F496510

General Info

Members Datasets Scaffolds Average Seq Length
2175 640 2172 135

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100137509|Ga0070668_1001375093
Length 165
Sequence MAGSAGCDYDCFAVMPACAGMTLEQVAREQQMIGRLNHVAIAVPDIAKAAAQYRQTLGADVAEAFVQPEHGVTVVFITLPNTKIELLEPLGEASPIAAFLERNPAGGIHHICYEVDDIIVARDRLKASGARVLGDGSPKIGAHGKPVLFLHPKDFNGTLVELEQA

Samples

Sample ID Description Type Environment
1 2643221599 Rhizobium sp. Root708 Isolate Unclassified
2 2738541293 Rhizobium sp. GV031 Isolate Unclassified
3 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
8 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
20 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
21 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
35 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
53 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
66 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
112 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
113 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
114 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
115 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
116 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
117 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
118 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
121 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
122 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
123 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
124 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
125 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
126 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
127 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
133 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
134 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
135 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
136 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
137 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
138 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
140 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
141 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
142 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
143 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
147 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
148 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
151 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
152 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
156 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
157 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
158 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
159 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
160 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
161 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
162 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
163 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
164 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
165 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
166 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
167 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
168 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
169 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
170 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
171 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
172 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
173 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
174 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
175 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
176 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
177 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
178 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
179 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
180 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
181 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
182 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
183 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
184 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
185 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
186 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
189 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
190 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
191 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
192 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
193 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
194 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
195 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
196 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
197 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
198 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
199 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
200 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
201 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
202 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
204 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
206 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
207 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
208 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
210 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
211 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
212 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
214 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
215 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
218 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
220 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
223 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
292 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
293 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
295 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
297 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
301 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
302 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
303 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
304 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
305 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
306 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
309 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
310 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
311 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
312 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
313 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
314 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
315 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
316 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
317 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
318 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
319 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
320 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
321 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
322 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
323 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
324 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
325 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
326 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
327 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
328 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
329 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
330 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
331 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
332 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
333 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
334 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
335 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
336 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
337 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
338 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
339 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
340 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
341 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
342 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
343 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
344 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
345 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
346 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
347 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
349 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
