_10148326 | |||
| 3415 | Ga0307510_10090852 | |||
| 3416 | Ga0307510_10218789 | |||
| 3417 | Ga0373930_0025313 | |||
| 3418 | Ga0373950_0077527 | |||
| 3419 | Ga0373958_0010738 | |||
| 3420 | Ga0373959_0020412 | |||
| 3421 | Ga0373938_0001426 | |||
| 3422 | Ga0373938_0130541 | |||
| 3423 | Ga0373926_0034160 | |||
| 3424 | Ga0373926_0068678 | |||
| 3425 | Ga0373929_0026404 | |||
| 3426 | Ga0373934_0040018 | |||
| 3427 | Ga0373940_0048280 | |||
| 3428 | Ga0373940_0222946 | |||
| 3429 | Ga0373940_0307663 | |||
| 3430 | Ga0373944_0004086 | |||
| 3431 | Ga0373944_0062771 | |||
| 3432 | Ga0373944_0073109 | |||
| 3433 | Ga0373944_0368231 | |||
| 3434 | Ga0373949_0038456 | |||
| 3435 | Ga0373951_0027396 | |||
| 3436 | Ga0373951_0037788 | |||
| 3437 | Ga0373951_0235748 | |||
| 3438 | Ga0373923_0014805 | |||
| 3439 | Ga0373923_0107546 | |||
| 3440 | Ga0373923_0210712 | |||
| 3441 | Ga0373936_0071846 | |||
| 3442 | Ga0373936_0326230 | |||
| 3443 | Ga0373936_0585638 | |||
| 3444 | Ga0373939_0010117 | |||
| 3445 | Ga0373939_0458280 | |||
| 3446 | Ga0373941_0039099 | |||
| 3447 | Ga0373945_0028673 | |||
| 3448 | Ga0373945_0067182 | |||
| 3449 | Ga0373945_0069441 | |||
| 3450 | Ga0373945_0121367 | |||
| 3451 | Ga0373953_0020810 | |||
| 3452 | Ga0373954_0102373 | |||
| 3453 | Ga0373956_0041225 | |||
| 3454 | Ga0373956_0581112 | |||
| 3455 | Ga0373957_0051489 | |||
| 3456 | Ga0373957_0358587 | |||
| 3457 | Ga0373960_0002462 | |||
| 3458 | Ga0373960_0280893 | |||
| 3459 | Ga0373960_0329935 | |||
| 3460 | Ga0373943_0024217 | |||
| 3461 | Ga0373943_0182958 | |||
| 3462 | Ga0373943_0385367 | |||
| 3463 | Ga0373946_0374942 | |||
| 3464 | Ga0373946_0747046 | |||
| 3465 | Ga0373946_0774150 | |||
| 3466 | Ga0373955_0291763 | |||
| 3467 | Ga0373955_0540394 | |||
| 3468 | Ga0373942_0016107 | |||
| 3469 | Ga0373942_0049827 | |||
| 3470 | Ga0373961_0069794 | |||
| 3471 | Ga0316574_0379218 | |||
| 3472 | Ga0316574_0533956 | |||
| 3473 | Ga0316574_0661307 | |||
| 3474 | Ga0373924_0018083 | |||
| 3475 | Ga0373924_0037517 | |||
| 3476 | Ga0373931_0107722 | |||
| 3477 | Ga0373931_0738751 | |||
| 3478 | Ga0373931_0739457 | |||
| 3479 | Ga0373931_0953070 | |||
| 3480 | Ga0373935_0189880 | |||
| 3481 | Ga0373935_0258508 | |||
| 3482 | Ga0373935_0271051 | |||
| 3483 | Ga0373935_0630585 | |||
| 3484 | Ga0373935_0702300 | |||
| 3485 | Ga0373935_0779448 | |||
| 3486 | Ga0373935_1261808 | |||
| 3487 | Ga0373927_0108408 | |||
| 3488 | Ga0373927_0116777 | |||
| 3489 | Ga0373927_0194092 | |||
| 3490 | Ga0373927_0229413 | |||
| 3491 | Ga0373933_0195094 | |||
| 3492 | Ga0373947_0146162 | |||
| 3493 | Ga0373947_0154034 | |||
| 3494 | Ga0373947_0169552 | |||
| 3495 | Ga0373947_0175028 | |||
| 3496 | Ga0373947_0227152 | |||
| 3497 | Ga0373947_0716735 | |||
| 3498 | Ga0373937_0289081 | |||
| 3499 | Ga0373937_0382347 | |||
| 3500 | Ga0373937_0390445 | |||
| 3501 | Ga0316582_0250181 | |||
| 3502 | Ga0316584_1062113 | |||
| 3503 | Ga0316584_1062273 | |||
| 3504 | Ga0373925_0026850 | |||
| 3505 | Ga0373925_0052739 | |||
| 3506 | Ga0373925_0240883 | |||
| 3507 | Ga0373925_0290833 | |||
| 3508 | Ga0373925_1686490 | |||
| 3509 | Ga0373925_1715268 | |||
| 3510 | Ga0395900_0747076 | |||
| 3511 | Ga0395900_1210458 | |||
| 3512 | Ga0395900_1756391 | |||
| 3513 | Ga0395898_0060463 | |||
| 3514 | Ga0395898_0348393 | |||
| 3515 | Ga0395898_1444344 | |||
| 3516 | Ga0395905_0484243 | |||
| 3517 | Ga0436364_0255320 | |||
| 3518 | Ga0436364_0541898 | |||
| 3519 | Ga0436364_0554499 | |||
| 3520 | Ga0436364_0726935 | |||
| 3521 | Ga0436364_0963528 | |||
| 3522 | Ga0436364_1483246 | |||
| 3523 | Ga0395901_0456402 | |||
| 3524 | Ga0395901_1102178 | |||
| 3525 | Ga0395901_2039156 | |||
| 3526 | Ga0436365_0532529 | |||
| 3527 | Ga0436365_0966114 | |||
| 3528 | Ga0436365_1020445 | |||
| 3529 | Ga0436365_1131554 | |||
| 3530 | Ga0436365_1388600 | |||
| 3531 | Ga0436365_1925217 | |||
| 3532 | Ga0436360_0429478 | |||
| 3533 | Ga0436360_0770642 | |||
| 3534 | Ga0436360_0832524 | |||
| 3535 | Ga0436360_1128830 | |||
| 3536 | Ga0436360_1166796 | |||
| 3537 | Ga0436361_0044025 | |||
| 3538 | Ga0436361_0671466 | |||
| 3539 | Ga0436361_0697198 | |||
| 3540 | Ga0436361_0948409 | |||
| 3541 | Ga0436361_0985371 | |||
| 3542 | Ga0436363_0018834 | |||
| 3543 | Ga0436363_0817356 | |||
| 3544 | Ga0436363_1001204 | |||
