F496552

General Info

Members Datasets Scaffolds Average Seq Length
2211 710 4422 88

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_11851723|Ga0105248_118517232
Length 103
Sequence MMTSKSGFAKNLEDEVKKARFSEQQIIEIPKLAEAGTKVADLCRKHGISQWTFYQWRNKYGGMGVNEAKRLKELQEENRRLKKSVADQAFDVSALKEALHRKW

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
146 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
147 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
148 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
149 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
150 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
151 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
152 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
153 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
157 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
168 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
170 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
171 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
172 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
174 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
175 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
176 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
177 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
178 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
179 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
188 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
191 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
261 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
263 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
270 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
271 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
272 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
273 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
274 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
275 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
276 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
277 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
282 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
283 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
284 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
285 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
286 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
287 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
288 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
289 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
290 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
291 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
292 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
293 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
294 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
295 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
296 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
297 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
298 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
299 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
300 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
301 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
302 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
303 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
304 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
305 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
306 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
307 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
308 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
309 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
310 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
311 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
312 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
313 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
314 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
315 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
316 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
317 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
318 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
319 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
320 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
321 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
322 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
323 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
324 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
325 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
326 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
327 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
328 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
329 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
330 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
331 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
332 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
333 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
334 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
335 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
336 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
337 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
338 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
339 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
340 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
341 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
342 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
343 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
344 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
345 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
346 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
347 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
348 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
349 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
350 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
351 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
352 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
353 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
354 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
355 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
356 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
357 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
358 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
359 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
360 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
361 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
362 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
363 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
364 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
365 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
366 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
367 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
368 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
369 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
370 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
371 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
372 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
373 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
374 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
375 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
376 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
377 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
378 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
379 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
380 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
381 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
382 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
383 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
384 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
385 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
386 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
387 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
388 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
389 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
390 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
391 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
392 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
393 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
394 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
395 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
396 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
397 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
398 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
399 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
400 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
401 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
402 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
403 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
404 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
405 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
406 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
407 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
408 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
409 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
410 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
411 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
412 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
413 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
414 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
415 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
416 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
417 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
418 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
419 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
420 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
421 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
422 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
423 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
424 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
425 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
426 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
427 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
428 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
429 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
430 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
431 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
432 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
433 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
434 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
435 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
436 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
437 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
438 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
439 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
440 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
441 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
442 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
443 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
444 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
445 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
446 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
447 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
448 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
449 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
450 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
451 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
452 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
453 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
454 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
455 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
456 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
457 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
458 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
459 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
460 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
461 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
462 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
463 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
464 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
465 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
466 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
467 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
468 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
469 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
470 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
471 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
472 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
473 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
474 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
475 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
476 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
477 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
478 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
479 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
480 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
481 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
482 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
483 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
484 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
485 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
486 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
487 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
488 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
489 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
490 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
491 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
492 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
493 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
494 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
495 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
496 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
497 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
498 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
499 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
500 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
501 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
502 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
503 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
504 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
505 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
506 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
507 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
508 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
509 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
510 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
511 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
512 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
513 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
514 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
515 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
516 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
517 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
518 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
519 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
520 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
521 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
522 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
523 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
524 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
525 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
526 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
527 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
528 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
529 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
530 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
531 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
532 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
533 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
534 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
535 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
536 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
537 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
538 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
539 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
540 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
541 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
542 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
543 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
544 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
545 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
546 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
547 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
548 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
549 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
550 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
551 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
552 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
553 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
554 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
555 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
556 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
557 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
558 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
559 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
560 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
561 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
562 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
563 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
564 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
565 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
566 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
567 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
568 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
569 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
570 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
571 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
572 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
573 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
574 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
575 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
576 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
577 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
578 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
579 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
580 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
581 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
582 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
583 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
584 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
585 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
586 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
587 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
588 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
589 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
590 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
591 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
592 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
593 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
594 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
595 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
596 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
597 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
598 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
599 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
600 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
601 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
602 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
603 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
604 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
605 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
606 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
607 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
608 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
609 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
610 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
611 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
612 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
613 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
614 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
615 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
616 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
617 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
618 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
619 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
620 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
621 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
622 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
623 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
624 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
625 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
626 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
627 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
628 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
629 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
630 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
631 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
632 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
633 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
634 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
635 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
636 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
637 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
638 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
639 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
640 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
641 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
642 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
643 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
644 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
645 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
646 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