350 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
351 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
352 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
353 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
354 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
355 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
356 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
357 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
358 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
359 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
360 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
361 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
362 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
363 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
364 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
365 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
366 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
367 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
368 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
369 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
370 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
371 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
372 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
373 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
374 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
375 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
376 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
377 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
378 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
379 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
380 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
381 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
382 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
383 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
384 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
385 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
386 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
387 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
388 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
389 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
390 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
391 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
392 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
393 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
394 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
395 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
396 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
397 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
398 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
399 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
400 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
401 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
402 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
403 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
404 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
405 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
406 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
407 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
408 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
409 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
410 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
411 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
412 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
413 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
414 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
415 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
416 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
417 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
418 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
419 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
420 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
421 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
422 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
423 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
424 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
425 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
426 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
427 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
428 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
429 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
430 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
431 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
432 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
433 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
434 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
435 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
436 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
437 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
438 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
439 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
440 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
441 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
442 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
443 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
444 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
445 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
446 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
447 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
448 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
449 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
450 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
451 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
452 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
453 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
454 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
455 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
456 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
457 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
458 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
459 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
460 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
461 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
462 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
463 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
464 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
465 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
466 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
467 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
468 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
469 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
470 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
471 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
472 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
473 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
474 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
475 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
476 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
477 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
478 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
479 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
480 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
481 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
482 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
483 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
484 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
485 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
486 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
487 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
488 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
489 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
490 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
491 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
492 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
493 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
494 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
495 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
496 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
497 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
498 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
499 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