| 3545 | Ga0436362_0016536 | |||
| 3546 | Ga0436362_0376050 | |||
| 3547 | Ga0436362_0926788 | |||
| 3548 | Ga0439436_0033996 | |||
| 3549 | Ga0439436_0123331 | |||
| 3550 | Ga0439439_0036586 | |||
| 3551 | Ga0439447_027919 | |||
| 3552 | Ga0439453_0017139 | |||
| 3553 | Ga0439453_0062135 | |||
| 3554 | Ga0439461_0008144 | |||
| 3555 | Ga0439465_0000081 | |||
| 3556 | Ga0451787_087122 | |||
| 3557 | Ga0451789_1080748 | |||
| 3558 | Ga0451791_0659445 | |||
| 3559 | Ga0451791_0973324 | |||
| 3560 | Ga0451791_1087098 | |||
| 3561 | Ga0451791_1201354 | |||
| 3562 | Ga0451791_1361698 | |||
| 3563 | Ga0451797_1582856 | |||
| 3564 | Ga0451795_0150957 | |||
| 3565 | Ga0451795_1073768 | |||
| 3566 | Ga0451798_0233393 | |||
| 3567 | Ga0451798_0687350 | |||
| 3568 | Ga0451800_0467117 | |||
| 3569 | Ga0451800_0478560 | |||
| 3570 | Ga0451800_0514837 | |||
| 3571 | Ga0451800_1567732 | |||
| 3572 | Ga0451802_0651888 | |||
| 3573 | Ga0451802_1912908 | |||
| 3574 | Ga0451804_0438673 | |||
| 3575 | Ga0451807_0289057 | |||
| 3576 | Ga0451807_1300876 | |||
| 3577 | Ga0451833_0920853 | |||
| 3578 | Ga0451833_1273368 | |||
| 3579 | Ga0451835_1138368 | |||
| 3580 | Ga0451835_1260456 | |||
| 3581 | Ga0451837_0538533 | |||
| 3582 | Ga0451837_1753977 | |||
| 3583 | Ga0451841_0245237 | |||
| 3584 | Ga0451845_0067126 | |||
| 3585 | Ga0451845_0626369 | |||
| 3586 | Ga0451847_0954509 | |||
| 3587 | Ga0451849_1486900 | |||
| 3588 | Ga0451851_0617812 | |||
| 3589 | Ga0451843_0028691 | |||
| 3590 | Ga0451843_1612071 | |||
| 3591 | Ga0451853_0025403 | |||
| 3592 | Ga0451853_1048281 | |||
| 3593 | Ga0451853_3365647 | |||
| 3594 | Ga0439441_021140 | |||
| 3595 | Ga0439448_0059925 | |||
| 3596 | Ga0439448_0103011 | |||
| 3597 | Ga0439432_253793 | |||
| 3598 | Ga0439449_0154125 | |||
| 3599 | Ga0439451_031816 | |||
| 3600 | Ga0439452_031173 | |||
| 3601 | Ga0439454_009771 | |||
| 3602 | Ga0439457_028826 | |||
| 3603 | Ga0439462_0031121 | |||
| 3604 | Ga0439462_0035441 | |||
| 3605 | Ga0450914_005632 | |||
| 3606 | Ga0450898_016660 | |||
| 3607 | Ga0450903_064932 | |||
| 3608 | Ga0439446_0051970 | |||
| 3609 | Ga0439446_0125999 | |||
| 3610 | Ga0450909_086486 | |||
| 3611 | Ga0439434_0027544 | |||
| 3612 | Ga0439435_0032471 | |||
| 3613 | Ga0439444_0016557 | |||
| 3614 | Ga0439444_0134282 | |||
| 3615 | Ga0439459_0000106 | |||
| 3616 | Ga0439459_0000690 | |||
| 3617 | Ga0439459_0151550 | |||
| 3618 | Ga0439459_0187706 | |||
| 3619 | Ga0439464_0042650 | |||
| 3620 | Ga0439460_0051046 | |||
| 3621 | Ga0450893_0092695 | |||
| 3622 | Ga0451577_0039329 | |||
| 3623 | Ga0451577_0089653 | |||
| 3624 | Ga0451577_0207422 | |||
| 3625 | Ga0451577_0340359 | |||
| 3626 | Ga0439440_0201111 | |||
| 3627 | Ga0466969_0120383 | |||
| 3628 | Ga0453683_0036678 | |||
| 3629 | Ga0453683_0070373 | |||
| 3630 | Ga0453683_0166036 | |||
| 3631 | Ga0453683_0308001 | |||
| 3632 | Ga0466965_0248141 | |||
| 3633 | Ga0466966_0191340 | |||
| 3634 | Ga0466966_0832149 | |||
| 3635 | Ga0466961_0177888 | |||
| 3636 | Ga0466963_0136281 | |||
| 3637 | Ga0466964_0106656 | |||
| 3638 | Ga0466964_0796220 | |||
| 3639 | Ga0453684_0092963 | |||
| 3640 | Ga0453684_0134912 | |||
| 3641 | Ga0453684_1552583 | |||
| 3642 | Ga0466971_0078765 | |||
| 3643 | Ga0466968_0077765 | |||
| 3644 | Ga0466970_0132543 | |||
| 3645 | Ga0466970_0163103 | |||
| 3646 | Ga0466957_0102406 | |||
| 3647 | Ga0466957_0212421 | |||
| 3648 | Ga0466957_0226723 | |||
| 3649 | Ga0451576_0009749 | |||
| 3650 | Ga0451576_0125849 | |||
| 3651 | Ga0451576_1865451 | |||
| 3652 | Ga0451576_2330833 | |||
| 3653 | Ga0466958_0176781 | |||
| 3654 | Ga0466958_0230737 | |||
| 3655 | Ga0466967_0367160 | |||
| 3656 | Ga0466967_0512709 | |||
| 3657 | Ga0466967_0536351 | |||
| 3658 | Ga0466967_0596187 | |||
| 3659 | Ga0466967_2171523 | |||
| 3660 | Ga0495627_044618 | |||
| 3661 | Ga0495592_0218003 | |||
| 3662 | Ga0495592_0320842 | |||
| 3663 | Ga0495603_0121147 | |||
| 3664 | Ga0495603_0176565 | |||
| 3665 | Ga0495603_0261788 | |||
| 3666 | Ga0495590_0053109 | |||
| 3667 | Ga0495590_0088863 | |||
| 3668 | Ga0495590_0239992 | |||
| 3669 | Ga0495591_034336 | |||
| 3670 | Ga0495629_0103686 | |||
| 3671 | Ga0495629_0248371 | |||
| 3672 | Ga0495629_0254649 | |||
| 3673 | Ga0495638_0002512 | |||
| 3674 | Ga0495638_0043353 | |||
| 3675 | Ga0495641_0050797 | |||