647 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
648 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
649 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
650 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
651 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
652 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
653 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
654 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
655 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
656 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
657 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
658 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
659 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
660 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
661 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
662 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
663 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
664 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
665 2643221688 Rhizobium sp. Root482 Isolate Unclassified
666 2718217927 Rhizobium sp. N324 Isolate Nodule
667 2718218423 Rhizobium sp. N941 Isolate Nodule
668 2721755809 Rhizobium sp. N541 Isolate Nodule
669 2738541277 Variovorax sp. GV051 Isolate Unclassified
670 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
671 2738543019 Variovorax sp. GV040 Isolate Unclassified
672 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
673 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
674 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
675 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
676 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
677 2791355261 Rhizobium sp. J15 Isolate Nodule
678 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
679 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
680 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
681 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
682 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
683 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
684 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
685 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
686 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
687 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
688 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
689 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
690 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
691 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
692 2854911287 Brucella lupini LUP21 Isolate Unclassified
693 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
694 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
695 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
696 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
697 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
698 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
699 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
700 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
701 2906610324
702 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
703 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
704 2919675420 Luteimonas terrae 4099 Isolate Unclassified
705 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
706 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
707 8005275841 Rhizobium sp. N4311 Isolate Nodule
708 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
709 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
710 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.51
Metatranscriptomes 0.36
Isolates 3.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.12
Nodule 1.72
Rhizoplane 5.11
Rhizosphere 83.49
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_11851723 3300009177 Bacteria 685
2 CNAas_1002737 3300000532 Bacteria 1220
3 JGI24747J21853_1019306 3300001978 Bacteria 735
4 JGI24740J21852_10154184 3300001979 Bacteria 570
5 JGI24750J21931_1008344 3300002070 Bacteria 1316
6 JGI24750J21931_1049781 3300002070 Bacteria 652
7 JGI24748J21848_1007479 3300002074 Bacteria 1280
8 JGI24748J21848_1021846 3300002074 Bacteria 774
9 JGI24749J21850_1010864 3300002076 Bacteria 1278
10 JGI24749J21850_1045135 3300002076 Bacteria 650
11 JGI24744J21845_10026855 3300002077 Bacteria 1115
12 JGI24033J26618_1035970 3300002155 Bacteria 679
13 JGI24034J26672_10011309 3300002239 Bacteria 1336
14 JGI24742J22300_10015481 3300002244 Bacteria 1282
15 JGI24742J22300_10015711 3300002244 Bacteria 1274
16 JGI24751J29686_10099474 3300002459 Bacteria 607
17 JGI24751J29686_10101126 3300002459 Bacteria 602
18 JGI25150J39212_1015910 3300002774 Bacteria 1244
19 JGI25159J45721_1022579 3300002987 Bacteria 1160
20 rootH2_10023835 3300003320 Bacteria 11613
21 rootH2_10077013 3300003320 Bacteria 1067
22 rootL2_10232720 3300003322 Bacteria 7199
23 rootH1_10054396 3300003323 Bacteria 2203
24 rootH1_10156375 3300003323 Bacteria 5110
25 JGI25160J50197_1089346 3300003354 Bacteria 561
26 Ga0006562J51391_1021829 3300003578 Bacteria 1000
27 Ga0055526_1023784 3300003771 Bacteria 2032
28 Ga0055526_1029595 3300003771 Bacteria 1621
29 Ga0055537_1016604 3300003773 Bacteria 1240
30 Ga0055524_1071201 3300003775 Bacteria 669
31 Ga0055524_1071265 3300003775 Bacteria 669
32 Ga0055536_1059387 3300003781 Bacteria 798
33 Ga0055534_1017639 3300003784 Bacteria 1259
34 Ga0055528_1065723 3300003790 Bacteria 669
35 Ga0055528_1065782 3300003790 Bacteria 669
36 Ga0055530_10035639 3300003791 Bacteria 1260
37 Ga0058692_1001917 3300003856 Bacteria 7270
38 JGI25405J52794_10024828 3300003911 Bacteria 1226
39 Ga0065712_10780520 3300005290 Bacteria 518
40 Ga0065715_10015161 3300005293 Bacteria 3052
41 Ga0070658_10124014 3300005327 Bacteria 2149
42 Ga0070658_10858739 3300005327 Bacteria 789
43 Ga0070658_11107294 3300005327 Bacteria 689
44 Ga0070658_11608920 3300005327 Bacteria 563
45 Ga0070676_10051740 3300005328 Bacteria 2412
46 Ga0070676_10068180 3300005328 Bacteria 2129
47 Ga0070676_10154730 3300005328 Bacteria 1471
48 Ga0070676_10501380 3300005328 Bacteria 862
49 Ga0070676_10544907 3300005328 Bacteria 830
50 Ga0070676_11147935 3300005328 Bacteria 589
51 Ga0070683_100082772 3300005329 Bacteria 3006
52 Ga0070683_100282219 3300005329 Bacteria 1579
53 Ga0070683_100321487 3300005329 Bacteria 1473
54 Ga0070683_100395674 3300005329 Bacteria 1317
55 Ga0070683_100785927 3300005329 Bacteria 912
56 Ga0070683_101159199 3300005329 Bacteria 742
57 Ga0070683_101541339 3300005329 Bacteria 639
58 Ga0070690_100096765 3300005330 Bacteria 1951
59 Ga0070690_100108055 3300005330 Bacteria 1852
60 Ga0070690_100280899 3300005330 Bacteria 1188
61 Ga0070690_100355078 3300005330 Bacteria 1065
62 Ga0070690_100556223 3300005330 Bacteria 866
63 Ga0070690_101393984 3300005330 Bacteria 564
64 Ga0070690_101536822 3300005330 Bacteria 538
65 Ga0070670_100187330 3300005331 Bacteria 1797
66 Ga0070670_100225720 3300005331 Bacteria 1630
67 Ga0070670_100280892 3300005331 Bacteria 1454
68 Ga0070670_100422453 3300005331 Bacteria 1179
69 Ga0070670_101554017 3300005331 Unclassified 608
70 Ga0070670_101924988 3300005331 Bacteria 545
71 Ga0070677_10082651 3300005333 Bacteria 1378
72 Ga0070677_10096451 3300005333 Bacteria 1295
73 Ga0070677_10291468 3300005333 Bacteria 826
74 Ga0070677_10661396 3300005333 Bacteria 585
75 Ga0070677_10814696 3300005333 Bacteria 534
76 Ga0068869_100541730 3300005334 Bacteria 976
77 Ga0068869_101324623 3300005334 Bacteria 636
78 Ga0068869_101360188 3300005334 Bacteria 628
79 Ga0070666_10342575 3300005335 Bacteria 1068
80 Ga0070666_10422167 3300005335 Bacteria 960
81 Ga0070666_10561302 3300005335 Bacteria 831
82 Ga0070666_10749516 3300005335 Bacteria 718
83 Ga0070666_10949497 3300005335 Bacteria 637
84 Ga0070680_100246940 3300005336 Bacteria 1509
85 Ga0070680_100374091 3300005336 Bacteria 1212
86 Ga0070680_101531973 3300005336 Bacteria 577
87 Ga0070682_100138542 3300005337 Bacteria 1656
88 Ga0070682_100186969 3300005337 Bacteria 1452
89 Ga0070682_100303170 3300005337 Bacteria 1173
90 Ga0070682_100389439 3300005337 Bacteria 1051
91 Ga0070682_100511241 3300005337 Bacteria 932
92 Ga0070682_100910926 3300005337 Bacteria 723
93 Ga0070682_101129308 3300005337 Bacteria 658
94 Ga0068868_100239665 3300005338 Bacteria 1523
95 Ga0068868_100438758 3300005338 Bacteria 1133
96 Ga0068868_101104804 3300005338 Bacteria 730
97 Ga0070660_100138296 3300005339 Bacteria 1952
98 Ga0070660_100226383 3300005339 Bacteria 1521
99 Ga0070660_100255987 3300005339 Bacteria 1428
100 Ga0070660_100281025 3300005339 Bacteria 1362
101 Ga0070660_101018482 3300005339 Bacteria 700
102 Ga0070689_100131776 3300005340 Bacteria 2005
103 Ga0070689_100182518 3300005340 Bacteria 1705
104 Ga0070689_100237098 3300005340 Bacteria 1501
105 Ga0070689_100263329 3300005340 Bacteria 1425
106 Ga0070689_100307645 3300005340 Bacteria 1321
107 Ga0070691_10087471 3300005341 Bacteria 1532
108 Ga0070691_10548290 3300005341 Bacteria 675
109 Ga0070691_10775764 3300005341 Bacteria 582
110 Ga0070687_100154356 3300005343 Bacteria 1351
111 Ga0070687_100215447 3300005343 Bacteria 1173
112 Ga0070687_100246019 3300005343 Bacteria 1108
113 Ga0070687_100834874 3300005343 Bacteria 656
114 Ga0070661_100215295 3300005344 Bacteria 1472
115 Ga0070661_100428724 3300005344 Bacteria 1049
116 Ga0070661_101393085 3300005344 Bacteria 590
117 Ga0070692_11256858 3300005345 Bacteria 529
118 Ga0070668_100036900 3300005347 Bacteria 3730
119 Ga0070668_100202767 3300005347 Bacteria 1629
120 Ga0070668_100223535 3300005347 Bacteria 1554
121 Ga0070668_100432266 3300005347 Bacteria 1129
122 Ga0070668_100622872 3300005347 Bacteria 946
123 Ga0070668_100710920 3300005347 Bacteria 887
124 Ga0070668_100939626 3300005347 Bacteria 775
125 Ga0070668_101563063 3300005347 Bacteria 604
126 Ga0070668_101824250 3300005347 Unclassified 559
127 Ga0070669_100139543 3300005353 Bacteria 1867
128 Ga0070669_100264300 3300005353 Bacteria 1374
129 Ga0070669_100800123 3300005353 Bacteria 801
130 Ga0070669_101880248 3300005353 Bacteria 523
131 Ga0070675_100257815 3300005354 Bacteria 1527
132 Ga0070675_100441898 3300005354 Bacteria 1165
133 Ga0070675_100886082 3300005354 Bacteria 817
134 Ga0070675_101004375 3300005354 Bacteria 766
135 Ga0070675_101416461 3300005354 Bacteria 641
136 Ga0070675_101612126 3300005354 Bacteria 599
137 Ga0070675_101801909 3300005354 Bacteria 565
138 Ga0070671_100155121 3300005355 Bacteria 1934
139 Ga0070671_100159025 3300005355 Bacteria 1909
140 Ga0070671_101369437 3300005355 Bacteria 625
141 Ga0070671_101739141 3300005355 Bacteria 554
142 Ga0070674_100178188 3300005356 Bacteria 1626
143 Ga0070674_100211510 3300005356 Bacteria 1503
144 Ga0070674_100269575 3300005356 Bacteria 1345
145 Ga0070674_100280377 3300005356 Bacteria 1321
146 Ga0070674_100284263 3300005356 Bacteria 1312
147 Ga0070674_100992231 3300005356 Bacteria 736
148 Ga0070674_101829734 3300005356 Bacteria 551
149 Ga0070673_100218792 3300005364 Bacteria 1647
150 Ga0070673_100249840 3300005364 Bacteria 1545
151 Ga0070673_100695017 3300005364 Bacteria 934
152 Ga0070673_100981672 3300005364 Bacteria 786
153 Ga0070688_100059557 3300005365 Bacteria 2408
154 Ga0070688_100238065 3300005365 Bacteria 1290
155 Ga0070688_100321332 3300005365 Bacteria 1125
156 Ga0070688_100369152 3300005365 Bacteria 1055
157 Ga0070688_101665974 3300005365 Bacteria 522
158 Ga0070659_100291239 3300005366 Bacteria 1360
159 Ga0070659_100315096 3300005366 Bacteria 1307
160 Ga0070659_100414742 3300005366 Bacteria 1138
161 Ga0070659_101375429 3300005366 Bacteria 627
162 Ga0070667_100056812 3300005367 Bacteria 3306
163 Ga0070667_100394719 3300005367 Bacteria 1258
164 Ga0070667_100817664 3300005367 Bacteria 865
165 Ga0070667_100869401 3300005367 Bacteria 839
166 Ga0070703_10050110 3300005406 Bacteria 1332
167 Ga0070709_10007373 3300005434 Bacteria 6026
168 Ga0070709_10183406 3300005434 Bacteria 1471
169 Ga0070709_10211288 3300005434 Bacteria 1379
170 Ga0070709_10480528 3300005434 Bacteria 941
171 Ga0070709_10989269 3300005434 Bacteria 669
172 Ga0070709_11005027 3300005434 Bacteria 664
173 Ga0070709_11514537 3300005434 Bacteria 545
174 Ga0070714_100039508 3300005435 Bacteria 3973
175 Ga0070714_100103084 3300005435 Bacteria 2516
176 Ga0070714_100214295 3300005435 Bacteria 1767
177 Ga0070714_100278380 3300005435 Bacteria 1554
178 Ga0070714_100321287 3300005435 Bacteria 1447
179 Ga0070714_100345328 3300005435 Bacteria 1397
180 Ga0070714_100350934 3300005435 Bacteria 1385
181 Ga0070714_100354790 3300005435 Bacteria 1378
182 Ga0070714_101002269 3300005435 Bacteria 813
183 Ga0070714_101192174 3300005435 Bacteria 743
184 Ga0070714_101322109 3300005435 Bacteria 704
185 Ga0070714_102114060 3300005435 Bacteria 549
186 Ga0070714_102200768 3300005435 Bacteria 537
187 Ga0070713_100253604 3300005436 Bacteria 1605
188 Ga0070713_100262123 3300005436 Bacteria 1580
189 Ga0070713_100264595 3300005436 Bacteria 1573
190 Ga0070713_100374415 3300005436 Bacteria 1325
191 Ga0070713_100375535 3300005436 Bacteria 1323
192 Ga0070713_100483323 3300005436 Bacteria 1167
193 Ga0070713_100570730 3300005436 Bacteria 1073
194 Ga0070713_100787429 3300005436 Bacteria 911
195 Ga0070713_101095290 3300005436 Bacteria 770
196 Ga0070713_101121674 3300005436 Bacteria 760
197 Ga0070713_101210100 3300005436 Unclassified 731
198 Ga0070713_101222213 3300005436 Bacteria 727
199 Ga0070713_101748095 3300005436 Bacteria 604
200 Ga0070713_102120998 3300005436 Unclassified 545
201 Ga0070710_10042070 3300005437 Bacteria 2525
202 Ga0070710_10099555 3300005437 Bacteria 1729
203 Ga0070710_10152482 3300005437 Bacteria 1426
204 Ga0070710_10225805 3300005437 Bacteria 1193
205 Ga0070710_10618977 3300005437 Bacteria 755
206 Ga0070710_11101183 3300005437 Unclassified 583
207 Ga0070701_10031901 3300005438 Bacteria 2618
208 Ga0070701_11352137 3300005438 Bacteria 511
209 Ga0070711_100135248 3300005439 Bacteria 1841
210 Ga0070711_100259873 3300005439 Bacteria 1365
211 Ga0070711_100361775 3300005439 Bacteria 1169
212 Ga0070711_100534772 3300005439 Bacteria 970
213 Ga0070711_100728846 3300005439 Bacteria 836
214 Ga0070711_101076548 3300005439 Bacteria 692
215 Ga0070711_101366900 3300005439 Unclassified 616
216 Ga0070711_101784635 3300005439 Bacteria 540
217 Ga0070705_100530233 3300005440 Bacteria 899
218 Ga0070700_100093317 3300005441 Bacteria 1968
219 Ga0070700_100211477 3300005441 Bacteria 1369
220 Ga0070700_100256618 3300005441 Bacteria 1257
221 Ga0070700_100393429 3300005441 Bacteria 1040
222 Ga0070694_100270217 3300005444 Bacteria 1293
223 Ga0070694_100315366 3300005444 Bacteria 1202
224 Ga0070708_100221416 3300005445 Bacteria 1775
225 Ga0070708_100485897 3300005445 Bacteria 1165
226 Ga0070708_101029774 3300005445 Bacteria 772
227 Ga0070708_101368530 3300005445 Bacteria 660
228 Ga0070708_101620701 3300005445 Bacteria 602
229 Ga0070663_100062297 3300005455 Bacteria 2688
230 Ga0070663_100194381 3300005455 Bacteria 1581
231 Ga0070663_100224723 3300005455 Bacteria 1475
232 Ga0070663_100275601 3300005455 Bacteria 1339
233 Ga0070663_100357689 3300005455 Bacteria 1184
234 Ga0070663_100381793 3300005455 Bacteria 1148
235 Ga0070663_100558775 3300005455 Bacteria 957
236 Ga0070663_101009936 3300005455 Bacteria 724
237 Ga0070663_101230295 3300005455 Unclassified 659
238 Ga0070663_101750475 3300005455 Bacteria 556
239 Ga0070678_100067725 3300005456 Bacteria 2658
240 Ga0070678_100163166 3300005456 Bacteria 1808
241 Ga0070678_100238069 3300005456 Bacteria 1520
242 Ga0070678_100360294 3300005456 Bacteria 1253
243 Ga0070678_100472704 3300005456 Bacteria 1102
244 Ga0070678_100984417 3300005456 Bacteria 774
245 Ga0070662_100164042 3300005457 Bacteria 1740
246 Ga0070662_100227482 3300005457 Bacteria 1491
247 Ga0070662_100313889 3300005457 Bacteria 1277
248 Ga0070662_100352041 3300005457 Bacteria 1207
249 Ga0070662_100471016 3300005457 Bacteria 1045
250 Ga0070662_100939296 3300005457 Bacteria 739
251 Ga0070681_10064911 3300005458 Bacteria 3621
252 Ga0070681_10218494 3300005458 Bacteria 1822
253 Ga0070681_10231301 3300005458 Bacteria 1763
254 Ga0070681_10249129 3300005458 Bacteria 1689
255 Ga0070681_10290308 3300005458 Bacteria 1545
256 Ga0070681_10584768 3300005458 Bacteria 1031
257 Ga0070681_11005594 3300005458 Bacteria 754
258 Ga0068867_100159997 3300005459 Bacteria 1775
259 Ga0068867_100164031 3300005459 Bacteria 1754
260 Ga0068867_100327321 3300005459 Bacteria 1271
261 Ga0068867_100732032 3300005459 Bacteria 876
262 Ga0068867_101511345 3300005459 Bacteria 625
263 Ga0068867_102278151 3300005459 Bacteria 515
264 Ga0070685_10108330 3300005466 Bacteria 1707
265 Ga0070685_10311014 3300005466 Bacteria 1065
266 Ga0070685_10914670 3300005466 Bacteria 654
267 Ga0070706_100061903 3300005467 Bacteria 3457
268 Ga0070706_100448732 3300005467 Bacteria 1200
269 Ga0070706_101340202 3300005467 Bacteria 656
270 Ga0070707_100212441 3300005468 Bacteria 1885
271 Ga0070707_100310197 3300005468 Bacteria 1533
272 Ga0070707_100489432 3300005468 Bacteria 1191
273 Ga0070698_100126881 3300005471 Bacteria 2508
274 Ga0070698_100294574 3300005471 Bacteria 1554
275 Ga0070698_100299611 3300005471 Bacteria 1538
276 Ga0070698_100380620 3300005471 Bacteria 1344
277 Ga0070698_101714401 3300005471 Bacteria 581
278 Ga0070699_100083325 3300005518 Bacteria 2789
279 Ga0070699_100385025 3300005518 Unclassified 1266
280 Ga0070699_100813820 3300005518 Bacteria 855
281 Ga0070699_101052286 3300005518 Bacteria 746
282 Ga0070699_101214851 3300005518 Bacteria 691
283 Ga0070679_100015955 3300005530 Bacteria 7232
284 Ga0070679_100325124 3300005530 Bacteria 1487
285 Ga0070679_101583424 3300005530 Bacteria 603
286 Ga0070684_100334507 3300005535 Bacteria 1392
287 Ga0070684_100429803 3300005535 Bacteria 1219
288 Ga0070684_100662915 3300005535 Bacteria 972
289 Ga0070684_101362088 3300005535 Unclassified 668
290 Ga0070684_101536390 3300005535 Bacteria 628
291 Ga0070684_101862982 3300005535 Bacteria 568
292 Ga0070684_102197908 3300005535 Bacteria 521
293 Ga0070684_102330390 3300005535 Bacteria 505
294 Ga0070697_100143250 3300005536 Bacteria 2011
295 Ga0070697_100186018 3300005536 Bacteria 1761
296 Ga0070697_100344910 3300005536 Bacteria 1285
297 Ga0070697_100449806 3300005536 Bacteria 1122
298 Ga0068853_100253025 3300005539 Bacteria 1617
299 Ga0068853_100300369 3300005539 Bacteria 1484
300 Ga0068853_100338471 3300005539 Bacteria 1398
301 Ga0068853_100403701 3300005539 Bacteria 1279
302 Ga0068853_100537465 3300005539 Bacteria 1106
303 Ga0068853_100610392 3300005539 Bacteria 1036
304 Ga0068853_101981645 3300005539 Bacteria 565
305 Ga0070672_100182458 3300005543 Bacteria 1749
306 Ga0070672_100187632 3300005543 Bacteria 1725
307 Ga0070672_100190547 3300005543 Bacteria 1712
308 Ga0070672_100209362 3300005543 Bacteria 1633
309 Ga0070672_100234742 3300005543 Bacteria 1541
310 Ga0070672_100359123 3300005543 Bacteria 1243
311 Ga0070672_100862265 3300005543 Bacteria 799
312 Ga0070672_102088004 3300005543 Bacteria 511
313 Ga0070686_100094323 3300005544 Bacteria 2008
314 Ga0070686_100239382 3300005544 Bacteria 1320
315 Ga0070686_100243742 3300005544 Bacteria 1310
316 Ga0070686_100317851 3300005544 Bacteria 1160
317 Ga0070686_100342371 3300005544 Bacteria 1121
318 Ga0070686_100678797 3300005544 Bacteria 819
319 Ga0070686_101740701 3300005544 Bacteria 530
320 Ga0070695_100178255 3300005545 Bacteria 1504
321 Ga0070696_101015122 3300005546 Bacteria 694
322 Ga0070696_101518869 3300005546 Bacteria 574
323 Ga0070693_100146738 3300005547 Bacteria 1490
324 Ga0070693_101405532 3300005547 Bacteria 543
325 Ga0070665_100031069 3300005548 Bacteria 5375
326 Ga0070665_100272951 3300005548 Bacteria 1693
327 Ga0070665_100319662 3300005548 Bacteria 1556
328 Ga0070665_100486099 3300005548 Bacteria 1245
329 Ga0070665_100675686 3300005548 Bacteria 1046
330 Ga0070665_100740737 3300005548 Bacteria 996
331 Ga0070665_101868720 3300005548 Bacteria 607
332 Ga0070665_102063509 3300005548 Bacteria 575
333 Ga0070704_100133025 3300005549 Bacteria 1931
334 Ga0070704_100383689 3300005549 Bacteria 1194
335 Ga0070704_100823641 3300005549 Bacteria 831
336 Ga0070704_101774355 3300005549 Bacteria 571
337 Ga0068855_100051034 3300005563 Bacteria 4873
338 Ga0068855_100500011 3300005563 Bacteria 1321
339 Ga0068855_100694257 3300005563 Bacteria 1090
340 Ga0068855_101241199 3300005563 Bacteria 773
341 Ga0068855_102485872 3300005563 Bacteria 515
342 Ga0070664_100050384 3300005564 Bacteria 3523
343 Ga0070664_100092878 3300005564 Bacteria 2614
344 Ga0070664_101120037 3300005564 Bacteria 742
345 Ga0070664_101491894 3300005564 Bacteria 640
346 Ga0070664_101837897 3300005564 Bacteria 575
347 Ga0070664_102017298 3300005564 Bacteria 547
348 Ga0070664_102367342 3300005564 Bacteria 504
349 Ga0068857_101089966 3300005577 Bacteria 771
350 Ga0068857_101184017 3300005577 Bacteria 740
351 Ga0068857_101189980 3300005577 Bacteria 738
352 Ga0068857_101729938 3300005577 Bacteria 611
353 Ga0068854_100043543 3300005578 Bacteria 3183
354 Ga0068854_100187797 3300005578 Bacteria 1618
355 Ga0068854_101455686 3300005578 Bacteria 621
356 Ga0068854_102200645 3300005578 Bacteria 510
357 Ga0068856_100085585 3300005614 Bacteria 3132
358 Ga0068856_100203240 3300005614 Bacteria 1996
359 Ga0068856_100313694 3300005614 Bacteria 1586
360 Ga0068856_100319130 3300005614 Bacteria 1571
361 Ga0068856_100493371 3300005614 Bacteria 1245
362 Ga0068856_100897353 3300005614 Bacteria 905
363 Ga0068856_101008967 3300005614 Unclassified 851
364 Ga0068856_101061294 3300005614 Bacteria 828
365 Ga0068856_101397130 3300005614 Bacteria 715
366 Ga0068856_101698958 3300005614 Bacteria 644
367 Ga0068856_101946195 3300005614 Bacteria 599
368 Ga0068856_102170796 3300005614 Bacteria 564
369 Ga0068856_102240363 3300005614 Bacteria 555
370 Ga0070702_100122363 3300005615 Bacteria 1631
371 Ga0070702_100135966 3300005615 Bacteria 1559
372 Ga0070702_100206725 3300005615 Bacteria 1303
373 Ga0070702_100449184 3300005615 Bacteria 935
374 Ga0070702_100649177 3300005615 Bacteria 798
375 Ga0070702_101587332 3300005615 Bacteria 541
376 Ga0068852_100507673 3300005616 Bacteria 1201
377 Ga0068852_100707716 3300005616 Bacteria 1018
378 Ga0068852_100812394 3300005616 Bacteria 949
379 Ga0068859_100475036 3300005617 Bacteria 1346
380 Ga0068859_100526729 3300005617 Bacteria 1277
381 Ga0068859_101242091 3300005617 Bacteria 821
382 Ga0068864_100310363 3300005618 Bacteria 1479
383 Ga0068864_100342258 3300005618 Bacteria 1409
384 Ga0068864_100708233 3300005618 Bacteria 984
385 Ga0068864_101001942 3300005618 Bacteria 829
386 Ga0068864_101360730 3300005618 Bacteria 711
387 Ga0068866_10064864 3300005718 Bacteria 1908
388 Ga0068866_10077897 3300005718 Bacteria 1772
389 Ga0068866_10167903 3300005718 Bacteria 1286
390 Ga0068866_10602677 3300005718 Bacteria 742
391 Ga0068866_10717140 3300005718 Bacteria 687
392 Ga0068861_100265764 3300005719 Bacteria 1471
393 Ga0068861_100286171 3300005719 Bacteria 1421
394 Ga0068861_100447604 3300005719 Bacteria 1157
395 Ga0068870_10126480 3300005840 Bacteria 1479
396 Ga0068870_11409466 3300005840 Bacteria 511
397 Ga0068863_100277736 3300005841 Bacteria 1622
398 Ga0068863_100342412 3300005841 Bacteria 1455
399 Ga0068863_100393305 3300005841 Bacteria 1355
400 Ga0068863_102444477 3300005841 Bacteria 532
401 Ga0068858_100130658 3300005842 Bacteria 2355
402 Ga0068858_100220190 3300005842 Bacteria 1797
403 Ga0068858_100320711 3300005842 Bacteria 1481