500 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
501 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
502 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
503 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
504 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
505 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
506 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
507 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
508 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
509 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
510 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
511 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
512 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
513 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
514 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
515 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
516 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
517 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
518 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
519 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
520 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
521 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
522 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
523 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
524 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
525 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
526 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
527 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
528 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
529 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
530 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
531 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
532 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
533 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
534 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
535 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
536 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
537 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
538 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
539 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
540 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
541 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
542 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
543 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
544 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
545 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
546 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
547 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
548 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
549 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
550 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
551 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
552 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
553 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
554 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
555 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
556 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
557 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
558 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
559 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
560 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
561 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
562 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
563 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
564 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
565 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
566 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
567 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
568 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
569 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
570 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
571 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
572 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
573 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
574 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
575 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
576 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
577 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
578 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
579 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
580 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
581 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
582 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
583 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
584 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
585 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
586 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
587 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
588 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
589 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
590 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
591 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
592 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
593 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
594 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
595 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
596 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
597 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
598 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
599 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
600 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
601 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
602 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
603 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
604 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
605 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
606 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
607 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
608 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
609 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
610 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
611 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
612 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
613 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
614 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
615 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
616 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
617 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
618 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
619 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
620 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
621 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
622 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
623 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
624 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
625 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
626 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
627 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
628 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
629 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
630 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
631 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
632 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
633 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
634 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
635 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
636 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
637 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
638 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
639 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
640 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.37
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.86
Nodule 0.74
Rhizoplane 4.78
Rhizosphere 77.52
Stem 0
Stem Tuber 0
Unclassified 5.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c006516 3300000041 Bacteria 996
2 ARSoilOldRDRAFT_c010326 3300000044 Bacteria 780
3 ARCol0yngRDRAFT_1006355 3300000652 Bacteria 848
4 JGI24741J21665_1052059 3300001915 Bacteria 602
5 JGI24747J21853_1011662 3300001978 Bacteria 891
6 JGI24740J21852_10000083 3300001979 Bacteria 32327
7 JGI24740J21852_10039826 3300001979 Bacteria 1430
8 JGI24737J22298_10009690 3300001990 Bacteria 3194