| 3676 | Ga0495641_0088208 | |||
| 3677 | Ga0495641_0094513 | |||
| 3678 | Ga0495641_0257827 | |||
| 3679 | Ga0495651_0124442 | |||
| 3680 | Ga0495651_0305320 | |||
| 3681 | Ga0495653_0123480 | |||
| 3682 | Ga0495653_0222661 | |||
| 3683 | Ga0495653_0457003 | |||
| 3684 | Ga0495580_0388956 | |||
| 3685 | Ga0495582_0208256 | |||
| 3686 | Ga0495582_0267446 | |||
| 3687 | Ga0495605_0109124 | |||
| 3688 | Ga0495605_0140644 | |||
| 3689 | Ga0495639_0055704 | |||
| 3690 | Ga0495639_0101308 | |||
| 3691 | Ga0495639_0110429 | |||
| 3692 | Ga0495639_0128793 | |||
| 3693 | Ga0495639_0244154 | |||
| 3694 | Ga0495662_0112644 | |||
| 3695 | Ga0495662_0181763 | |||
| 3696 | Ga0495662_0196052 | |||
| 3697 | Ga0495664_0020887 | |||
| 3698 | Ga0495664_0183508 | |||
| 3699 | Ga0495664_0272202 | |||
| 3700 | Ga0495664_0276046 | |||
| 3701 | Ga0495584_0136449 | |||
| 3702 | Ga0495584_0137515 | |||
| 3703 | Ga0495585_0108637 | |||
| 3704 | Ga0495594_0092562 | |||
| 3705 | Ga0495594_0129438 | |||
| 3706 | Ga0495594_0142752 | |||
| 3707 | Ga0495594_0332694 | |||
| 3708 | Ga0495594_0428073 | |||
| 3709 | Ga0495594_0872343 | |||
| 3710 | Ga0495607_0109479 | |||
| 3711 | Ga0495607_0168099 | |||
| 3712 | Ga0495583_0304742 | |||
| 3713 | Ga0495606_0151522 | |||
| 3714 | Ga0495606_0166696 | |||
| 3715 | Ga0495606_0177129 | |||
| 3716 | Ga0495608_0190310 | |||
| 3717 | Ga0495608_0249375 | |||
| 3718 | Ga0495610_0335753 | |||
| 3719 | Ga0495616_0041790 | |||
| 3720 | Ga0495618_0171691 | |||
| 3721 | Ga0495618_0487064 | |||
| 3722 | Ga0495618_0749040 | |||
| 3723 | Ga0495620_0074838 | |||
| 3724 | Ga0495620_0080985 | |||
| 3725 | Ga0495620_0175124 | |||
| 3726 | Ga0495620_0189164 | |||
| 3727 | Ga0495628_0274870 | |||
| 3728 | Ga0495628_0282733 | |||
| 3729 | Ga0495628_0404820 | |||
| 3730 | Ga0495628_0833781 | |||
| 3731 | Ga0495630_0058711 | |||
| 3732 | Ga0495630_0264249 | |||
| 3733 | Ga0495630_0266217 | |||
| 3734 | Ga0495630_0298618 | |||
| 3735 | Ga0495631_0009052 | |||
| 3736 | Ga0495631_0025621 | |||
| 3737 | Ga0495632_0076925 | |||
| 3738 | Ga0495632_0379423 | |||
| 3739 | Ga0495632_0493262 | |||
| 3740 | Ga0495637_0058375 | |||
| 3741 | Ga0495643_0131453 | |||
| 3742 | Ga0495643_0138615 | |||
| 3743 | Ga0495643_0139789 | |||
| 3744 | Ga0495643_0159805 | |||
| 3745 | Ga0495643_0216664 | |||
| 3746 | Ga0495644_0281749 | |||
| 3747 | Ga0495648_0071391 | |||
| 3748 | Ga0495648_0212217 | |||
| 3749 | Ga0495663_0055302 | |||
| 3750 | Ga0495666_0089783 | |||
| 3751 | Ga0495666_0104088 | |||
| 3752 | Ga0495666_0278285 | |||
| 3753 | Ga0495652_0137051 | |||
| 3754 | Ga0495652_0217572 | |||
| 3755 | Ga0495652_0248676 | |||
| 3756 | Ga0495665_0390327 | |||
| 3757 | Ga0495640_0178474 | |||
| 3758 | Ga0495640_0192539 | |||
| 3759 | Ga0495640_0208420 | |||
| 3760 | Ga0495586_0111523 | |||
| 3761 | Ga0495586_0115396 | |||
| 3762 | Ga0495586_0133551 | |||
| 3763 | Ga0495587_0064421 | |||
| 3764 | Ga0495587_0320450 | |||
| 3765 | Ga0495598_0285669 | |||
| 3766 | Ga0495609_0083751 | |||
| 3767 | Ga0495621_0067002 | |||
| 3768 | Ga0495597_0116550 | |||
| 3769 | Ga0495597_0176638 | |||
| 3770 | Ga0495645_0161545 | |||
| 3771 | Ga0495645_0627371 | |||
| 3772 | Ga0495645_0842658 | |||
| 3773 | Ga0495622_0129437 | |||
| 3774 | Ga0495633_0072529 | |||
| 3775 | Ga0495667_0114054 | |||
| 3776 | Ga0495667_0207252 | |||
| 3777 | Ga0495656_0046619 | |||
| 3778 | Ga0495668_0034180 | |||
| 3779 | Ga0495668_0079381 | |||
| 3780 | Ga0495634_0005027 | |||
| 3781 | Ga0495634_0126300 | |||
| 3782 | Ga0495634_0179009 | |||
| 3783 | Ga0495634_0198450 | |||
| 3784 | Ga0495611_0093745 | |||
| 3785 | Ga0495611_0103386 | |||
| 3786 | Ga0495625_0173962 | |||
| 3787 | Ga0495625_0176598 | |||
| 3788 | Ga0495625_0695161 | |||
| 3789 | Ga0495635_0073937 | |||
| 3790 | Ga0495635_0264822 | |||
| 3791 | Ga0495659_0078894 | |||
| 3792 | Ga0495661_0254294 | |||
| 3793 | Ga0495588_0099748 | |||
| 3794 | Ga0495588_0135876 | |||
| 3795 | Ga0495588_0141263 | |||
| 3796 | Ga0495657_0088566 | |||
| 3797 | Ga0495657_0208578 | |||
| 3798 | Ga0495657_0263738 | |||
| 3799 | Ga0495599_0153044 | |||
| 3800 | Ga0495599_0404590 | |||
| 3801 | Ga0495646_0136216 | |||
| 3802 | Ga0495647_0078824 | |||
| 3803 | Ga0495647_0113124 | |||
| 3804 | Ga0495658_0157971 | |||
| 3805 | Ga0495658_0191218 | |||
| 3806 | Ga0495658_0800410 | |||