404 Ga0068858_100472340 3300005842 Bacteria 1210
405 Ga0068860_100168570 3300005843 Bacteria 2115
406 Ga0068860_100371272 3300005843 Bacteria 1411
407 Ga0068860_100449053 3300005843 Bacteria 1282
408 Ga0068860_102792641 3300005843 Bacteria 506
409 Ga0068862_100805172 3300005844 Bacteria 918
410 Ga0068862_101738404 3300005844 Unclassified 632
411 Ga0068862_101869816 3300005844 Bacteria 610
412 Ga0081455_10046286 3300005937 Bacteria 3776
413 Ga0081455_10250741 3300005937 Bacteria 1295
414 Ga0081540_1017006 3300005983 Bacteria 4521
415 Ga0081540_1074102 3300005983 Bacteria 1561
416 Ga0081540_1086022 3300005983 Bacteria 1398
417 Ga0081539_10114267 3300005985 Bacteria 1353
418 Ga0070717_10213997 3300006028 Bacteria 1692
419 Ga0070717_10221698 3300006028 Bacteria 1662
420 Ga0070717_10256053 3300006028 Bacteria 1547
421 Ga0070717_10367959 3300006028 Bacteria 1288
422 Ga0070717_10417560 3300006028 Bacteria 1207
423 Ga0070717_10421593 3300006028 Bacteria 1200
424 Ga0070717_10495798 3300006028 Bacteria 1103
425 Ga0070717_11202727 3300006028 Bacteria 690
426 Ga0070717_11769542 3300006028 Bacteria 559
427 Ga0075365_10727129 3300006038 Bacteria 701
428 Ga0075368_10329634 3300006042 Bacteria 662
429 Ga0075368_10391967 3300006042 Bacteria 609
430 Ga0075368_10508771 3300006042 Bacteria 538
431 Ga0075364_10145535 3300006051 Bacteria 1595
432 Ga0070715_10031823 3300006163 Bacteria 2144
433 Ga0070715_10087313 3300006163 Bacteria 1428
434 Ga0070715_10131844 3300006163 Bacteria 1204
435 Ga0070715_10135376 3300006163 Bacteria 1190
436 Ga0070716_100130300 3300006173 Bacteria 1589
437 Ga0070716_100152675 3300006173 Bacteria 1487
438 Ga0070716_100165240 3300006173 Bacteria 1438
439 Ga0070716_100187164 3300006173 Bacteria 1365
440 Ga0070716_100240877 3300006173 Bacteria 1226
441 Ga0070716_101216022 3300006173 Bacteria 606
442 Ga0070716_101818830 3300006173 Bacteria 505
443 Ga0070712_100113774 3300006175 Bacteria 2024
444 Ga0070712_100124070 3300006175 Bacteria 1947
445 Ga0070712_100140936 3300006175 Bacteria 1840
446 Ga0070712_100196704 3300006175 Bacteria 1581
447 Ga0070712_100300126 3300006175 Bacteria 1300
448 Ga0070712_100362005 3300006175 Bacteria 1190
449 Ga0070712_100670037 3300006175 Bacteria 883
450 Ga0070712_101854711 3300006175 Unclassified 528
451 Ga0075362_10343762 3300006177 Bacteria 746
452 Ga0075366_10317694 3300006195 Bacteria 954
453 Ga0075366_11028025 3300006195 Bacteria 514
454 Ga0097621_100165706 3300006237 Bacteria 1902
455 Ga0097621_100353795 3300006237 Bacteria 1307
456 Ga0097621_100509307 3300006237 Bacteria 1091
457 Ga0097621_101134455 3300006237 Bacteria 735
458 Ga0097621_101213405 3300006237 Bacteria 711
459 Ga0097621_101624450 3300006237 Bacteria 615
460 Ga0075370_10018351 3300006353 Bacteria 3796
461 Ga0075370_10398210 3300006353 Bacteria 826
462 Ga0075370_10479554 3300006353 Bacteria 750
463 Ga0068871_100223343 3300006358 Bacteria 1633
464 Ga0068871_100418847 3300006358 Bacteria 1196
465 Ga0068871_100503616 3300006358 Bacteria 1092
466 Ga0068871_100678043 3300006358 Bacteria 943
467 Ga0068871_100984709 3300006358 Bacteria 785
468 Ga0068871_101200222 3300006358 Bacteria 712
469 Ga0068871_101320802 3300006358 Bacteria 679
470 Ga0068871_101455426 3300006358 Bacteria 647
471 Ga0068871_102181991 3300006358 Bacteria 528
472 Ga0075431_100243693 3300006847 Bacteria 1828
473 Ga0075433_10211151 3300006852 Bacteria 1725
474 Ga0075434_100342412 3300006871 Bacteria 1516
475 Ga0075429_100291936 3300006880 Bacteria 1428
476 Ga0075429_101882346 3300006880 Unclassified 518
477 Ga0068865_100117360 3300006881 Bacteria 1972
478 Ga0068865_100147778 3300006881 Bacteria 1779
479 Ga0068865_100278151 3300006881 Bacteria 1331
480 Ga0068865_100337672 3300006881 Bacteria 1217
481 Ga0068865_101921967 3300006881 Unclassified 536
482 Ga0075436_100655350 3300006914 Bacteria 776
483 Ga0075436_100791819 3300006914 Bacteria 705
484 Ga0097620_100475015 3300006931 Bacteria 1346
485 Ga0097620_100526695 3300006931 Bacteria 1277
486 Ga0097620_101241979 3300006931 Bacteria 821
487 Ga0099824_1009340 3300006942 Bacteria 12111
488 Ga0099824_1016446 3300006942 Bacteria 6698
489 Ga0075435_100204931 3300007076 Bacteria 1672
490 Ga0075435_100743455 3300007076 Bacteria 853
491 Ga0075435_100972674 3300007076 Bacteria 741
492 Ga0099795_10058949 3300007788 Bacteria 1419
493 Ga0099795_10155021 3300007788 Bacteria 941
494 Ga0105251_10280255 3300009011 Bacteria 754
495 Ga0105250_10000799 3300009092 Bacteria 18969
496 Ga0105250_10385126 3300009092 Bacteria 619
497 Ga0105240_10005524 3300009093 Bacteria 18841
498 Ga0105240_10210513 3300009093 Bacteria 2272
499 Ga0105240_10318713 3300009093 Bacteria 1773
500 Ga0105240_10338378 3300009093 Bacteria 1710
501 Ga0105240_10537827 3300009093 Bacteria 1294
502 Ga0105240_10595819 3300009093 Bacteria 1217
503 Ga0105240_11860274 3300009093 Bacteria 627
504 Ga0105240_12489691 3300009093 Bacteria 535
505 Ga0111539_11092854 3300009094 Bacteria 927
506 Ga0111539_12530640 3300009094 Bacteria 595
507 Ga0111539_12566513 3300009094 Bacteria 591
508 Ga0105245_10162924 3300009098 Bacteria 2117
509 Ga0105245_10255495 3300009098 Bacteria 1704
510 Ga0105245_10264317 3300009098 Bacteria 1676
511 Ga0105245_10732320 3300009098 Bacteria 1024
512 Ga0105245_10873742 3300009098 Bacteria 940
513 Ga0105245_11170307 3300009098 Bacteria 816
514 Ga0105245_11539172 3300009098 Bacteria 716
515 Ga0105245_12935186 3300009098 Bacteria 529
516 Ga0105245_13045481 3300009098 Bacteria 519
517 Ga0105247_10080414 3300009101 Bacteria 2053
518 Ga0105247_10235613 3300009101 Bacteria 1245
519 Ga0105247_10741872 3300009101 Bacteria 743
520 Ga0105247_10982490 3300009101 Bacteria 658
521 Ga0105247_11534054 3300009101 Bacteria 544
522 Ga0105247_11672637 3300009101 Bacteria 525
523 Ga0105243_10211452 3300009148 Bacteria 1708
524 Ga0105243_10214752 3300009148 Bacteria 1696
525 Ga0105243_10227350 3300009148 Bacteria 1653
526 Ga0105243_11918131 3300009148 Bacteria 625
527 Ga0105241_10371674 3300009174 Bacteria 1247
528 Ga0105241_10450330 3300009174 Bacteria 1138
529 Ga0105241_10454709 3300009174 Bacteria 1133
530 Ga0105241_10591647 3300009174 Bacteria 1001
531 Ga0105241_11053265 3300009174 Bacteria 764
532 Ga0105241_11148391 3300009174 Bacteria 733
533 Ga0105241_11732412 3300009174 Bacteria 608
534 Ga0105241_11817377 3300009174 Bacteria 595
535 Ga0105241_12085585 3300009174 Bacteria 560
536 Ga0105241_12186897 3300009174 Bacteria 548
537 Ga0105241_12365259 3300009174 Bacteria 530
538 Ga0105242_10277795 3300009176 Bacteria 1520
539 Ga0105242_10342528 3300009176 Bacteria 1378
540 Ga0105242_10626926 3300009176 Bacteria 1042
541 Ga0105242_11212483 3300009176 Bacteria 774
542 Ga0105242_11536460 3300009176 Bacteria 697
543 Ga0105248_10250825 3300009177 Bacteria 1992
544 Ga0105248_10426812 3300009177 Bacteria 1493
545 Ga0105248_10539679 3300009177 Bacteria 1315
546 Ga0105248_11904624 3300009177 Bacteria 675
547 Ga0105237_10002325 3300009545 Bacteria 23594
548 Ga0105237_10077160 3300009545 Bacteria 3322
549 Ga0105237_10161389 3300009545 Bacteria 2240
550 Ga0105237_10228725 3300009545 Bacteria 1860
551 Ga0105237_10288352 3300009545 Bacteria 1644
552 Ga0105237_10313926 3300009545 Bacteria 1571
553 Ga0105237_10313963 3300009545 Bacteria 1571
554 Ga0105238_10001477 3300009551 Bacteria 23596
555 Ga0105238_10108713 3300009551 Bacteria 2754
556 Ga0105238_10169393 3300009551 Bacteria 2160
557 Ga0105238_10194298 3300009551 Bacteria 2005
558 Ga0105238_10241180 3300009551 Bacteria 1785
559 Ga0105238_10280974 3300009551 Bacteria 1646
560 Ga0105238_10308182 3300009551 Bacteria 1568
561 Ga0105238_10434339 3300009551 Bacteria 1309
562 Ga0105238_10988673 3300009551 Bacteria 862
563 Ga0105238_11867698 3300009551 Bacteria 633
564 Ga0105238_11889836 3300009551 Bacteria 630
565 Ga0105249_10279021 3300009553 Bacteria 1668
566 Ga0105249_11410582 3300009553 Bacteria 768
567 Ga0105249_13109832 3300009553 Bacteria 533
568 Ga0099796_10417279 3300010159 Bacteria 591
569 Ga0105239_10002458 3300010375 Bacteria 23596
570 Ga0105239_10148167 3300010375 Bacteria 2619
571 Ga0105239_10191792 3300010375 Bacteria 2287
572 Ga0105239_10237594 3300010375 Bacteria 2045
573 Ga0105239_10339523 3300010375 Bacteria 1695
574 Ga0105239_10403074 3300010375 Bacteria 1548
575 Ga0105239_10490795 3300010375 Bacteria 1396
576 Ga0105239_10937353 3300010375 Bacteria 994
577 Ga0105239_11058836 3300010375 Bacteria 933
578 Ga0105239_11528944 3300010375 Bacteria 771
579 Ga0105239_11709873 3300010375 Bacteria 728
580 Ga0105239_12204231 3300010375 Bacteria 641
581 Ga0105246_10164959 3300011119 Bacteria 1691
582 Ga0105246_10175189 3300011119 Bacteria 1646
583 Ga0105246_10216814 3300011119 Bacteria 1497
584 Ga0105246_10255355 3300011119 Bacteria 1393
585 Ga0105246_10380041 3300011119 Bacteria 1167
586 Ga0105246_10449422 3300011119 Bacteria 1083
587 Ga0105246_10470500 3300011119 Bacteria 1061
588 Ga0105246_10802564 3300011119 Bacteria 835
589 Ga0105246_10839763 3300011119 Bacteria 818
590 Ga0105246_11198592 3300011119 Bacteria 699
591 Ga0105246_11240966 3300011119 Bacteria 688
592 Ga0157346_1025154 3300012480 Bacteria 547
593 Ga0157343_1015045 3300012488 Bacteria 642
594 Ga0157313_1013363 3300012503 Bacteria 744
595 Ga0157324_1030636 3300012506 Unclassified 607
596 Ga0157342_1056773 3300012507 Bacteria 565
597 Ga0157326_1006887 3300012513 Unclassified 1221
598 Ga0157326_1010884 3300012513 Bacteria 1019
599 Ga0157338_1008242 3300012515 Bacteria 1007
600 Ga0157373_10228363 3300013100 Bacteria 1314
601 Ga0157373_10256574 3300013100 Bacteria 1237
602 Ga0157373_10538742 3300013100 Bacteria 846
603 Ga0157373_10543279 3300013100 Bacteria 842
604 Ga0157371_10142781 3300013102 Bacteria 1705
605 Ga0157371_10151617 3300013102 Bacteria 1653
606 Ga0157371_10647374 3300013102 Bacteria 788
607 Ga0157371_11129763 3300013102 Bacteria 602
608 Ga0157371_11183827 3300013102 Bacteria 588
609 Ga0157370_10003645 3300013104 Bacteria 18003
610 Ga0157370_10087500 3300013104 Bacteria 2926
611 Ga0157370_10137061 3300013104 Bacteria 2281
612 Ga0157370_10194609 3300013104 Bacteria 1882
613 Ga0157370_10218349 3300013104 Bacteria 1766
614 Ga0157370_10229388 3300013104 Bacteria 1719
615 Ga0157370_10392962 3300013104 Bacteria 1277
616 Ga0157370_11468934 3300013104 Bacteria 613
617 Ga0157369_10439753 3300013105 Bacteria 1351
618 Ga0157369_10683316 3300013105 Bacteria 1058
619 Ga0157369_10684448 3300013105 Bacteria 1056
620 Ga0157369_10928643 3300013105 Unclassified 892
621 Ga0157369_11167075 3300013105 Bacteria 786
622 Ga0157369_12455171 3300013105 Bacteria 528
623 Ga0157374_10205120 3300013296 Bacteria 1932
624 Ga0157374_10340397 3300013296 Bacteria 1489
625 Ga0157374_10402091 3300013296 Bacteria 1366
626 Ga0157374_10488770 3300013296 Bacteria 1234
627 Ga0157374_10492328 3300013296 Bacteria 1230
628 Ga0157374_12024923 3300013296 Bacteria 602
629 Ga0157374_12669957 3300013296 Bacteria 527
630 Ga0157378_10183104 3300013297 Bacteria 1972
631 Ga0157378_10248553 3300013297 Bacteria 1702
632 Ga0157378_10278317 3300013297 Bacteria 1612
633 Ga0157378_10538972 3300013297 Bacteria 1171
634 Ga0157378_12066705 3300013297 Bacteria 620
635 Ga0157378_12236339 3300013297 Bacteria 598
636 Ga0163162_10446629 3300013306 Bacteria 1425
637 Ga0163162_10490939 3300013306 Bacteria 1359
638 Ga0163162_10648610 3300013306 Bacteria 1179
639 Ga0163162_11516500 3300013306 Bacteria 764
640 Ga0163162_12557983 3300013306 Bacteria 587
641 Ga0157372_10096001 3300013307 Bacteria 3378
642 Ga0157372_10248543 3300013307 Bacteria 2064
643 Ga0157372_10285442 3300013307 Bacteria 1919
644 Ga0157372_11486835 3300013307 Unclassified 780
645 Ga0157372_11503054 3300013307 Bacteria 776
646 Ga0157372_12394250 3300013307 Bacteria 606
647 Ga0157375_10135124 3300013308 Bacteria 2589
648 Ga0157375_10279253 3300013308 Bacteria 1833
649 Ga0157375_10841589 3300013308 Bacteria 1064
650 Ga0157375_11548773 3300013308 Bacteria 783
651 Ga0157375_12765557 3300013308 Bacteria 587
652 Ga0157375_12772079 3300013308 Bacteria 586
653 Ga0157375_13329664 3300013308 Bacteria 535
654 Ga0163163_10305487 3300014325 Bacteria 1643
655 Ga0163163_10358160 3300014325 Bacteria 1515
656 Ga0163163_10420491 3300014325 Bacteria 1395
657 Ga0163163_10467213 3300014325 Bacteria 1322
658 Ga0163163_10840308 3300014325 Bacteria 982
659 Ga0163163_11432692 3300014325 Bacteria 752
660 Ga0163163_11553042 3300014325 Bacteria 723
661 Ga0157380_10152291 3300014326 Bacteria 2001
662 Ga0157380_10287587 3300014326 Bacteria 1508
663 Ga0157380_10837023 3300014326 Bacteria 941
664 Ga0157380_10909983 3300014326 Bacteria 906
665 Ga0157380_11205758 3300014326 Bacteria 801
666 Ga0157380_11544303 3300014326 Bacteria 718
667 Ga0157380_12020281 3300014326 Bacteria 638
668 Ga0182008_10058226 3300014497 Bacteria 1908
669 Ga0182008_10089955 3300014497 Bacteria 1513
670 Ga0182008_10094018 3300014497 Bacteria 1479
671 Ga0157377_10092504 3300014745 Bacteria 1788
672 Ga0157377_10157434 3300014745 Bacteria 1410
673 Ga0157377_10163505 3300014745 Bacteria 1386
674 Ga0157377_10333969 3300014745 Bacteria 1011
675 Ga0157379_10254372 3300014968 Bacteria 1595
676 Ga0157379_10364947 3300014968 Bacteria 1324
677 Ga0157379_10588349 3300014968 Bacteria 1038
678 Ga0157379_10818022 3300014968 Bacteria 880
679 Ga0157379_11852373 3300014968 Bacteria 594
680 Ga0157379_11921807 3300014968 Bacteria 583
681 Ga0157376_10158083 3300014969 Bacteria 2052
682 Ga0157376_10318166 3300014969 Bacteria 1479
683 Ga0157376_10457277 3300014969 Bacteria 1246
684 Ga0157376_11076190 3300014969 Bacteria 829
685 Ga0157376_12250386 3300014969 Bacteria 584
686 Ga0157376_12726615 3300014969 Bacteria 534
687 Ga0163161_10140339 3300017792 Bacteria 1830
688 Ga0163161_10200841 3300017792 Bacteria 1536
689 Ga0163161_10221297 3300017792 Bacteria 1466
690 Ga0163161_10229481 3300017792 Bacteria 1440
691 Ga0163161_11086041 3300017792 Bacteria 687
692 Ga0206353_10492261 3300020082 Bacteria 567
693 Ga0213874_10087750 3300021377 Bacteria 1017
694 Ga0213876_10151516 3300021384 Bacteria 1233
695 Ga0213875_10060072 3300021388 Bacteria 1778
696 Ga0213875_10079298 3300021388 Bacteria 1531
697 Ga0224712_10012275 3300022467 Unclassified 2689
698 Ga0224570_103029 3300022730 Bacteria 1084
699 Ga0224571_102319 3300022734 Bacteria 1211
700 Ga0224572_1022032 3300024225 Bacteria 1224
701 Ga0228598_1023645 3300024227 Bacteria 1209
702 Ga0207425_1001721 3300025245 Bacteria 8673
703 Ga0207425_1013102 3300025245 Bacteria 1924
704 Ga0209129_1000851 3300025258 Bacteria 19126
705 Ga0209129_1014578 3300025258 Bacteria 1668
706 Ga0209565_1024149 3300025263 Bacteria 1240
707 Ga0207666_1007976 3300025271 Bacteria 1406
708 Ga0209673_1000840 3300025273 Bacteria 40156
709 Ga0209673_1044027 3300025273 Bacteria 1240
710 Ga0209130_1026745 3300025284 Bacteria 1234
711 Ga0209675_1002336 3300025291 Bacteria 9791
712 Ga0209675_1031273 3300025291 Bacteria 1260
713 Ga0209676_1018913 3300025292 Bacteria 2386
714 Ga0209025_1002528 3300025294 Bacteria 19126
715 Ga0209025_1053563 3300025294 Bacteria 1581
716 Ga0209564_1040623 3300025295 Bacteria 1260
717 Ga0209758_1001161 3300025297 Bacteria 33607
718 Ga0209758_1001517 3300025297 Bacteria 26909
719 Ga0209050_1053254 3300025298 Bacteria 1007
720 Ga0209256_1000555 3300025299 Bacteria 53550
721 Ga0209256_1007286 3300025299 Bacteria 5512
722 Ga0207426_1003336 3300025302 Bacteria 8859
723 Ga0207426_1010449 3300025302 Bacteria 3599
724 Ga0207697_10042901 3300025315 Bacteria 1859
725 Ga0207697_10111556 3300025315 Bacteria 1171
726 Ga0207656_10504475 3300025321 Bacteria 614
727 Ga0207713_1181430 3300025735 Bacteria 657
728 Ga0207653_10035981 3300025885 Bacteria 1612
729 Ga0207682_10009832 3300025893 Bacteria 3762
730 Ga0207682_10094199 3300025893 Bacteria 1302
731 Ga0207682_10193832 3300025893 Bacteria 932
732 Ga0207692_10113333 3300025898 Bacteria 1507
733 Ga0207692_10139866 3300025898 Bacteria 1376
734 Ga0207692_10239028 3300025898 Bacteria 1084
735 Ga0207692_10569542 3300025898 Bacteria 725
736 Ga0207642_10133397 3300025899 Bacteria 1299
737 Ga0207642_10151695 3300025899 Bacteria 1234
738 Ga0207642_10368377 3300025899 Bacteria 852
739 Ga0207710_10107702 3300025900 Bacteria 1321
740 Ga0207710_10186777 3300025900 Bacteria 1019
741 Ga0207710_10263464 3300025900 Bacteria 864
742 Ga0207688_10003840 3300025901 Bacteria 8198
743 Ga0207688_10165826 3300025901 Bacteria 1311
744 Ga0207688_10290156 3300025901 Bacteria 998
745 Ga0207688_10395461 3300025901 Bacteria 857
746 Ga0207688_10418689 3300025901 Bacteria 832
747 Ga0207688_10504161 3300025901 Bacteria 758
748 Ga0207688_10598594 3300025901 Bacteria 695
749 Ga0207680_10209454 3300025903 Bacteria 1332
750 Ga0207680_10253007 3300025903 Bacteria 1217
751 Ga0207680_10626768 3300025903 Bacteria 769
752 Ga0207647_10504487 3300025904 Bacteria 674
753 Ga0207647_10507191 3300025904 Bacteria 672
754 Ga0207685_10058795 3300025905 Bacteria 1513
755 Ga0207685_10067957 3300025905 Bacteria 1434
756 Ga0207685_10346299 3300025905 Bacteria 748
757 Ga0207685_10374677 3300025905 Bacteria 724
758 Ga0207685_10410522 3300025905 Bacteria 696
759 Ga0207699_10212055 3300025906 Bacteria 1318
760 Ga0207699_10212691 3300025906 Bacteria 1316
761 Ga0207699_10266796 3300025906 Bacteria 1185
762 Ga0207699_10384311 3300025906 Bacteria 997
763 Ga0207699_10469182 3300025906 Bacteria 905
764 Ga0207699_11232896 3300025906 Bacteria 554
765 Ga0207699_11295175 3300025906 Bacteria 539
766 Ga0207645_10041875 3300025907 Bacteria 2931
767 Ga0207645_10067656 3300025907 Bacteria 2283
768 Ga0207645_10116851 3300025907 Bacteria 1730
769 Ga0207645_10130830 3300025907 Bacteria 1633
770 Ga0207645_10696626 3300025907 Bacteria 690
771 Ga0207643_10089119 3300025908 Bacteria 1796
772 Ga0207643_10463685 3300025908 Bacteria 807
773 Ga0207643_10867273 3300025908 Bacteria 585
774 Ga0207705_10562675 3300025909 Bacteria 886
775 Ga0207684_10139016 3300025910 Bacteria 2087
776 Ga0207684_10319531 3300025910 Bacteria 1338
777 Ga0207684_10803481 3300025910 Bacteria 795
778 Ga0207654_10211907 3300025911 Bacteria 1281
779 Ga0207654_10589266 3300025911 Bacteria 793
780 Ga0207654_10693515 3300025911 Bacteria 731
781 Ga0207654_10758071 3300025911 Bacteria 699
782 Ga0207654_10872713 3300025911 Bacteria 652
783 Ga0207707_10087924 3300025912 Bacteria 2715
784 Ga0207707_10281468 3300025912 Bacteria 1441
785 Ga0207707_10817660 3300025912 Bacteria 775
786 Ga0207707_10966096 3300025912 Bacteria 701
787 Ga0207707_11427353 3300025912 Bacteria 551
788 Ga0207695_10011275 3300025913 Bacteria 10836
789 Ga0207695_10337086 3300025913 Bacteria 1396
790 Ga0207695_10390859 3300025913 Bacteria 1276
791 Ga0207695_10892567 3300025913 Bacteria 769
792 Ga0207695_11411067 3300025913 Bacteria 577
793 Ga0207671_10002412 3300025914 Bacteria 20034
794 Ga0207671_10010604 3300025914 Bacteria 7587
795 Ga0207671_10017611 3300025914 Bacteria 5501
796 Ga0207671_10092670 3300025914 Bacteria 2278
797 Ga0207671_10253897 3300025914 Bacteria 1382
798 Ga0207671_10815258 3300025914 Bacteria 740
799 Ga0207671_10888639 3300025914 Bacteria 705
800 Ga0207671_11140280 3300025914 Bacteria 611
801 Ga0207693_10131667 3300025915 Bacteria 1966
802 Ga0207693_10152032 3300025915 Bacteria 1821
803 Ga0207693_10172712 3300025915 Bacteria 1701
804 Ga0207693_10211500 3300025915 Bacteria 1524
805 Ga0207693_10264723 3300025915 Bacteria 1348
806 Ga0207693_10289764 3300025915 Bacteria 1283
807 Ga0207663_10140759 3300025916 Bacteria 1680
808 Ga0207663_10176665 3300025916 Bacteria 1521
809 Ga0207663_10179633 3300025916 Bacteria 1510
810 Ga0207663_10270157 3300025916 Bacteria 1259
811 Ga0207663_10277228 3300025916 Bacteria 1244
812 Ga0207663_10284567 3300025916 Bacteria 1229
813 Ga0207663_10288778 3300025916 Bacteria 1221
814 Ga0207663_10710473 3300025916 Bacteria 796
815 Ga0207660_10254332 3300025917 Bacteria 1387
816 Ga0207660_10763277 3300025917 Bacteria 789
817 Ga0207662_10102725 3300025918 Bacteria 1773
818 Ga0207662_10142809 3300025918 Bacteria 1517
819 Ga0207662_10299572 3300025918 Bacteria 1068
820 Ga0207662_10517515 3300025918 Bacteria 823
821 Ga0207657_10204864 3300025919 Bacteria 1585
822 Ga0207657_10222470 3300025919 Bacteria 1512
823 Ga0207657_10260248 3300025919 Bacteria 1381
824 Ga0207657_10305613 3300025919 Bacteria 1259
825 Ga0207657_10413884 3300025919 Bacteria 1060
826 Ga0207657_11265032 3300025919 Bacteria 559
827 Ga0207649_10260032 3300025920 Bacteria 1254
828 Ga0207649_10319870 3300025920 Bacteria 1140
829 Ga0207649_10470202 3300025920 Bacteria 952
830 Ga0207652_10056697 3300025921 Bacteria 3373
831 Ga0207652_10372605 3300025921 Bacteria 1289
832 Ga0207652_10396381 3300025921 Bacteria 1246
833 Ga0207652_10407288 3300025921 Bacteria 1227
834 Ga0207652_10661110 3300025921 Bacteria 934
835 Ga0207652_10666606 3300025921 Bacteria 930
836 Ga0207652_10919769 3300025921 Bacteria 772
837 Ga0207652_11729162 3300025921 Bacteria 530
838 Ga0207646_10330389 3300025922 Unclassified 1377
839 Ga0207646_10400095 3300025922 Bacteria 1240
840 Ga0207646_10546967 3300025922 Bacteria 1041
841 Ga0207681_10160831 3300025923 Bacteria 1692
842 Ga0207681_10291784 3300025923 Bacteria 1287
843 Ga0207681_10940650 3300025923 Bacteria 724
844 Ga0207694_10000851 3300025924 Bacteria 27152
845 Ga0207694_10147646 3300025924 Bacteria 1893
846 Ga0207694_10153299 3300025924 Bacteria 1857
847 Ga0207694_10205127 3300025924 Bacteria 1605
848 Ga0207694_10284265 3300025924 Bacteria 1359
849 Ga0207694_10298116 3300025924 Bacteria 1327
850 Ga0207694_10409025 3300025924 Bacteria 1129
851 Ga0207694_10878642 3300025924 Bacteria 758
852 Ga0207694_11339674 3300025924 Bacteria 605
853 Ga0207650_10297956 3300025925 Bacteria 1316
854 Ga0207650_10324024 3300025925 Bacteria 1262
855 Ga0207650_11236417 3300025925 Bacteria 636
856 Ga0207659_10171827 3300025926 Bacteria 1710
857 Ga0207659_10267539 3300025926 Bacteria 1393
858 Ga0207659_10516471 3300025926 Bacteria 1012
859 Ga0207659_10898641 3300025926 Bacteria 761
860 Ga0207659_11086915 3300025926 Bacteria 688
861 Ga0207687_10257203 3300025927 Bacteria 1391
862 Ga0207687_10330903 3300025927 Bacteria 1236
863 Ga0207687_11323095 3300025927 Bacteria 619
864 Ga0207687_11337395 3300025927 Bacteria 616
865 Ga0207687_11622563 3300025927 Bacteria 555
866 Ga0207700_10201475 3300025928 Bacteria 1677
867 Ga0207700_10207089 3300025928 Bacteria 1656
868 Ga0207700_10317494 3300025928 Bacteria 1349
869 Ga0207700_10322369 3300025928 Bacteria 1339
870 Ga0207700_10329868 3300025928 Bacteria 1324
871 Ga0207700_10361196 3300025928 Bacteria 1266
872 Ga0207700_10386904 3300025928 Bacteria 1224
873 Ga0207700_10407354 3300025928 Bacteria 1192
874 Ga0207700_10448468 3300025928 Bacteria 1137
875 Ga0207700_10525939 3300025928 Bacteria 1048
876 Ga0207700_11619884 3300025928 Bacteria 572
877 Ga0207700_11994693 3300025928 Unclassified 507
878 Ga0207664_10037599 3300025929 Bacteria 3748
879 Ga0207664_10205174 3300025929 Bacteria 1703
880 Ga0207664_10355697 3300025929 Bacteria 1297
881 Ga0207664_10369341 3300025929 Bacteria 1272
882 Ga0207664_10693569 3300025929 Bacteria 916
883 Ga0207664_10707014 3300025929 Bacteria 906
884 Ga0207664_10830825 3300025929 Bacteria 831
885 Ga0207664_11997895 3300025929 Bacteria 503
886 Ga0207644_10167343 3300025931 Bacteria 1713
887 Ga0207644_10221296 3300025931 Bacteria 1500
888 Ga0207644_10358937 3300025931 Bacteria 1185
889 Ga0207690_10312900 3300025932 Bacteria 1232
890 Ga0207690_10491467 3300025932 Bacteria 992
891 Ga0207690_10849208 3300025932 Bacteria 756