9 JGI24743J22301_10003961 3300001991 Bacteria 2376
10 JGI24750J21931_1003673 3300002070 Bacteria 1846
11 JGI24738J21930_10002342 3300002075 Bacteria 4998
12 JGI24749J21850_1018712 3300002076 Bacteria 978
13 JGI24744J21845_10022170 3300002077 Bacteria 1248
14 JGI24742J22300_10018848 3300002244 Bacteria 1171
15 JGI25156J39149_1003138 3300002705 Bacteria 5562
16 JGI25162J39368_1002012 3300002737 Bacteria 9033
17 JGI25162J39368_1002022 3300002737 Bacteria 8988
18 JGI25158J39367_1000077 3300002739 Bacteria 22544
19 JGI25158J39367_1000102 3300002739 Bacteria 19874
20 JGI25157J39369_1000707 3300002741 Bacteria 17999
21 JGI25152J39213_1002631 3300002773 Bacteria 6669
22 JGI25152J39213_1019402 3300002773 Bacteria 1237
23 JGI25152J39213_1023749 3300002773 Bacteria 1039
24 JGI25150J39212_1002649 3300002774 Bacteria 4386
25 JGI25150J39212_1023588 3300002774 Bacteria 913
26 JGI25159J45721_1000221 3300002987 Bacteria 26974
27 JGI25151J46595_10005507 3300003187 Bacteria 6525
28 JGI25151J46595_10045011 3300003187 Bacteria 1561
29 JGI25165J46597_1001766 3300003214 Bacteria 9392
30 JGI25165J46597_1005983 3300003214 Bacteria 2233
31 JGI25153J46596_10000103 3300003215 Bacteria 96279
32 JGI25153J46596_10000907 3300003215 Bacteria 18008
33 JGI25153J46596_10035654 3300003215 Bacteria 1608
34 JGI25153J46596_10059911 3300003215 Bacteria 1039
35 JGI25153J46596_10068010 3300003215 Bacteria 935
36 rootL2_10017653 3300003322 Bacteria 5220
37 JGI25160J50197_1027462 3300003354 Bacteria 1548
38 JGI25161J50226_1000179 3300003374 Bacteria 42521
39 JGI25161J50226_1026812 3300003374 Bacteria 560
40 Ga0055526_1001350 3300003771 Bacteria 17555
41 Ga0055526_1014418 3300003771 Bacteria 3253
42 Ga0055526_1021565 3300003771 Bacteria 2234
43 Ga0055524_1013595 3300003775 Bacteria 3065
44 Ga0055524_1018944 3300003775 Bacteria 2370
45 Ga0055524_1019140 3300003775 Bacteria 2350
46 Ga0055524_1051751 3300003775 Bacteria 924
47 Ga0055528_1009191 3300003790 Bacteria 4153
48 Ga0055528_1023889 3300003790 Bacteria 1849
49 Ga0055540_1000703 3300003792 Bacteria 23029
50 Ga0055540_1005247 3300003792 Bacteria 5526
51 Ga0055540_1064648 3300003792 Bacteria 724
52 Ga0058692_1017595 3300003856 Bacteria 1565
53 JGI25405J52794_10062364 3300003911 Bacteria 808
54 Ga0055543_1000193 3300004625 Bacteria 50071
55 Ga0055543_1003259 3300004625 Bacteria 4898
56 Ga0065165_1014067 3300005262 Bacteria 3126
57 Ga0065165_1067380 3300005262 Bacteria 960
58 Ga0065707_10153478 3300005295 Bacteria 1633
59 Ga0070658_10312800 3300005327 Bacteria 1340
60 Ga0070658_10722100 3300005327 Bacteria 865
61 Ga0070676_10099362 3300005328 Bacteria 1795
62 Ga0070676_10584771 3300005328 Bacteria 803
63 Ga0070676_11531364 3300005328 Bacteria 514
64 Ga0070683_100019702 3300005329 Bacteria 5995
65 Ga0070690_100056685 3300005330 Bacteria 2513
66 Ga0070690_100720260 3300005330 Bacteria 768
67 Ga0070670_100002769 3300005331 Bacteria 14488
68 Ga0070670_101153336 3300005331 Bacteria 707
69 Ga0070677_10023304 3300005333 Bacteria 2291
70 Ga0068869_100053474 3300005334 Bacteria 2936
71 Ga0070666_10002383 3300005335 Bacteria 11365
72 Ga0070666_10124759 3300005335 Bacteria 1787
73 Ga0070680_100012695 3300005336 Bacteria 6548
74 Ga0070682_100006057 3300005337 Bacteria 6771
75 Ga0070682_100308447 3300005337 Bacteria 1164
76 Ga0070682_100875862 3300005337 Bacteria 736
77 Ga0070682_101650778 3300005337 Bacteria 555
78 Ga0068868_100012734 3300005338 Bacteria 6152
79 Ga0070660_100000318 3300005339 Bacteria 31811
80 Ga0070660_100426754 3300005339 Bacteria 1098
81 Ga0070660_100595414 3300005339 Bacteria 924
82 Ga0070660_101940167 3300005339 Bacteria 502
83 Ga0070689_100000208 3300005340 Bacteria 35520
84 Ga0070689_100018148 3300005340 Bacteria 5179
85 Ga0070689_100256990 3300005340 Bacteria 1443
86 Ga0070691_10003057 3300005341 Bacteria 7490
87 Ga0070691_10122209 3300005341 Bacteria 1312
88 Ga0070691_10526745 3300005341 Bacteria 687
89 Ga0070687_100016938 3300005343 Bacteria 3339
90 Ga0070687_100318846 3300005343 Bacteria 992
91 Ga0070661_100000444 3300005344 Bacteria 31791
92 Ga0070661_100008945 3300005344 Bacteria 6931
93 Ga0070661_100869603 3300005344 Bacteria 743
94 Ga0070661_101120535 3300005344 Bacteria 656
95 Ga0070692_10003029 3300005345 Bacteria 6702
96 Ga0070692_10041783 3300005345 Bacteria 2351
97 Ga0070668_100000073 3300005347 Bacteria 62170
98 Ga0070668_100137509 3300005347 Bacteria 1966
99 Ga0070668_100142120 3300005347 Bacteria 1935
100 Ga0070668_100209628 3300005347 Bacteria 1602
101 Ga0070668_100715357 3300005347 Bacteria 884
102 Ga0070669_100002859 3300005353 Bacteria 12462
103 Ga0070669_100102921 3300005353 Bacteria 2157
104 Ga0070669_100357395 3300005353 Bacteria 1187
105 Ga0070669_101583542 3300005353 Bacteria 570
106 Ga0070675_100002210 3300005354 Bacteria 14433
107 Ga0070675_100587946 3300005354 Bacteria 1009
108 Ga0070671_100002558 3300005355 Bacteria 14095
109 Ga0070674_100000803 3300005356 Bacteria 16176
110 Ga0070674_100058928 3300005356 Bacteria 2671
111 Ga0070674_100403016 3300005356 Bacteria 1118
112 Ga0070673_100000548 3300005364 Bacteria 20333
113 Ga0070673_100246579 3300005364 Bacteria 1555
114 Ga0070673_101405635 3300005364 Bacteria 657
115 Ga0070688_100000195 3300005365 Bacteria 32155
116 Ga0070659_100012915 3300005366 Bacteria 6207
117 Ga0070659_100071718 3300005366 Bacteria 2755
118 Ga0070659_100687870 3300005366 Bacteria 884
119 Ga0070659_100753404 3300005366 Bacteria 845
120 Ga0070667_100000825 3300005367 Bacteria 28821
121 Ga0070667_100038293 3300005367 Bacteria 4020
122 Ga0070667_100101214 3300005367 Bacteria 2489
123 Ga0070667_100114725 3300005367 Bacteria 2339
124 Ga0070667_100176581 3300005367 Bacteria 1888
125 Ga0070703_10238623 3300005406 Bacteria 732
126 Ga0070709_10001744 3300005434 Bacteria 11827
127 Ga0070714_100002521 3300005435 Bacteria 13502
128 Ga0070714_100270049 3300005435 Bacteria 1577
129 Ga0070714_100767363 3300005435 Bacteria 933
130 Ga0070714_101174079 3300005435 Bacteria 749
131 Ga0070713_100005338 3300005436 Bacteria 8771
132 Ga0070710_10083769 3300005437 Bacteria 1867
133 Ga0070710_10119858 3300005437 Bacteria 1591
134 Ga0070701_10001093 3300005438 Bacteria 9897
135 Ga0070701_10214788 3300005438 Bacteria 1144
136 Ga0070701_10315305 3300005438 Bacteria 966
137 Ga0070711_100000336 3300005439 Bacteria 24119
138 Ga0070711_100134006 3300005439 Bacteria 1849
139 Ga0070711_100163419 3300005439 Bacteria 1690
140 Ga0070711_101058416 3300005439 Bacteria 698
141 Ga0070705_100002821 3300005440 Bacteria 8663
142 Ga0070705_100080646 3300005440 Bacteria 1997
143 Ga0070705_100319670 3300005440 Bacteria 1120
144 Ga0070705_100755693 3300005440 Bacteria 769
145 Ga0070705_100945211 3300005440 Bacteria 696
146 Ga0070700_100000209 3300005441 Bacteria 32736
147 Ga0070700_100175171 3300005441 Bacteria 1488
148 Ga0070700_100213715 3300005441 Bacteria 1362
149 Ga0070700_100285642 3300005441 Bacteria 1198
150 Ga0070700_100287755 3300005441 Bacteria 1194
151 Ga0070700_100408313 3300005441 Bacteria 1023
152 Ga0070694_100000343 3300005444 Bacteria 24947
153 Ga0070694_100495712 3300005444 Bacteria 971
154 Ga0070708_100146828 3300005445 Bacteria 2191
155 Ga0070708_100153886 3300005445 Bacteria 2140
156 Ga0070708_100184634 3300005445 Bacteria 1950
157 Ga0070708_101308262 3300005445 Bacteria 677
158 Ga0070663_100000990 3300005455 Bacteria 15468
159 Ga0070663_100562118 3300005455 Bacteria 955
160 Ga0070663_100578101 3300005455 Bacteria 942
161 Ga0070663_101066098 3300005455 Bacteria 705
162 Ga0070678_100000082 3300005456 Bacteria 35799
163 Ga0070678_100369833 3300005456 Bacteria 1238
164 Ga0070678_100494750 3300005456 Bacteria 1078
165 Ga0070678_101711773 3300005456 Bacteria 592
166 Ga0070662_100003057 3300005457 Bacteria 10385
167 Ga0070662_100203188 3300005457 Bacteria 1573
168 Ga0070662_100753421 3300005457 Bacteria 826
169 Ga0070681_10136538 3300005458 Bacteria 2383
170 Ga0070681_10295245 3300005458 Bacteria 1530
171 Ga0070681_11478074 3300005458 Bacteria 604
172 Ga0068867_100192658 3300005459 Bacteria 1627
173 Ga0068867_100361451 3300005459 Bacteria 1214
174 Ga0068867_100978050 3300005459 Bacteria 766
175 Ga0070685_10006974 3300005466 Bacteria 5764
176 Ga0070685_10151797 3300005466 Bacteria 1468
177 Ga0070685_10306487 3300005466 Bacteria 1072
178 Ga0070706_100060410 3300005467 Bacteria 3499
179 Ga0070706_100267711 3300005467 Bacteria 1595
180 Ga0070707_100413720 3300005468 Bacteria 1309
181 Ga0070698_100028688 3300005471 Bacteria 5777
182 Ga0070698_100088455 3300005471 Bacteria 3083
183 Ga0070698_100580718 3300005471 Bacteria 1061
184 Ga0070699_100035800 3300005518 Bacteria 4292
185 Ga0070699_100037544 3300005518 Bacteria 4194
186 Ga0070699_100056411 3300005518 Bacteria 3401
187 Ga0070699_100123280 3300005518 Bacteria 2280