| 3807 | Ga0495658_1088838 | |||
| 3808 | Ga0495669_0046029 | |||
| 3809 | Ga0495613_0216801 | |||
| 3810 | Ga0495613_0255437 | |||
| 3811 | Ga0495613_0306445 | |||
| 3812 | Ga0495624_0083237 | |||
| 3813 | Ga0495624_0149607 | |||
| 3814 | Ga0495624_0183716 | |||
| 3815 | Ga0495624_0431070 | |||
| 3816 | Ga0495624_0737741 | |||
| 3817 | Ga0495670_0118969 | |||
| 3818 | Ga0495671_0057755 | |||
| 3819 | Ga0495671_0321379 | |||
| 3820 | Ga0495649_0149467 | |||
| 3821 | Ga0495589_0192540 | |||
| 3822 | Ga0495600_0116786 | |||
| 3823 | Ga0495600_0163077 | |||
| 3824 | Ga0495660_0117219 | |||
| 3825 | Ga0495581_0179350 | |||
| 3826 | Ga0495581_0186413 | |||
| 3827 | Ga0495581_0219426 | |||
| 3828 | Ga0495604_0195988 | |||
| 3829 | Ga0495604_0233857 | |||
| 3830 | Ga0495604_0518072 | |||
| 3831 | Ga0495604_0909157 | |||
| 3832 | Ga0495604_1051096 | |||
| 3833 | Ga0495674_0001495 | |||
| 3834 | Ga0495674_0083380 | |||
| 3835 | Ga0495674_0253868 | |||
| 3836 | Ga0495674_0294083 | |||
| 3837 | Ga0495674_0787984 | |||
| 3838 | Ga0495672_0220057 | |||
| 3839 | Ga0495676_0192804 | |||
| 3840 | Ga0495676_0237430 | |||
| 3841 | Ga0495676_0261802 | |||
| 3842 | Ga0495680_0205135 | |||
| 3843 | Ga0495680_0252133 | |||
| 3844 | Ga0495683_0122063 | |||
| 3845 | Ga0495683_0123013 | |||
| 3846 | Ga0495683_0269253 | |||
| 3847 | Ga0495675_0137558 | |||
| 3848 | Ga0495677_0346313 | |||
| 3849 | Ga0495673_0119671 | |||
| 3850 | Ga0495673_0307484 | |||
| 3851 | Ga0495673_0350496 | |||
| 3852 | Ga0495681_0339473 | |||
| 3853 | Ga0495684_0195905 | |||
| 3854 | Ga0495684_0748373 | |||
| 3855 | Ga0495686_0004864 | |||
| 3856 | Ga0495686_0165831 | |||
| 3857 | Ga0495686_0571846 | |||
| 3858 | Ga0495593_0052820 | |||
| 3859 | Ga0495593_0065174 | |||
| 3860 | Ga0495593_0145160 | |||
| 3861 | Ga0495593_0169992 | |||
| 3862 | Ga0495602_0152712 | |||
| 3863 | Ga0495602_0400510 | |||
| 3864 | Ga0495602_0628017 | |||
| 3865 | Ga0495602_1087087 | |||
| 3866 | Ga0495614_0629626 | |||
| 3867 | Ga0495626_0102073 | |||
| 3868 | Ga0496100_0026554 | |||
| 3869 | Ga0496100_0206815 | |||
| 3870 | Ga0496100_0273644 | |||
| 3871 | Ga0496100_0405239 | |||
| 3872 | Ga0496100_0439162 | |||
| 3873 | Ga0496100_1556724 | |||
| 3874 | Ga0496101_0013716 | |||
| 3875 | Ga0496101_0150392 | |||
| 3876 | Ga0496101_0207169 | |||
| 3877 | Ga0496101_0237315 | |||
| 3878 | Ga0496101_0255668 | |||
| 3879 | Ga0496101_0284191 | |||
| 3880 | Ga0496101_0436141 | |||
| 3881 | Ga0496101_0644601 | |||
| 3882 | Ga0496102_0133290 | |||
| 3883 | Ga0496102_0227055 | |||
| 3884 | Ga0496102_0262179 | |||
| 3885 | Ga0496102_0289600 | |||
| 3886 | Ga0496102_0373274 | |||
| 3887 | Ga0496102_0388194 | |||
| 3888 | Ga0496102_0436784 | |||
| 3889 | Ga0496102_0745184 | |||
| 3890 | Ga0496102_1392947 | |||
| 3891 | Ga0496103_0007755 | |||
| 3892 | Ga0496103_0162551 | |||
| 3893 | Ga0496103_0200421 | |||
| 3894 | Ga0496103_0208364 | |||
| 3895 | Ga0496103_0738672 | |||
| 3896 | Ga0496103_0789900 | |||
| 3897 | Ga0496104_0302886 | |||
| 3898 | Ga0496104_0394902 | |||
| 3899 | Ga0496104_0411536 | |||
| 3900 | Ga0496104_0417735 | |||
| 3901 | Ga0496104_0774124 | |||
| 3902 | Ga0496104_1761888 | |||
| 3903 | Ga0496105_0253724 | |||
| 3904 | Ga0496105_0304495 | |||
| 3905 | Ga0496105_0363906 | |||
| 3906 | Ga0496105_0442735 | |||
| 3907 | Ga0496105_0643499 | |||
| 3908 | Ga0496105_0928200 | |||
| 3909 | Ga0496106_0008196 | |||
| 3910 | Ga0496106_0008640 | |||
| 3911 | Ga0496106_0197488 | |||
| 3912 | Ga0496106_0212744 | |||
| 3913 | Ga0496106_0232986 | |||
| 3914 | Ga0496106_0284267 | |||
| 3915 | Ga0496106_0339907 | |||
| 3916 | Ga0496107_0028081 | |||
| 3917 | Ga0496107_0199932 | |||
| 3918 | Ga0496107_0297028 | |||
| 3919 | Ga0496107_0315459 | |||
| 3920 | Ga0496107_0397707 | |||
| 3921 | Ga0496108_0323092 | |||
| 3922 | Ga0496108_0699809 | |||
| 3923 | Ga0496108_0880357 | |||
| 3924 | Ga0496109_0041208 | |||
| 3925 | Ga0496109_0389822 | |||
| 3926 | Ga0496109_1020796 | |||
| 3927 | Ga0496110_0276414 | |||
| 3928 | Ga0496110_0329841 | |||
| 3929 | Ga0496110_0345976 | |||
| 3930 | Ga0496110_0347121 | |||
| 3931 | Ga0496110_0379246 | |||
| 3932 | Ga0496110_1687317 | |||
| 3933 | Ga0496111_0223857 | |||
| 3934 | Ga0496111_0269719 | |||
| 3935 | Ga0496111_0367103 | |||
| 3936 | Ga0496111_0959515 | |||