892 Ga0207706_10100179 3300025933 Bacteria 2549
893 Ga0207706_10239068 3300025933 Bacteria 1588
894 Ga0207706_10270446 3300025933 Bacteria 1483
895 Ga0207706_10291406 3300025933 Bacteria 1423
896 Ga0207686_10242961 3300025934 Bacteria 1311
897 Ga0207686_10281992 3300025934 Bacteria 1227
898 Ga0207686_10292778 3300025934 Bacteria 1206
899 Ga0207686_10330084 3300025934 Bacteria 1142
900 Ga0207709_10220865 3300025935 Bacteria 1367
901 Ga0207709_10246699 3300025935 Bacteria 1302
902 Ga0207709_10873923 3300025935 Bacteria 729
903 Ga0207670_10133751 3300025936 Bacteria 1821
904 Ga0207670_10139473 3300025936 Bacteria 1786
905 Ga0207670_10267118 3300025936 Bacteria 1328
906 Ga0207670_10290602 3300025936 Bacteria 1277
907 Ga0207670_11192350 3300025936 Bacteria 644
908 Ga0207669_10124742 3300025937 Bacteria 1756
909 Ga0207669_10256842 3300025937 Bacteria 1304
910 Ga0207669_10328392 3300025937 Bacteria 1173
911 Ga0207669_11344675 3300025937 Bacteria 607
912 Ga0207704_10134008 3300025938 Bacteria 1721
913 Ga0207704_10306240 3300025938 Bacteria 1219
914 Ga0207704_11323653 3300025938 Bacteria 616
915 Ga0207704_11422251 3300025938 Bacteria 594
916 Ga0207665_10097283 3300025939 Bacteria 2049
917 Ga0207665_10150074 3300025939 Bacteria 1669
918 Ga0207665_10214346 3300025939 Bacteria 1408
919 Ga0207665_10215973 3300025939 Bacteria 1403
920 Ga0207665_10246177 3300025939 Bacteria 1319
921 Ga0207665_10293118 3300025939 Bacteria 1214
922 Ga0207665_10303648 3300025939 Bacteria 1194
923 Ga0207665_10623470 3300025939 Bacteria 843
924 Ga0207665_10710720 3300025939 Bacteria 790
925 Ga0207691_10104040 3300025940 Bacteria 2531
926 Ga0207691_10282428 3300025940 Bacteria 1428
927 Ga0207691_10298557 3300025940 Bacteria 1384
928 Ga0207691_10321342 3300025940 Bacteria 1327
929 Ga0207691_10457161 3300025940 Bacteria 1086
930 Ga0207691_10679832 3300025940 Bacteria 869
931 Ga0207691_10905904 3300025940 Bacteria 738
932 Ga0207691_11671032 3300025940 Unclassified 516
933 Ga0207711_10258076 3300025941 Bacteria 1601
934 Ga0207711_10312963 3300025941 Bacteria 1450
935 Ga0207711_11605656 3300025941 Bacteria 594
936 Ga0207689_10394720 3300025942 Bacteria 1153
937 Ga0207689_10466223 3300025942 Bacteria 1057
938 Ga0207689_11118141 3300025942 Bacteria 664
939 Ga0207689_11367775 3300025942 Bacteria 594
940 Ga0207661_10281765 3300025944 Bacteria 1486
941 Ga0207661_10374692 3300025944 Bacteria 1287
942 Ga0207661_10785828 3300025944 Bacteria 876
943 Ga0207661_10939054 3300025944 Bacteria 797
944 Ga0207661_11026479 3300025944 Bacteria 759
945 Ga0207679_10230678 3300025945 Bacteria 1563
946 Ga0207679_10292638 3300025945 Bacteria 1400
947 Ga0207679_11064970 3300025945 Bacteria 742
948 Ga0207679_11850841 3300025945 Bacteria 551
949 Ga0207679_12054514 3300025945 Bacteria 520
950 Ga0207679_12193354 3300025945 Bacteria 501
951 Ga0207667_10041069 3300025949 Bacteria 4921
952 Ga0207667_10250756 3300025949 Bacteria 1811
953 Ga0207667_10392789 3300025949 Bacteria 1413
954 Ga0207667_10661222 3300025949 Bacteria 1050
955 Ga0207667_10831251 3300025949 Bacteria 919
956 Ga0207667_11140523 3300025949 Bacteria 761
957 Ga0207667_11511583 3300025949 Bacteria 642
958 Ga0207651_10042818 3300025960 Bacteria 3017
959 Ga0207651_10233546 3300025960 Bacteria 1495
960 Ga0207651_10311586 3300025960 Bacteria 1312
961 Ga0207651_10358793 3300025960 Bacteria 1229
962 Ga0207651_10426339 3300025960 Bacteria 1133
963 Ga0207712_10304803 3300025961 Bacteria 1309
964 Ga0207712_10840430 3300025961 Bacteria 809
965 Ga0207668_10150768 3300025972 Bacteria 1799
966 Ga0207668_10302427 3300025972 Bacteria 1320
967 Ga0207668_10621936 3300025972 Bacteria 942
968 Ga0207668_11353453 3300025972 Bacteria 641
969 Ga0207668_11471879 3300025972 Bacteria 614
970 Ga0207668_11589497 3300025972 Unclassified 590
971 Ga0207640_10025526 3300025981 Bacteria 3578
972 Ga0207640_10032794 3300025981 Bacteria 3223
973 Ga0207640_10177424 3300025981 Bacteria 1594
974 Ga0207640_10466204 3300025981 Bacteria 1044
975 Ga0207658_10337190 3300025986 Bacteria 1309
976 Ga0207658_10359124 3300025986 Bacteria 1270
977 Ga0207658_10883535 3300025986 Bacteria 813
978 Ga0207658_11845578 3300025986 Bacteria 551
979 Ga0207677_10467255 3300026023 Bacteria 1084
980 Ga0207677_10542916 3300026023 Bacteria 1012
981 Ga0207677_10929366 3300026023 Bacteria 785
982 Ga0207677_11578395 3300026023 Bacteria 607
983 Ga0207703_10074166 3300026035 Bacteria 2817
984 Ga0207703_10298665 3300026035 Bacteria 1468
985 Ga0207703_10523474 3300026035 Bacteria 1116
986 Ga0207703_10573814 3300026035 Bacteria 1065
987 Ga0207639_10336648 3300026041 Bacteria 1344
988 Ga0207639_10341581 3300026041 Bacteria 1335
989 Ga0207639_10372405 3300026041 Bacteria 1280
990 Ga0207639_10374102 3300026041 Bacteria 1278
991 Ga0207639_10959512 3300026041 Bacteria 800
992 Ga0207639_11077418 3300026041 Bacteria 753
993 Ga0207639_11126253 3300026041 Bacteria 736
994 Ga0207639_12038794 3300026041 Bacteria 535
995 Ga0207678_10170907 3300026067 Bacteria 1856
996 Ga0207678_10179889 3300026067 Bacteria 1806
997 Ga0207678_10643863 3300026067 Bacteria 931
998 Ga0207678_10658453 3300026067 Bacteria 920
999 Ga0207678_11309088 3300026067 Bacteria 641
1000 Ga0207708_10142385 3300026075 Bacteria 1882
1001 Ga0207708_10143340 3300026075 Bacteria 1876
1002 Ga0207708_10153255 3300026075 Bacteria 1816
1003 Ga0207708_10489822 3300026075 Bacteria 1029
1004 Ga0207708_10586199 3300026075 Bacteria 943
1005 Ga0207708_10676365 3300026075 Bacteria 880
1006 Ga0207702_10293980 3300026078 Bacteria 1540
1007 Ga0207702_10419228 3300026078 Bacteria 1294
1008 Ga0207702_10437262 3300026078 Bacteria 1267
1009 Ga0207702_10496339 3300026078 Bacteria 1189
1010 Ga0207702_10581159 3300026078 Bacteria 1098
1011 Ga0207702_10649515 3300026078 Bacteria 1037
1012 Ga0207702_10650872 3300026078 Bacteria 1036
1013 Ga0207702_10760332 3300026078 Bacteria 957
1014 Ga0207702_10919483 3300026078 Bacteria 867
1015 Ga0207702_10958549 3300026078 Bacteria 848
1016 Ga0207702_11273605 3300026078 Bacteria 729
1017 Ga0207702_11275879 3300026078 Bacteria 729
1018 Ga0207702_11471140 3300026078 Bacteria 675
1019 Ga0207702_11610888 3300026078 Bacteria 642
1020 Ga0207641_10246215 3300026088 Bacteria 1668
1021 Ga0207641_10407527 3300026088 Bacteria 1306
1022 Ga0207641_10818450 3300026088 Bacteria 922
1023 Ga0207641_11334841 3300026088 Bacteria 718
1024 Ga0207648_10105951 3300026089 Bacteria 2467
1025 Ga0207648_10172230 3300026089 Bacteria 1914
1026 Ga0207648_10797957 3300026089 Bacteria 879
1027 Ga0207648_11244504 3300026089 Bacteria 699
1028 Ga0207648_11332059 3300026089 Bacteria 675
1029 Ga0207676_10205442 3300026095 Bacteria 1743
1030 Ga0207676_10431972 3300026095 Bacteria 1237
1031 Ga0207676_10938154 3300026095 Bacteria 850
1032 Ga0207676_11266247 3300026095 Bacteria 732
1033 Ga0207674_10047869 3300026116 Bacteria 4380
1034 Ga0207674_10518034 3300026116 Bacteria 1152
1035 Ga0207674_10553421 3300026116 Bacteria 1111
1036 Ga0207674_10681070 3300026116 Bacteria 993
1037 Ga0207674_10822058 3300026116 Bacteria 896
1038 Ga0207675_100214846 3300026118 Bacteria 1851
1039 Ga0207675_100394894 3300026118 Bacteria 1362
1040 Ga0207675_100414728 3300026118 Bacteria 1329
1041 Ga0207683_10063437 3300026121 Bacteria 3255
1042 Ga0207683_10195897 3300026121 Bacteria 1836
1043 Ga0207683_10406104 3300026121 Bacteria 1253
1044 Ga0207683_11078746 3300026121 Bacteria 745
1045 Ga0207698_10403965 3300026142 Bacteria 1306
1046 Ga0207698_10698405 3300026142 Bacteria 1009
1047 Ga0207698_10723852 3300026142 Bacteria 992
1048 Ga0207698_10818550 3300026142 Bacteria 935
1049 Ga0207698_10931457 3300026142 Bacteria 877
1050 Ga0207698_12147514 3300026142 Bacteria 572
1051 Ga0209389_1000192 3300027296 Bacteria 45530
1052 Ga0209389_1080073 3300027296 Bacteria 1586
1053 Ga0209371_1002705 3300027312 Bacteria 9578
1054 Ga0209371_1006726 3300027312 Bacteria 4188
1055 Ga0209489_100397 3300027361 Bacteria 78711
1056 Ga0209998_10217517 3300027717 Bacteria 502
1057 Ga0209974_10076738 3300027876 Bacteria 1145
1058 Ga0265356_1007901 3300028017 Bacteria 1218
1059 Ga0265356_1019577 3300028017 Bacteria 732
1060 Ga0265356_1036310 3300028017 Bacteria 540
1061 Ga0268266_10303467 3300028379 Bacteria 1490
1062 Ga0268266_10306718 3300028379 Bacteria 1482
1063 Ga0268266_10356965 3300028379 Bacteria 1374
1064 Ga0268266_10495033 3300028379 Bacteria 1166
1065 Ga0268265_10317836 3300028380 Bacteria 1409
1066 Ga0268265_11191156 3300028380 Bacteria 759
1067 Ga0268265_11204619 3300028380 Bacteria 755
1068 Ga0268264_10325575 3300028381 Bacteria 1455
1069 Ga0268264_10368347 3300028381 Bacteria 1372
1070 Ga0268264_10406041 3300028381 Bacteria 1310
1071 Ga0268264_10427688 3300028381 Bacteria 1278
1072 Ga0268264_10865924 3300028381 Bacteria 905
1073 Ga0265326_10049984 3300028558 Bacteria 1184
1074 Ga0265319_1158520 3300028563 Bacteria 699
1075 Ga0265334_10064030 3300028573 Bacteria 1381
1076 Ga0265334_10076067 3300028573 Bacteria 1243
1077 Ga0265334_10086860 3300028573 Bacteria 1146
1078 Ga0265318_10001985 3300028577 Bacteria 11359
1079 Ga0265318_10070123 3300028577 Bacteria 1299
1080 Ga0265318_10075889 3300028577 Bacteria 1243
1081 Ga0265318_10202234 3300028577 Bacteria 726
1082 Ga0265322_10249122 3300028654 Bacteria 510
1083 Ga0307515_10042604 3300028794 Bacteria 7093
1084 Ga0307515_10103410 3300028794 Bacteria 3414
1085 Ga0265338_10263345 3300028800 Bacteria 1266
1086 Ga0265338_10273330 3300028800 Bacteria 1237
1087 Ga0265338_10939467 3300028800 Bacteria 587
1088 Ga0268256_1001745 3300030500 Bacteria 12286
1089 Ga0268256_1006802 3300030500 Bacteria 4188
1090 Ga0265762_1007147 3300030760 Bacteria 1992
1091 Ga0265765_1048822 3300030879 Bacteria 577
1092 Ga0265771_1004795 3300031010 Bacteria 836
1093 Ga0265760_10047101 3300031090 Bacteria 1294
1094 Ga0265760_10106150 3300031090 Bacteria 891
1095 Ga0265330_10015058 3300031235 Bacteria 3581
1096 Ga0265330_10072655 3300031235 Bacteria 1487
1097 Ga0265330_10080198 3300031235 Bacteria 1406
1098 Ga0265330_10087350 3300031235 Bacteria 1340
1099 Ga0265332_10063520 3300031238 Bacteria 1577
1100 Ga0265332_10090311 3300031238 Bacteria 1295
1101 Ga0265332_10103138 3300031238 Bacteria 1202
1102 Ga0265332_10161183 3300031238 Bacteria 937
1103 Ga0265328_10048948 3300031239 Bacteria 1552
1104 Ga0265328_10057540 3300031239 Bacteria 1427
1105 Ga0265328_10079784 3300031239 Bacteria 1206
1106 Ga0265328_10091235 3300031239 Bacteria 1125
1107 Ga0265320_10041934 3300031240 Bacteria 2273
1108 Ga0265320_10080033 3300031240 Bacteria 1526
1109 Ga0265320_10103775 3300031240 Bacteria 1307
1110 Ga0265320_10112585 3300031240 Bacteria 1245
1111 Ga0265320_10364802 3300031240 Bacteria 638
1112 Ga0265325_10000470 3300031241 Bacteria 29219
1113 Ga0265325_10054640 3300031241 Bacteria 2043
1114 Ga0265325_10122415 3300031241 Bacteria 1252
1115 Ga0265325_10128642 3300031241 Bacteria 1214
1116 Ga0265325_10433513 3300031241 Bacteria 573
1117 Ga0265325_10531146 3300031241 Bacteria 509
1118 Ga0265329_10029038 3300031242 Bacteria 1810
1119 Ga0265329_10049337 3300031242 Bacteria 1341
1120 Ga0265329_10073789 3300031242 Bacteria 1079
1121 Ga0265340_10011622 3300031247 Bacteria 4673
1122 Ga0265340_10062318 3300031247 Bacteria 1781
1123 Ga0265340_10070416 3300031247 Bacteria 1659
1124 Ga0265340_10102395 3300031247 Bacteria 1329
1125 Ga0265340_10167316 3300031247 Bacteria 997
1126 Ga0265340_10249564 3300031247 Bacteria 791
1127 Ga0265339_10135113 3300031249 Bacteria 1258
1128 Ga0265339_10135652 3300031249 Bacteria 1255
1129 Ga0265339_10136538 3300031249 Bacteria 1250
1130 Ga0265339_10353019 3300031249 Bacteria 693
1131 Ga0265331_10081048 3300031250 Bacteria 1507
1132 Ga0265331_10095015 3300031250 Bacteria 1375
1133 Ga0265331_10138324 3300031250 Bacteria 1108
1134 Ga0265331_10178527 3300031250 Bacteria 959
1135 Ga0265331_10430736 3300031250 Bacteria 592
1136 Ga0265316_10166360 3300031344 Bacteria 1647
1137 Ga0265316_10225778 3300031344 Bacteria 1380
1138 Ga0265316_10264059 3300031344 Bacteria 1261
1139 Ga0265316_10272434 3300031344 Bacteria 1238
1140 Ga0265316_10295259 3300031344 Bacteria 1181
1141 Ga0265316_10979554 3300031344 Bacteria 589
1142 Ga0265316_11239844 3300031344 Bacteria 516
1143 Ga0307513_10159534 3300031456 Bacteria 2150
1144 Ga0307513_10309001 3300031456 Bacteria 1344
1145 Ga0307513_10344740 3300031456 Bacteria 1239
1146 Ga0307513_10347567 3300031456 Bacteria 1232
1147 Ga0307509_10133310 3300031507 Bacteria 2435
1148 Ga0307408_100215213 3300031548 Bacteria 1564
1149 Ga0307408_100255173 3300031548 Bacteria 1448
1150 Ga0307408_100324833 3300031548 Bacteria 1297
1151 Ga0307408_101669679 3300031548 Bacteria 606
1152 Ga0307408_102218182 3300031548 Bacteria 531
1153 Ga0307408_102444453 3300031548 Bacteria 507
1154 Ga0265313_10076729 3300031595 Bacteria 1526
1155 Ga0265313_10109435 3300031595 Bacteria 1216
1156 Ga0265313_10110736 3300031595 Bacteria 1207
1157 Ga0307508_10428770 3300031616 Bacteria 914
1158 Ga0316579_10420320 3300031691 Bacteria 646
1159 Ga0265314_10041671 3300031711 Bacteria 3283
1160 Ga0265314_10124768 3300031711 Bacteria 1614
1161 Ga0265314_10218619 3300031711 Bacteria 1113
1162 Ga0265314_10306169 3300031711 Bacteria 889
1163 Ga0265342_10065842 3300031712 Bacteria 2122
1164 Ga0265342_10075554 3300031712 Bacteria 1954
1165 Ga0265342_10127927 3300031712 Bacteria 1425
1166 Ga0265342_10225795 3300031712 Bacteria 1007
1167 Ga0316576_10239741 3300031727 Bacteria 1363
1168 Ga0316576_10241589 3300031727 Bacteria 1357
1169 Ga0316578_10148389 3300031728 Bacteria 1413
1170 Ga0307405_10389182 3300031731 Bacteria 1088
1171 Ga0307405_10566048 3300031731 Bacteria 922
1172 Ga0307405_11357174 3300031731 Bacteria 620
1173 Ga0307405_11421853 3300031731 Bacteria 607
1174 Ga0307405_11549831 3300031731 Bacteria 583
1175 Ga0307410_10292516 3300031852 Bacteria 1282
1176 Ga0307406_10216268 3300031901 Bacteria 1421
1177 Ga0307406_11027229 3300031901 Bacteria 708
1178 Ga0307407_10327409 3300031903 Bacteria 1077
1179 Ga0307412_10085052 3300031911 Bacteria 2197
1180 Ga0307412_10275288 3300031911 Bacteria 1319
1181 Ga0307412_10374009 3300031911 Bacteria 1151
1182 Ga0307412_10709552 3300031911 Bacteria 864
1183 Ga0307412_10727655 3300031911 Bacteria 854
1184 Ga0307412_11312075 3300031911 Bacteria 652
1185 Ga0307409_100409749 3300031995 Bacteria 1297
1186 Ga0307409_100616228 3300031995 Bacteria 1075
1187 Ga0307416_100268704 3300032002 Bacteria 1672
1188 Ga0307416_100323152 3300032002 Bacteria 1546
1189 Ga0307416_100409499 3300032002 Bacteria 1396
1190 Ga0307416_100529230 3300032002 Bacteria 1248
1191 Ga0307416_101939398 3300032002 Bacteria 692
1192 Ga0307416_103795019 3300032002 Bacteria 506
1193 Ga0307414_10364651 3300032004 Bacteria 1244
1194 Ga0307414_10686141 3300032004 Unclassified 926
1195 Ga0307411_10182162 3300032005 Bacteria 1595
1196 Ga0307411_10306328 3300032005 Bacteria 1276
1197 Ga0307411_10734723 3300032005 Bacteria 863
1198 Ga0307411_11491439 3300032005 Bacteria 621
1199 Ga0307415_100758863 3300032126 Bacteria 881
1200 Ga0307415_100808608 3300032126 Bacteria 856
1201 Ga0307415_101193386 3300032126 Bacteria 717
1202 Ga0307415_101643232 3300032126 Bacteria 618
1203 Ga0307507_10148326 3300033179 Bacteria 1774
1204 Ga0307510_10090852 3300033180 Bacteria 2898
1205 Ga0307510_10218789 3300033180 Bacteria 1418
1206 Ga0373930_0025313 3300034816 Bacteria 1190
1207 Ga0373950_0077527 3300034818 Bacteria 689
1208 Ga0373958_0010738 3300034819 Bacteria 1533
1209 Ga0373959_0020412 3300034820 Bacteria 1264
1210 Ga0373938_0001426 3300034957 Bacteria 3828
1211 Ga0373938_0130541 3300034957 Bacteria 655
1212 Ga0373926_0034160 3300035083 Bacteria 1799
1213 Ga0373926_0068678 3300035083 Bacteria 1299
1214 Ga0373929_0026404 3300035085 Bacteria 1213
1215 Ga0373934_0040018 3300035086 Bacteria 1848
1216 Ga0373940_0048280 3300035088 Bacteria 1189
1217 Ga0373940_0222946 3300035088 Bacteria 627
1218 Ga0373940_0307663 3300035088 Bacteria 547
1219 Ga0373944_0004086 3300035089 Bacteria 3786
1220 Ga0373944_0062771 3300035089 Bacteria 1195
1221 Ga0373944_0073109 3300035089 Bacteria 1120
1222 Ga0373944_0368231 3300035089 Bacteria 549
1223 Ga0373949_0038456 3300035090 Bacteria 1167
1224 Ga0373951_0027396 3300035091 Bacteria 1331
1225 Ga0373951_0037788 3300035091 Bacteria 1156
1226 Ga0373951_0235748 3300035091 Bacteria 545
1227 Ga0373923_0014805 3300035111 Bacteria 2936
1228 Ga0373923_0107546 3300035111 Bacteria 1235
1229 Ga0373923_0210712 3300035111 Bacteria 901
1230 Ga0373936_0071846 3300035113 Bacteria 1427
1231 Ga0373936_0326230 3300035113 Bacteria 696
1232 Ga0373936_0585638 3300035113 Bacteria 523
1233 Ga0373939_0010117 3300035114 Bacteria 2350
1234 Ga0373939_0458280 3300035114 Bacteria 538
1235 Ga0373941_0039099 3300035115 Bacteria 1456
1236 Ga0373945_0028673 3300035116 Bacteria 1951
1237 Ga0373945_0067182 3300035116 Bacteria 1349
1238 Ga0373945_0069441 3300035116 Bacteria 1330
1239 Ga0373945_0121367 3300035116 Bacteria 1039
1240 Ga0373953_0020810 3300035117 Bacteria 2454
1241 Ga0373954_0102373 3300035118 Bacteria 1382
1242 Ga0373956_0041225 3300035119 Bacteria 2049
1243 Ga0373956_0581112 3300035119 Bacteria 535
1244 Ga0373957_0051489 3300035120 Bacteria 1575
1245 Ga0373957_0358587 3300035120 Bacteria 623
1246 Ga0373960_0002462 3300035121 Bacteria 4159
1247 Ga0373960_0280893 3300035121 Bacteria 614
1248 Ga0373960_0329935 3300035121 Bacteria 574
1249 Ga0373943_0024217 3300035170 Bacteria 2829
1250 Ga0373943_0182958 3300035170 Bacteria 1153
1251 Ga0373943_0385367 3300035170 Bacteria 807
1252 Ga0373946_0374942 3300035171 Bacteria 715
1253 Ga0373946_0747046 3300035171 Bacteria 513
1254 Ga0373946_0774150 3300035171 Bacteria 504
1255 Ga0373955_0291763 3300035172 Bacteria 983
1256 Ga0373955_0540394 3300035172 Bacteria 713
1257 Ga0373942_0016107 3300035207 Bacteria 1830
1258 Ga0373942_0049827 3300035207 Bacteria 1170
1259 Ga0373961_0069794 3300035241 Bacteria 1084
1260 Ga0316574_0379218 3300035398 Bacteria 892
1261 Ga0316574_0533956 3300035398 Unclassified 729
1262 Ga0316574_0661307 3300035398 Bacteria 643
1263 Ga0373924_0018083 3300035410 Bacteria 2713
1264 Ga0373924_0037517 3300035410 Bacteria 1973
1265 Ga0373931_0107722 3300035691 Bacteria 1576
1266 Ga0373931_0738751 3300035691 Bacteria 652
1267 Ga0373931_0739457 3300035691 Bacteria 652
1268 Ga0373931_0953070 3300035691 Bacteria 579
1269 Ga0373935_0189880 3300035692 Bacteria 1414
1270 Ga0373935_0258508 3300035692 Bacteria 1220
1271 Ga0373935_0271051 3300035692 Bacteria 1193
1272 Ga0373935_0630585 3300035692 Bacteria 785
1273 Ga0373935_0702300 3300035692 Bacteria 744
1274 Ga0373935_0779448 3300035692 Bacteria 705
1275 Ga0373935_1261808 3300035692 Bacteria 551
1276 Ga0373927_0108408 3300035695 Bacteria 1809
1277 Ga0373927_0116777 3300035695 Bacteria 1740
1278 Ga0373927_0194092 3300035695 Bacteria 1332
1279 Ga0373927_0229413 3300035695 Bacteria 1220
1280 Ga0373933_0195094 3300035724 Bacteria 1294
1281 Ga0373947_0146162 3300035725 Bacteria 1520
1282 Ga0373947_0154034 3300035725 Bacteria 1482
1283 Ga0373947_0169552 3300035725 Bacteria 1415
1284 Ga0373947_0175028 3300035725 Bacteria 1394
1285 Ga0373947_0227152 3300035725 Bacteria 1228
1286 Ga0373947_0716735 3300035725 Bacteria 682
1287 Ga0373937_0289081 3300036401 Bacteria 1548
1288 Ga0373937_0382347 3300036401 Bacteria 1335
1289 Ga0373937_0390445 3300036401 Bacteria 1320
1290 Ga0316582_0250181 3300036647 Bacteria 1214
1291 Ga0316584_1062113 3300036712 Bacteria 539
1292 Ga0316584_1062273 3300036712 Unclassified 539
1293 Ga0373925_0026850 3300037068 Bacteria 4215
1294 Ga0373925_0052739 3300037068 Bacteria 3039
1295 Ga0373925_0240883 3300037068 Bacteria 1448
1296 Ga0373925_0290833 3300037068 Bacteria 1317
1297 Ga0373925_1686490 3300037068 Bacteria 517
1298 Ga0373925_1715268 3300037068 Bacteria 513
1299 Ga0395900_0747076 3300037418 Bacteria 909
1300 Ga0395900_1210458 3300037418 Bacteria 671
1301 Ga0395900_1756391 3300037418 Bacteria 531
1302 Ga0395898_0060463 3300037466 Bacteria 3682
1303 Ga0395898_0348393 3300037466 Bacteria 1412
1304 Ga0395898_1444344 3300037466 Bacteria 615
1305 Ga0395905_0484243 3300037471 Unclassified 1137
1306 Ga0436364_0255320 3300037853 Bacteria 578
1307 Ga0436364_0541898 3300037853 Bacteria 566
1308 Ga0436364_0554499 3300037853 Bacteria 1947
1309 Ga0436364_0726935 3300037853 Bacteria 1697
1310 Ga0436364_0963528 3300037853 Bacteria 1194
1311 Ga0436364_1483246 3300037853 Bacteria 3752
1312 Ga0395901_0456402 3300038443 Bacteria 1306
1313 Ga0395901_1102178 3300038443 Bacteria 764
1314 Ga0395901_2039156 3300038443 Bacteria 519
1315 Ga0436365_0532529 3300039437 Bacteria 917
1316 Ga0436365_0966114 3300039437 Bacteria 1454
1317 Ga0436365_1020445 3300039437 Bacteria 705
1318 Ga0436365_1131554 3300039437 Bacteria 1482
1319 Ga0436365_1388600 3300039437 Bacteria 809
1320 Ga0436365_1925217 3300039437 Bacteria 653
1321 Ga0436360_0429478 3300039438 Bacteria 589
1322 Ga0436360_0770642 3300039438 Bacteria 661
1323 Ga0436360_0832524 3300039438 Bacteria 1704
1324 Ga0436360_1128830 3300039438 Bacteria 512
1325 Ga0436360_1166796 3300039438 Bacteria 1550
1326 Ga0436361_0044025 3300039447 Bacteria 593
1327 Ga0436361_0671466 3300039447 Bacteria 541
1328 Ga0436361_0697198 3300039447 Bacteria 621
1329 Ga0436361_0948409 3300039447 Bacteria 559
1330 Ga0436361_0985371 3300039447 Bacteria 726
1331 Ga0436363_0018834 3300039450 Bacteria 1611
1332 Ga0436363_0817356 3300039450 Bacteria 584
1333 Ga0436363_1001204 3300039450 Bacteria 914
1334 Ga0436362_0016536 3300039453 Bacteria 614
1335 Ga0436362_0376050 3300039453 Bacteria 532
1336 Ga0436362_0926788 3300039453 Bacteria 1182
1337 Ga0439436_0033996 3300041404 Bacteria 1474
1338 Ga0439436_0123331 3300041404 Bacteria 725
1339 Ga0439439_0036586 3300041406 Bacteria 1263
1340 Ga0439447_027919 3300041407 Bacteria 1437
1341 Ga0439453_0017139 3300041408 Bacteria 1270
1342 Ga0439453_0062135 3300041408 Bacteria 775
1343 Ga0439461_0008144 3300041410 Bacteria 1872
1344 Ga0439465_0000081 3300041413 Bacteria 20876
1345 Ga0451787_087122 3300041441 Bacteria 608
1346 Ga0451789_1080748 3300041443 Bacteria 689
1347 Ga0451791_0659445 3300041451 Bacteria 561
1348 Ga0451791_0973324 3300041451 Bacteria 741
1349 Ga0451791_1087098 3300041451 Bacteria 508
1350 Ga0451791_1201354 3300041451 Bacteria 552
1351 Ga0451791_1361698 3300041451 Bacteria 681
1352 Ga0451797_1582856 3300041453 Bacteria 721
1353 Ga0451795_0150957 3300041456 Bacteria 536
1354 Ga0451795_1073768 3300041456 Bacteria 1576
1355 Ga0451798_0233393 3300041458 Bacteria 592
1356 Ga0451798_0687350 3300041458 Bacteria 795
1357 Ga0451800_0467117 3300041459 Bacteria 565
1358 Ga0451800_0478560 3300041459 Bacteria 1342
1359 Ga0451800_0514837 3300041459 Bacteria 558
1360 Ga0451800_1567732 3300041459 Bacteria 709
1361 Ga0451802_0651888 3300041460 Bacteria 714
1362 Ga0451802_1912908 3300041460 Bacteria 925
1363 Ga0451804_0438673 3300041463 Bacteria 801
1364 Ga0451807_0289057 3300041486 Bacteria 703
1365 Ga0451807_1300876 3300041486 Bacteria 745
1366 Ga0451833_0920853 3300041491 Bacteria 839
1367 Ga0451833_1273368 3300041491 Bacteria 714
1368 Ga0451835_1138368 3300041492 Bacteria 767
1369 Ga0451835_1260456 3300041492 Bacteria 590
1370 Ga0451837_0538533 3300041494 Bacteria 729
1371 Ga0451837_1753977 3300041494 Bacteria 717
1372 Ga0451841_0245237 3300041498 Bacteria 847
1373 Ga0451845_0067126 3300041501 Bacteria 1194
1374 Ga0451845_0626369 3300041501 Bacteria 706
1375 Ga0451847_0954509 3300041503 Bacteria 575
1376 Ga0451849_1486900 3300041505 Bacteria 1502