188 Ga0070699_100481950 3300005518 Bacteria 1126
189 Ga0070679_100019831 3300005530 Bacteria 6547
190 Ga0070679_100337230 3300005530 Bacteria 1456
191 Ga0070679_100826334 3300005530 Bacteria 870
192 Ga0070679_101553329 3300005530 Bacteria 609
193 Ga0070684_100001344 3300005535 Bacteria 17616
194 Ga0070684_100677444 3300005535 Bacteria 961
195 Ga0070697_100065896 3300005536 Bacteria 2960
196 Ga0070697_100289002 3300005536 Bacteria 1408
197 Ga0070697_100685122 3300005536 Bacteria 904
198 Ga0070697_100777717 3300005536 Bacteria 846
199 Ga0068853_100000284 3300005539 Bacteria 35801
200 Ga0068853_100181378 3300005539 Bacteria 1909
201 Ga0068853_100360020 3300005539 Bacteria 1355
202 Ga0068853_100644837 3300005539 Bacteria 1008
203 Ga0068853_101809410 3300005539 Bacteria 592
204 Ga0070672_100000995 3300005543 Bacteria 17134
205 Ga0070672_100572347 3300005543 Bacteria 982
206 Ga0070672_101288473 3300005543 Bacteria 652
207 Ga0070672_101306838 3300005543 Bacteria 648
208 Ga0070686_100001059 3300005544 Bacteria 15858
209 Ga0070686_100342815 3300005544 Bacteria 1120
210 Ga0070695_100000199 3300005545 Bacteria 29292
211 Ga0070695_100003365 3300005545 Bacteria 9345
212 Ga0070695_100041745 3300005545 Bacteria 2909
213 Ga0070696_100010712 3300005546 Bacteria 6142
214 Ga0070696_100012550 3300005546 Bacteria 5688
215 Ga0070696_100036086 3300005546 Bacteria 3407
216 Ga0070696_100059170 3300005546 Bacteria 2677
217 Ga0070693_100056724 3300005547 Bacteria 2261
218 Ga0070665_100024824 3300005548 Bacteria 6039
219 Ga0070665_100061611 3300005548 Bacteria 3761
220 Ga0070665_100211409 3300005548 Bacteria 1941
221 Ga0070665_100236487 3300005548 Bacteria 1827
222 Ga0070665_100291948 3300005548 Bacteria 1633
223 Ga0070665_100437687 3300005548 Bacteria 1317
224 Ga0070665_100629521 3300005548 Bacteria 1086
225 Ga0070665_100894256 3300005548 Bacteria 901
226 Ga0070665_101057404 3300005548 Bacteria 823
227 Ga0070665_101135375 3300005548 Bacteria 793
228 Ga0070665_101280510 3300005548 Bacteria 743
229 Ga0070704_100000781 3300005549 Bacteria 15732
230 Ga0070704_100063201 3300005549 Bacteria 2656
231 Ga0070704_100130838 3300005549 Unclassified 1945
232 Ga0070704_100343943 3300005549 Bacteria 1257
233 Ga0068855_100014591 3300005563 Bacteria 9462
234 Ga0068855_100111148 3300005563 Bacteria 3146
235 Ga0068855_100400012 3300005563 Bacteria 1505
236 Ga0068855_101506011 3300005563 Bacteria 691
237 Ga0070664_100002678 3300005564 Bacteria 14372
238 Ga0068857_100009106 3300005577 Bacteria 8613
239 Ga0068857_100807160 3300005577 Bacteria 896
240 Ga0068857_101215030 3300005577 Bacteria 730
241 Ga0068854_100000361 3300005578 Bacteria 29086
242 Ga0068854_100078109 3300005578 Bacteria 2438
243 Ga0068854_100306054 3300005578 Bacteria 1287
244 Ga0068854_100372304 3300005578 Bacteria 1175
245 Ga0068854_100771534 3300005578 Bacteria 836
246 Ga0068854_100803414 3300005578 Bacteria 820
247 Ga0068856_100012765 3300005614 Bacteria 8133
248 Ga0068856_100049297 3300005614 Bacteria 4151
249 Ga0068856_100239439 3300005614 Bacteria 1830
250 Ga0068856_100462965 3300005614 Bacteria 1289
251 Ga0068856_102559477 3300005614 Bacteria 516
252 Ga0070702_100000174 3300005615 Bacteria 20524
253 Ga0070702_100051678 3300005615 Bacteria 2354
254 Ga0070702_100467003 3300005615 Bacteria 919
255 Ga0070702_101023942 3300005615 Bacteria 655
256 Ga0068852_100019573 3300005616 Bacteria 5361
257 Ga0068852_100026703 3300005616 Bacteria 4698
258 Ga0068852_100059801 3300005616 Bacteria 3306
259 Ga0068852_102044570 3300005616 Bacteria 595
260 Ga0068859_100105524 3300005617 Bacteria 2877
261 Ga0068859_100240869 3300005617 Bacteria 1898
262 Ga0068859_100483147 3300005617 Bacteria 1334
263 Ga0068859_100493666 3300005617 Bacteria 1319
264 Ga0068864_100001077 3300005618 Bacteria 22916
265 Ga0068864_100440246 3300005618 Bacteria 1245
266 Ga0068866_10001495 3300005718 Bacteria 9955
267 Ga0068866_10018641 3300005718 Bacteria 3143
268 Ga0068866_10122630 3300005718 Bacteria 1467
269 Ga0068866_10548811 3300005718 Bacteria 772
270 Ga0068861_100000276 3300005719 Bacteria 28799
271 Ga0068861_100042348 3300005719 Bacteria 3412
272 Ga0068861_100126282 3300005719 Bacteria 2070
273 Ga0068861_100128108 3300005719 Bacteria 2057
274 Ga0068861_100195481 3300005719 Bacteria 1694
275 Ga0068863_100146967 3300005841 Bacteria 2255
276 Ga0068863_100686448 3300005841 Bacteria 1017
277 Ga0068858_100002002 3300005842 Bacteria 20847
278 Ga0068858_100022397 3300005842 Bacteria 5897
279 Ga0068858_100328072 3300005842 Bacteria 1463
280 Ga0068860_100001413 3300005843 Bacteria 26001
281 Ga0068860_102150036 3300005843 Bacteria 579
282 Ga0068862_100006220 3300005844 Bacteria 9942
283 Ga0068862_100034737 3300005844 Bacteria 4267
284 Ga0068862_100173038 3300005844 Bacteria 1934
285 Ga0068862_100359519 3300005844 Bacteria 1353
286 Ga0068862_100434921 3300005844 Bacteria 1234
287 Ga0068862_100529540 3300005844 Bacteria 1122
288 Ga0068862_100690547 3300005844 Bacteria 988
289 Ga0068862_100817124 3300005844 Bacteria 911
290 Ga0068862_100919812 3300005844 Bacteria 861
291 Ga0068862_101124499 3300005844 Bacteria 781
292 Ga0068862_101258374 3300005844 Bacteria 740
293 Ga0068862_101392317 3300005844 Bacteria 704
294 Ga0068862_102162917 3300005844 Bacteria 568
295 Ga0081455_10001182 3300005937 Bacteria 32680
296 Ga0081455_10002564 3300005937 Bacteria 21576
297 Ga0081455_10030415 3300005937 Bacteria 4904
298 Ga0081455_10043812 3300005937 Bacteria 3911
299 Ga0081455_10043891 3300005937 Bacteria 3907
300 Ga0081455_10303224 3300005937 Bacteria 1145
301 Ga0081455_10399085 3300005937 Bacteria 955
302 Ga0081538_10000854 3300005981 Bacteria 32885
303 Ga0081538_10013129 3300005981 Bacteria 6579
304 Ga0081538_10084825 3300005981 Bacteria 1667
305 Ga0081538_10098196 3300005981 Bacteria 1485
306 Ga0081540_1005617 3300005983 Bacteria 9338
307 Ga0081540_1035413 3300005983 Bacteria 2677
308 Ga0081540_1197296 3300005983 Bacteria 735
309 Ga0081539_10001574 3300005985 Bacteria 37718
310 Ga0081539_10034959 3300005985 Bacteria 3028
311 Ga0081539_10087478 3300005985 Bacteria 1619
312 Ga0081539_10344536 3300005985 Bacteria 628
313 Ga0075365_10016328 3300006038 Bacteria 4514
314 Ga0075365_10076256 3300006038 Bacteria 2263
315 Ga0075365_10097788 3300006038 Bacteria 2007
316 Ga0075365_10136522 3300006038 Bacteria 1700
317 Ga0075365_10150703 3300006038 Bacteria 1618
318 Ga0075368_10003310 3300006042 Bacteria 5366
319 Ga0075368_10010512 3300006042 Bacteria 3346
320 Ga0075368_10028944 3300006042 Bacteria 2141
321 Ga0075368_10053922 3300006042 Bacteria 1602
322 Ga0075368_10173111 3300006042 Bacteria 908
323 Ga0075368_10497162 3300006042 Bacteria 544
324 Ga0075363_100002909 3300006048 Bacteria 7134
325 Ga0075363_100003593 3300006048 Bacteria 6635
326 Ga0075363_100081322 3300006048 Bacteria 1772
327 Ga0075363_100086438 3300006048 Bacteria 1721
328 Ga0075363_100121899 3300006048 Bacteria 1456
329 Ga0075364_10015965 3300006051 Bacteria 4663
330 Ga0075364_10159291 3300006051 Bacteria 1523
331 Ga0075364_10266756 3300006051 Unclassified 1164
332 Ga0075364_10478759 3300006051 Bacteria 851
333 Ga0075364_10591690 3300006051 Bacteria 758
334 Ga0075432_10052710 3300006058 Bacteria 1438
335 Ga0070715_10000281 3300006163 Bacteria 12426
336 Ga0070715_10476391 3300006163 Bacteria 710
337 Ga0070715_10914209 3300006163 Bacteria 541
338 Ga0070716_100000175 3300006173 Bacteria 25175
339 Ga0070716_100557641 3300006173 Bacteria 855
340 Ga0070716_100910993 3300006173 Bacteria 689
341 Ga0070712_100000328 3300006175 Bacteria 26928
342 Ga0070712_100073260 3300006175 Bacteria 2456
343 Ga0070712_100098776 3300006175 Bacteria 2154
344 Ga0075362_10024284 3300006177 Bacteria 2570
345 Ga0075362_10040674 3300006177 Bacteria 2048
346 Ga0075362_10128941 3300006177 Bacteria 1201
347 Ga0075367_10023248 3300006178 Bacteria 3485
348 Ga0075367_10040605 3300006178 Bacteria 2717
349 Ga0075367_10051202 3300006178 Bacteria 2440
350 Ga0075367_10082511 3300006178 Bacteria 1946
351 Ga0075367_10111561 3300006178 Bacteria 1679
352 Ga0075367_10314294 3300006178 Bacteria 987
353 Ga0075367_10489283 3300006178 Bacteria 780
354 Ga0075367_10542181 3300006178 Bacteria 738
355 Ga0075369_10021229 3300006186 Bacteria 2665
356 Ga0075369_10022491 3300006186 Bacteria 2600
357 Ga0075369_10076671 3300006186 Bacteria 1478
358 Ga0075366_10042755 3300006195 Bacteria 2683
359 Ga0097621_100034761 3300006237 Bacteria 4022
360 Ga0097621_100327454 3300006237 Bacteria 1358
361 Ga0075370_10027368 3300006353 Bacteria 3162
362 Ga0075370_10050107 3300006353 Bacteria 2368
363 Ga0075370_10056630 3300006353 Bacteria 2228
364 Ga0075370_10166573 3300006353 Bacteria 1294
365 Ga0075370_10252212 3300006353 Bacteria 1046
366 Ga0075370_10635801 3300006353 Unclassified 647
367 Ga0075370_10906456 3300006353 Bacteria 539