| 3937 | Ga0496112_0401425 | |||
| 3938 | Ga0496112_0412018 | |||
| 3939 | Ga0496112_0631657 | |||
| 3940 | Ga0496112_1011898 | |||
| 3941 | Ga0496113_0351147 | |||
| 3942 | Ga0496113_0381662 | |||
| 3943 | Ga0496113_0444134 | |||
| 3944 | Ga0496113_0618161 | |||
| 3945 | Ga0496114_0001685 | |||
| 3946 | Ga0496114_0220819 | |||
| 3947 | Ga0496114_0347574 | |||
| 3948 | Ga0496114_0373830 | |||
| 3949 | Ga0496114_0423391 | |||
| 3950 | Ga0496114_0536349 | |||
| 3951 | Ga0496114_1091680 | |||
| 3952 | Ga0496115_0076611 | |||
| 3953 | Ga0496115_0176716 | |||
| 3954 | Ga0496115_0266288 | |||
| 3955 | Ga0496115_0281725 | |||
| 3956 | Ga0496115_0290789 | |||
| 3957 | Ga0496115_0330471 | |||
| 3958 | Ga0496116_0092087 | |||
| 3959 | Ga0496117_0016248 | |||
| 3960 | Ga0496117_0549801 | |||
| 3961 | Ga0496118_0003921 | |||
| 3962 | Ga0496118_0005006 | |||
| 3963 | Ga0496118_0066028 | |||
| 3964 | Ga0496119_0087479 | |||
| 3965 | Ga0496119_0158176 | |||
| 3966 | Ga0496119_0249964 | |||
| 3967 | Ga0496121_0000476 | |||
| 3968 | Ga0496121_0006084 | |||
| 3969 | Ga0496121_0020936 | |||
| 3970 | Ga0496121_0124621 | |||
| 3971 | Ga0496121_0662306 | |||
| 3972 | Ga0496121_0696532 | |||
| 3973 | Ga0496122_0000283 | |||
| 3974 | Ga0496122_0004099 | |||
| 3975 | Ga0496122_0087657 | |||
| 3976 | Ga0496122_0187791 | |||
| 3977 | Ga0496123_0000231 | |||
| 3978 | Ga0496123_0035623 | |||
| 3979 | Ga0496123_0061121 | |||
| 3980 | Ga0496123_0149555 | |||
| 3981 | Ga0496124_0000312 | |||
| 3982 | Ga0496124_0000907 | |||
| 3983 | Ga0496124_0013510 | |||
| 3984 | Ga0496124_0055068 | |||
| 3985 | Ga0496124_0069437 | |||
| 3986 | Ga0496124_0319733 | |||
| 3987 | Ga0496125_0079779 | |||
| 3988 | Ga0496125_0318112 | |||
| 3989 | Ga0496126_0007244 | |||
| 3990 | Ga0496126_0077872 | |||
| 3991 | Ga0496126_0087925 | |||
| 3992 | Ga0496126_0093482 | |||
| 3993 | Ga0496126_0116424 | |||
| 3994 | Ga0496126_0260512 | |||
| 3995 | Ga0496126_0314267 | |||
| 3996 | Ga0496126_0747877 | |||
| 3997 | Ga0496126_1230397 | |||
| 3998 | Ga0495682_0024737 | |||
| 3999 | Ga0495682_0308087 | |||
| 4000 | Ga0501290_002163 | |||
| 4001 | Ga0501291_012107 | |||
| 4002 | Ga0501292_011533 | |||
| 4003 | Ga0501297_003309 | |||
| 4004 | Ga0501299_010759 | |||
| 4005 | Ga0501300_012715 | |||
| 4006 | Ga0501300_015106 | |||
| 4007 | Ga0501301_005144 | |||
| 4008 | Ga0501303_000456 | |||
| 4009 | Ga0501031_0042997 | |||
| 4010 | Ga0501031_0187223 | |||
| 4011 | Ga0501031_0224307 | |||
| 4012 | Ga0501031_0294730 | |||
| 4013 | Ga0501031_0637556 | |||
| 4014 | Ga0501032_0005248 | |||
| 4015 | Ga0501032_0157886 | |||
| 4016 | Ga0501032_0261284 | |||
| 4017 | Ga0501032_0482849 | |||
| 4018 | Ga0501032_0675125 | |||
| 4019 | Ga0501033_0003930 | |||
| 4020 | Ga0501033_0006647 | |||
| 4021 | Ga0501033_0058533 | |||
| 4022 | Ga0501033_0196932 | |||
| 4023 | Ga0501033_0210910 | |||
| 4024 | Ga0501033_0229707 | |||
| 4025 | Ga0501033_0279538 | |||
| 4026 | Ga0501033_0453406 | |||
| 4027 | Ga0501033_0758861 | |||
| 4028 | Ga0501034_0012031 | |||
| 4029 | Ga0501034_0018190 | |||
| 4030 | Ga0501034_0018287 | |||
| 4031 | Ga0501034_0078724 | |||
| 4032 | Ga0501034_0276118 | |||
| 4033 | Ga0501034_0374074 | |||
| 4034 | Ga0501034_0394074 | |||
| 4035 | Ga0501034_0409826 | |||
| 4036 | Ga0501034_0435498 | |||
| 4037 | Ga0501034_0452087 | |||
| 4038 | Ga0501034_0453937 | |||
| 4039 | Ga0501034_0478568 | |||
| 4040 | Ga0501034_1217086 | |||
| 4041 | Ga0501036_0003926 | |||
| 4042 | Ga0501036_0040536 | |||
| 4043 | Ga0501036_0070148 | |||
| 4044 | Ga0501036_0206756 | |||
| 4045 | Ga0501036_0224572 | |||
| 4046 | Ga0501036_0347329 | |||
| 4047 | Ga0501036_0360201 | |||
| 4048 | Ga0501036_0417502 | |||
| 4049 | Ga0501036_0893015 | |||
| 4050 | Ga0501037_0009503 | |||
| 4051 | Ga0501037_0060761 | |||
| 4052 | Ga0501037_0100313 | |||
| 4053 | Ga0501037_0151115 | |||
| 4054 | Ga0501037_0210791 | |||
| 4055 | Ga0501037_0297924 | |||
| 4056 | Ga0501037_0729778 | |||
| 4057 | Ga0501038_0212787 | |||
| 4058 | Ga0501038_0233687 | |||
| 4059 | Ga0501038_0278808 | |||
| 4060 | Ga0501038_0302303 | |||
| 4061 | Ga0501038_0356840 | |||
| 4062 | Ga0501038_0506120 | |||
| 4063 | Ga0501038_0890210 | |||
| 4064 | Ga0501038_0964018 | |||
| 4065 | Ga0501039_0237723 | |||
| 4066 | Ga0501039_0408793 | |||
| 4067 | Ga0501039_0417692 | |||