1377 Ga0451851_0617812 3300041507 Bacteria 640
1378 Ga0451843_0028691 3300041509 Bacteria 732
1379 Ga0451843_1612071 3300041509 Bacteria 578
1380 Ga0451853_0025403 3300041512 Bacteria 505
1381 Ga0451853_1048281 3300041512 Bacteria 1355
1382 Ga0451853_3365647 3300041512 Bacteria 580
1383 Ga0439441_021140 3300042001 Bacteria 1198
1384 Ga0439448_0059925 3300042005 Bacteria 1257
1385 Ga0439448_0103011 3300042005 Bacteria 971
1386 Ga0439432_253793 3300042006 Bacteria 504
1387 Ga0439449_0154125 3300042007 Bacteria 857
1388 Ga0439451_031816 3300042009 Bacteria 1060
1389 Ga0439452_031173 3300042010 Bacteria 1309
1390 Ga0439454_009771 3300042011 Bacteria 1252
1391 Ga0439457_028826 3300042014 Bacteria 1229
1392 Ga0439462_0031121 3300042015 Bacteria 1412
1393 Ga0439462_0035441 3300042015 Bacteria 1326
1394 Ga0450914_005632 3300042118 Bacteria 1068
1395 Ga0450898_016660 3300042134 Bacteria 1256
1396 Ga0450903_064932 3300042138 Bacteria 528
1397 Ga0439446_0051970 3300042156 Bacteria 1225
1398 Ga0439446_0125999 3300042156 Bacteria 828
1399 Ga0450909_086486 3300042185 Bacteria 511
1400 Ga0439434_0027544 3300042435 Bacteria 1718
1401 Ga0439435_0032471 3300042436 Bacteria 1424
1402 Ga0439444_0016557 3300042437 Bacteria 1257
1403 Ga0439444_0134282 3300042437 Bacteria 587
1404 Ga0439459_0000106 3300042438 Bacteria 7783
1405 Ga0439459_0000690 3300042438 Bacteria 4605
1406 Ga0439459_0151550 3300042438 Bacteria 606
1407 Ga0439459_0187706 3300042438 Bacteria 558
1408 Ga0439464_0042650 3300042439 Bacteria 1296
1409 Ga0439460_0051046 3300042461 Bacteria 1240
1410 Ga0450893_0092695 3300042532 Bacteria 608
1411 Ga0451577_0039329 3300042876 Bacteria 4251
1412 Ga0451577_0089653 3300042876 Bacteria 2744
1413 Ga0451577_0207422 3300042876 Bacteria 1770
1414 Ga0451577_0340359 3300042876 Bacteria 1360
1415 Ga0439440_0201111 3300042993 Bacteria 591
1416 Ga0466969_0120383 3300044656 Bacteria 1222
1417 Ga0453683_0036678 3300044673 Bacteria 3085
1418 Ga0453683_0070373 3300044673 Bacteria 2188
1419 Ga0453683_0166036 3300044673 Bacteria 1397
1420 Ga0453683_0308001 3300044673 Bacteria 1014
1421 Ga0466965_0248141 3300044683 Bacteria 954
1422 Ga0466966_0191340 3300044684 Bacteria 1239
1423 Ga0466966_0832149 3300044684 Bacteria 556
1424 Ga0466961_0177888 3300044693 Bacteria 1321
1425 Ga0466963_0136281 3300044694 Bacteria 1698
1426 Ga0466964_0106656 3300044706 Bacteria 1243
1427 Ga0466964_0796220 3300044706 Bacteria 534
1428 Ga0453684_0092963 3300044712 Bacteria 3716
1429 Ga0453684_0134912 3300044712 Bacteria 2957
1430 Ga0453684_1552583 3300044712 Bacteria 681
1431 Ga0466971_0078765 3300044719 Bacteria 1501
1432 Ga0466968_0077765 3300044735 Bacteria 1453
1433 Ga0466970_0132543 3300044765 Bacteria 1369
1434 Ga0466970_0163103 3300044765 Bacteria 1233
1435 Ga0466957_0102406 3300044842 Bacteria 1806
1436 Ga0466957_0212421 3300044842 Bacteria 1274
1437 Ga0466957_0226723 3300044842 Bacteria 1235
1438 Ga0451576_0009749 3300045051 Bacteria 11104
1439 Ga0451576_0125849 3300045051 Bacteria 2670
1440 Ga0451576_1865451 3300045051 Bacteria 621
1441 Ga0451576_2330833 3300045051 Bacteria 548
1442 Ga0466958_0176781 3300045836 Bacteria 1353
1443 Ga0466958_0230737 3300045836 Bacteria 1182
1444 Ga0466967_0367160 3300045976 Bacteria 1395
1445 Ga0466967_0512709 3300045976 Bacteria 1178
1446 Ga0466967_0536351 3300045976 Bacteria 1151
1447 Ga0466967_0596187 3300045976 Bacteria 1090
1448 Ga0466967_2171523 3300045976 Bacteria 551
1449 Ga0495627_044618 3300046453 Bacteria 1353
1450 Ga0495592_0218003 3300046454 Bacteria 1277
1451 Ga0495592_0320842 3300046454 Bacteria 1001
1452 Ga0495603_0121147 3300046455 Bacteria 1524
1453 Ga0495603_0176565 3300046455 Bacteria 1236
1454 Ga0495603_0261788 3300046455 Bacteria 995
1455 Ga0495590_0053109 3300046457 Bacteria 1415
1456 Ga0495590_0088863 3300046457 Bacteria 1092
1457 Ga0495590_0239992 3300046457 Bacteria 672
1458 Ga0495591_034336 3300046458 Bacteria 1494
1459 Ga0495629_0103686 3300046459 Bacteria 1984
1460 Ga0495629_0248371 3300046459 Bacteria 1224
1461 Ga0495629_0254649 3300046459 Bacteria 1207
1462 Ga0495638_0002512 3300046460 Bacteria 14916
1463 Ga0495638_0043353 3300046460 Bacteria 2838
1464 Ga0495641_0050797 3300046461 Bacteria 1895
1465 Ga0495641_0088208 3300046461 Bacteria 1387
1466 Ga0495641_0094513 3300046461 Bacteria 1335
1467 Ga0495641_0257827 3300046461 Bacteria 784
1468 Ga0495651_0124442 3300046462 Bacteria 1889
1469 Ga0495651_0305320 3300046462 Bacteria 1066
1470 Ga0495653_0123480 3300046463 Bacteria 1842
1471 Ga0495653_0222661 3300046463 Bacteria 1267
1472 Ga0495653_0457003 3300046463 Bacteria 802
1473 Ga0495580_0388956 3300046472 Bacteria 941
1474 Ga0495582_0208256 3300046473 Bacteria 1117
1475 Ga0495582_0267446 3300046473 Bacteria 981
1476 Ga0495605_0109124 3300046474 Bacteria 1264
1477 Ga0495605_0140644 3300046474 Bacteria 1083
1478 Ga0495639_0055704 3300046475 Bacteria 1804
1479 Ga0495639_0101308 3300046475 Bacteria 1360
1480 Ga0495639_0110429 3300046475 Bacteria 1304
1481 Ga0495639_0128793 3300046475 Bacteria 1210
1482 Ga0495639_0244154 3300046475 Bacteria 887
1483 Ga0495662_0112644 3300046476 Bacteria 1333
1484 Ga0495662_0181763 3300046476 Bacteria 1036
1485 Ga0495662_0196052 3300046476 Bacteria 995
1486 Ga0495664_0020887 3300046477 Bacteria 3780
1487 Ga0495664_0183508 3300046477 Bacteria 1268
1488 Ga0495664_0272202 3300046477 Bacteria 1023
1489 Ga0495664_0276046 3300046477 Bacteria 1015
1490 Ga0495584_0136449 3300046491 Bacteria 1245
1491 Ga0495584_0137515 3300046491 Bacteria 1240
1492 Ga0495585_0108637 3300046492 Bacteria 1477
1493 Ga0495594_0092562 3300046499 Bacteria 1695
1494 Ga0495594_0129438 3300046499 Bacteria 1429
1495 Ga0495594_0142752 3300046499 Bacteria 1358
1496 Ga0495594_0332694 3300046499 Bacteria 865
1497 Ga0495594_0428073 3300046499 Bacteria 752
1498 Ga0495594_0872343 3300046499 Bacteria 506
1499 Ga0495607_0109479 3300046501 Bacteria 1467
1500 Ga0495607_0168099 3300046501 Bacteria 1109
1501 Ga0495583_0304742 3300046506 Bacteria 633
1502 Ga0495606_0151522 3300046507 Bacteria 1360
1503 Ga0495606_0166696 3300046507 Bacteria 1281
1504 Ga0495606_0177129 3300046507 Bacteria 1232
1505 Ga0495608_0190310 3300046511 Bacteria 1295
1506 Ga0495608_0249375 3300046511 Bacteria 1107
1507 Ga0495610_0335753 3300046512 Bacteria 573
1508 Ga0495616_0041790 3300046513 Bacteria 2337
1509 Ga0495618_0171691 3300046514 Bacteria 1379
1510 Ga0495618_0487064 3300046514 Bacteria 745
1511 Ga0495618_0749040 3300046514 Bacteria 572
1512 Ga0495620_0074838 3300046515 Bacteria 1379
1513 Ga0495620_0080985 3300046515 Bacteria 1313
1514 Ga0495620_0175124 3300046515 Bacteria 831
1515 Ga0495620_0189164 3300046515 Bacteria 794
1516 Ga0495628_0274870 3300046516 Bacteria 1252
1517 Ga0495628_0282733 3300046516 Bacteria 1231
1518 Ga0495628_0404820 3300046516 Bacteria 996
1519 Ga0495628_0833781 3300046516 Bacteria 643
1520 Ga0495630_0058711 3300046517 Bacteria 2884
1521 Ga0495630_0264249 3300046517 Bacteria 1314
1522 Ga0495630_0266217 3300046517 Bacteria 1309
1523 Ga0495630_0298618 3300046517 Bacteria 1231
1524 Ga0495631_0009052 3300046518 Bacteria 4987
1525 Ga0495631_0025621 3300046518 Bacteria 2714
1526 Ga0495632_0076925 3300046519 Bacteria 1596
1527 Ga0495632_0379423 3300046519 Bacteria 619
1528 Ga0495632_0493262 3300046519 Bacteria 529
1529 Ga0495637_0058375 3300046520 Bacteria 1590
1530 Ga0495643_0131453 3300046522 Bacteria 1256
1531 Ga0495643_0138615 3300046522 Bacteria 1215
1532 Ga0495643_0139789 3300046522 Bacteria 1209
1533 Ga0495643_0159805 3300046522 Bacteria 1109
1534 Ga0495643_0216664 3300046522 Bacteria 910
1535 Ga0495644_0281749 3300046523 Bacteria 648
1536 Ga0495648_0071391 3300046524 Bacteria 2013
1537 Ga0495648_0212217 3300046524 Bacteria 961
1538 Ga0495663_0055302 3300046525 Bacteria 1237
1539 Ga0495666_0089783 3300046526 Bacteria 1450
1540 Ga0495666_0104088 3300046526 Bacteria 1336
1541 Ga0495666_0278285 3300046526 Bacteria 759
1542 Ga0495652_0137051 3300046529 Bacteria 1930
1543 Ga0495652_0217572 3300046529 Bacteria 1437
1544 Ga0495652_0248676 3300046529 Bacteria 1319
1545 Ga0495665_0390327 3300046531 Bacteria 706
1546 Ga0495640_0178474 3300046533 Bacteria 1354
1547 Ga0495640_0192539 3300046533 Bacteria 1295
1548 Ga0495640_0208420 3300046533 Bacteria 1236
1549 Ga0495586_0111523 3300046535 Bacteria 1522
1550 Ga0495586_0115396 3300046535 Bacteria 1497
1551 Ga0495586_0133551 3300046535 Bacteria 1390
1552 Ga0495587_0064421 3300046536 Bacteria 2141
1553 Ga0495587_0320450 3300046536 Bacteria 866
1554 Ga0495598_0285669 3300046537 Bacteria 620
1555 Ga0495609_0083751 3300046538 Bacteria 1392
1556 Ga0495621_0067002 3300046539 Bacteria 1314
1557 Ga0495597_0116550 3300046542 Bacteria 1116
1558 Ga0495597_0176638 3300046542 Bacteria 865
1559 Ga0495645_0161545 3300046543 Bacteria 1548
1560 Ga0495645_0627371 3300046543 Bacteria 659
1561 Ga0495645_0842658 3300046543 Bacteria 547
1562 Ga0495622_0129437 3300046557 Bacteria 1150
1563 Ga0495633_0072529 3300046558 Bacteria 1605
1564 Ga0495667_0114054 3300046559 Bacteria 1746
1565 Ga0495667_0207252 3300046559 Bacteria 1253
1566 Ga0495656_0046619 3300046615 Bacteria 1834
1567 Ga0495668_0034180 3300046616 Bacteria 2854
1568 Ga0495668_0079381 3300046616 Bacteria 1801
1569 Ga0495634_0005027 3300046642 Bacteria 10210
1570 Ga0495634_0126300 3300046642 Bacteria 1634
1571 Ga0495634_0179009 3300046642 Bacteria 1328
1572 Ga0495634_0198450 3300046642 Bacteria 1247
1573 Ga0495611_0093745 3300046648 Bacteria 1389
1574 Ga0495611_0103386 3300046648 Bacteria 1324
1575 Ga0495625_0173962 3300046660 Bacteria 1436
1576 Ga0495625_0176598 3300046660 Bacteria 1423
1577 Ga0495625_0695161 3300046660 Bacteria 601
1578 Ga0495635_0073937 3300046663 Bacteria 2334
1579 Ga0495635_0264822 3300046663 Bacteria 1157
1580 Ga0495659_0078894 3300046664 Bacteria 1246
1581 Ga0495661_0254294 3300046665 Bacteria 895
1582 Ga0495588_0099748 3300046674 Bacteria 1525
1583 Ga0495588_0135876 3300046674 Bacteria 1298
1584 Ga0495588_0141263 3300046674 Bacteria 1272
1585 Ga0495657_0088566 3300046675 Bacteria 1989
1586 Ga0495657_0208578 3300046675 Bacteria 1188
1587 Ga0495657_0263738 3300046675 Bacteria 1034
1588 Ga0495599_0153044 3300046678 Bacteria 1427
1589 Ga0495599_0404590 3300046678 Bacteria 812
1590 Ga0495646_0136216 3300046680 Bacteria 1377
1591 Ga0495647_0078824 3300046681 Bacteria 1332
1592 Ga0495647_0113124 3300046681 Bacteria 1134
1593 Ga0495658_0157971 3300046683 Bacteria 1396
1594 Ga0495658_0191218 3300046683 Bacteria 1273
1595 Ga0495658_0800410 3300046683 Bacteria 603
1596 Ga0495658_1088838 3300046683 Bacteria 509
1597 Ga0495669_0046029 3300046684 Bacteria 1946
1598 Ga0495613_0216801 3300046689 Bacteria 1344
1599 Ga0495613_0255437 3300046689 Bacteria 1222
1600 Ga0495613_0306445 3300046689 Bacteria 1098
1601 Ga0495624_0083237 3300046690 Bacteria 1979
1602 Ga0495624_0149607 3300046690 Bacteria 1428
1603 Ga0495624_0183716 3300046690 Bacteria 1273
1604 Ga0495624_0431070 3300046690 Bacteria 790
1605 Ga0495624_0737741 3300046690 Bacteria 584
1606 Ga0495670_0118969 3300046691 Bacteria 1371
1607 Ga0495671_0057755 3300046692 Bacteria 1920
1608 Ga0495671_0321379 3300046692 Bacteria 743
1609 Ga0495649_0149467 3300046694 Bacteria 1227
1610 Ga0495589_0192540 3300046794 Bacteria 964
1611 Ga0495600_0116786 3300046809 Bacteria 1736
1612 Ga0495600_0163077 3300046809 Bacteria 1440
1613 Ga0495660_0117219 3300046810 Bacteria 1351
1614 Ga0495581_0179350 3300047315 Bacteria 1238
1615 Ga0495581_0186413 3300047315 Bacteria 1213
1616 Ga0495581_0219426 3300047315 Bacteria 1112
1617 Ga0495604_0195988 3300047317 Bacteria 1404
1618 Ga0495604_0233857 3300047317 Bacteria 1259
1619 Ga0495604_0518072 3300047317 Bacteria 772
1620 Ga0495604_0909157 3300047317 Bacteria 549
1621 Ga0495604_1051096 3300047317 Bacteria 502
1622 Ga0495674_0001495 3300047319 Bacteria 22929
1623 Ga0495674_0083380 3300047319 Bacteria 2740
1624 Ga0495674_0253868 3300047319 Bacteria 1446
1625 Ga0495674_0294083 3300047319 Bacteria 1327
1626 Ga0495674_0787984 3300047319 Bacteria 740
1627 Ga0495672_0220057 3300047320 Bacteria 938
1628 Ga0495676_0192804 3300047321 Bacteria 1420
1629 Ga0495676_0237430 3300047321 Bacteria 1249
1630 Ga0495676_0261802 3300047321 Bacteria 1176
1631 Ga0495680_0205135 3300047322 Bacteria 1413
1632 Ga0495680_0252133 3300047322 Bacteria 1250
1633 Ga0495683_0122063 3300047323 Bacteria 1235
1634 Ga0495683_0123013 3300047323 Bacteria 1230
1635 Ga0495683_0269253 3300047323 Bacteria 741
1636 Ga0495675_0137558 3300047444 Bacteria 1515
1637 Ga0495677_0346313 3300047445 Bacteria 586
1638 Ga0495673_0119671 3300047469 Bacteria 1044
1639 Ga0495673_0307484 3300047469 Bacteria 567
1640 Ga0495673_0350496 3300047469 Bacteria 521
1641 Ga0495681_0339473 3300047470 Bacteria 573
1642 Ga0495684_0195905 3300047471 Bacteria 1491
1643 Ga0495684_0748373 3300047471 Bacteria 643
1644 Ga0495686_0004864 3300047472 Bacteria 10834
1645 Ga0495686_0165831 3300047472 Bacteria 1288
1646 Ga0495686_0571846 3300047472 Bacteria 588
1647 Ga0495593_0052820 3300047673 Bacteria 2146
1648 Ga0495593_0065174 3300047673 Bacteria 1900
1649 Ga0495593_0145160 3300047673 Bacteria 1201
1650 Ga0495593_0169992 3300047673 Bacteria 1099
1651 Ga0495602_0152712 3300048088 Bacteria 1812
1652 Ga0495602_0400510 3300048088 Bacteria 979
1653 Ga0495602_0628017 3300048088 Bacteria 736
1654 Ga0495602_1087087 3300048088 Bacteria 525
1655 Ga0495614_0629626 3300048089 Bacteria 516
1656 Ga0495626_0102073 3300048091 Bacteria 1249
1657 Ga0496100_0026554 3300048903 Bacteria 3551
1658 Ga0496100_0206815 3300048903 Bacteria 1433
1659 Ga0496100_0273644 3300048903 Bacteria 1256
1660 Ga0496100_0405239 3300048903 Bacteria 1039
1661 Ga0496100_0439162 3300048903 Bacteria 999
1662 Ga0496100_1556724 3300048903 Bacteria 522
1663 Ga0496101_0013716 3300048904 Bacteria 5435
1664 Ga0496101_0150392 3300048904 Bacteria 1780
1665 Ga0496101_0207169 3300048904 Bacteria 1518
1666 Ga0496101_0237315 3300048904 Bacteria 1418
1667 Ga0496101_0255668 3300048904 Bacteria 1365
1668 Ga0496101_0284191 3300048904 Bacteria 1294
1669 Ga0496101_0436141 3300048904 Bacteria 1033
1670 Ga0496101_0644601 3300048904 Bacteria 837
1671 Ga0496102_0133290 3300048905 Bacteria 2327
1672 Ga0496102_0227055 3300048905 Bacteria 1760
1673 Ga0496102_0262179 3300048905 Bacteria 1629
1674 Ga0496102_0289600 3300048905 Bacteria 1543
1675 Ga0496102_0373274 3300048905 Bacteria 1342
1676 Ga0496102_0388194 3300048905 Bacteria 1313
1677 Ga0496102_0436784 3300048905 Bacteria 1229
1678 Ga0496102_0745184 3300048905 Bacteria 902
1679 Ga0496102_1392947 3300048905 Bacteria 620
1680 Ga0496103_0007755 3300048906 Bacteria 6383
1681 Ga0496103_0162551 3300048906 Bacteria 1432
1682 Ga0496103_0200421 3300048906 Bacteria 1283
1683 Ga0496103_0208364 3300048906 Bacteria 1257
1684 Ga0496103_0738672 3300048906 Bacteria 623
1685 Ga0496103_0789900 3300048906 Bacteria 599
1686 Ga0496104_0302886 3300048907 Bacteria 1510
1687 Ga0496104_0394902 3300048907 Bacteria 1295
1688 Ga0496104_0411536 3300048907 Bacteria 1264
1689 Ga0496104_0417735 3300048907 Bacteria 1253
1690 Ga0496104_0774124 3300048907 Unclassified 866
1691 Ga0496104_1761888 3300048907 Bacteria 522
1692 Ga0496105_0253724 3300048908 Bacteria 1424
1693 Ga0496105_0304495 3300048908 Bacteria 1280
1694 Ga0496105_0363906 3300048908 Bacteria 1153
1695 Ga0496105_0442735 3300048908 Bacteria 1026
1696 Ga0496105_0643499 3300048908 Bacteria 819
1697 Ga0496105_0928200 3300048908 Bacteria 655
1698 Ga0496106_0008196 3300048909 Bacteria 7723
1699 Ga0496106_0008640 3300048909 Bacteria 7538
1700 Ga0496106_0197488 3300048909 Bacteria 1600
1701 Ga0496106_0212744 3300048909 Bacteria 1540
1702 Ga0496106_0232986 3300048909 Bacteria 1471
1703 Ga0496106_0284267 3300048909 Bacteria 1325
1704 Ga0496106_0339907 3300048909 Bacteria 1205
1705 Ga0496107_0028081 3300048910 Bacteria 3998
1706 Ga0496107_0199932 3300048910 Bacteria 1485
1707 Ga0496107_0297028 3300048910 Bacteria 1202
1708 Ga0496107_0315459 3300048910 Bacteria 1163
1709 Ga0496107_0397707 3300048910 Bacteria 1025
1710 Ga0496108_0323092 3300048911 Bacteria 1345
1711 Ga0496108_0699809 3300048911 Bacteria 879
1712 Ga0496108_0880357 3300048911 Bacteria 769
1713 Ga0496109_0041208 3300048912 Bacteria 4184
1714 Ga0496109_0389822 3300048912 Bacteria 1316
1715 Ga0496109_1020796 3300048912 Bacteria 765
1716 Ga0496110_0276414 3300048913 Bacteria 1529
1717 Ga0496110_0329841 3300048913 Bacteria 1390
1718 Ga0496110_0345976 3300048913 Bacteria 1354
1719 Ga0496110_0347121 3300048913 Bacteria 1352
1720 Ga0496110_0379246 3300048913 Bacteria 1288
1721 Ga0496110_1687317 3300048913 Bacteria 544
1722 Ga0496111_0223857 3300048914 Bacteria 1398
1723 Ga0496111_0269719 3300048914 Bacteria 1262
1724 Ga0496111_0367103 3300048914 Bacteria 1065
1725 Ga0496111_0959515 3300048914 Bacteria 614
1726 Ga0496112_0401425 3300048915 Bacteria 1310
1727 Ga0496112_0412018 3300048915 Bacteria 1290
1728 Ga0496112_0631657 3300048915 Bacteria 1001
1729 Ga0496112_1011898 3300048915 Bacteria 751
1730 Ga0496113_0351147 3300048916 Bacteria 1183
1731 Ga0496113_0381662 3300048916 Bacteria 1131
1732 Ga0496113_0444134 3300048916 Bacteria 1042
1733 Ga0496113_0618161 3300048916 Bacteria 867
1734 Ga0496114_0001685 3300048917 Bacteria 16766
1735 Ga0496114_0220819 3300048917 Bacteria 1663
1736 Ga0496114_0347574 3300048917 Bacteria 1311
1737 Ga0496114_0373830 3300048917 Bacteria 1261
1738 Ga0496114_0423391 3300048917 Bacteria 1179
1739 Ga0496114_0536349 3300048917 Bacteria 1034
1740 Ga0496114_1091680 3300048917 Bacteria 683
1741 Ga0496115_0076611 3300048918 Bacteria 2718
1742 Ga0496115_0176716 3300048918 Bacteria 1765
1743 Ga0496115_0266288 3300048918 Bacteria 1409
1744 Ga0496115_0281725 3300048918 Bacteria 1364
1745 Ga0496115_0290789 3300048918 Bacteria 1340
1746 Ga0496115_0330471 3300048918 Bacteria 1245
1747 Ga0496116_0092087 3300048919 Bacteria 1840
1748 Ga0496117_0016248 3300048920 Bacteria 6290
1749 Ga0496117_0549801 3300048920 Bacteria 550
1750 Ga0496118_0003921 3300048921 Bacteria 18212
1751 Ga0496118_0005006 3300048921 Bacteria 15309
1752 Ga0496118_0066028 3300048921 Bacteria 2643
1753 Ga0496119_0087479 3300048922 Bacteria 1778
1754 Ga0496119_0158176 3300048922 Bacteria 1207
1755 Ga0496119_0249964 3300048922 Bacteria 894
1756 Ga0496121_0000476 3300048924 Bacteria 78015
1757 Ga0496121_0006084 3300048924 Bacteria 15185
1758 Ga0496121_0020936 3300048924 Bacteria 6436
1759 Ga0496121_0124621 3300048924 Bacteria 1939
1760 Ga0496121_0662306 3300048924 Bacteria 634
1761 Ga0496121_0696532 3300048924 Bacteria 612
1762 Ga0496122_0000283 3300048925 Bacteria 113402
1763 Ga0496122_0004099 3300048925 Bacteria 18459
1764 Ga0496122_0087657 3300048925 Bacteria 2137
1765 Ga0496122_0187791 3300048925 Bacteria 1224
1766 Ga0496123_0000231 3300048926 Bacteria 113369
1767 Ga0496123_0035623 3300048926 Bacteria 3543
1768 Ga0496123_0061121 3300048926 Bacteria 2423
1769 Ga0496123_0149555 3300048926 Bacteria 1262
1770 Ga0496124_0000312 3300048927 Bacteria 89996
1771 Ga0496124_0000907 3300048927 Bacteria 47809
1772 Ga0496124_0013510 3300048927 Bacteria 7966
1773 Ga0496124_0055068 3300048927 Bacteria 3364
1774 Ga0496124_0069437 3300048927 Bacteria 2925
1775 Ga0496124_0319733 3300048927 Bacteria 1112
1776 Ga0496125_0079779 3300048928 Bacteria 2508
1777 Ga0496125_0318112 3300048928 Bacteria 945
1778 Ga0496126_0007244 3300048929 Bacteria 12196
1779 Ga0496126_0077872 3300048929 Bacteria 2939
1780 Ga0496126_0087925 3300048929 Bacteria 2738
1781 Ga0496126_0093482 3300048929 Bacteria 2640
1782 Ga0496126_0116424 3300048929 Bacteria 2323
1783 Ga0496126_0260512 3300048929 Bacteria 1442
1784 Ga0496126_0314267 3300048929 Bacteria 1289
1785 Ga0496126_0747877 3300048929 Bacteria 755
1786 Ga0496126_1230397 3300048929 Unclassified 549
1787 Ga0495682_0024737 3300049460 Bacteria 2237
1788 Ga0495682_0308087 3300049460 Bacteria 558
1789 Ga0501290_002163 3300049513 Bacteria 2560
1790 Ga0501291_012107 3300049514 Bacteria 1255
1791 Ga0501292_011533 3300049515 Bacteria 1338
1792 Ga0501297_003309 3300049520 Bacteria 1598
1793 Ga0501299_010759 3300049522 Bacteria 1533
1794 Ga0501300_012715 3300049523 Bacteria 1226
1795 Ga0501300_015106 3300049523 Bacteria 1128
1796 Ga0501301_005144 3300049524 Unclassified 950
1797 Ga0501303_000456 3300049526 Bacteria 3233
1798 Ga0501031_0042997 3300049568 Bacteria 2949
1799 Ga0501031_0187223 3300049568 Bacteria 1352
1800 Ga0501031_0224307 3300049568 Bacteria 1223
1801 Ga0501031_0294730 3300049568 Bacteria 1051
1802 Ga0501031_0637556 3300049568 Bacteria 685
1803 Ga0501032_0005248 3300049569 Bacteria 9638
1804 Ga0501032_0157886 3300049569 Bacteria 1489
1805 Ga0501032_0261284 3300049569 Bacteria 1122
1806 Ga0501032_0482849 3300049569 Bacteria 792
1807 Ga0501032_0675125 3300049569 Bacteria 655
1808 Ga0501033_0003930 3300049570 Bacteria 12056
1809 Ga0501033_0006647 3300049570 Bacteria 9043
1810 Ga0501033_0058533 3300049570 Bacteria 2846
1811 Ga0501033_0196932 3300049570 Bacteria 1440
1812 Ga0501033_0210910 3300049570 Bacteria 1385
1813 Ga0501033_0229707 3300049570 Bacteria 1318
1814 Ga0501033_0279538 3300049570 Bacteria 1178
1815 Ga0501033_0453406 3300049570 Bacteria 890
1816 Ga0501033_0758861 3300049570 Bacteria 657
1817 Ga0501034_0012031 3300049571 Bacteria 8944
1818 Ga0501034_0018190 3300049571 Bacteria 7209
1819 Ga0501034_0018287 3300049571 Bacteria 7188
1820 Ga0501034_0078724 3300049571 Bacteria 3300
1821 Ga0501034_0276118 3300049571 Bacteria 1620
1822 Ga0501034_0374074 3300049571 Bacteria 1350
1823 Ga0501034_0394074 3300049571 Bacteria 1308
1824 Ga0501034_0409826 3300049571 Bacteria 1277
1825 Ga0501034_0435498 3300049571 Bacteria 1230
1826 Ga0501034_0452087 3300049571 Bacteria 1202
1827 Ga0501034_0453937 3300049571 Bacteria 1199
1828 Ga0501034_0478568 3300049571 Bacteria 1161
1829 Ga0501034_1217086 3300049571 Bacteria 631
1830 Ga0501036_0003926 3300049572 Bacteria 11944
1831 Ga0501036_0040536 3300049572 Bacteria 3938
1832 Ga0501036_0070148 3300049572 Bacteria 2963
1833 Ga0501036_0206756 3300049572 Bacteria 1650
1834 Ga0501036_0224572 3300049572 Bacteria 1576
1835 Ga0501036_0347329 3300049572 Bacteria 1239
1836 Ga0501036_0360201 3300049572 Bacteria 1214
1837 Ga0501036_0417502 3300049572 Bacteria 1119
1838 Ga0501036_0893015 3300049572 Bacteria 729
1839 Ga0501037_0009503 3300049573 Bacteria 7135
1840 Ga0501037_0060761 3300049573 Bacteria 2756
1841 Ga0501037_0100313 3300049573 Bacteria 2090
1842 Ga0501037_0151115 3300049573 Bacteria 1659
1843 Ga0501037_0210791 3300049573 Bacteria 1370
1844 Ga0501037_0297924 3300049573 Bacteria 1120
1845 Ga0501037_0729778 3300049573 Bacteria 657
1846 Ga0501038_0212787 3300049574 Bacteria 1545
1847 Ga0501038_0233687 3300049574 Bacteria 1462
1848 Ga0501038_0278808 3300049574 Bacteria 1316
1849 Ga0501038_0302303 3300049574 Bacteria 1255
1850 Ga0501038_0356840 3300049574 Bacteria 1137
1851 Ga0501038_0506120 3300049574 Bacteria 923
1852 Ga0501038_0890210 3300049574 Bacteria 657
1853 Ga0501038_0964018 3300049574 Bacteria 627
1854 Ga0501039_0237723 3300049575 Bacteria 1432
1855 Ga0501039_0408793 3300049575 Bacteria 1066
1856 Ga0501039_0417692 3300049575 Bacteria 1053
1857 Ga0501040_0047584 3300049576 Bacteria 2928
1858 Ga0501040_0158049 3300049576 Bacteria 1601
1859 Ga0501041_0114858 3300049577 Bacteria 1671
1860 Ga0501042_0154610 3300049578 Bacteria 1654
1861 Ga0501042_0461124 3300049578 Bacteria 922
1862 Ga0501043_0008514 3300049579 Bacteria 8078
1863 Ga0501043_0011933 3300049579 Bacteria 6798
1864 Ga0501043_0158651 3300049579 Bacteria 1768