368 Ga0068871_100023489 3300006358 Bacteria 4772
369 Ga0068871_101767777 3300006358 Bacteria 587
370 Ga0075428_100004322 3300006844 Bacteria 15657
371 Ga0075428_100016545 3300006844 Bacteria 8143
372 Ga0075428_100055073 3300006844 Bacteria 4359
373 Ga0075428_100233523 3300006844 Bacteria 1985
374 Ga0075428_100238213 3300006844 Bacteria 1964
375 Ga0075428_100239643 3300006844 Bacteria 1957
376 Ga0075428_100308376 3300006844 Bacteria 1701
377 Ga0075428_100409648 3300006844 Bacteria 1453
378 Ga0075428_100522615 3300006844 Bacteria 1269
379 Ga0075428_101312299 3300006844 Bacteria 761
380 Ga0075428_102162329 3300006844 Bacteria 575
381 Ga0075430_100099479 3300006846 Bacteria 2429
382 Ga0075430_100315754 3300006846 Bacteria 1292
383 Ga0075430_100356357 3300006846 Bacteria 1208
384 Ga0075430_100958991 3300006846 Bacteria 705
385 Ga0075431_100004355 3300006847 Bacteria 13888
386 Ga0075431_100005312 3300006847 Bacteria 12700
387 Ga0075431_100016376 3300006847 Bacteria 7522
388 Ga0075431_100264735 3300006847 Bacteria 1744
389 Ga0075431_100916349 3300006847 Bacteria 846
390 Ga0075431_101137963 3300006847 Bacteria 744
391 Ga0075431_101644180 3300006847 Bacteria 600
392 Ga0075433_10051063 3300006852 Bacteria 3600
393 Ga0075433_10053333 3300006852 Bacteria 3525
394 Ga0075433_10284501 3300006852 Bacteria 1465
395 Ga0075433_10315625 3300006852 Bacteria 1383
396 Ga0075434_100052327 3300006871 Bacteria 4057
397 Ga0075434_100585877 3300006871 Bacteria 1135
398 Ga0075434_101650010 3300006871 Bacteria 649
399 Ga0075429_100013278 3300006880 Bacteria 7144
400 Ga0075429_100247701 3300006880 Bacteria 1560
401 Ga0075429_100544996 3300006880 Bacteria 1017
402 Ga0075429_100806910 3300006880 Bacteria 822
403 Ga0068865_100002259 3300006881 Bacteria 11338
404 Ga0068865_100052231 3300006881 Bacteria 2832
405 Ga0068865_100379610 3300006881 Bacteria 1152
406 Ga0097620_100105528 3300006931 Bacteria 2877
407 Ga0097620_100240870 3300006931 Bacteria 1898
408 Ga0097620_100483146 3300006931 Bacteria 1334
409 Ga0097620_100493668 3300006931 Bacteria 1319
410 Ga0079104_1000185 3300006946 Bacteria 88917
411 Ga0079104_1000353 3300006946 Bacteria 55448
412 Ga0075435_100056569 3300007076 Bacteria 3171
413 Ga0075435_100095190 3300007076 Bacteria 2462
414 Ga0075435_100666740 3300007076 Bacteria 903
415 Ga0099794_10659711 3300007265 Bacteria 556
416 Ga0099795_10046084 3300007788 Bacteria 1570
417 Ga0105250_10024900 3300009092 Bacteria 2412
418 Ga0105240_10020529 3300009093 Bacteria 8807
419 Ga0105240_10323184 3300009093 Bacteria 1758
420 Ga0105240_11942824 3300009093 Bacteria 612
421 Ga0111539_10000445 3300009094 Bacteria 52233
422 Ga0111539_10008643 3300009094 Bacteria 12927
423 Ga0111539_10032510 3300009094 Bacteria 6335
424 Ga0111539_10146093 3300009094 Bacteria 2769
425 Ga0111539_10149105 3300009094 Bacteria 2738
426 Ga0111539_10244598 3300009094 Bacteria 2089
427 Ga0111539_10852175 3300009094 Bacteria 1060
428 Ga0111539_11210830 3300009094 Bacteria 877
429 Ga0111539_12484893 3300009094 Bacteria 601
430 Ga0105245_10002842 3300009098 Bacteria 15569
431 Ga0105245_10088851 3300009098 Bacteria 2839
432 Ga0105245_10284165 3300009098 Bacteria 1618
433 Ga0105245_10844111 3300009098 Bacteria 956
434 Ga0105245_11104802 3300009098 Bacteria 839
435 Ga0105245_12751329 3300009098 Bacteria 545
436 Ga0105247_10000149 3300009101 Bacteria 68765
437 Ga0105247_10026167 3300009101 Bacteria 3522
438 Ga0105247_10111436 3300009101 Bacteria 1762
439 Ga0105247_10116867 3300009101 Bacteria 1723
440 Ga0105247_10249908 3300009101 Bacteria 1212
441 Ga0105247_10445919 3300009101 Bacteria 932
442 Ga0105247_10950940 3300009101 Bacteria 667
443 Ga0114129_10008972 3300009147 Bacteria 14258
444 Ga0114129_10016344 3300009147 Bacteria 10565
445 Ga0114129_10128670 3300009147 Bacteria 3480
446 Ga0114129_10254109 3300009147 Bacteria 2358
447 Ga0114129_10284266 3300009147 Bacteria 2209
448 Ga0114129_10417152 3300009147 Bacteria 1766
449 Ga0114129_10426300 3300009147 Bacteria 1744
450 Ga0114129_10442908 3300009147 Bacteria 1705
451 Ga0114129_10539031 3300009147 Bacteria 1519
452 Ga0114129_12101603 3300009147 Bacteria 681
453 Ga0114129_12113672 3300009147 Bacteria 679
454 Ga0114129_12655690 3300009147 Bacteria 597
455 Ga0105243_10000599 3300009148 Bacteria 36060
456 Ga0105243_10128179 3300009148 Bacteria 2149
457 Ga0105243_10405872 3300009148 Bacteria 1267
458 Ga0105243_10421770 3300009148 Bacteria 1245
459 Ga0105243_10529136 3300009148 Bacteria 1122
460 Ga0105243_10792697 3300009148 Bacteria 933
461 Ga0105243_12704115 3300009148 Bacteria 536
462 Ga0105241_10002361 3300009174 Bacteria 14178
463 Ga0105241_10181440 3300009174 Bacteria 1747
464 Ga0105241_10586242 3300009174 Bacteria 1005
465 Ga0105241_10836364 3300009174 Bacteria 850
466 Ga0105241_11095849 3300009174 Bacteria 750
467 Ga0105241_11346691 3300009174 Bacteria 681
468 Ga0105241_11798672 3300009174 Bacteria 598
469 Ga0105242_10001949 3300009176 Bacteria 16241
470 Ga0105242_10161900 3300009176 Bacteria 1960
471 Ga0105242_11383604 3300009176 Bacteria 730
472 Ga0105248_10009531 3300009177 Bacteria 10687
473 Ga0105248_10590630 3300009177 Bacteria 1253
474 Ga0105248_10684338 3300009177 Bacteria 1157
475 Ga0105248_11343240 3300009177 Bacteria 809
476 Ga0105237_10001906 3300009545 Bacteria 26600
477 Ga0105237_10004796 3300009545 Bacteria 15535
478 Ga0105237_10053656 3300009545 Bacteria 4043
479 Ga0105237_10140443 3300009545 Bacteria 2410
480 Ga0105237_10260723 3300009545 Bacteria 1736
481 Ga0105237_10962258 3300009545 Bacteria 861
482 Ga0105238_10043003 3300009551 Bacteria 4572
483 Ga0105238_10043272 3300009551 Bacteria 4557
484 Ga0105238_10103748 3300009551 Bacteria 2825
485 Ga0105238_10107438 3300009551 Bacteria 2771
486 Ga0105238_10800209 3300009551 Bacteria 958
487 Ga0105238_10868370 3300009551 Bacteria 920
488 Ga0105238_11652240 3300009551 Bacteria 671
489 Ga0105249_10152381 3300009553 Bacteria 2227
490 Ga0105249_10236562 3300009553 Bacteria 1804
491 Ga0105249_10928354 3300009553 Bacteria 938
492 Ga0105249_11988307 3300009553 Bacteria 654
493 Ga0105249_13561508 3300009553 Bacteria 502
494 Ga0123341_1000026 3300009765 Bacteria 71667
495 Ga0123342_1013897 3300009766 Bacteria 7887
496 Ga0105029_102828 3300009984 Bacteria 1139
497 Ga0105030_102461 3300009987 Bacteria 1610
498 Ga0105028_100754 3300009993 Bacteria 3452
499 Ga0099796_10096179 3300010159 Bacteria 1108
500 Ga0105239_10001103 3300010375 Bacteria 37309
501 Ga0105239_10032834 3300010375 Bacteria 5703
502 Ga0105239_10071050 3300010375 Bacteria 3824
503 Ga0105239_10299316 3300010375 Bacteria 1811
504 Ga0105239_10458221 3300010375 Bacteria 1447
505 Ga0105239_11817178 3300010375 Bacteria 706
506 Ga0105239_12062693 3300010375 Bacteria 662
507 Ga0105239_12265175 3300010375 Bacteria 632
508 Ga0105246_10000551 3300011119 Bacteria 20625
509 Ga0105246_10038166 3300011119 Bacteria 3227
510 Ga0105246_10220497 3300011119 Bacteria 1486
511 Ga0105246_10754804 3300011119 Bacteria 858
512 Ga0105246_11784586 3300011119 Bacteria 587
513 Ga0105246_12253111 3300011119 Bacteria 531
514 Ga0157340_1005610 3300012473 Bacteria 763
515 Ga0157317_1015233 3300012475 Bacteria 637
516 Ga0157335_1006305 3300012492 Bacteria 857
517 Ga0157323_1009262 3300012495 Bacteria 751
518 Ga0157326_1057689 3300012513 Bacteria 586
519 Ga0157373_10002184 3300013100 Bacteria 14813
520 Ga0157373_10121171 3300013100 Bacteria 1838
521 Ga0157371_10019238 3300013102 Bacteria 5038
522 Ga0157371_10157860 3300013102 Bacteria 1619
523 Ga0157371_10229987 3300013102 Bacteria 1332
524 Ga0157370_10026493 3300013104 Bacteria 5724
525 Ga0157369_10032038 3300013105 Bacteria 5783
526 Ga0157369_10061261 3300013105 Bacteria 4057
527 Ga0157369_10490782 3300013105 Bacteria 1271
528 Ga0157369_11180726 3300013105 Bacteria 781
529 Ga0157374_10022700 3300013296 Bacteria 5601
530 Ga0157374_10545521 3300013296 Bacteria 1167
531 Ga0157374_10813613 3300013296 Bacteria 950
532 Ga0157378_10000562 3300013297 Bacteria 35265
533 Ga0157378_10006236 3300013297 Bacteria 10440
534 Ga0157378_11039669 3300013297 Bacteria 854
535 Ga0157378_13273914 3300013297 Bacteria 503
536 Ga0163162_10010813 3300013306 Bacteria 8878
537 Ga0163162_10830754 3300013306 Bacteria 1040
538 Ga0163162_11282399 3300013306 Bacteria 832
539 Ga0163162_11330581 3300013306 Bacteria 817
540 Ga0163162_13353961 3300013306 Bacteria 512
541 Ga0157372_10001660 3300013307 Bacteria 24114
542 Ga0157372_10278053 3300013307 Bacteria 1946
543 Ga0157372_10313756 3300013307 Bacteria 1825
544 Ga0157372_10627681 3300013307 Bacteria 1252
545 Ga0157372_11096922 3300013307 Bacteria 921
546 Ga0157375_10010085 3300013308 Bacteria 8307
547 Ga0157375_10023408 3300013308 Bacteria 5700
548 Ga0157375_10025986 3300013308 Bacteria 5450
549 Ga0157375_10422607 3300013308 Bacteria 1499