| 4068 | Ga0501040_0047584 | |||
| 4069 | Ga0501040_0158049 | |||
| 4070 | Ga0501041_0114858 | |||
| 4071 | Ga0501042_0154610 | |||
| 4072 | Ga0501042_0461124 | |||
| 4073 | Ga0501043_0008514 | |||
| 4074 | Ga0501043_0011933 | |||
| 4075 | Ga0501043_0158651 | |||
| 4076 | Ga0501043_0251336 | |||
| 4077 | Ga0501043_0275616 | |||
| 4078 | Ga0501043_0389839 | |||
| 4079 | Ga0501043_0694927 | |||
| 4080 | Ga0501043_0853655 | |||
| 4081 | Ga0501043_0958920 | |||
| 4082 | Ga0501046_0085149 | |||
| 4083 | Ga0501046_0131819 | |||
| 4084 | Ga0501046_0136599 | |||
| 4085 | Ga0501046_0182480 | |||
| 4086 | Ga0501046_0232506 | |||
| 4087 | Ga0501046_0566742 | |||
| 4088 | Ga0501046_0642967 | |||
| 4089 | Ga0501046_1102730 | |||
| 4090 | Ga0501047_0000871 | |||
| 4091 | Ga0501047_0007264 | |||
| 4092 | Ga0501047_0046350 | |||
| 4093 | Ga0501047_0077786 | |||
| 4094 | Ga0501047_0141276 | |||
| 4095 | Ga0501047_0264368 | |||
| 4096 | Ga0501047_0460159 | |||
| 4097 | Ga0501047_0612786 | |||
| 4098 | Ga0501047_0875985 | |||
| 4099 | Ga0501048_0153706 | |||
| 4100 | Ga0501048_0197090 | |||
| 4101 | Ga0501048_0207595 | |||
| 4102 | Ga0501048_0240900 | |||
| 4103 | Ga0501048_0262756 | |||
| 4104 | Ga0501048_0333703 | |||
| 4105 | Ga0501048_1378230 | |||
| 4106 | Ga0501067_0007394 | |||
| 4107 | Ga0501067_0094222 | |||
| 4108 | Ga0501067_0181747 | |||
| 4109 | Ga0501067_0184014 | |||
| 4110 | Ga0501067_0290608 | |||
| 4111 | Ga0501067_0398778 | |||
| 4112 | Ga0501067_0788631 | |||
| 4113 | Ga0501068_0032654 | |||
| 4114 | Ga0501068_0128338 | |||
| 4115 | Ga0501068_0133172 | |||
| 4116 | Ga0501068_0142359 | |||
| 4117 | Ga0501068_0191421 | |||
| 4118 | Ga0501068_0286001 | |||
| 4119 | Ga0501068_0294585 | |||
| 4120 | Ga0501068_0468489 | |||
| 4121 | Ga0501068_0608742 | |||
| 4122 | Ga0501068_1179622 | |||
| 4123 | Ga0501069_0052068 | |||
| 4124 | Ga0501069_0100280 | |||
| 4125 | Ga0501069_0132567 | |||
| 4126 | Ga0501069_0137949 | |||
| 4127 | Ga0501069_0147779 | |||
| 4128 | Ga0501069_0153209 | |||
| 4129 | Ga0501069_0157826 | |||
| 4130 | Ga0501069_0359817 | |||
| 4131 | Ga0501069_0661500 | |||
| 4132 | Ga0501070_0004207 | |||
| 4133 | Ga0501070_0019671 | |||
| 4134 | Ga0501070_0104408 | |||
| 4135 | Ga0501070_0144794 | |||
| 4136 | Ga0501070_0250350 | |||
| 4137 | Ga0501070_0264484 | |||
| 4138 | Ga0501070_0267208 | |||
| 4139 | Ga0501070_0303880 | |||
| 4140 | Ga0501070_0346429 | |||
| 4141 | Ga0501070_0473861 | |||
| 4142 | Ga0501070_0478785 | |||
| 4143 | Ga0501070_0580424 | |||
| 4144 | Ga0501070_0901138 | |||
| 4145 | Ga0501071_0056312 | |||
| 4146 | Ga0501071_0145173 | |||
| 4147 | Ga0501071_0248402 | |||
| 4148 | Ga0501071_0507777 | |||
| 4149 | Ga0501072_0331229 | |||
| 4150 | Ga0501072_0877459 | |||
| 4151 | Ga0501072_0890574 | |||
| 4152 | Ga0501073_0009716 | |||
| 4153 | Ga0501073_0039852 | |||
| 4154 | Ga0501073_0052370 | |||
| 4155 | Ga0501073_0126391 | |||
| 4156 | Ga0501073_0127091 | |||
| 4157 | Ga0501073_0187241 | |||
| 4158 | Ga0501073_0215075 | |||
| 4159 | Ga0501073_0228273 | |||
| 4160 | Ga0501073_0322388 | |||
| 4161 | Ga0501073_0330941 | |||
| 4162 | Ga0501074_0003848 | |||
| 4163 | Ga0501074_0031110 | |||
| 4164 | Ga0501074_0162839 | |||
| 4165 | Ga0501074_0176743 | |||
| 4166 | Ga0501074_0211620 | |||
| 4167 | Ga0501074_0306959 | |||
| 4168 | Ga0501074_0409578 | |||
| 4169 | Ga0501074_0983014 | |||
| 4170 | Ga0501074_1114326 | |||
| 4171 | Ga0501075_0253977 | |||
| 4172 | Ga0501075_0289658 | |||
| 4173 | Ga0501075_0766317 | |||
| 4174 | Ga0501075_1265879 | |||
| 4175 | Ga0501076_0149267 | |||
| 4176 | Ga0501076_0255439 | |||
| 4177 | Ga0501076_0270772 | |||
| 4178 | Ga0501076_0319768 | |||
| 4179 | Ga0501076_1489989 | |||
| 4180 | Ga0501077_0191137 | |||
| 4181 | Ga0501077_0504840 | |||
| 4182 | Ga0501206_008985 | |||
| 4183 | Ga0501207_017112 | |||
| 4184 | Ga0501207_094430 | |||
| 4185 | Ga0501217_029043 | |||
| 4186 | Ga0501222_044291 | |||
| 4187 | Ga0501223_001599 | |||
| 4188 | Ga0501224_003560 | |||
| 4189 | Ga0501235_020919 | |||
| 4190 | Ga0501242_058278 | |||
| 4191 | Ga0501243_080789 | |||
| 4192 | Ga0501249_008312 | |||
| 4193 | Ga0501253_035166 | |||
| 4194 | Ga0501257_140500 | |||
| 4195 | Ga0501259_018031 | |||
| 4196 | Ga0501221_092574 | |||
| 4197 | Ga0501079_0236393 | |||
| 4198 | Ga0501079_0266410 | |||