1865 Ga0501043_0251336 3300049579 Bacteria 1362
1866 Ga0501043_0275616 3300049579 Bacteria 1290
1867 Ga0501043_0389839 3300049579 Bacteria 1053
1868 Ga0501043_0694927 3300049579 Bacteria 743
1869 Ga0501043_0853655 3300049579 Bacteria 655
1870 Ga0501043_0958920 3300049579 Bacteria 611
1871 Ga0501046_0085149 3300049580 Bacteria 2437
1872 Ga0501046_0131819 3300049580 Bacteria 1895
1873 Ga0501046_0136599 3300049580 Bacteria 1857
1874 Ga0501046_0182480 3300049580 Bacteria 1568
1875 Ga0501046_0232506 3300049580 Bacteria 1361
1876 Ga0501046_0566742 3300049580 Bacteria 808
1877 Ga0501046_0642967 3300049580 Bacteria 750
1878 Ga0501046_1102730 3300049580 Bacteria 548
1879 Ga0501047_0000871 3300049581 Bacteria 30824
1880 Ga0501047_0007264 3300049581 Bacteria 10411
1881 Ga0501047_0046350 3300049581 Bacteria 4201
1882 Ga0501047_0077786 3300049581 Bacteria 3190
1883 Ga0501047_0141276 3300049581 Bacteria 2286
1884 Ga0501047_0264368 3300049581 Bacteria 1567
1885 Ga0501047_0460159 3300049581 Bacteria 1101
1886 Ga0501047_0612786 3300049581 Bacteria 909
1887 Ga0501047_0875985 3300049581 Bacteria 711
1888 Ga0501048_0153706 3300049582 Bacteria 1627
1889 Ga0501048_0197090 3300049582 Bacteria 1427
1890 Ga0501048_0207595 3300049582 Bacteria 1389
1891 Ga0501048_0240900 3300049582 Bacteria 1283
1892 Ga0501048_0262756 3300049582 Bacteria 1226
1893 Ga0501048_0333703 3300049582 Bacteria 1080
1894 Ga0501048_1378230 3300049582 Bacteria 507
1895 Ga0501067_0007394 3300049583 Bacteria 6102
1896 Ga0501067_0094222 3300049583 Bacteria 1662
1897 Ga0501067_0181747 3300049583 Bacteria 1171
1898 Ga0501067_0184014 3300049583 Bacteria 1163
1899 Ga0501067_0290608 3300049583 Bacteria 910
1900 Ga0501067_0398778 3300049583 Bacteria 767
1901 Ga0501067_0788631 3300049583 Bacteria 535
1902 Ga0501068_0032654 3300049584 Bacteria 3095
1903 Ga0501068_0128338 3300049584 Bacteria 1584
1904 Ga0501068_0133172 3300049584 Bacteria 1555
1905 Ga0501068_0142359 3300049584 Bacteria 1503
1906 Ga0501068_0191421 3300049584 Bacteria 1295
1907 Ga0501068_0286001 3300049584 Bacteria 1054
1908 Ga0501068_0294585 3300049584 Bacteria 1038
1909 Ga0501068_0468489 3300049584 Bacteria 816
1910 Ga0501068_0608742 3300049584 Bacteria 712
1911 Ga0501068_1179622 3300049584 Bacteria 507
1912 Ga0501069_0052068 3300049585 Bacteria 2279
1913 Ga0501069_0100280 3300049585 Bacteria 1643
1914 Ga0501069_0132567 3300049585 Bacteria 1427
1915 Ga0501069_0137949 3300049585 Bacteria 1398
1916 Ga0501069_0147779 3300049585 Bacteria 1349
1917 Ga0501069_0153209 3300049585 Bacteria 1325
1918 Ga0501069_0157826 3300049585 Bacteria 1305
1919 Ga0501069_0359817 3300049585 Bacteria 858
1920 Ga0501069_0661500 3300049585 Bacteria 629
1921 Ga0501070_0004207 3300049586 Bacteria 12374
1922 Ga0501070_0019671 3300049586 Bacteria 5661
1923 Ga0501070_0104408 3300049586 Bacteria 2343
1924 Ga0501070_0144794 3300049586 Bacteria 1961
1925 Ga0501070_0250350 3300049586 Bacteria 1449
1926 Ga0501070_0264484 3300049586 Bacteria 1405
1927 Ga0501070_0267208 3300049586 Bacteria 1397
1928 Ga0501070_0303880 3300049586 Bacteria 1299
1929 Ga0501070_0346429 3300049586 Bacteria 1206
1930 Ga0501070_0473861 3300049586 Bacteria 1007
1931 Ga0501070_0478785 3300049586 Bacteria 1001
1932 Ga0501070_0580424 3300049586 Bacteria 895
1933 Ga0501070_0901138 3300049586 Bacteria 690
1934 Ga0501071_0056312 3300049587 Bacteria 2839
1935 Ga0501071_0145173 3300049587 Bacteria 1768
1936 Ga0501071_0248402 3300049587 Bacteria 1342
1937 Ga0501071_0507777 3300049587 Bacteria 925
1938 Ga0501072_0331229 3300049588 Bacteria 1209
1939 Ga0501072_0877459 3300049588 Bacteria 701
1940 Ga0501072_0890574 3300049588 Bacteria 695
1941 Ga0501073_0009716 3300049589 Bacteria 7085
1942 Ga0501073_0039852 3300049589 Bacteria 3327
1943 Ga0501073_0052370 3300049589 Bacteria 2858
1944 Ga0501073_0126391 3300049589 Bacteria 1772
1945 Ga0501073_0127091 3300049589 Bacteria 1767
1946 Ga0501073_0187241 3300049589 Bacteria 1432
1947 Ga0501073_0215075 3300049589 Bacteria 1328
1948 Ga0501073_0228273 3300049589 Bacteria 1286
1949 Ga0501073_0322388 3300049589 Bacteria 1066
1950 Ga0501073_0330941 3300049589 Bacteria 1051
1951 Ga0501074_0003848 3300049590 Bacteria 10682
1952 Ga0501074_0031110 3300049590 Bacteria 3867
1953 Ga0501074_0162839 3300049590 Bacteria 1593
1954 Ga0501074_0176743 3300049590 Bacteria 1523
1955 Ga0501074_0211620 3300049590 Bacteria 1381
1956 Ga0501074_0306959 3300049590 Bacteria 1127
1957 Ga0501074_0409578 3300049590 Bacteria 961
1958 Ga0501074_0983014 3300049590 Bacteria 593
1959 Ga0501074_1114326 3300049590 Bacteria 554
1960 Ga0501075_0253977 3300049591 Bacteria 1340
1961 Ga0501075_0289658 3300049591 Bacteria 1247
1962 Ga0501075_0766317 3300049591 Unclassified 734
1963 Ga0501075_1265879 3300049591 Unclassified 559
1964 Ga0501076_0149267 3300049592 Bacteria 1901
1965 Ga0501076_0255439 3300049592 Bacteria 1434
1966 Ga0501076_0270772 3300049592 Bacteria 1391
1967 Ga0501076_0319768 3300049592 Bacteria 1273
1968 Ga0501076_1489989 3300049592 Bacteria 556
1969 Ga0501077_0191137 3300049593 Bacteria 1300
1970 Ga0501077_0504840 3300049593 Bacteria 775
1971 Ga0501206_008985 3300049653 Bacteria 1325
1972 Ga0501207_017112 3300049654 Bacteria 1129
1973 Ga0501207_094430 3300049654 Unclassified 592
1974 Ga0501217_029043 3300049661 Bacteria 1350
1975 Ga0501222_044291 3300049662 Bacteria 639
1976 Ga0501223_001599 3300049663 Bacteria 5214
1977 Ga0501224_003560 3300049664 Bacteria 2180
1978 Ga0501235_020919 3300049669 Bacteria 1453
1979 Ga0501242_058278 3300049674 Bacteria 582
1980 Ga0501243_080789 3300049675 Bacteria 632
1981 Ga0501249_008312 3300049679 Bacteria 2154
1982 Ga0501253_035166 3300049683 Bacteria 979
1983 Ga0501257_140500 3300049686 Unclassified 659
1984 Ga0501259_018031 3300049688 Unclassified 1229
1985 Ga0501221_092574 3300049704 Bacteria 741
1986 Ga0501079_0236393 3300049741 Bacteria 1427
1987 Ga0501079_0266410 3300049741 Bacteria 1339
1988 Ga0501079_0283211 3300049741 Bacteria 1296
1989 Ga0501079_0336290 3300049741 Bacteria 1183
1990 Ga0501079_0359761 3300049741 Bacteria 1140
1991 Ga0501079_0890373 3300049741 Bacteria 701
1992 Ga0501080_0029683 3300049742 Bacteria 5089
1993 Ga0501080_0093232 3300049742 Bacteria 2796
1994 Ga0501080_0152621 3300049742 Bacteria 2134
1995 Ga0501080_0351650 3300049742 Bacteria 1330
1996 Ga0501080_0362097 3300049742 Bacteria 1308
1997 Ga0501080_0411182 3300049742 Bacteria 1216
1998 Ga0501080_0487863 3300049742 Bacteria 1102
1999 Ga0501080_0527277 3300049742 Bacteria 1053
2000 Ga0501080_0807315 3300049742 Bacteria 822
2001 Ga0501080_1372695 3300049742 Bacteria 603
2002 Ga0501080_1659446 3300049742 Bacteria 540
2003 Ga0501081_0049115 3300049743 Bacteria 2904
2004 Ga0501081_0330800 3300049743 Bacteria 1121
2005 Ga0501083_0052551 3300049744 Bacteria 2737
2006 Ga0501083_0091803 3300049744 Bacteria 2004
2007 Ga0501083_0122975 3300049744 Bacteria 1702
2008 Ga0501083_0209832 3300049744 Bacteria 1270
2009 Ga0501083_0277836 3300049744 Bacteria 1089
2010 Ga0501083_0327228 3300049744 Bacteria 996
2011 Ga0501083_0347540 3300049744 Bacteria 964
2012 Ga0501083_0548255 3300049744 Bacteria 752
2013 Ga0501262_001134 3300049759 Bacteria 3024
2014 Ga0501263_020663 3300049760 Unclassified 884
2015 Ga0501266_013527 3300049763 Bacteria 1063
2016 Ga0501268_013370 3300049765 Bacteria 1325
2017 Ga0501271_043772 3300049768 Unclassified 590
2018 Ga0501282_000529 3300049778 Bacteria 4520
2019 Ga0501283_012729 3300049779 Bacteria 1268
2020 Ga0501035_0009620 3300049822 Bacteria 8990
2021 Ga0501035_0081675 3300049822 Bacteria 2852
2022 Ga0501035_0133888 3300049822 Bacteria 2159
2023 Ga0501035_0160257 3300049822 Bacteria 1948
2024 Ga0501035_0176522 3300049822 Bacteria 1842
2025 Ga0501035_0194310 3300049822 Bacteria 1743
2026 Ga0501035_0196283 3300049822 Bacteria 1733
2027 Ga0501035_0248552 3300049822 Bacteria 1511
2028 Ga0501035_0569952 3300049822 Bacteria 925
2029 Ga0501035_0645723 3300049822 Bacteria 858
2030 Ga0501035_1340629 3300049822 Bacteria 550
2031 Ga0501044_0019807 3300049823 Bacteria 7188
2032 Ga0501044_0095123 3300049823 Bacteria 3002
2033 Ga0501044_0130311 3300049823 Bacteria 2509
2034 Ga0501044_0218051 3300049823 Bacteria 1859
2035 Ga0501044_0284531 3300049823 Bacteria 1586
2036 Ga0501044_0331436 3300049823 Bacteria 1445
2037 Ga0501044_0349886 3300049823 Bacteria 1397
2038 Ga0501044_0351835 3300049823 Bacteria 1392
2039 Ga0501044_0372952 3300049823 Bacteria 1343
2040 Ga0501044_0384319 3300049823 Bacteria 1318
2041 Ga0501044_0549905 3300049823 Bacteria 1051
2042 Ga0501044_0647803 3300049823 Bacteria 946
2043 Ga0501044_1249745 3300049823 Bacteria 610
2044 Ga0501044_1454529 3300049823 Bacteria 550
2045 Ga0501044_1501762 3300049823 Bacteria 539
2046 Ga0501045_0135952 3300049824 Bacteria 1827
2047 Ga0501045_0159364 3300049824 Bacteria 1679
2048 Ga0501045_1103343 3300049824 Bacteria 580
2049 Ga0501045_1347057 3300049824 Bacteria 519
2050 Ga0501212_056318 3300049851 Unclassified 673
2051 Ga0501226_000708 3300049853 Bacteria 4512
2052 Ga0501226_001034 3300049853 Bacteria 3618
2053 Ga0501226_008827 3300049853 Bacteria 1124
2054 nmdc:mga03n38_422580_c1 3300050490 Bacteria 737
2055 nmdc:mga00v17_1034712_c1 3300050491 Bacteria 516
2056 nmdc:mga00v17_1039400_c1 3300050491 Bacteria 514
2057 nmdc:mga00v17_134419_c2 3300050491 Bacteria 1104
2058 nmdc:mga00v17_151397_c1 3300050491 Bacteria 1491
2059 nmdc:mga0yw44_217286_c1 3300050492 Bacteria 1266
2060 nmdc:mga0yw44_696900_c1 3300050492 Bacteria 690
2061 nmdc:mga0k408_870450_c1 3300050493 Bacteria 523
2062 nmdc:mga06z11_1031203_c1 3300050494 Bacteria 501
2063 nmdc:mga06z11_149914_c1 3300050494 Bacteria 1325
2064 nmdc:mga06z11_30542_c1 3300050494 Bacteria 2608
2065 nmdc:mga07m45_582228_c1 3300050496 Bacteria 646
2066 nmdc:mga09592_377565_c1 3300050508 Bacteria 1226
2067 nmdc:mga06r32_225414_c1 3300050510 Bacteria 1863
2068 nmdc:mga08y16_1987945_c1 3300050511 Bacteria 531
2069 nmdc:mga08y16_432759_c1 3300050511 Bacteria 1343
2070 nmdc:mga0n895_302608_c1 3300050512 Bacteria 1621
2071 nmdc:mga0n895_339760_c1 3300050512 Bacteria 1521
2072 nmdc:mga0rr50_1166683_c1 3300050513 Bacteria 655
2073 nmdc:mga0rr50_1519982_c1 3300050513 Bacteria 566
2074 nmdc:mga0rr50_233574_c1 3300050513 Bacteria 1522
2075 nmdc:mga0rr50_796287_c1 3300050513 Bacteria 806
2076 nmdc:mga0rr50_798963_c1 3300050513 Bacteria 805
2077 nmdc:mga08x19_232809_c1 3300050514 Bacteria 1268
2078 nmdc:mga0a205_181601_c1 3300050515 Bacteria 1998
2079 Ga0495601_0191242 3300053077 Bacteria 1337
2080 Ga0495601_0191747 3300053077 Bacteria 1335
2081 Ga0495601_0313586 3300053077 Bacteria 1021
2082 Ga0495601_0360455 3300053077 Bacteria 945
2083 Ga0495601_1007270 3300053077 Unclassified 524
2084 Ga0495612_0078028 3300053078 Bacteria 1388
2085 Ga0495612_0597991 3300053078 Bacteria 510
2086 Ga0495655_0020494 3300053083 Bacteria 1484
2087 Ga0495595_0101138 3300053084 Bacteria 1391
2088 Ga0495595_0113859 3300053084 Bacteria 1313
2089 Ga0495595_0317060 3300053084 Bacteria 785
2090 Ga0495619_0109636 3300053085 Bacteria 1885
2091 Ga0495619_0168624 3300053085 Bacteria 1513
2092 Ga0495619_0239089 3300053085 Bacteria 1258
2093 Ga0500578_0138896 3300053086 Bacteria 1520
2094 Ga0500646_0022176 3300053090 Unclassified 1697
2095 Ga0500566_0008223 3300053094 Bacteria 6176
2096 Ga0500650_0109508 3300053098 Bacteria 1289
2097 Ga0500558_068157 3300053106 Bacteria 1473
2098 Ga0500562_025143 3300053108 Bacteria 1557
2099 Ga0500569_020710 3300053109 Bacteria 1729
2100 Ga0500572_092276 3300053111 Bacteria 960
2101 Ga0500594_0045313 3300053118 Bacteria 1219
2102 Ga0500594_0158061 3300053118 Unclassified 731
2103 Ga0500595_025654 3300053119 Bacteria 2040
2104 Ga0500614_246496 3300053123 Bacteria 557
2105 Ga0500628_025556 3300053129 Unclassified 1236
2106 Ga0500642_0262637 3300053130 Bacteria 790
2107 Ga0500658_0006423 3300053134 Bacteria 4361
2108 Ga0500658_0039664 3300053134 Bacteria 1883
2109 Ga0500559_0107805 3300053136 Bacteria 1288
2110 Ga0500568_0145071 3300053139 Bacteria 879
2111 Ga0500577_0372171 3300053142 Bacteria 625
2112 Ga0500586_035469 3300053145 Bacteria 1668
2113 Ga0500588_0167673 3300053146 Unclassified 802
2114 Ga0500604_0006346 3300053151 Bacteria 3126
2115 Ga0500616_0081831 3300053153 Bacteria 1621
2116 Ga0500616_0128429 3300053153 Bacteria 1200
2117 Ga0500616_0169140 3300053153 Bacteria 994
2118 Ga0500627_0081787 3300053158 Bacteria 1440
2119 Ga0500627_0318400 3300053158 Bacteria 676
2120 Ga0500636_0164114 3300053177 Bacteria 1208
2121 Ga0500636_0302320 3300053177 Bacteria 787
2122 Ga0500611_018656 3300053727 Bacteria 1283
2123 Ga0500645_051354 3300053730 Bacteria 1203
2124 Ga0500645_103754 3300053730 Bacteria 801
2125 Ga0500596_005955 3300053735 Bacteria 2101
2126 Ga0500587_044374 3300053739 Bacteria 645
2127 Ga0501084_0020392 3300054114 Bacteria 5528
2128 Ga0501084_0416242 3300054114 Bacteria 1136
2129 Ga0501084_0508209 3300054114 Bacteria 1018
2130 Ga0501084_0841112 3300054114 Bacteria 772
2131 Ga0501084_1196443 3300054114 Bacteria 637
2132 Ga0501082_0379787 3300060353 Bacteria 1233
2133 Ga0501082_0798703 3300060353 Bacteria 825
2134 Ga0501082_0914199 3300060353 Bacteria 767
2135 Ga0466962_0114097 3300061719 Bacteria 1301
2136 Ga0530510_0138411 3300061734 Bacteria 1793
2137 Ga0530510_0180204 3300061734 Bacteria 1566
2138 Ga0530510_0843003 3300061734 Unclassified 700
2139 2510893835 2510461076 Bacteria 8618824
2140 2513577259 2513237085 Bacteria 7695351
2141 2513581453 2513237085 Bacteria 7695351
2142 2513707018 2513237102 Bacteria 7703324
2143 2513720658 2513237104 Bacteria 10034502
2144 2513930638 2513237146 Bacteria 7166346
2145 2585169661 2582581283 Bacteria 6030556
2146 2599336066 2599185156 Bacteria 5403036
2147 2599722235 2599185236 Bacteria 6875203
2148 2617380036 2617270741 Bacteria 8201522
2149 2644191438 2643221634 Bacteria 6705461
2150 2644493881 2643221688 Bacteria 5260751
2151 2719383372 2718217927 Bacteria 6972593
2152 2719383454 2718217927 Bacteria 6972593
2153 2719383536 2718217927 Bacteria 6972593
2154 2719383582 2718217927 Bacteria 6972593
2155 2719383689 2718217927 Bacteria 6972593
2156 2719384468 2718217927 Bacteria 6972593
2157 2721399385 2718218423 Bacteria 6438183
2158 2724038198 2721755809 Bacteria 6438790
2159 2738723763 2738541277 Bacteria 7458140
2160 2739037615 2738541333 Bacteria 7106503
2161 2739284494 2738543019 Bacteria 7459457
2162 2748017038 2747842501 Bacteria 5293829
2163 2748017498 2747842501 Bacteria 5293829
2164 2753461395 2751185821 Bacteria 6189929
2165 2766063961 2765235942 Bacteria 7445910
2166 2776266503 2775506901 Bacteria 9631051
2167 2776268344 2775506902 Bacteria 6208009
2168 2793331764 2791355261 Bacteria 6661293
2169 2824618783 2824617872 Bacteria 8814715
2170 2824628889 2824626560 Bacteria 8813858
2171 2824638400 2824635225 Bacteria 8785348
2172 2824647582 2824644064 Bacteria 8743947
2173 2824717702 2824714736 Bacteria 8717648
2174 2824725991 2824723954 Bacteria 8758240
2175 2842083805 2842077413 Bacteria 6508645
2176 2842211484 2842205361 Bacteria 6340321
2177 2842284938 2842278818 Bacteria 6340002
2178 2842311084 2842304105 Bacteria 7023636
2179 2842316309 2842311132 Bacteria 6616990
2180 2842402383 2842395702 Bacteria 6780583
2181 2842454507 2842447887 Bacteria 6754142
2182 2842927522 2842922631 Bacteria 5824079
2183 2854911494 2854911287 Bacteria 5582813
2184 2857533423 2857531043 Bacteria 6754041
2185 2881369912 2881364244 Bacteria 7710352
2186 2885197662 2885192300 Bacteria 5882526
2187 2885371719 2885366525 Bacteria 8326213
2188 2885375810 2885374607 Bacteria 8927485
2189 2894238267 2894232714 Bacteria 8834183
2190 2899849594 2899845264 Bacteria 5672268
2191 2904480462 2904479285 Bacteria 5073931
2192 2904482114 2904479285 Bacteria 5073931
2193 2904483661 2904479285 Bacteria 5073931
2194 2906614864
2195 2906615356
2196 2906615643
2197 2906618289
2198 2915651348 2915650412 Bacteria 4288180
2199 2919124275 2919119836 Bacteria 5208557
2200 2919124354 2919119836 Bacteria 5208557
2201 2919679068 2919675420 Bacteria 3969095
2202 2928972420 2928968154 Bacteria 4633371
2203 3005451794 3005445848 Bacteria 6906074
2204 8005276592 8005275841 Bacteria 6929066
2205 8005276677 8005275841 Bacteria 6929066
2206 8005276763 8005275841 Bacteria 6929066
2207 8005276807 8005275841 Bacteria 6929066
2208 8005276909 8005275841 Bacteria 6929066
2209 8019648901 8019648815 Bacteria 10014479
2210 8019687826 8019678201 Bacteria 8863603
2211 8057881260 8057874678 Bacteria 7494653
2212 Ga0105248_11851723
2213 CNAas_1002737
2214 JGI24747J21853_1019306
2215 JGI24740J21852_10154184
2216 JGI24750J21931_1008344
2217 JGI24750J21931_1049781
2218 JGI24748J21848_1007479
2219 JGI24748J21848_1021846
2220 JGI24749J21850_1010864
2221 JGI24749J21850_1045135
2222 JGI24744J21845_10026855
2223 JGI24033J26618_1035970
2224 JGI24034J26672_10011309
2225 JGI24742J22300_10015481
2226 JGI24742J22300_10015711
2227 JGI24751J29686_10099474
2228 JGI24751J29686_10101126
2229 JGI25150J39212_1015910
2230 JGI25159J45721_1022579
2231 rootH2_10023835
2232 rootH2_10077013
2233 rootL2_10232720
2234 rootH1_10054396
2235 rootH1_10156375
2236 JGI25160J50197_1089346
2237 Ga0006562J51391_1021829
2238 Ga0055526_1023784
2239 Ga0055526_1029595
2240 Ga0055537_1016604
2241 Ga0055524_1071201
2242 Ga0055524_1071265
2243 Ga0055536_1059387
2244 Ga0055534_1017639
2245 Ga0055528_1065723
2246 Ga0055528_1065782
2247 Ga0055530_10035639
2248 Ga0058692_1001917
2249 JGI25405J52794_10024828
2250 Ga0065712_10780520
2251 Ga0065715_10015161
2252 Ga0070658_10124014
2253 Ga0070658_10858739
2254 Ga0070658_11107294
2255 Ga0070658_11608920
2256 Ga0070676_10051740
2257 Ga0070676_10068180
2258 Ga0070676_10154730
2259 Ga0070676_10501380
2260 Ga0070676_10544907
2261 Ga0070676_11147935
2262 Ga0070683_100082772
2263 Ga0070683_100282219
2264 Ga0070683_100321487
2265 Ga0070683_100395674
2266 Ga0070683_100785927
2267 Ga0070683_101159199
2268 Ga0070683_101541339
2269 Ga0070690_100096765
2270 Ga0070690_100108055
2271 Ga0070690_100280899
2272 Ga0070690_100355078
2273 Ga0070690_100556223
2274 Ga0070690_101393984
2275 Ga0070690_101536822
2276 Ga0070670_100187330
2277 Ga0070670_100225720
2278 Ga0070670_100280892
2279 Ga0070670_100422453
2280 Ga0070670_101554017
2281 Ga0070670_101924988
2282 Ga0070677_10082651
2283 Ga0070677_10096451
2284 Ga0070677_10291468
2285 Ga0070677_10661396
2286 Ga0070677_10814696
2287 Ga0068869_100541730
2288 Ga0068869_101324623
2289 Ga0068869_101360188
2290 Ga0070666_10342575
2291 Ga0070666_10422167
2292 Ga0070666_10561302
2293 Ga0070666_10749516
2294 Ga0070666_10949497
2295 Ga0070680_100246940
2296 Ga0070680_100374091
2297 Ga0070680_101531973
2298 Ga0070682_100138542
2299 Ga0070682_100186969
2300 Ga0070682_100303170
2301 Ga0070682_100389439
2302 Ga0070682_100511241
2303 Ga0070682_100910926
2304 Ga0070682_101129308
2305 Ga0068868_100239665
2306 Ga0068868_100438758
2307 Ga0068868_101104804
2308 Ga0070660_100138296
2309 Ga0070660_100226383
2310 Ga0070660_100255987
2311 Ga0070660_100281025
2312 Ga0070660_101018482
2313 Ga0070689_100131776
2314 Ga0070689_100182518
2315 Ga0070689_100237098
2316 Ga0070689_100263329
2317 Ga0070689_100307645
2318 Ga0070691_10087471
2319 Ga0070691_10548290
2320 Ga0070691_10775764
2321 Ga0070687_100154356
2322 Ga0070687_100215447
2323 Ga0070687_100246019
2324 Ga0070687_100834874
2325 Ga0070661_100215295
2326 Ga0070661_100428724
2327 Ga0070661_101393085
2328 Ga0070692_11256858
2329 Ga0070668_100036900
2330 Ga0070668_100202767
2331 Ga0070668_100223535
2332 Ga0070668_100432266
2333 Ga0070668_100622872
2334 Ga0070668_100710920
2335 Ga0070668_100939626
2336 Ga0070668_101563063
2337 Ga0070668_101824250
2338 Ga0070669_100139543
2339 Ga0070669_100264300
2340 Ga0070669_100800123
2341 Ga0070669_101880248
2342 Ga0070675_100257815
2343 Ga0070675_100441898
2344 Ga0070675_100886082
2345 Ga0070675_101004375
2346 Ga0070675_101416461
2347 Ga0070675_101612126
2348 Ga0070675_101801909
2349 Ga0070671_100155121
2350 Ga0070671_100159025
2351 Ga0070671_101369437
2352 Ga0070671_101739141
2353 Ga0070674_100178188
2354 Ga0070674_100211510
2355 Ga0070674_100269575
2356 Ga0070674_100280377
2357 Ga0070674_100284263
2358 Ga0070674_100992231
2359 Ga0070674_101829734
2360 Ga0070673_100218792
2361 Ga0070673_100249840
2362 Ga0070673_100695017
2363 Ga0070673_100981672
2364 Ga0070688_100059557
2365 Ga0070688_100238065
2366 Ga0070688_100321332
2367 Ga0070688_100369152
2368 Ga0070688_101665974
2369 Ga0070659_100291239
2370 Ga0070659_100315096
2371 Ga0070659_100414742
2372 Ga0070659_101375429
2373 Ga0070667_100056812
2374 Ga0070667_100394719
2375 Ga0070667_100817664
2376 Ga0070667_100869401
2377 Ga0070703_10050110
2378 Ga0070709_10007373
2379 Ga0070709_10183406
2380 Ga0070709_10211288
2381 Ga0070709_10480528
2382 Ga0070709_10989269
2383 Ga0070709_11005027
2384 Ga0070709_11514537
2385 Ga0070714_100039508
2386 Ga0070714_100103084
2387 Ga0070714_100214295
2388 Ga0070714_100278380
2389 Ga0070714_100321287
2390 Ga0070714_100345328
2391 Ga0070714_100350934
2392 Ga0070714_100354790
2393 Ga0070714_101002269
2394 Ga0070714_101192174
2395 Ga0070714_101322109
2396 Ga0070714_102114060
2397 Ga0070714_102200768
2398 Ga0070713_100253604
2399 Ga0070713_100262123
2400 Ga0070713_100264595
2401 Ga0070713_100374415
2402 Ga0070713_100375535
2403 Ga0070713_100483323
2404 Ga0070713_100570730
2405 Ga0070713_100787429
2406 Ga0070713_101095290
2407 Ga0070713_101121674
2408 Ga0070713_101210100
2409 Ga0070713_101222213
2410 Ga0070713_101748095
2411 Ga0070713_102120998
2412 Ga0070710_10042070
2413 Ga0070710_10099555
2414 Ga0070710_10152482
2415 Ga0070710_10225805
2416 Ga0070710_10618977
2417 Ga0070710_11101183
2418 Ga0070701_10031901
2419 Ga0070701_11352137
2420 Ga0070711_100135248
2421 Ga0070711_100259873
2422 Ga0070711_100361775
2423 Ga0070711_100534772
2424 Ga0070711_100728846
2425 Ga0070711_101076548
2426 Ga0070711_101366900
2427 Ga0070711_101784635
2428 Ga0070705_100530233
2429 Ga0070700_100093317
2430 Ga0070700_100211477
2431 Ga0070700_100256618
2432 Ga0070700_100393429
2433 Ga0070694_100270217
2434 Ga0070694_100315366
2435 Ga0070708_100221416
2436 Ga0070708_100485897
2437 Ga0070708_101029774
2438 Ga0070708_101368530
2439 Ga0070708_101620701
2440 Ga0070663_100062297
2441 Ga0070663_100194381
2442 Ga0070663_100224723
2443 Ga0070663_100275601
2444 Ga0070663_100357689
2445 Ga0070663_100381793
2446 Ga0070663_100558775
2447 Ga0070663_101009936
2448 Ga0070663_101230295
2449 Ga0070663_101750475
2450 Ga0070678_100067725
2451 Ga0070678_100163166
2452 Ga0070678_100238069
2453 Ga0070678_100360294
2454 Ga0070678_100472704
2455 Ga0070678_100984417
2456 Ga0070662_100164042
2457 Ga0070662_100227482
2458 Ga0070662_100313889
2459 Ga0070662_100352041
2460 Ga0070662_100471016
2461 Ga0070662_100939296
2462 Ga0070681_10064911
2463 Ga0070681_10218494
2464 Ga0070681_10231301
2465 Ga0070681_10249129
2466 Ga0070681_10290308
2467 Ga0070681_10584768
2468 Ga0070681_11005594
2469 Ga0068867_100159997
2470 Ga0068867_100164031
2471 Ga0068867_100327321
2472 Ga0068867_100732032
2473 Ga0068867_101511345
2474 Ga0068867_102278151
2475 Ga0070685_10108330
2476 Ga0070685_10311014
2477 Ga0070685_10914670
2478 Ga0070706_100061903
2479 Ga0070706_100448732
2480 Ga0070706_101340202
2481 Ga0070707_100212441
2482 Ga0070707_100310197
2483 Ga0070707_100489432
2484 Ga0070698_100126881
2485 Ga0070698_100294574
2486 Ga0070698_100299611
2487 Ga0070698_100380620
2488 Ga0070698_101714401
2489 Ga0070699_100083325
2490 Ga0070699_100385025