550 Ga0157375_12581689 3300013308 Bacteria 607
551 Ga0163163_10058906 3300014325 Bacteria 3797
552 Ga0163163_10091048 3300014325 Bacteria 3064
553 Ga0163163_10747608 3300014325 Bacteria 1041
554 Ga0163163_11150267 3300014325 Bacteria 839
555 Ga0163163_11235835 3300014325 Bacteria 809
556 Ga0163163_11400737 3300014325 Bacteria 761
557 Ga0163163_11405372 3300014325 Bacteria 759
558 Ga0157380_10002796 3300014326 Bacteria 11863
559 Ga0157380_10018982 3300014326 Bacteria 5118
560 Ga0157380_10113274 3300014326 Bacteria 2284
561 Ga0157380_10279531 3300014326 Bacteria 1527
562 Ga0157380_10689233 3300014326 Bacteria 1025
563 Ga0157380_10765432 3300014326 Bacteria 979
564 Ga0157380_11042057 3300014326 Bacteria 854
565 Ga0157380_11194777 3300014326 Bacteria 804
566 Ga0182008_10051065 3300014497 Bacteria 2052
567 Ga0182008_10091566 3300014497 Bacteria 1499
568 Ga0157377_10002752 3300014745 Bacteria 7828
569 Ga0157379_10002389 3300014968 Bacteria 15688
570 Ga0157379_10065378 3300014968 Bacteria 3251
571 Ga0157379_10202659 3300014968 Bacteria 1794
572 Ga0157379_10208906 3300014968 Bacteria 1767
573 Ga0157379_10616880 3300014968 Bacteria 1013
574 Ga0157379_10676750 3300014968 Bacteria 967
575 Ga0157379_10856455 3300014968 Bacteria 860
576 Ga0157379_10919432 3300014968 Bacteria 831
577 Ga0157376_10000431 3300014969 Bacteria 27175
578 Ga0157376_10000924 3300014969 Bacteria 19089
579 Ga0182007_10051961 3300015262 Bacteria 1351
580 Ga0163161_10001894 3300017792 Bacteria 15280
581 Ga0163161_10128791 3300017792 Bacteria 1907
582 Ga0206356_10357052 3300020070 Bacteria 1476
583 Ga0206353_10988117 3300020082 Bacteria 789
584 Ga0214544_1002722 3300021320 Bacteria 36995
585 Ga0214542_1000006 3300021321 Bacteria 345164
586 Ga0214543_1000003 3300021327 Bacteria 692327
587 Ga0214543_1000014 3300021327 Bacteria 324986
588 Ga0213873_10000537 3300021358 Bacteria 6162
589 Ga0213872_10005597 3300021361 Bacteria 6416
590 Ga0213874_10114079 3300021377 Bacteria 911
591 Ga0213876_10003346 3300021384 Bacteria 9180
592 Ga0213876_10013484 3300021384 Bacteria 4340
593 Ga0213875_10124551 3300021388 Bacteria 1204
594 Ga0213875_10236941 3300021388 Bacteria 860
595 Ga0213871_10027552 3300021441 Bacteria 1460
596 Ga0228711_1000015 3300022739 Bacteria 126974
597 Ga0228710_1000015 3300022740 Bacteria 133640
598 Ga0228598_1092825 3300024227 Bacteria 608
599 Ga0209435_100024 3300025206 Bacteria 199665
600 Ga0209436_100141 3300025208 Bacteria 34727
601 Ga0207427_103054 3300025231 Bacteria 3812
602 Ga0209437_100033 3300025233 Bacteria 512520
603 Ga0209258_116945 3300025242 Bacteria 806
604 Ga0207425_1002787 3300025245 Bacteria 5927
605 Ga0207425_1003038 3300025245 Bacteria 5566
606 Ga0207425_1008511 3300025245 Bacteria 2618
607 Ga0207425_1020020 3300025245 Bacteria 1435
608 Ga0209646_1000064 3300025246 Bacteria 246524
609 Ga0209026_1000024 3300025250 Bacteria 355839
610 Ga0209026_1000053 3300025250 Bacteria 246524
611 Ga0209148_1000636 3300025254 Bacteria 30719
612 Ga0209759_1000042 3300025256 Bacteria 246524
613 Ga0209759_1000057 3300025256 Bacteria 205181
614 Ga0209129_1003089 3300025258 Bacteria 7501
615 Ga0209129_1004073 3300025258 Bacteria 5955
616 Ga0209129_1004523 3300025258 Bacteria 5380
617 Ga0209233_1000262 3300025261 Bacteria 79485
618 Ga0209233_1000983 3300025261 Bacteria 12178
619 Ga0209233_1072236 3300025261 Bacteria 635
620 Ga0209455_1002662 3300025272 Bacteria 6729
621 Ga0209673_1000429 3300025273 Bacteria 72898
622 Ga0209673_1002264 3300025273 Bacteria 13857
623 Ga0209673_1003567 3300025273 Bacteria 9064
624 Ga0209673_1007109 3300025273 Bacteria 5244
625 Ga0209673_1034831 3300025273 Bacteria 1515
626 Ga0209673_1109770 3300025273 Bacteria 579
627 Ga0209130_1000006 3300025284 Bacteria 596528
628 Ga0209130_1000167 3300025284 Bacteria 95517
629 Ga0209675_1049273 3300025291 Bacteria 877
630 Ga0209675_1053025 3300025291 Bacteria 829
631 Ga0209676_1057684 3300025292 Bacteria 983
632 Ga0209025_1000077 3300025294 Bacteria 271958
633 Ga0209025_1000440 3300025294 Bacteria 81964
634 Ga0209025_1006741 3300025294 Bacteria 8813
635 Ga0209025_1101625 3300025294 Bacteria 908
636 Ga0209025_1170932 3300025294 Bacteria 571
637 Ga0209564_1000640 3300025295 Bacteria 53056
638 Ga0209564_1000652 3300025295 Bacteria 51925
639 Ga0209564_1002555 3300025295 Bacteria 13996
640 Ga0209564_1041902 3300025295 Bacteria 1221
641 Ga0209758_1000239 3300025297 Bacteria 114761
642 Ga0209758_1000717 3300025297 Bacteria 48915
643 Ga0209758_1001231 3300025297 Bacteria 32044
644 Ga0209758_1002395 3300025297 Bacteria 19280
645 Ga0209758_1002533 3300025297 Bacteria 18442
646 Ga0209758_1009634 3300025297 Bacteria 5955
647 Ga0209758_1009763 3300025297 Bacteria 5887
648 Ga0209758_1010363 3300025297 Bacteria 5591
649 Ga0209050_1005108 3300025298 Bacteria 8450
650 Ga0209050_1006425 3300025298 Bacteria 6963
651 Ga0209256_1001672 3300025299 Bacteria 21526
652 Ga0209256_1012032 3300025299 Bacteria 3375
653 Ga0209256_1016818 3300025299 Bacteria 2466
654 Ga0209256_1034357 3300025299 Bacteria 1351
655 Ga0207426_1000119 3300025302 Bacteria 221800
656 Ga0207426_1000231 3300025302 Bacteria 128171
657 Ga0207426_1000239 3300025302 Bacteria 123307
658 Ga0209051_1001893 3300025303 Bacteria 16331
659 Ga0209051_1009712 3300025303 Bacteria 4931
660 Ga0209051_1010508 3300025303 Bacteria 4664
661 Ga0209051_1055446 3300025303 Bacteria 1286
662 Ga0209051_1084505 3300025303 Bacteria 903
663 Ga0209051_1089326 3300025303 Bacteria 862
664 Ga0209257_1002840 3300025304 Bacteria 16243
665 Ga0209257_1003626 3300025304 Bacteria 12988
666 Ga0209257_1041979 3300025304 Bacteria 1353
667 Ga0207697_10015917 3300025315 Bacteria 3102
668 Ga0207656_10060607 3300025321 Bacteria 1659
669 Ga0207696_1024847 3300025711 Bacteria 1874
670 Ga0207653_10091147 3300025885 Bacteria 1068
671 Ga0207682_10114763 3300025893 Bacteria 1189
672 Ga0207692_10075824 3300025898 Bacteria 1785
673 Ga0207642_10062563 3300025899 Bacteria 1736
674 Ga0207642_10096332 3300025899 Bacteria 1475
675 Ga0207710_10004411 3300025900 Bacteria 6146
676 Ga0207710_10006878 3300025900 Bacteria 4840
677 Ga0207710_10051289 3300025900 Bacteria 1853
678 Ga0207688_10021415 3300025901 Bacteria 3532
679 Ga0207688_10234459 3300025901 Bacteria 1108
680 Ga0207688_10567147 3300025901 Bacteria 714
681 Ga0207688_10671875 3300025901 Bacteria 654
682 Ga0207688_10956123 3300025901 Bacteria 542
683 Ga0207680_10006188 3300025903 Bacteria 5773
684 Ga0207680_10334214 3300025903 Bacteria 1062
685 Ga0207647_10000860 3300025904 Bacteria 23528
686 Ga0207647_10051264 3300025904 Bacteria 2551
687 Ga0207647_10187860 3300025904 Bacteria 1198
688 Ga0207685_10000138 3300025905 Bacteria 10749
689 Ga0207685_10025794 3300025905 Bacteria 2034
690 Ga0207685_10419336 3300025905 Bacteria 690
691 Ga0207699_10002265 3300025906 Bacteria 9081
692 Ga0207645_10001877 3300025907 Bacteria 16980
693 Ga0207645_10298847 3300025907 Bacteria 1072
694 Ga0207645_10493097 3300025907 Bacteria 829
695 Ga0207684_10020270 3300025910 Bacteria 5681
696 Ga0207684_10253463 3300025910 Bacteria 1518
697 Ga0207684_10304410 3300025910 Bacteria 1374
698 Ga0207654_10221736 3300025911 Bacteria 1255
699 Ga0207654_10601635 3300025911 Bacteria 784
700 Ga0207654_11429113 3300025911 Bacteria 504
701 Ga0207707_10013646 3300025912 Bacteria 7085
702 Ga0207707_10174883 3300025912 Bacteria 1876
703 Ga0207695_10080032 3300025913 Bacteria 3310
704 Ga0207695_10174922 3300025913 Bacteria 2070
705 Ga0207695_10293117 3300025913 Bacteria 1519
706 Ga0207671_10000168 3300025914 Bacteria 100117
707 Ga0207671_10079774 3300025914 Bacteria 2453
708 Ga0207671_10529185 3300025914 Bacteria 940
709 Ga0207671_10693874 3300025914 Bacteria 810
710 Ga0207671_10727846 3300025914 Bacteria 788
711 Ga0207693_10000529 3300025915 Bacteria 34501
712 Ga0207693_10044401 3300025915 Bacteria 3493
713 Ga0207663_10000644 3300025916 Bacteria 15509
714 Ga0207663_10403681 3300025916 Bacteria 1046
715 Ga0207663_11170198 3300025916 Bacteria 619
716 Ga0207663_11208345 3300025916 Bacteria 609
717 Ga0207660_10009058 3300025917 Bacteria 6447
718 Ga0207662_10006259 3300025918 Bacteria 6411
719 Ga0207657_10000034 3300025919 Bacteria 127192
720 Ga0207657_10460369 3300025919 Bacteria 998
721 Ga0207657_10693413 3300025919 Unclassified 791
722 Ga0207657_11127274 3300025919 Bacteria 599
723 Ga0207649_10011798 3300025920 Bacteria 4832
724 Ga0207649_10134641 3300025920 Bacteria 1683
725 Ga0207649_10392238 3300025920 Bacteria 1037
726 Ga0207649_10460093 3300025920 Bacteria 962
727 Ga0207649_10628496 3300025920 Bacteria 828
728 Ga0207652_10574364 3300025921 Bacteria 1012
729 Ga0207652_11125747 3300025921 Bacteria 686
730 Ga0207646_10171311 3300025922 Bacteria 1960
731 Ga0207646_10475132 3300025922 Bacteria 1127