| 4199 | Ga0501079_0283211 | |||
| 4200 | Ga0501079_0336290 | |||
| 4201 | Ga0501079_0359761 | |||
| 4202 | Ga0501079_0890373 | |||
| 4203 | Ga0501080_0029683 | |||
| 4204 | Ga0501080_0093232 | |||
| 4205 | Ga0501080_0152621 | |||
| 4206 | Ga0501080_0351650 | |||
| 4207 | Ga0501080_0362097 | |||
| 4208 | Ga0501080_0411182 | |||
| 4209 | Ga0501080_0487863 | |||
| 4210 | Ga0501080_0527277 | |||
| 4211 | Ga0501080_0807315 | |||
| 4212 | Ga0501080_1372695 | |||
| 4213 | Ga0501080_1659446 | |||
| 4214 | Ga0501081_0049115 | |||
| 4215 | Ga0501081_0330800 | |||
| 4216 | Ga0501083_0052551 | |||
| 4217 | Ga0501083_0091803 | |||
| 4218 | Ga0501083_0122975 | |||
| 4219 | Ga0501083_0209832 | |||
| 4220 | Ga0501083_0277836 | |||
| 4221 | Ga0501083_0327228 | |||
| 4222 | Ga0501083_0347540 | |||
| 4223 | Ga0501083_0548255 | |||
| 4224 | Ga0501262_001134 | |||
| 4225 | Ga0501263_020663 | |||
| 4226 | Ga0501266_013527 | |||
| 4227 | Ga0501268_013370 | |||
| 4228 | Ga0501271_043772 | |||
| 4229 | Ga0501282_000529 | |||
| 4230 | Ga0501283_012729 | |||
| 4231 | Ga0501035_0009620 | |||
| 4232 | Ga0501035_0081675 | |||
| 4233 | Ga0501035_0133888 | |||
| 4234 | Ga0501035_0160257 | |||
| 4235 | Ga0501035_0176522 | |||
| 4236 | Ga0501035_0194310 | |||
| 4237 | Ga0501035_0196283 | |||
| 4238 | Ga0501035_0248552 | |||
| 4239 | Ga0501035_0569952 | |||
| 4240 | Ga0501035_0645723 | |||
| 4241 | Ga0501035_1340629 | |||
| 4242 | Ga0501044_0019807 | |||
| 4243 | Ga0501044_0095123 | |||
| 4244 | Ga0501044_0130311 | |||
| 4245 | Ga0501044_0218051 | |||
| 4246 | Ga0501044_0284531 | |||
| 4247 | Ga0501044_0331436 | |||
| 4248 | Ga0501044_0349886 | |||
| 4249 | Ga0501044_0351835 | |||
| 4250 | Ga0501044_0372952 | |||
| 4251 | Ga0501044_0384319 | |||
| 4252 | Ga0501044_0549905 | |||
| 4253 | Ga0501044_0647803 | |||
| 4254 | Ga0501044_1249745 | |||
| 4255 | Ga0501044_1454529 | |||
| 4256 | Ga0501044_1501762 | |||
| 4257 | Ga0501045_0135952 | |||
| 4258 | Ga0501045_0159364 | |||
| 4259 | Ga0501045_1103343 | |||
| 4260 | Ga0501045_1347057 | |||
| 4261 | Ga0501212_056318 | |||
| 4262 | Ga0501226_000708 | |||
| 4263 | Ga0501226_001034 | |||
| 4264 | Ga0501226_008827 | |||
| 4265 | nmdc:mga03n38_422580_c1 | |||
| 4266 | nmdc:mga00v17_1034712_c1 | |||
| 4267 | nmdc:mga00v17_1039400_c1 | |||
| 4268 | nmdc:mga00v17_134419_c2 | |||
| 4269 | nmdc:mga00v17_151397_c1 | |||
| 4270 | nmdc:mga0yw44_217286_c1 | |||
| 4271 | nmdc:mga0yw44_696900_c1 | |||
| 4272 | nmdc:mga0k408_870450_c1 | |||
| 4273 | nmdc:mga06z11_1031203_c1 | |||
| 4274 | nmdc:mga06z11_149914_c1 | |||
| 4275 | nmdc:mga06z11_30542_c1 | |||
| 4276 | nmdc:mga07m45_582228_c1 | |||
| 4277 | nmdc:mga09592_377565_c1 | |||
| 4278 | nmdc:mga06r32_225414_c1 | |||
| 4279 | nmdc:mga08y16_1987945_c1 | |||
| 4280 | nmdc:mga08y16_432759_c1 | |||
| 4281 | nmdc:mga0n895_302608_c1 | |||
| 4282 | nmdc:mga0n895_339760_c1 | |||
| 4283 | nmdc:mga0rr50_1166683_c1 | |||
| 4284 | nmdc:mga0rr50_1519982_c1 | |||
| 4285 | nmdc:mga0rr50_233574_c1 | |||
| 4286 | nmdc:mga0rr50_796287_c1 | |||
| 4287 | nmdc:mga0rr50_798963_c1 | |||
| 4288 | nmdc:mga08x19_232809_c1 | |||
| 4289 | nmdc:mga0a205_181601_c1 | |||
| 4290 | Ga0495601_0191242 | |||
| 4291 | Ga0495601_0191747 | |||
| 4292 | Ga0495601_0313586 | |||
| 4293 | Ga0495601_0360455 | |||
| 4294 | Ga0495601_1007270 | |||
| 4295 | Ga0495612_0078028 | |||
| 4296 | Ga0495612_0597991 | |||
| 4297 | Ga0495655_0020494 | |||
| 4298 | Ga0495595_0101138 | |||
| 4299 | Ga0495595_0113859 | |||
| 4300 | Ga0495595_0317060 | |||
| 4301 | Ga0495619_0109636 | |||
| 4302 | Ga0495619_0168624 | |||
| 4303 | Ga0495619_0239089 | |||
| 4304 | Ga0500578_0138896 | |||
| 4305 | Ga0500646_0022176 | |||
| 4306 | Ga0500566_0008223 | |||
| 4307 | Ga0500650_0109508 | |||
| 4308 | Ga0500558_068157 | |||
| 4309 | Ga0500562_025143 | |||
| 4310 | Ga0500569_020710 | |||
| 4311 | Ga0500572_092276 | |||
| 4312 | Ga0500594_0045313 | |||
| 4313 | Ga0500594_0158061 | |||
| 4314 | Ga0500595_025654 | |||
| 4315 | Ga0500614_246496 | |||
| 4316 | Ga0500628_025556 | |||
| 4317 | Ga0500642_0262637 | |||
| 4318 | Ga0500658_0006423 | |||
| 4319 | Ga0500658_0039664 | |||
| 4320 | Ga0500559_0107805 | |||
| 4321 | Ga0500568_0145071 | |||
| 4322 | Ga0500577_0372171 | |||
| 4323 | Ga0500586_035469 | |||
| 4324 | Ga0500588_0167673 | |||