2491 Ga0070699_100813820
2492 Ga0070699_101052286
2493 Ga0070699_101214851
2494 Ga0070679_100015955
2495 Ga0070679_100325124
2496 Ga0070679_101583424
2497 Ga0070684_100334507
2498 Ga0070684_100429803
2499 Ga0070684_100662915
2500 Ga0070684_101362088
2501 Ga0070684_101536390
2502 Ga0070684_101862982
2503 Ga0070684_102197908
2504 Ga0070684_102330390
2505 Ga0070697_100143250
2506 Ga0070697_100186018
2507 Ga0070697_100344910
2508 Ga0070697_100449806
2509 Ga0068853_100253025
2510 Ga0068853_100300369
2511 Ga0068853_100338471
2512 Ga0068853_100403701
2513 Ga0068853_100537465
2514 Ga0068853_100610392
2515 Ga0068853_101981645
2516 Ga0070672_100182458
2517 Ga0070672_100187632
2518 Ga0070672_100190547
2519 Ga0070672_100209362
2520 Ga0070672_100234742
2521 Ga0070672_100359123
2522 Ga0070672_100862265
2523 Ga0070672_102088004
2524 Ga0070686_100094323
2525 Ga0070686_100239382
2526 Ga0070686_100243742
2527 Ga0070686_100317851
2528 Ga0070686_100342371
2529 Ga0070686_100678797
2530 Ga0070686_101740701
2531 Ga0070695_100178255
2532 Ga0070696_101015122
2533 Ga0070696_101518869
2534 Ga0070693_100146738
2535 Ga0070693_101405532
2536 Ga0070665_100031069
2537 Ga0070665_100272951
2538 Ga0070665_100319662
2539 Ga0070665_100486099
2540 Ga0070665_100675686
2541 Ga0070665_100740737
2542 Ga0070665_101868720
2543 Ga0070665_102063509
2544 Ga0070704_100133025
2545 Ga0070704_100383689
2546 Ga0070704_100823641
2547 Ga0070704_101774355
2548 Ga0068855_100051034
2549 Ga0068855_100500011
2550 Ga0068855_100694257
2551 Ga0068855_101241199
2552 Ga0068855_102485872
2553 Ga0070664_100050384
2554 Ga0070664_100092878
2555 Ga0070664_101120037
2556 Ga0070664_101491894
2557 Ga0070664_101837897
2558 Ga0070664_102017298
2559 Ga0070664_102367342
2560 Ga0068857_101089966
2561 Ga0068857_101184017
2562 Ga0068857_101189980
2563 Ga0068857_101729938
2564 Ga0068854_100043543
2565 Ga0068854_100187797
2566 Ga0068854_101455686
2567 Ga0068854_102200645
2568 Ga0068856_100085585
2569 Ga0068856_100203240
2570 Ga0068856_100313694
2571 Ga0068856_100319130
2572 Ga0068856_100493371
2573 Ga0068856_100897353
2574 Ga0068856_101008967
2575 Ga0068856_101061294
2576 Ga0068856_101397130
2577 Ga0068856_101698958
2578 Ga0068856_101946195
2579 Ga0068856_102170796
2580 Ga0068856_102240363
2581 Ga0070702_100122363
2582 Ga0070702_100135966
2583 Ga0070702_100206725
2584 Ga0070702_100449184
2585 Ga0070702_100649177
2586 Ga0070702_101587332
2587 Ga0068852_100507673
2588 Ga0068852_100707716
2589 Ga0068852_100812394
2590 Ga0068859_100475036
2591 Ga0068859_100526729
2592 Ga0068859_101242091
2593 Ga0068864_100310363
2594 Ga0068864_100342258
2595 Ga0068864_100708233
2596 Ga0068864_101001942
2597 Ga0068864_101360730
2598 Ga0068866_10064864
2599 Ga0068866_10077897
2600 Ga0068866_10167903
2601 Ga0068866_10602677
2602 Ga0068866_10717140
2603 Ga0068861_100265764
2604 Ga0068861_100286171
2605 Ga0068861_100447604
2606 Ga0068870_10126480
2607 Ga0068870_11409466
2608 Ga0068863_100277736
2609 Ga0068863_100342412
2610 Ga0068863_100393305
2611 Ga0068863_102444477
2612 Ga0068858_100130658
2613 Ga0068858_100220190
2614 Ga0068858_100320711
2615 Ga0068858_100472340
2616 Ga0068860_100168570
2617 Ga0068860_100371272
2618 Ga0068860_100449053
2619 Ga0068860_102792641
2620 Ga0068862_100805172
2621 Ga0068862_101738404
2622 Ga0068862_101869816
2623 Ga0081455_10046286
2624 Ga0081455_10250741
2625 Ga0081540_1017006
2626 Ga0081540_1074102
2627 Ga0081540_1086022
2628 Ga0081539_10114267
2629 Ga0070717_10213997
2630 Ga0070717_10221698
2631 Ga0070717_10256053
2632 Ga0070717_10367959
2633 Ga0070717_10417560
2634 Ga0070717_10421593
2635 Ga0070717_10495798
2636 Ga0070717_11202727
2637 Ga0070717_11769542
2638 Ga0075365_10727129
2639 Ga0075368_10329634
2640 Ga0075368_10391967
2641 Ga0075368_10508771
2642 Ga0075364_10145535
2643 Ga0070715_10031823
2644 Ga0070715_10087313
2645 Ga0070715_10131844
2646 Ga0070715_10135376
2647 Ga0070716_100130300
2648 Ga0070716_100152675
2649 Ga0070716_100165240
2650 Ga0070716_100187164
2651 Ga0070716_100240877
2652 Ga0070716_101216022
2653 Ga0070716_101818830
2654 Ga0070712_100113774
2655 Ga0070712_100124070
2656 Ga0070712_100140936
2657 Ga0070712_100196704
2658 Ga0070712_100300126
2659 Ga0070712_100362005
2660 Ga0070712_100670037
2661 Ga0070712_101854711
2662 Ga0075362_10343762
2663 Ga0075366_10317694
2664 Ga0075366_11028025
2665 Ga0097621_100165706
2666 Ga0097621_100353795
2667 Ga0097621_100509307
2668 Ga0097621_101134455
2669 Ga0097621_101213405
2670 Ga0097621_101624450
2671 Ga0075370_10018351
2672 Ga0075370_10398210
2673 Ga0075370_10479554
2674 Ga0068871_100223343
2675 Ga0068871_100418847
2676 Ga0068871_100503616
2677 Ga0068871_100678043
2678 Ga0068871_100984709
2679 Ga0068871_101200222
2680 Ga0068871_101320802
2681 Ga0068871_101455426
2682 Ga0068871_102181991
2683 Ga0075431_100243693
2684 Ga0075433_10211151
2685 Ga0075434_100342412
2686 Ga0075429_100291936
2687 Ga0075429_101882346
2688 Ga0068865_100117360
2689 Ga0068865_100147778
2690 Ga0068865_100278151
2691 Ga0068865_100337672
2692 Ga0068865_101921967
2693 Ga0075436_100655350
2694 Ga0075436_100791819
2695 Ga0097620_100475015
2696 Ga0097620_100526695
2697 Ga0097620_101241979
2698 Ga0099824_1009340
2699 Ga0099824_1016446
2700 Ga0075435_100204931
2701 Ga0075435_100743455
2702 Ga0075435_100972674
2703 Ga0099795_10058949
2704 Ga0099795_10155021
2705 Ga0105251_10280255
2706 Ga0105250_10000799
2707 Ga0105250_10385126
2708 Ga0105240_10005524
2709 Ga0105240_10210513
2710 Ga0105240_10318713
2711 Ga0105240_10338378
2712 Ga0105240_10537827
2713 Ga0105240_10595819
2714 Ga0105240_11860274
2715 Ga0105240_12489691
2716 Ga0111539_11092854
2717 Ga0111539_12530640
2718 Ga0111539_12566513
2719 Ga0105245_10162924
2720 Ga0105245_10255495
2721 Ga0105245_10264317
2722 Ga0105245_10732320
2723 Ga0105245_10873742
2724 Ga0105245_11170307
2725 Ga0105245_11539172
2726 Ga0105245_12935186
2727 Ga0105245_13045481
2728 Ga0105247_10080414
2729 Ga0105247_10235613
2730 Ga0105247_10741872
2731 Ga0105247_10982490
2732 Ga0105247_11534054
2733 Ga0105247_11672637
2734 Ga0105243_10211452
2735 Ga0105243_10214752
2736 Ga0105243_10227350
2737 Ga0105243_11918131
2738 Ga0105241_10371674
2739 Ga0105241_10450330
2740 Ga0105241_10454709
2741 Ga0105241_10591647
2742 Ga0105241_11053265
2743 Ga0105241_11148391
2744 Ga0105241_11732412
2745 Ga0105241_11817377
2746 Ga0105241_12085585
2747 Ga0105241_12186897
2748 Ga0105241_12365259
2749 Ga0105242_10277795
2750 Ga0105242_10342528
2751 Ga0105242_10626926
2752 Ga0105242_11212483
2753 Ga0105242_11536460
2754 Ga0105248_10250825
2755 Ga0105248_10426812
2756 Ga0105248_10539679
2757 Ga0105248_11904624
2758 Ga0105237_10002325
2759 Ga0105237_10077160
2760 Ga0105237_10161389
2761 Ga0105237_10228725
2762 Ga0105237_10288352
2763 Ga0105237_10313926
2764 Ga0105237_10313963
2765 Ga0105238_10001477
2766 Ga0105238_10108713
2767 Ga0105238_10169393
2768 Ga0105238_10194298
2769 Ga0105238_10241180
2770 Ga0105238_10280974
2771 Ga0105238_10308182
2772 Ga0105238_10434339
2773 Ga0105238_10988673
2774 Ga0105238_11867698
2775 Ga0105238_11889836
2776 Ga0105249_10279021
2777 Ga0105249_11410582
2778 Ga0105249_13109832
2779 Ga0099796_10417279
2780 Ga0105239_10002458
2781 Ga0105239_10148167
2782 Ga0105239_10191792
2783 Ga0105239_10237594
2784 Ga0105239_10339523
2785 Ga0105239_10403074
2786 Ga0105239_10490795
2787 Ga0105239_10937353
2788 Ga0105239_11058836
2789 Ga0105239_11528944
2790 Ga0105239_11709873
2791 Ga0105239_12204231
2792 Ga0105246_10164959
2793 Ga0105246_10175189
2794 Ga0105246_10216814
2795 Ga0105246_10255355
2796 Ga0105246_10380041
2797 Ga0105246_10449422
2798 Ga0105246_10470500
2799 Ga0105246_10802564
2800 Ga0105246_10839763
2801 Ga0105246_11198592
2802 Ga0105246_11240966
2803 Ga0157346_1025154
2804 Ga0157343_1015045
2805 Ga0157313_1013363
2806 Ga0157324_1030636
2807 Ga0157342_1056773
2808 Ga0157326_1006887
2809 Ga0157326_1010884
2810 Ga0157338_1008242
2811 Ga0157373_10228363
2812 Ga0157373_10256574
2813 Ga0157373_10538742
2814 Ga0157373_10543279
2815 Ga0157371_10142781
2816 Ga0157371_10151617
2817 Ga0157371_10647374
2818 Ga0157371_11129763
2819 Ga0157371_11183827
2820 Ga0157370_10003645
2821 Ga0157370_10087500
2822 Ga0157370_10137061
2823 Ga0157370_10194609
2824 Ga0157370_10218349
2825 Ga0157370_10229388
2826 Ga0157370_10392962
2827 Ga0157370_11468934
2828 Ga0157369_10439753
2829 Ga0157369_10683316
2830 Ga0157369_10684448
2831 Ga0157369_10928643
2832 Ga0157369_11167075
2833 Ga0157369_12455171
2834 Ga0157374_10205120
2835 Ga0157374_10340397
2836 Ga0157374_10402091
2837 Ga0157374_10488770
2838 Ga0157374_10492328
2839 Ga0157374_12024923
2840 Ga0157374_12669957
2841 Ga0157378_10183104
2842 Ga0157378_10248553
2843 Ga0157378_10278317
2844 Ga0157378_10538972
2845 Ga0157378_12066705
2846 Ga0157378_12236339
2847 Ga0163162_10446629
2848 Ga0163162_10490939
2849 Ga0163162_10648610
2850 Ga0163162_11516500
2851 Ga0163162_12557983
2852 Ga0157372_10096001
2853 Ga0157372_10248543
2854 Ga0157372_10285442
2855 Ga0157372_11486835
2856 Ga0157372_11503054
2857 Ga0157372_12394250
2858 Ga0157375_10135124
2859 Ga0157375_10279253
2860 Ga0157375_10841589
2861 Ga0157375_11548773
2862 Ga0157375_12765557
2863 Ga0157375_12772079
2864 Ga0157375_13329664
2865 Ga0163163_10305487
2866 Ga0163163_10358160
2867 Ga0163163_10420491
2868 Ga0163163_10467213
2869 Ga0163163_10840308
2870 Ga0163163_11432692
2871 Ga0163163_11553042
2872 Ga0157380_10152291
2873 Ga0157380_10287587
2874 Ga0157380_10837023
2875 Ga0157380_10909983
2876 Ga0157380_11205758
2877 Ga0157380_11544303
2878 Ga0157380_12020281
2879 Ga0182008_10058226
2880 Ga0182008_10089955
2881 Ga0182008_10094018
2882 Ga0157377_10092504
2883 Ga0157377_10157434
2884 Ga0157377_10163505
2885 Ga0157377_10333969
2886 Ga0157379_10254372
2887 Ga0157379_10364947
2888 Ga0157379_10588349
2889 Ga0157379_10818022
2890 Ga0157379_11852373
2891 Ga0157379_11921807
2892 Ga0157376_10158083
2893 Ga0157376_10318166
2894 Ga0157376_10457277
2895 Ga0157376_11076190
2896 Ga0157376_12250386
2897 Ga0157376_12726615
2898 Ga0163161_10140339
2899 Ga0163161_10200841
2900 Ga0163161_10221297
2901 Ga0163161_10229481
2902 Ga0163161_11086041
2903 Ga0206353_10492261
2904 Ga0213874_10087750
2905 Ga0213876_10151516
2906 Ga0213875_10060072
2907 Ga0213875_10079298
2908 Ga0224712_10012275
2909 Ga0224570_103029
2910 Ga0224571_102319
2911 Ga0224572_1022032
2912 Ga0228598_1023645
2913 Ga0207425_1001721
2914 Ga0207425_1013102
2915 Ga0209129_1000851
2916 Ga0209129_1014578
2917 Ga0209565_1024149
2918 Ga0207666_1007976
2919 Ga0209673_1000840
2920 Ga0209673_1044027
2921 Ga0209130_1026745
2922 Ga0209675_1002336
2923 Ga0209675_1031273
2924 Ga0209676_1018913
2925 Ga0209025_1002528
2926 Ga0209025_1053563
2927 Ga0209564_1040623
2928 Ga0209758_1001161
2929 Ga0209758_1001517
2930 Ga0209050_1053254
2931 Ga0209256_1000555
2932 Ga0209256_1007286
2933 Ga0207426_1003336
2934 Ga0207426_1010449
2935 Ga0207697_10042901
2936 Ga0207697_10111556
2937 Ga0207656_10504475
2938 Ga0207713_1181430
2939 Ga0207653_10035981
2940 Ga0207682_10009832
2941 Ga0207682_10094199
2942 Ga0207682_10193832
2943 Ga0207692_10113333
2944 Ga0207692_10139866
2945 Ga0207692_10239028
2946 Ga0207692_10569542
2947 Ga0207642_10133397
2948 Ga0207642_10151695
2949 Ga0207642_10368377
2950 Ga0207710_10107702
2951 Ga0207710_10186777
2952 Ga0207710_10263464
2953 Ga0207688_10003840
2954 Ga0207688_10165826
2955 Ga0207688_10290156
2956 Ga0207688_10395461
2957 Ga0207688_10418689
2958 Ga0207688_10504161
2959 Ga0207688_10598594
2960 Ga0207680_10209454
2961 Ga0207680_10253007
2962 Ga0207680_10626768
2963 Ga0207647_10504487
2964 Ga0207647_10507191
2965 Ga0207685_10058795
2966 Ga0207685_10067957
2967 Ga0207685_10346299
2968 Ga0207685_10374677
2969 Ga0207685_10410522
2970 Ga0207699_10212055
2971 Ga0207699_10212691
2972 Ga0207699_10266796
2973 Ga0207699_10384311
2974 Ga0207699_10469182
2975 Ga0207699_11232896
2976 Ga0207699_11295175
2977 Ga0207645_10041875
2978 Ga0207645_10067656
2979 Ga0207645_10116851
2980 Ga0207645_10130830
2981 Ga0207645_10696626
2982 Ga0207643_10089119
2983 Ga0207643_10463685
2984 Ga0207643_10867273
2985 Ga0207705_10562675
2986 Ga0207684_10139016
2987 Ga0207684_10319531
2988 Ga0207684_10803481
2989 Ga0207654_10211907
2990 Ga0207654_10589266
2991 Ga0207654_10693515
2992 Ga0207654_10758071
2993 Ga0207654_10872713
2994 Ga0207707_10087924
2995 Ga0207707_10281468
2996 Ga0207707_10817660
2997 Ga0207707_10966096
2998 Ga0207707_11427353
2999 Ga0207695_10011275
3000 Ga0207695_10337086
3001 Ga0207695_10390859
3002 Ga0207695_10892567
3003 Ga0207695_11411067
3004 Ga0207671_10002412
3005 Ga0207671_10010604
3006 Ga0207671_10017611
3007 Ga0207671_10092670
3008 Ga0207671_10253897
3009 Ga0207671_10815258
3010 Ga0207671_10888639
3011 Ga0207671_11140280
3012 Ga0207693_10131667
3013 Ga0207693_10152032
3014 Ga0207693_10172712
3015 Ga0207693_10211500
3016 Ga0207693_10264723
3017 Ga0207693_10289764
3018 Ga0207663_10140759
3019 Ga0207663_10176665
3020 Ga0207663_10179633
3021 Ga0207663_10270157
3022 Ga0207663_10277228
3023 Ga0207663_10284567
3024 Ga0207663_10288778
3025 Ga0207663_10710473
3026 Ga0207660_10254332
3027 Ga0207660_10763277
3028 Ga0207662_10102725
3029 Ga0207662_10142809
3030 Ga0207662_10299572
3031 Ga0207662_10517515
3032 Ga0207657_10204864
3033 Ga0207657_10222470
3034 Ga0207657_10260248
3035 Ga0207657_10305613
3036 Ga0207657_10413884
3037 Ga0207657_11265032
3038 Ga0207649_10260032
3039 Ga0207649_10319870
3040 Ga0207649_10470202
3041 Ga0207652_10056697
3042 Ga0207652_10372605
3043 Ga0207652_10396381
3044 Ga0207652_10407288
3045 Ga0207652_10661110
3046 Ga0207652_10666606
3047 Ga0207652_10919769
3048 Ga0207652_11729162
3049 Ga0207646_10330389
3050 Ga0207646_10400095
3051 Ga0207646_10546967
3052 Ga0207681_10160831
3053 Ga0207681_10291784
3054 Ga0207681_10940650
3055 Ga0207694_10000851
3056 Ga0207694_10147646
3057 Ga0207694_10153299
3058 Ga0207694_10205127
3059 Ga0207694_10284265
3060 Ga0207694_10298116
3061 Ga0207694_10409025
3062 Ga0207694_10878642
3063 Ga0207694_11339674
3064 Ga0207650_10297956
3065 Ga0207650_10324024
3066 Ga0207650_11236417
3067 Ga0207659_10171827
3068 Ga0207659_10267539
3069 Ga0207659_10516471
3070 Ga0207659_10898641
3071 Ga0207659_11086915
3072 Ga0207687_10257203
3073 Ga0207687_10330903
3074 Ga0207687_11323095
3075 Ga0207687_11337395
3076 Ga0207687_11622563
3077 Ga0207700_10201475
3078 Ga0207700_10207089
3079 Ga0207700_10317494
3080 Ga0207700_10322369
3081 Ga0207700_10329868
3082 Ga0207700_10361196
3083 Ga0207700_10386904
3084 Ga0207700_10407354
3085 Ga0207700_10448468
3086 Ga0207700_10525939
3087 Ga0207700_11619884
3088 Ga0207700_11994693
3089 Ga0207664_10037599
3090 Ga0207664_10205174
3091 Ga0207664_10355697
3092 Ga0207664_10369341
3093 Ga0207664_10693569
3094 Ga0207664_10707014
3095 Ga0207664_10830825
3096 Ga0207664_11997895
3097 Ga0207644_10167343
3098 Ga0207644_10221296
3099 Ga0207644_10358937
3100 Ga0207690_10312900
3101 Ga0207690_10491467
3102 Ga0207690_10849208
3103 Ga0207706_10100179
3104 Ga0207706_10239068
3105 Ga0207706_10270446
3106 Ga0207706_10291406
3107 Ga0207686_10242961
3108 Ga0207686_10281992
3109 Ga0207686_10292778
3110 Ga0207686_10330084
3111 Ga0207709_10220865
3112 Ga0207709_10246699
3113 Ga0207709_10873923
3114 Ga0207670_10133751
3115 Ga0207670_10139473
3116 Ga0207670_10267118
3117 Ga0207670_10290602
3118 Ga0207670_11192350
3119 Ga0207669_10124742
3120 Ga0207669_10256842
3121 Ga0207669_10328392
3122 Ga0207669_11344675
3123 Ga0207704_10134008
3124 Ga0207704_10306240
3125 Ga0207704_11323653
3126 Ga0207704_11422251
3127 Ga0207665_10097283
3128 Ga0207665_10150074
3129 Ga0207665_10214346
3130 Ga0207665_10215973
3131 Ga0207665_10246177
3132 Ga0207665_10293118
3133 Ga0207665_10303648
3134 Ga0207665_10623470
3135 Ga0207665_10710720
3136 Ga0207691_10104040
3137 Ga0207691_10282428
3138 Ga0207691_10298557
3139 Ga0207691_10321342
3140 Ga0207691_10457161
3141 Ga0207691_10679832
3142 Ga0207691_10905904
3143 Ga0207691_11671032
3144 Ga0207711_10258076
3145 Ga0207711_10312963
3146 Ga0207711_11605656
3147 Ga0207689_10394720
3148 Ga0207689_10466223
3149 Ga0207689_11118141
3150 Ga0207689_11367775
3151 Ga0207661_10281765
3152 Ga0207661_10374692
3153 Ga0207661_10785828
3154 Ga0207661_10939054
3155 Ga0207661_11026479
3156 Ga0207679_10230678
3157 Ga0207679_10292638
3158 Ga0207679_11064970
3159 Ga0207679_11850841
3160 Ga0207679_12054514
3161 Ga0207679_12193354
3162 Ga0207667_10041069
3163 Ga0207667_10250756
3164 Ga0207667_10392789
3165 Ga0207667_10661222
3166 Ga0207667_10831251
3167 Ga0207667_11140523
3168 Ga0207667_11511583
3169 Ga0207651_10042818
3170 Ga0207651_10233546
3171 Ga0207651_10311586
3172 Ga0207651_10358793
3173 Ga0207651_10426339
3174 Ga0207712_10304803
3175 Ga0207712_10840430
3176 Ga0207668_10150768
3177 Ga0207668_10302427
3178 Ga0207668_10621936
3179 Ga0207668_11353453
3180 Ga0207668_11471879
3181 Ga0207668_11589497
3182 Ga0207640_10025526
3183 Ga0207640_10032794
3184 Ga0207640_10177424
3185 Ga0207640_10466204
3186 Ga0207658_10337190
3187 Ga0207658_10359124
3188 Ga0207658_10883535
3189 Ga0207658_11845578
3190 Ga0207677_10467255
3191 Ga0207677_10542916
3192 Ga0207677_10929366
3193 Ga0207677_11578395
3194 Ga0207703_10074166
3195 Ga0207703_10298665
3196 Ga0207703_10523474
3197 Ga0207703_10573814
3198 Ga0207639_10336648
3199 Ga0207639_10341581
3200 Ga0207639_10372405
3201 Ga0207639_10374102
3202 Ga0207639_10959512
3203 Ga0207639_11077418
3204 Ga0207639_11126253
3205 Ga0207639_12038794
3206 Ga0207678_10170907
3207 Ga0207678_10179889
3208 Ga0207678_10643863
3209 Ga0207678_10658453
3210 Ga0207678_11309088
3211 Ga0207708_10142385
3212 Ga0207708_10143340
3213 Ga0207708_10153255
3214 Ga0207708_10489822
3215 Ga0207708_10586199
3216 Ga0207708_10676365
3217 Ga0207702_10293980
3218 Ga0207702_10419228
3219 Ga0207702_10437262
3220 Ga0207702_10496339
3221 Ga0207702_10581159
3222 Ga0207702_10649515
3223 Ga0207702_10650872
3224 Ga0207702_10760332
3225 Ga0207702_10919483
3226 Ga0207702_10958549
3227 Ga0207702_11273605
3228 Ga0207702_11275879
3229 Ga0207702_11471140
3230 Ga0207702_11610888
3231 Ga0207641_10246215
3232 Ga0207641_10407527
3233 Ga0207641_10818450
3234 Ga0207641_11334841
3235 Ga0207648_10105951
3236 Ga0207648_10172230
3237 Ga0207648_10797957
3238 Ga0207648_11244504
3239 Ga0207648_11332059
3240 Ga0207676_10205442
3241 Ga0207676_10431972
3242 Ga0207676_10938154
3243 Ga0207676_11266247
3244 Ga0207674_10047869
3245 Ga0207674_10518034
3246 Ga0207674_10553421
3247 Ga0207674_10681070
3248 Ga0207674_10822058
3249 Ga0207675_100214846
3250 Ga0207675_100394894
3251 Ga0207675_100414728
3252 Ga0207683_10063437
3253 Ga0207683_10195897
3254 Ga0207683_10406104
3255 Ga0207683_11078746
3256 Ga0207698_10403965
3257 Ga0207698_10698405
3258 Ga0207698_10723852
3259 Ga0207698_10818550
3260 Ga0207698_10931457
3261 Ga0207698_12147514
3262 Ga0209389_1000192
3263 Ga0209389_1080073
3264 Ga0209371_1002705
3265 Ga0209371_1006726
3266 Ga0209489_100397
3267 Ga0209998_10217517
3268 Ga0209974_10076738
3269 Ga0265356_1007901
3270 Ga0265356_1019577
3271 Ga0265356_1036310
3272 Ga0268266_10303467
3273 Ga0268266_10306718
3274 Ga0268266_10356965
3275 Ga0268266_10495033
3276 Ga0268265_10317836
3277 Ga0268265_11191156
3278 Ga0268265_11204619
3279 Ga0268264_10325575
3280 Ga0268264_10368347
3281 Ga0268264_10406041
3282 Ga0268264_10427688
3283 Ga0268264_10865924
3284 Ga0265326_10049984
3285 Ga0265319_1158520
3286 Ga0265334_10064030
3287 Ga0265334_10076067
3288 Ga0265334_10086860
3289 Ga0265318_10001985
3290 Ga0265318_10070123
3291 Ga0265318_10075889
3292 Ga0265318_10202234
3293 Ga0265322_10249122
3294 Ga0307515_10042604
3295 Ga0307515_10103410
3296 Ga0265338_10263345
3297 Ga0265338_10273330
3298 Ga0265338_10939467
3299 Ga0268256_1001745
3300 Ga0268256_1006802
3301 Ga0265762_1007147
3302 Ga0265765_1048822
3303 Ga0265771_1004795
3304 Ga0265760_10047101
3305 Ga0265760_10106150
3306 Ga0265330_10015058
3307 Ga0265330_10072655
3308 Ga0265330_10080198
3309 Ga0265330_10087350
3310 Ga0265332_10063520
3311 Ga0265332_10090311
3312 Ga0265332_10103138
3313 Ga0265332_10161183
3314 Ga0265328_10048948
3315 Ga0265328_10057540
3316 Ga0265328_10079784
3317 Ga0265328_10091235
3318 Ga0265320_10041934
3319 Ga0265320_10080033
3320 Ga0265320_10103775
3321 Ga0265320_10112585
3322 Ga0265320_10364802
3323 Ga0265325_10000470
3324 Ga0265325_10054640
3325 Ga0265325_10122415
3326 Ga0265325_10128642
3327 Ga0265325_10433513
3328 Ga0265325_10531146
3329 Ga0265329_10029038
3330 Ga0265329_10049337
3331 Ga0265329_10073789
3332 Ga0265340_10011622
3333 Ga0265340_10062318
3334 Ga0265340_10070416
3335 Ga0265340_10102395
3336 Ga0265340_10167316
3337 Ga0265340_10249564
3338 Ga0265339_10135113
3339 Ga0265339_10135652
3340 Ga0265339_10136538
3341 Ga0265339_10353019
3342 Ga0265331_10081048
3343 Ga0265331_10095015
3344 Ga0265331_10138324
3345 Ga0265331_10178527
3346 Ga0265331_10430736
3347 Ga0265316_10166360
3348 Ga0265316_10225778
3349 Ga0265316_10264059
3350 Ga0265316_10272434
3351 Ga0265316_10295259
3352 Ga0265316_10979554
3353 Ga0265316_11239844
3354 Ga0307513_10159534
3355 Ga0307513_10309001
3356 Ga0307513_10344740
3357 Ga0307513_10347567
3358 Ga0307509_10133310
3359 Ga0307408_100215213
3360 Ga0307408_100255173
3361 Ga0307408_100324833
3362 Ga0307408_101669679
3363 Ga0307408_102218182
3364 Ga0307408_102444453
3365 Ga0265313_10076729
3366 Ga0265313_10109435
3367 Ga0265313_10110736
3368 Ga0307508_10428770
3369 Ga0316579_10420320
3370 Ga0265314_10041671
3371 Ga0265314_10124768
3372 Ga0265314_10218619
3373 Ga0265314_10306169
3374 Ga0265342_10065842
3375 Ga0265342_10075554
3376 Ga0265342_10127927
3377 Ga0265342_10225795
3378 Ga0316576_10239741
3379 Ga0316576_10241589
3380 Ga0316578_10148389
3381 Ga0307405_10389182
3382 Ga0307405_10566048
3383 Ga0307405_11357174
3384 Ga0307405_11421853
3385 Ga0307405_11549831
3386 Ga0307410_10292516
3387 Ga0307406_10216268
3388 Ga0307406_11027229
3389 Ga0307407_10327409
3390 Ga0307412_10085052
3391 Ga0307412_10275288
3392 Ga0307412_10374009
3393 Ga0307412_10709552
3394 Ga0307412_10727655
3395 Ga0307412_11312075
3396 Ga0307409_100409749
3397 Ga0307409_100616228
3398 Ga0307416_100268704
3399 Ga0307416_100323152
3400 Ga0307416_100409499
3401 Ga0307416_100529230
3402 Ga0307416_101939398
3403 Ga0307416_103795019
3404 Ga0307414_10364651
3405 Ga0307414_10686141
3406 Ga0307411_10182162
3407 Ga0307411_10306328
3408 Ga0307411_10734723
3409 Ga0307411_11491439
3410 Ga0307415_100758863
3411 Ga0307415_100808608
3412 Ga0307415_101193386
3413 Ga0307415_101643232
3414 Ga0307507_10148326
3415 Ga0307510_10090852
3416 Ga0307510_10218789
3417 Ga0373930_0025313
3418 Ga0373950_0077527
3419 Ga0373958_0010738
3420 Ga0373959_0020412
3421 Ga0373938_0001426
3422 Ga0373938_0130541
3423 Ga0373926_0034160
3424 Ga0373926_0068678
3425 Ga0373929_0026404
3426 Ga0373934_0040018
3427 Ga0373940_0048280
3428 Ga0373940_0222946
3429 Ga0373940_0307663
3430 Ga0373944_0004086
3431 Ga0373944_0062771
3432 Ga0373944_0073109
3433 Ga0373944_0368231
3434 Ga0373949_0038456
3435 Ga0373951_0027396
3436 Ga0373951_0037788
3437 Ga0373951_0235748
3438 Ga0373923_0014805
3439 Ga0373923_0107546
3440 Ga0373923_0210712
3441 Ga0373936_0071846
3442 Ga0373936_0326230
3443 Ga0373936_0585638
3444 Ga0373939_0010117
3445 Ga0373939_0458280
3446 Ga0373941_0039099
3447 Ga0373945_0028673
3448 Ga0373945_0067182
3449 Ga0373945_0069441
3450 Ga0373945_0121367
3451 Ga0373953_0020810
3452 Ga0373954_0102373
3453 Ga0373956_0041225
3454 Ga0373956_0581112
3455 Ga0373957_0051489
3456 Ga0373957_0358587
3457 Ga0373960_0002462
3458 Ga0373960_0280893
3459 Ga0373960_0329935
3460 Ga0373943_0024217
3461 Ga0373943_0182958
3462 Ga0373943_0385367
3463 Ga0373946_0374942
3464 Ga0373946_0747046
3465 Ga0373946_0774150
3466 Ga0373955_0291763
3467 Ga0373955_0540394
3468 Ga0373942_0016107
3469 Ga0373942_0049827
3470 Ga0373961_0069794
3471 Ga0316574_0379218
3472 Ga0316574_0533956
3473 Ga0316574_0661307
3474 Ga0373924_0018083
3475 Ga0373924_0037517
3476 Ga0373931_0107722
3477 Ga0373931_0738751
3478 Ga0373931_0739457
3479 Ga0373931_0953070
3480 Ga0373935_0189880
3481 Ga0373935_0258508
3482 Ga0373935_0271051
3483 Ga0373935_0630585
3484 Ga0373935_0702300
3485 Ga0373935_0779448
3486 Ga0373935_1261808
3487 Ga0373927_0108408
3488 Ga0373927_0116777
3489 Ga0373927_0194092
3490 Ga0373927_0229413
3491 Ga0373933_0195094
3492 Ga0373947_0146162
3493 Ga0373947_0154034
3494 Ga0373947_0169552
3495 Ga0373947_0175028
3496 Ga0373947_0227152
3497 Ga0373947_0716735
3498 Ga0373937_0289081
3499 Ga0373937_0382347
3500 Ga0373937_0390445
3501 Ga0316582_0250181
3502 Ga0316584_1062113
3503 Ga0316584_1062273
3504 Ga0373925_0026850
3505 Ga0373925_0052739
3506 Ga0373925_0240883
3507 Ga0373925_0290833
3508 Ga0373925_1686490
3509 Ga0373925_1715268
3510 Ga0395900_0747076
3511 Ga0395900_1210458
3512 Ga0395900_1756391
3513 Ga0395898_0060463
3514 Ga0395898_0348393
3515 Ga0395898_1444344
3516 Ga0395905_0484243
3517 Ga0436364_0255320
3518 Ga0436364_0541898
3519 Ga0436364_0554499
3520 Ga0436364_0726935
3521 Ga0436364_0963528
3522 Ga0436364_1483246
3523 Ga0395901_0456402
3524 Ga0395901_1102178
3525 Ga0395901_2039156
3526 Ga0436365_0532529
3527 Ga0436365_0966114
3528 Ga0436365_1020445
3529 Ga0436365_1131554
3530 Ga0436365_1388600
3531 Ga0436365_1925217
3532 Ga0436360_0429478
3533 Ga0436360_0770642
3534 Ga0436360_0832524
3535 Ga0436360_1128830
3536 Ga0436360_1166796
3537 Ga0436361_0044025
3538 Ga0436361_0671466
3539 Ga0436361_0697198
3540 Ga0436361_0948409
3541 Ga0436361_0985371
3542 Ga0436363_0018834
3543 Ga0436363_0817356
3544 Ga0436363_1001204
3545 Ga0436362_0016536
3546 Ga0436362_0376050
3547 Ga0436362_0926788
3548 Ga0439436_0033996
3549 Ga0439436_0123331
3550 Ga0439439_0036586
3551 Ga0439447_027919
3552 Ga0439453_0017139
3553 Ga0439453_0062135
3554 Ga0439461_0008144
3555 Ga0439465_0000081
3556 Ga0451787_087122
3557 Ga0451789_1080748
3558 Ga0451791_0659445
3559 Ga0451791_0973324
3560 Ga0451791_1087098
3561 Ga0451791_1201354
3562 Ga0451791_1361698
3563 Ga0451797_1582856
3564 Ga0451795_0150957
3565 Ga0451795_1073768
3566 Ga0451798_0233393
3567 Ga0451798_0687350
3568 Ga0451800_0467117
3569 Ga0451800_0478560
3570 Ga0451800_0514837
3571 Ga0451800_1567732
3572 Ga0451802_0651888
3573 Ga0451802_1912908
3574 Ga0451804_0438673
3575 Ga0451807_0289057
3576 Ga0451807_1300876
3577 Ga0451833_0920853
3578 Ga0451833_1273368
3579 Ga0451835_1138368
3580 Ga0451835_1260456
3581 Ga0451837_0538533
3582 Ga0451837_1753977
3583 Ga0451841_0245237
3584 Ga0451845_0067126
3585 Ga0451845_0626369
3586 Ga0451847_0954509
3587 Ga0451849_1486900
3588 Ga0451851_0617812
3589 Ga0451843_0028691
3590 Ga0451843_1612071
3591 Ga0451853_0025403
3592 Ga0451853_1048281
3593 Ga0451853_3365647
3594 Ga0439441_021140
3595 Ga0439448_0059925
3596 Ga0439448_0103011
3597 Ga0439432_253793
3598 Ga0439449_0154125
3599 Ga0439451_031816
3600 Ga0439452_031173
3601 Ga0439454_009771
3602 Ga0439457_028826
3603 Ga0439462_0031121
3604 Ga0439462_0035441
3605 Ga0450914_005632
3606 Ga0450898_016660
3607 Ga0450903_064932
3608 Ga0439446_0051970
3609 Ga0439446_0125999
3610 Ga0450909_086486
3611 Ga0439434_0027544
3612 Ga0439435_0032471
3613 Ga0439444_0016557
3614 Ga0439444_0134282
3615 Ga0439459_0000106
3616 Ga0439459_0000690
3617 Ga0439459_0151550
3618 Ga0439459_0187706
3619 Ga0439464_0042650
3620 Ga0439460_0051046
3621 Ga0450893_0092695
3622 Ga0451577_0039329
3623 Ga0451577_0089653
3624 Ga0451577_0207422
3625 Ga0451577_0340359
3626 Ga0439440_0201111
3627 Ga0466969_0120383
3628 Ga0453683_0036678
3629 Ga0453683_0070373
3630 Ga0453683_0166036
3631 Ga0453683_0308001
3632 Ga0466965_0248141
3633 Ga0466966_0191340
3634 Ga0466966_0832149
3635 Ga0466961_0177888
3636 Ga0466963_0136281
3637 Ga0466964_0106656
3638 Ga0466964_0796220
3639 Ga0453684_0092963
3640 Ga0453684_0134912
3641 Ga0453684_1552583
3642 Ga0466971_0078765
3643 Ga0466968_0077765
3644 Ga0466970_0132543
3645 Ga0466970_0163103
3646 Ga0466957_0102406
3647 Ga0466957_0212421
3648 Ga0466957_0226723
3649 Ga0451576_0009749
3650 Ga0451576_0125849
3651 Ga0451576_1865451
3652 Ga0451576_2330833
3653 Ga0466958_0176781
3654 Ga0466958_0230737
3655 Ga0466967_0367160
3656 Ga0466967_0512709
3657 Ga0466967_0536351
3658 Ga0466967_0596187
3659 Ga0466967_2171523
3660 Ga0495627_044618
3661 Ga0495592_0218003
3662 Ga0495592_0320842
3663 Ga0495603_0121147
3664 Ga0495603_0176565
3665 Ga0495603_0261788
3666 Ga0495590_0053109
3667 Ga0495590_0088863
3668 Ga0495590_0239992
3669 Ga0495591_034336
3670 Ga0495629_0103686
3671 Ga0495629_0248371
3672 Ga0495629_0254649
3673 Ga0495638_0002512
3674 Ga0495638_0043353
3675 Ga0495641_0050797
3676 Ga0495641_0088208
3677 Ga0495641_0094513
3678 Ga0495641_0257827
3679 Ga0495651_0124442
3680 Ga0495651_0305320
3681 Ga0495653_0123480
3682 Ga0495653_0222661
3683 Ga0495653_0457003
3684 Ga0495580_0388956
3685 Ga0495582_0208256
3686 Ga0495582_0267446
3687 Ga0495605_0109124
3688 Ga0495605_0140644
3689 Ga0495639_0055704
3690 Ga0495639_0101308
3691 Ga0495639_0110429
3692 Ga0495639_0128793
3693 Ga0495639_0244154
3694 Ga0495662_0112644
3695 Ga0495662_0181763
3696 Ga0495662_0196052
3697 Ga0495664_0020887
3698 Ga0495664_0183508
3699 Ga0495664_0272202
3700 Ga0495664_0276046
3701 Ga0495584_0136449
3702 Ga0495584_0137515
3703 Ga0495585_0108637
3704 Ga0495594_0092562
3705 Ga0495594_0129438
3706 Ga0495594_0142752
3707 Ga0495594_0332694
3708 Ga0495594_0428073
3709 Ga0495594_0872343
3710 Ga0495607_0109479
3711 Ga0495607_0168099
3712 Ga0495583_0304742
3713 Ga0495606_0151522
3714 Ga0495606_0166696
3715 Ga0495606_0177129
3716 Ga0495608_0190310
3717 Ga0495608_0249375
3718 Ga0495610_0335753
3719 Ga0495616_0041790
3720 Ga0495618_0171691
3721 Ga0495618_0487064
3722 Ga0495618_0749040
3723 Ga0495620_0074838
3724 Ga0495620_0080985
3725 Ga0495620_0175124
3726 Ga0495620_0189164
3727 Ga0495628_0274870
3728 Ga0495628_0282733
3729 Ga0495628_0404820
3730 Ga0495628_0833781
3731 Ga0495630_0058711
3732 Ga0495630_0264249
3733 Ga0495630_0266217
3734 Ga0495630_0298618
3735 Ga0495631_0009052
3736 Ga0495631_0025621
3737 Ga0495632_0076925
3738 Ga0495632_0379423
3739 Ga0495632_0493262
3740 Ga0495637_0058375
3741 Ga0495643_0131453
3742 Ga0495643_0138615
3743 Ga0495643_0139789
3744 Ga0495643_0159805
3745 Ga0495643_0216664
3746 Ga0495644_0281749
3747 Ga0495648_0071391
3748 Ga0495648_0212217
3749 Ga0495663_0055302
3750 Ga0495666_0089783
3751 Ga0495666_0104088
3752 Ga0495666_0278285
3753 Ga0495652_0137051
3754 Ga0495652_0217572
3755 Ga0495652_0248676
3756 Ga0495665_0390327
3757 Ga0495640_0178474
3758 Ga0495640_0192539
3759 Ga0495640_0208420
3760 Ga0495586_0111523
3761 Ga0495586_0115396
3762 Ga0495586_0133551
3763 Ga0495587_0064421
3764 Ga0495587_0320450
3765 Ga0495598_0285669
3766 Ga0495609_0083751
3767 Ga0495621_0067002
3768 Ga0495597_0116550
3769 Ga0495597_0176638
3770 Ga0495645_0161545
3771 Ga0495645_0627371
3772 Ga0495645_0842658
3773 Ga0495622_0129437
3774 Ga0495633_0072529
3775 Ga0495667_0114054
3776 Ga0495667_0207252
3777 Ga0495656_0046619
3778 Ga0495668_0034180
3779 Ga0495668_0079381
3780 Ga0495634_0005027
3781 Ga0495634_0126300
3782 Ga0495634_0179009
3783 Ga0495634_0198450
3784 Ga0495611_0093745
3785 Ga0495611_0103386
3786 Ga0495625_0173962
3787 Ga0495625_0176598
3788 Ga0495625_0695161
3789 Ga0495635_0073937
3790 Ga0495635_0264822
3791 Ga0495659_0078894
3792 Ga0495661_0254294
3793 Ga0495588_0099748
3794 Ga0495588_0135876
3795 Ga0495588_0141263
3796 Ga0495657_0088566
3797 Ga0495657_0208578
3798 Ga0495657_0263738
3799 Ga0495599_0153044
3800 Ga0495599_0404590
3801 Ga0495646_0136216
3802 Ga0495647_0078824
3803 Ga0495647_0113124
3804 Ga0495658_0157971
3805 Ga0495658_0191218
3806 Ga0495658_0800410
3807 Ga0495658_1088838
3808 Ga0495669_0046029
3809 Ga0495613_0216801
3810 Ga0495613_0255437
3811 Ga0495613_0306445
3812 Ga0495624_0083237
3813 Ga0495624_0149607
3814 Ga0495624_0183716
3815 Ga0495624_0431070
3816 Ga0495624_0737741
3817 Ga0495670_0118969
3818 Ga0495671_0057755
3819 Ga0495671_0321379
3820 Ga0495649_0149467
3821 Ga0495589_0192540
3822 Ga0495600_0116786
3823 Ga0495600_0163077
3824 Ga0495660_0117219
3825 Ga0495581_0179350
3826 Ga0495581_0186413
3827 Ga0495581_0219426
3828 Ga0495604_0195988
3829 Ga0495604_0233857
3830 Ga0495604_0518072
3831 Ga0495604_0909157
3832 Ga0495604_1051096
3833 Ga0495674_0001495
3834 Ga0495674_0083380
3835 Ga0495674_0253868
3836 Ga0495674_0294083
3837 Ga0495674_0787984
3838 Ga0495672_0220057
3839 Ga0495676_0192804
3840 Ga0495676_0237430
3841 Ga0495676_0261802
3842 Ga0495680_0205135
3843 Ga0495680_0252133
3844 Ga0495683_0122063
3845 Ga0495683_0123013
3846 Ga0495683_0269253
3847 Ga0495675_0137558
3848 Ga0495677_0346313
3849 Ga0495673_0119671
3850 Ga0495673_0307484
3851 Ga0495673_0350496
3852 Ga0495681_0339473
3853 Ga0495684_0195905
3854 Ga0495684_0748373
3855 Ga0495686_0004864
3856 Ga0495686_0165831
3857 Ga0495686_0571846
3858 Ga0495593_0052820
3859 Ga0495593_0065174
3860 Ga0495593_0145160
3861 Ga0495593_0169992
3862 Ga0495602_0152712
3863 Ga0495602_0400510
3864 Ga0495602_0628017
3865 Ga0495602_1087087
3866 Ga0495614_0629626
3867 Ga0495626_0102073
3868 Ga0496100_0026554
3869 Ga0496100_0206815
3870 Ga0496100_0273644
3871 Ga0496100_0405239
3872 Ga0496100_0439162
3873 Ga0496100_1556724
3874 Ga0496101_0013716
3875 Ga0496101_0150392
3876 Ga0496101_0207169
3877 Ga0496101_0237315
3878 Ga0496101_0255668
3879 Ga0496101_0284191
3880 Ga0496101_0436141
3881 Ga0496101_0644601
3882 Ga0496102_0133290
3883 Ga0496102_0227055
3884 Ga0496102_0262179
3885 Ga0496102_0289600
3886 Ga0496102_0373274
3887 Ga0496102_0388194
3888 Ga0496102_0436784
3889 Ga0496102_0745184
3890 Ga0496102_1392947
3891 Ga0496103_0007755
3892 Ga0496103_0162551
3893 Ga0496103_0200421
3894 Ga0496103_0208364
3895 Ga0496103_0738672
3896 Ga0496103_0789900
3897 Ga0496104_0302886
3898 Ga0496104_0394902
3899 Ga0496104_0411536
3900 Ga0496104_0417735
3901 Ga0496104_0774124
3902 Ga0496104_1761888
3903 Ga0496105_0253724
3904 Ga0496105_0304495
3905 Ga0496105_0363906
3906 Ga0496105_0442735
3907 Ga0496105_0643499
3908 Ga0496105_0928200
3909 Ga0496106_0008196
3910 Ga0496106_0008640
3911 Ga0496106_0197488
3912 Ga0496106_0212744
3913 Ga0496106_0232986
3914 Ga0496106_0284267
3915 Ga0496106_0339907
3916 Ga0496107_0028081
3917 Ga0496107_0199932
3918 Ga0496107_0297028
3919 Ga0496107_0315459
3920 Ga0496107_0397707
3921 Ga0496108_0323092
3922 Ga0496108_0699809
3923 Ga0496108_0880357
3924 Ga0496109_0041208
3925 Ga0496109_0389822
3926 Ga0496109_1020796
3927 Ga0496110_0276414
3928 Ga0496110_0329841
3929 Ga0496110_0345976
3930 Ga0496110_0347121
3931 Ga0496110_0379246
3932 Ga0496110_1687317
3933 Ga0496111_0223857
3934 Ga0496111_0269719
3935 Ga0496111_0367103
3936 Ga0496111_0959515
3937 Ga0496112_0401425
3938 Ga0496112_0412018
3939 Ga0496112_0631657
3940 Ga0496112_1011898
3941 Ga0496113_0351147
3942 Ga0496113_0381662
3943 Ga0496113_0444134
3944 Ga0496113_0618161
3945 Ga0496114_0001685
3946 Ga0496114_0220819
3947 Ga0496114_0347574
3948 Ga0496114_0373830
3949 Ga0496114_0423391
3950 Ga0496114_0536349
3951 Ga0496114_1091680
3952 Ga0496115_0076611
3953 Ga0496115_0176716
3954 Ga0496115_0266288
3955 Ga0496115_0281725
3956 Ga0496115_0290789
3957 Ga0496115_0330471
3958 Ga0496116_0092087
3959 Ga0496117_0016248
3960 Ga0496117_0549801
3961 Ga0496118_0003921
3962 Ga0496118_0005006
3963 Ga0496118_0066028
3964 Ga0496119_0087479
3965 Ga0496119_0158176
3966 Ga0496119_0249964
3967 Ga0496121_0000476
3968 Ga0496121_0006084
3969 Ga0496121_0020936
3970 Ga0496121_0124621
3971 Ga0496121_0662306
3972 Ga0496121_0696532
3973 Ga0496122_0000283
3974 Ga0496122_0004099
3975 Ga0496122_0087657
3976 Ga0496122_0187791
3977 Ga0496123_0000231
3978 Ga0496123_0035623
3979 Ga0496123_0061121
3980 Ga0496123_0149555
3981 Ga0496124_0000312
3982 Ga0496124_0000907
3983 Ga0496124_0013510
3984 Ga0496124_0055068
3985 Ga0496124_0069437
3986 Ga0496124_0319733
3987 Ga0496125_0079779
3988 Ga0496125_0318112
3989 Ga0496126_0007244
3990 Ga0496126_0077872
3991 Ga0496126_0087925
3992 Ga0496126_0093482
3993 Ga0496126_0116424
3994 Ga0496126_0260512
3995 Ga0496126_0314267
3996 Ga0496126_0747877
3997 Ga0496126_1230397
3998 Ga0495682_0024737
3999 Ga0495682_0308087
4000 Ga0501290_002163
4001 Ga0501291_012107
4002 Ga0501292_011533
4003 Ga0501297_003309
4004 Ga0501299_010759
4005 Ga0501300_012715
4006 Ga0501300_015106
4007 Ga0501301_005144
4008 Ga0501303_000456
4009 Ga0501031_0042997
4010 Ga0501031_0187223
4011 Ga0501031_0224307
4012 Ga0501031_0294730
4013 Ga0501031_0637556
4014 Ga0501032_0005248
4015 Ga0501032_0157886
4016 Ga0501032_0261284
4017 Ga0501032_0482849
4018 Ga0501032_0675125
4019 Ga0501033_0003930
4020 Ga0501033_0006647
4021 Ga0501033_0058533
4022 Ga0501033_0196932
4023 Ga0501033_0210910
4024 Ga0501033_0229707
4025 Ga0501033_0279538
4026 Ga0501033_0453406
4027 Ga0501033_0758861
4028 Ga0501034_0012031
4029 Ga0501034_0018190
4030 Ga0501034_0018287
4031 Ga0501034_0078724
4032 Ga0501034_0276118
4033 Ga0501034_0374074
4034 Ga0501034_0394074
4035 Ga0501034_0409826
4036 Ga0501034_0435498
4037 Ga0501034_0452087
4038 Ga0501034_0453937
4039 Ga0501034_0478568
4040 Ga0501034_1217086
4041 Ga0501036_0003926
4042 Ga0501036_0040536
4043 Ga0501036_0070148
4044 Ga0501036_0206756
4045 Ga0501036_0224572
4046 Ga0501036_0347329
4047 Ga0501036_0360201
4048 Ga0501036_0417502
4049 Ga0501036_0893015
4050 Ga0501037_0009503
4051 Ga0501037_0060761
4052 Ga0501037_0100313
4053 Ga0501037_0151115
4054 Ga0501037_0210791
4055 Ga0501037_0297924
4056 Ga0501037_0729778
4057 Ga0501038_0212787
4058 Ga0501038_0233687
4059 Ga0501038_0278808
4060 Ga0501038_0302303
4061 Ga0501038_0356840
4062 Ga0501038_0506120
4063 Ga0501038_0890210
4064 Ga0501038_0964018
4065 Ga0501039_0237723
4066 Ga0501039_0408793
4067 Ga0501039_0417692
4068 Ga0501040_0047584
4069 Ga0501040_0158049
4070 Ga0501041_0114858
4071 Ga0501042_0154610
4072 Ga0501042_0461124
4073 Ga0501043_0008514
4074 Ga0501043_0011933
4075 Ga0501043_0158651
4076 Ga0501043_0251336
4077 Ga0501043_0275616
4078 Ga0501043_0389839
4079 Ga0501043_0694927
4080 Ga0501043_0853655
4081 Ga0501043_0958920
4082 Ga0501046_0085149
4083 Ga0501046_0131819
4084 Ga0501046_0136599
4085 Ga0501046_0182480
4086 Ga0501046_0232506
4087 Ga0501046_0566742
4088 Ga0501046_0642967
4089 Ga0501046_1102730
4090 Ga0501047_0000871
4091 Ga0501047_0007264
4092 Ga0501047_0046350
4093 Ga0501047_0077786
4094 Ga0501047_0141276
4095 Ga0501047_0264368
4096 Ga0501047_0460159
4097 Ga0501047_0612786
4098 Ga0501047_0875985
4099 Ga0501048_0153706
4100 Ga0501048_0197090
4101 Ga0501048_0207595
4102 Ga0501048_0240900
4103 Ga0501048_0262756
4104 Ga0501048_0333703
4105 Ga0501048_1378230
4106 Ga0501067_0007394
4107 Ga0501067_0094222
4108 Ga0501067_0181747
4109 Ga0501067_0184014
4110 Ga0501067_0290608
4111 Ga0501067_0398778
4112 Ga0501067_0788631
4113 Ga0501068_0032654
4114 Ga0501068_0128338
4115 Ga0501068_0133172
4116 Ga0501068_0142359
4117 Ga0501068_0191421
4118 Ga0501068_0286001
4119 Ga0501068_0294585
4120 Ga0501068_0468489
4121 Ga0501068_0608742
4122 Ga0501068_1179622
4123 Ga0501069_0052068
4124 Ga0501069_0100280
4125 Ga0501069_0132567
4126 Ga0501069_0137949
4127 Ga0501069_0147779
4128 Ga0501069_0153209
4129 Ga0501069_0157826
4130 Ga0501069_0359817
4131 Ga0501069_0661500
4132 Ga0501070_0004207
4133 Ga0501070_0019671
4134 Ga0501070_0104408
4135 Ga0501070_0144794
4136 Ga0501070_0250350
4137 Ga0501070_0264484
4138 Ga0501070_0267208
4139 Ga0501070_0303880
4140 Ga0501070_0346429
4141 Ga0501070_0473861
4142 Ga0501070_0478785
4143 Ga0501070_0580424
4144 Ga0501070_0901138
4145 Ga0501071_0056312
4146 Ga0501071_0145173
4147 Ga0501071_0248402
4148 Ga0501071_0507777
4149 Ga0501072_0331229
4150 Ga0501072_0877459
4151 Ga0501072_0890574
4152 Ga0501073_0009716
4153 Ga0501073_0039852
4154 Ga0501073_0052370
4155 Ga0501073_0126391
4156 Ga0501073_0127091
4157 Ga0501073_0187241
4158 Ga0501073_0215075
4159 Ga0501073_0228273
4160 Ga0501073_0322388
4161 Ga0501073_0330941
4162 Ga0501074_0003848
4163 Ga0501074_0031110
4164 Ga0501074_0162839
4165 Ga0501074_0176743
4166 Ga0501074_0211620
4167 Ga0501074_0306959
4168 Ga0501074_0409578
4169 Ga0501074_0983014
4170 Ga0501074_1114326
4171 Ga0501075_0253977
4172 Ga0501075_0289658
4173 Ga0501075_0766317
4174 Ga0501075_1265879
4175 Ga0501076_0149267
4176 Ga0501076_0255439
4177 Ga0501076_0270772
4178 Ga0501076_0319768
4179 Ga0501076_1489989
4180 Ga0501077_0191137
4181 Ga0501077_0504840
4182 Ga0501206_008985
4183 Ga0501207_017112
4184 Ga0501207_094430
4185 Ga0501217_029043
4186 Ga0501222_044291
4187 Ga0501223_001599
4188 Ga0501224_003560
4189 Ga0501235_020919
4190 Ga0501242_058278
4191 Ga0501243_080789
4192 Ga0501249_008312
4193 Ga0501253_035166
4194 Ga0501257_140500
4195 Ga0501259_018031
4196 Ga0501221_092574
4197 Ga0501079_0236393
4198 Ga0501079_0266410
4199 Ga0501079_0283211
4200 Ga0501079_0336290
4201 Ga0501079_0359761
4202 Ga0501079_0890373
4203 Ga0501080_0029683
4204 Ga0501080_0093232
4205 Ga0501080_0152621
4206 Ga0501080_0351650
4207 Ga0501080_0362097
4208 Ga0501080_0411182
4209 Ga0501080_0487863
4210 Ga0501080_0527277
4211 Ga0501080_0807315
4212 Ga0501080_1372695
4213 Ga0501080_1659446
4214 Ga0501081_0049115
4215 Ga0501081_0330800
4216 Ga0501083_0052551
4217 Ga0501083_0091803
4218 Ga0501083_0122975
4219 Ga0501083_0209832
4220 Ga0501083_0277836
4221 Ga0501083_0327228
4222 Ga0501083_0347540
4223 Ga0501083_0548255
4224 Ga0501262_001134
4225 Ga0501263_020663
4226 Ga0501266_013527
4227 Ga0501268_013370
4228 Ga0501271_043772
4229 Ga0501282_000529
4230 Ga0501283_012729
4231 Ga0501035_0009620
4232 Ga0501035_0081675
4233 Ga0501035_0133888
4234 Ga0501035_0160257
4235 Ga0501035_0176522
4236 Ga0501035_0194310
4237 Ga0501035_0196283
4238 Ga0501035_0248552
4239 Ga0501035_0569952
4240 Ga0501035_0645723
4241 Ga0501035_1340629
4242 Ga0501044_0019807
4243 Ga0501044_0095123
4244 Ga0501044_0130311
4245 Ga0501044_0218051
4246 Ga0501044_0284531
4247 Ga0501044_0331436
4248 Ga0501044_0349886
4249 Ga0501044_0351835
4250 Ga0501044_0372952
4251 Ga0501044_0384319
4252 Ga0501044_0549905
4253 Ga0501044_0647803
4254 Ga0501044_1249745
4255 Ga0501044_1454529
4256 Ga0501044_1501762
4257 Ga0501045_0135952
4258 Ga0501045_0159364
4259 Ga0501045_1103343
4260 Ga0501045_1347057
4261 Ga0501212_056318
4262 Ga0501226_000708
4263 Ga0501226_001034
4264 Ga0501226_008827
4265 nmdc:mga03n38_422580_c1
4266 nmdc:mga00v17_1034712_c1
4267 nmdc:mga00v17_1039400_c1
4268 nmdc:mga00v17_134419_c2
4269 nmdc:mga00v17_151397_c1
4270 nmdc:mga0yw44_217286_c1
4271 nmdc:mga0yw44_696900_c1
4272 nmdc:mga0k408_870450_c1
4273 nmdc:mga06z11_1031203_c1
4274 nmdc:mga06z11_149914_c1
4275 nmdc:mga06z11_30542_c1
4276 nmdc:mga07m45_582228_c1
4277 nmdc:mga09592_377565_c1
4278 nmdc:mga06r32_225414_c1
4279 nmdc:mga08y16_1987945_c1
4280 nmdc:mga08y16_432759_c1
4281 nmdc:mga0n895_302608_c1
4282 nmdc:mga0n895_339760_c1
4283 nmdc:mga0rr50_1166683_c1
4284 nmdc:mga0rr50_1519982_c1
4285 nmdc:mga0rr50_233574_c1
4286 nmdc:mga0rr50_796287_c1
4287 nmdc:mga0rr50_798963_c1
4288 nmdc:mga08x19_232809_c1
4289 nmdc:mga0a205_181601_c1
4290 Ga0495601_0191242
4291 Ga0495601_0191747
4292 Ga0495601_0313586
4293 Ga0495601_0360455
4294 Ga0495601_1007270
4295 Ga0495612_0078028
4296 Ga0495612_0597991
4297 Ga0495655_0020494
4298 Ga0495595_0101138
4299 Ga0495595_0113859
4300 Ga0495595_0317060
4301 Ga0495619_0109636
4302 Ga0495619_0168624
4303 Ga0495619_0239089
4304 Ga0500578_0138896
4305 Ga0500646_0022176
4306 Ga0500566_0008223
4307 Ga0500650_0109508
4308 Ga0500558_068157
4309 Ga0500562_025143
4310 Ga0500569_020710
4311 Ga0500572_092276
4312 Ga0500594_0045313
4313 Ga0500594_0158061
4314 Ga0500595_025654
4315 Ga0500614_246496
4316 Ga0500628_025556
4317 Ga0500642_0262637
4318 Ga0500658_0006423
4319 Ga0500658_0039664
4320 Ga0500559_0107805
4321 Ga0500568_0145071
4322 Ga0500577_0372171
4323 Ga0500586_035469
4324 Ga0500588_0167673
4325 Ga0500604_0006346
4326 Ga0500616_0081831
4327 Ga0500616_0128429
4328 Ga0500616_0169140
4329 Ga0500627_0081787
4330 Ga0500627_0318400
4331 Ga0500636_0164114
4332 Ga0500636_0302320
4333 Ga0500611_018656
4334 Ga0500645_051354
4335 Ga0500645_103754
4336 Ga0500596_005955
4337 Ga0500587_044374
4338 Ga0501084_0020392
4339 Ga0501084_0416242
4340 Ga0501084_0508209
4341 Ga0501084_0841112
4342 Ga0501084_1196443
4343 Ga0501082_0379787
4344 Ga0501082_0798703
4345 Ga0501082_0914199
4346 Ga0466962_0114097
4347 Ga0530510_0138411
4348 Ga0530510_0180204
4349 Ga0530510_0843003
4350 2510893835
4351 2513577259
4352 2513581453
4353 2513707018
4354 2513720658
4355 2513930638
4356 2585169661
4357 2599336066
4358 2599722235
4359 2617380036
4360 2644191438
4361 2644493881
4362 2719383372
4363 2719383454
4364 2719383536
4365 2719383582
4366 2719383689
4367 2719384468
4368 2721399385
4369 2724038198
4370 2738723763
4371 2739037615
4372 2739284494
4373 2748017038
4374 2748017498
4375 2753461395
4376 2766063961
4377 2776266503
4378 2776268344
4379 2793331764
4380 2824618783
4381 2824628889
4382 2824638400
4383 2824647582
4384 2824717702
4385 2824725991
4386 2842083805
4387 2842211484
4388 2842284938
4389 2842311084
4390 2842316309
4391 2842402383
4392 2842454507
4393 2842927522
4394 2854911494
4395 2857533423
4396 2881369912
4397 2885197662
4398 2885371719
4399 2885375810
4400 2894238267
4401 2899849594
4402 2904480462
4403 2904482114
4404 2904483661
4405 2906614864
4406 2906615356
4407 2906615643
4408 2906618289
4409 2915651348
4410 2919124275
4411 2919124354
4412 2919679068
4413 2928972420
4414 3005451794
4415 8005276592
4416 8005276677
4417 8005276763
4418 8005276807
4419 8005276909
4420 8019648901
4421 8019687826
4422 8057881260

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01527

HTH_Tnp_1

Transposase

15

86

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b4h-assembly1.cif.gz_D ista transposase cleaved donor complex 0.8802 6 41
5af3-assembly1.cif.gz_B x-ray crystal structure of rv2018 from mycobacterium tuberculosis 0.8418 10 41
5af3-assembly1.cif.gz_A x-ray crystal structure of rv2018 from mycobacterium tuberculosis 0.8407 10 41
1ijw-assembly1.cif.gz_C testing the water-mediated hin recombinase dna recognition by systematic mutations. 0.8351 1 41
2elh-assembly1.cif.gz_A solution structure of the cenp-b n-terminal dna-binding domain of fruit fly distal antenna cg11849-pa 0.8335 1 44
ID Description Score Start End Superfamily
1jkpC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8339 1 41 1.10.10.60
2elhA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8335 1 44 1.10.10.10
2w48B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8334 11 45 1.10.10.60
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8221 11 44 1.10.10.10
1jkoC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8137 1 41 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A0N1N5S2-F1-model_v4 Transposase 0.997 1 51 GO:0003677
GO:0004803
GO:0006313
GO:0015074
AF-A0A2N6DDG8-F1-model_v4 IS3 family transposase 0.9937 1 83 GO:0003677
GO:0004803
GO:0006313
GO:0015074
AF-A0A7X5G1Z3-F1-model_v4 deleted 0.99 3 58
AF-A0A2W5DZ96-F1-model_v4 deleted 0.989 1 82
AF-A3X0K3-F1-model_v4 Transposase 0.9889 1 83 GO:0003677
GO:0004803
GO:0006313

Map