| 4325 | Ga0500604_0006346 | |||
| 4326 | Ga0500616_0081831 | |||
| 4327 | Ga0500616_0128429 | |||
| 4328 | Ga0500616_0169140 | |||
| 4329 | Ga0500627_0081787 | |||
| 4330 | Ga0500627_0318400 | |||
| 4331 | Ga0500636_0164114 | |||
| 4332 | Ga0500636_0302320 | |||
| 4333 | Ga0500611_018656 | |||
| 4334 | Ga0500645_051354 | |||
| 4335 | Ga0500645_103754 | |||
| 4336 | Ga0500596_005955 | |||
| 4337 | Ga0500587_044374 | |||
| 4338 | Ga0501084_0020392 | |||
| 4339 | Ga0501084_0416242 | |||
| 4340 | Ga0501084_0508209 | |||
| 4341 | Ga0501084_0841112 | |||
| 4342 | Ga0501084_1196443 | |||
| 4343 | Ga0501082_0379787 | |||
| 4344 | Ga0501082_0798703 | |||
| 4345 | Ga0501082_0914199 | |||
| 4346 | Ga0466962_0114097 | |||
| 4347 | Ga0530510_0138411 | |||
| 4348 | Ga0530510_0180204 | |||
| 4349 | Ga0530510_0843003 | |||
| 4350 | 2510893835 | |||
| 4351 | 2513577259 | |||
| 4352 | 2513581453 | |||
| 4353 | 2513707018 | |||
| 4354 | 2513720658 | |||
| 4355 | 2513930638 | |||
| 4356 | 2585169661 | |||
| 4357 | 2599336066 | |||
| 4358 | 2599722235 | |||
| 4359 | 2617380036 | |||
| 4360 | 2644191438 | |||
| 4361 | 2644493881 | |||
| 4362 | 2719383372 | |||
| 4363 | 2719383454 | |||
| 4364 | 2719383536 | |||
| 4365 | 2719383582 | |||
| 4366 | 2719383689 | |||
| 4367 | 2719384468 | |||
| 4368 | 2721399385 | |||
| 4369 | 2724038198 | |||
| 4370 | 2738723763 | |||
| 4371 | 2739037615 | |||
| 4372 | 2739284494 | |||
| 4373 | 2748017038 | |||
| 4374 | 2748017498 | |||
| 4375 | 2753461395 | |||
| 4376 | 2766063961 | |||
| 4377 | 2776266503 | |||
| 4378 | 2776268344 | |||
| 4379 | 2793331764 | |||
| 4380 | 2824618783 | |||
| 4381 | 2824628889 | |||
| 4382 | 2824638400 | |||
| 4383 | 2824647582 | |||
| 4384 | 2824717702 | |||
| 4385 | 2824725991 | |||
| 4386 | 2842083805 | |||
| 4387 | 2842211484 | |||
| 4388 | 2842284938 | |||
| 4389 | 2842311084 | |||
| 4390 | 2842316309 | |||
| 4391 | 2842402383 | |||
| 4392 | 2842454507 | |||
| 4393 | 2842927522 | |||
| 4394 | 2854911494 | |||
| 4395 | 2857533423 | |||
| 4396 | 2881369912 | |||
| 4397 | 2885197662 | |||
| 4398 | 2885371719 | |||
| 4399 | 2885375810 | |||
| 4400 | 2894238267 | |||
| 4401 | 2899849594 | |||
| 4402 | 2904480462 | |||
| 4403 | 2904482114 | |||
| 4404 | 2904483661 | |||
| 4405 | 2906614864 | |||
| 4406 | 2906615356 | |||
| 4407 | 2906615643 | |||
| 4408 | 2906618289 | |||
| 4409 | 2915651348 | |||
| 4410 | 2919124275 | |||
| 4411 | 2919124354 | |||
| 4412 | 2919679068 | |||
| 4413 | 2928972420 | |||
| 4414 | 3005451794 | |||
| 4415 | 8005276592 | |||
| 4416 | 8005276677 | |||
| 4417 | 8005276763 | |||
| 4418 | 8005276807 | |||
| 4419 | 8005276909 | |||
| 4420 | 8019648901 | |||
| 4421 | 8019687826 | |||
| 4422 | 8057881260 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8b4h-assembly1.cif.gz_D | ista transposase cleaved donor complex | 0.8802 | 6 | 41 |
| 5af3-assembly1.cif.gz_B | x-ray crystal structure of rv2018 from mycobacterium tuberculosis | 0.8418 | 10 | 41 |
| 5af3-assembly1.cif.gz_A | x-ray crystal structure of rv2018 from mycobacterium tuberculosis | 0.8407 | 10 | 41 |
| 1ijw-assembly1.cif.gz_C | testing the water-mediated hin recombinase dna recognition by systematic mutations. | 0.8351 | 1 | 41 |
| 2elh-assembly1.cif.gz_A | solution structure of the cenp-b n-terminal dna-binding domain of fruit fly distal antenna cg11849-pa | 0.8335 | 1 | 44 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jkpC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8339 | 1 | 41 | 1.10.10.60 |
| 2elhA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8335 | 1 | 44 | 1.10.10.10 |
| 2w48B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8334 | 11 | 45 | 1.10.10.60 |
| 3ulqB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8221 | 11 | 44 | 1.10.10.10 |
| 1jkoC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8137 | 1 | 41 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0N1N5S2-F1-model_v4 | Transposase | 0.997 | 1 | 51 |
GO:0003677
GO:0004803 GO:0006313 GO:0015074 |
| AF-A0A2N6DDG8-F1-model_v4 | IS3 family transposase | 0.9937 | 1 | 83 |
GO:0003677
GO:0004803 GO:0006313 GO:0015074 |
| AF-A0A7X5G1Z3-F1-model_v4 | deleted | 0.99 | 3 | 58 |
|
| AF-A0A2W5DZ96-F1-model_v4 | deleted | 0.989 | 1 | 82 |
|
| AF-A3X0K3-F1-model_v4 | Transposase | 0.9889 | 1 | 83 |
GO:0003677
GO:0004803 GO:0006313 |