732 Ga0207681_10002140 3300025923 Bacteria 12611
733 Ga0207681_10129422 3300025923 Bacteria 1864
734 Ga0207681_10318373 3300025923 Bacteria 1236
735 Ga0207694_10043477 3300025924 Bacteria 3468
736 Ga0207694_10089016 3300025924 Bacteria 2434
737 Ga0207694_10099887 3300025924 Bacteria 2299
738 Ga0207694_10120504 3300025924 Bacteria 2094
739 Ga0207694_10361424 3300025924 Bacteria 1203
740 Ga0207694_10374573 3300025924 Bacteria 1181
741 Ga0207650_10006785 3300025925 Bacteria 7807
742 Ga0207659_10083082 3300025926 Bacteria 2373
743 Ga0207659_10288875 3300025926 Bacteria 1343
744 Ga0207687_10003044 3300025927 Bacteria 11368
745 Ga0207687_10266171 3300025927 Bacteria 1368
746 Ga0207687_10364349 3300025927 Bacteria 1180
747 Ga0207687_11047489 3300025927 Bacteria 700
748 Ga0207700_10060723 3300025928 Bacteria 2864
749 Ga0207700_10248934 3300025928 Bacteria 1517
750 Ga0207664_10002200 3300025929 Bacteria 12840
751 Ga0207664_10433158 3300025929 Bacteria 1172
752 Ga0207664_10541173 3300025929 Bacteria 1044
753 Ga0207664_10811266 3300025929 Bacteria 842
754 Ga0207644_10003446 3300025931 Bacteria 10223
755 Ga0207690_10000053 3300025932 Bacteria 105125
756 Ga0207690_10170305 3300025932 Bacteria 1631
757 Ga0207690_10856718 3300025932 Bacteria 752
758 Ga0207690_10921998 3300025932 Bacteria 725
759 Ga0207690_11274016 3300025932 Bacteria 614
760 Ga0207706_10000076 3300025933 Bacteria 102376
761 Ga0207706_10541497 3300025933 Bacteria 1003
762 Ga0207706_10742453 3300025933 Bacteria 837
763 Ga0207706_10833592 3300025933 Bacteria 782
764 Ga0207686_10038878 3300025934 Bacteria 2883
765 Ga0207709_10006904 3300025935 Bacteria 6353
766 Ga0207709_10085876 3300025935 Bacteria 2041
767 Ga0207709_10092768 3300025935 Bacteria 1978
768 Ga0207709_10628079 3300025935 Bacteria 853
769 Ga0207709_11357948 3300025935 Bacteria 588
770 Ga0207709_11512264 3300025935 Bacteria 557
771 Ga0207670_10218658 3300025936 Bacteria 1457
772 Ga0207669_10080154 3300025937 Bacteria 2087
773 Ga0207669_10268345 3300025937 Bacteria 1280
774 Ga0207669_10338009 3300025937 Bacteria 1159
775 Ga0207704_10011920 3300025938 Bacteria 4299
776 Ga0207704_10159751 3300025938 Bacteria 1602
777 Ga0207704_10171183 3300025938 Bacteria 1558
778 Ga0207704_10333965 3300025938 Bacteria 1174
779 Ga0207665_10000911 3300025939 Bacteria 19954
780 Ga0207691_10001503 3300025940 Bacteria 23199
781 Ga0207691_10170940 3300025940 Bacteria 1903
782 Ga0207691_10441710 3300025940 Bacteria 1107
783 Ga0207691_10577986 3300025940 Bacteria 952
784 Ga0207691_11219689 3300025940 Bacteria 623
785 Ga0207711_10063574 3300025941 Bacteria 3186
786 Ga0207711_10221358 3300025941 Bacteria 1731
787 Ga0207711_10911747 3300025941 Bacteria 817
788 Ga0207689_10066767 3300025942 Bacteria 2956
789 Ga0207689_10295284 3300025942 Bacteria 1343
790 Ga0207661_10774004 3300025944 Bacteria 884
791 Ga0207679_10002471 3300025945 Bacteria 11377
792 Ga0207667_10006980 3300025949 Bacteria 13646
793 Ga0207667_10021802 3300025949 Bacteria 7091
794 Ga0207667_10110607 3300025949 Bacteria 2834
795 Ga0207667_11255486 3300025949 Bacteria 719
796 Ga0207651_10001023 3300025960 Bacteria 12353
797 Ga0207651_10924687 3300025960 Bacteria 777
798 Ga0207712_10063637 3300025961 Bacteria 2627
799 Ga0207712_10075087 3300025961 Bacteria 2443
800 Ga0207712_10158719 3300025961 Bacteria 1755
801 Ga0207668_10000608 3300025972 Bacteria 22267
802 Ga0207668_10107250 3300025972 Bacteria 2088
803 Ga0207668_10130699 3300025972 Bacteria 1917
804 Ga0207668_10134257 3300025972 Bacteria 1894
805 Ga0207668_10524385 3300025972 Bacteria 1023
806 Ga0207668_11044594 3300025972 Bacteria 731
807 Ga0207668_11358729 3300025972 Bacteria 640
808 Ga0207640_10028940 3300025981 Bacteria 3394
809 Ga0207640_10058081 3300025981 Bacteria 2547
810 Ga0207640_10197430 3300025981 Bacteria 1522
811 Ga0207640_10221007 3300025981 Bacteria 1450
812 Ga0207640_10332807 3300025981 Bacteria 1213
813 Ga0207658_10002570 3300025986 Bacteria 13186
814 Ga0207658_10674948 3300025986 Bacteria 933
815 Ga0207677_10021947 3300026023 Bacteria 3913
816 Ga0207677_10356755 3300026023 Bacteria 1227
817 Ga0207677_10560129 3300026023 Bacteria 997
818 Ga0207677_10682606 3300026023 Bacteria 910
819 Ga0207703_10011879 3300026035 Bacteria 6780
820 Ga0207703_10107765 3300026035 Bacteria 2372
821 Ga0207703_10156666 3300026035 Bacteria 1991
822 Ga0207703_10228636 3300026035 Bacteria 1667
823 Ga0207703_11183360 3300026035 Bacteria 735
824 Ga0207639_10018434 3300026041 Bacteria 4959
825 Ga0207639_10104254 3300026041 Bacteria 2299
826 Ga0207639_10131200 3300026041 Bacteria 2075
827 Ga0207639_10152647 3300026041 Bacteria 1936
828 Ga0207639_10790749 3300026041 Bacteria 884
829 Ga0207678_10000036 3300026067 Bacteria 104164
830 Ga0207678_10994797 3300026067 Bacteria 742
831 Ga0207678_11094689 3300026067 Bacteria 705
832 Ga0207708_10027653 3300026075 Bacteria 4296
833 Ga0207708_10157797 3300026075 Bacteria 1790
834 Ga0207708_10178883 3300026075 Bacteria 1683
835 Ga0207708_10408059 3300026075 Bacteria 1125
836 Ga0207708_10422291 3300026075 Bacteria 1106
837 Ga0207708_10911220 3300026075 Bacteria 761
838 Ga0207702_10123895 3300026078 Bacteria 2317
839 Ga0207702_10609028 3300026078 Bacteria 1072
840 Ga0207702_12239168 3300026078 Bacteria 535
841 Ga0207648_10048718 3300026089 Bacteria 3709
842 Ga0207648_10166544 3300026089 Bacteria 1948
843 Ga0207648_10271261 3300026089 Bacteria 1516
844 Ga0207676_10104953 3300026095 Bacteria 2351
845 Ga0207676_10950359 3300026095 Bacteria 845
846 Ga0207674_10006679 3300026116 Bacteria 13553
847 Ga0207674_10164554 3300026116 Bacteria 2172
848 Ga0207675_100000970 3300026118 Bacteria 28501
849 Ga0207675_100057278 3300026118 Bacteria 3636
850 Ga0207675_100067662 3300026118 Bacteria 3339
851 Ga0207675_100070419 3300026118 Bacteria 3269
852 Ga0207675_100251380 3300026118 Bacteria 1711
853 Ga0207683_10000015 3300026121 Bacteria 125989
854 Ga0207683_10121226 3300026121 Bacteria 2348
855 Ga0207683_10273725 3300026121 Bacteria 1542
856 Ga0207683_11399963 3300026121 Bacteria 646
857 Ga0207698_10014923 3300026142 Bacteria 5184
858 Ga0207698_10033333 3300026142 Bacteria 3742
859 Ga0207698_10048186 3300026142 Bacteria 3233
860 Ga0207698_11639245 3300026142 Bacteria 659
861 Ga0207698_11931934 3300026142 Bacteria 605
862 Ga0209281_1000211 3300027111 Bacteria 130597
863 Ga0209281_1000339 3300027111 Bacteria 79862
864 Ga0209282_1000022 3300027666 Bacteria 173388
865 Ga0209998_10004998 3300027717 Bacteria 2787
866 Ga0209998_10068743 3300027717 Bacteria 844
867 Ga0209813_10000485 3300027866 Bacteria 9415
868 Ga0209813_10011873 3300027866 Bacteria 2287
869 Ga0209813_10022129 3300027866 Bacteria 1794
870 Ga0209813_10096322 3300027866 Bacteria 1001
871 Ga0209813_10285739 3300027866 Bacteria 637
872 Ga0209974_10135044 3300027876 Bacteria 882
873 Ga0209974_10315918 3300027876 Bacteria 600
874 Ga0207428_10000242 3300027907 Bacteria 74839
875 Ga0207428_10009524 3300027907 Bacteria 8702
876 Ga0207428_10047529 3300027907 Bacteria 3446
877 Ga0207428_10053128 3300027907 Bacteria 3232
878 Ga0207428_10055600 3300027907 Bacteria 3146
879 Ga0207428_10155648 3300027907 Bacteria 1738
880 Ga0268266_10000691 3300028379 Bacteria 45474
881 Ga0268266_10012981 3300028379 Bacteria 7183
882 Ga0268266_10175048 3300028379 Bacteria 1950
883 Ga0268266_10720511 3300028379 Bacteria 962
884 Ga0268266_11383133 3300028379 Bacteria 679
885 Ga0268265_10014961 3300028380 Bacteria 5298
886 Ga0268265_10030568 3300028380 Bacteria 3880
887 Ga0268265_12329449 3300028380 Bacteria 542
888 Ga0268265_12684840 3300028380 Bacteria 503
889 Ga0268264_10011840 3300028381 Bacteria 7188
890 Ga0268264_10406113 3300028381 Bacteria 1310
891 Ga0268264_10434852 3300028381 Bacteria 1268
892 Ga0268264_11046090 3300028381 Bacteria 824
893 Ga0268264_11601848 3300028381 Bacteria 662
894 Ga0265318_10009830 3300028577 Bacteria 4192
895 Ga0307517_10159381 3300028786 Bacteria 1520
896 Ga0307515_10053381 3300028794 Bacteria 5966
897 Ga0265338_10635806 3300028800 Bacteria 741
898 Ga0311004_122382 3300029276 Bacteria 732
899 Ga0265324_10004826 3300029957 Bacteria 5953
900 Ga0265770_1100144 3300030878 Bacteria 588
901 Ga0265760_10085058 3300031090 Bacteria 984
902 Ga0265330_10006199 3300031235 Bacteria 5919
903 Ga0265332_10088414 3300031238 Bacteria 1311
904 Ga0265328_10000857 3300031239 Bacteria 14123
905 Ga0265328_10004107 3300031239 Bacteria 6357
906 Ga0265328_10011592 3300031239 Bacteria 3517
907 Ga0265328_10450642 3300031239 Bacteria 509
908 Ga0265320_10196465 3300031240 Bacteria 901
909 Ga0265325_10004328 3300031241 Bacteria 8993
910 Ga0265325_10011278 3300031241 Bacteria 5136
911 Ga0265325_10051774 3300031241 Bacteria 2110
912 Ga0265340_10043927 3300031247 Bacteria 2188
913 Ga0265340_10148605 3300031247 Bacteria 1069
914 Ga0265339_10000227 3300031249 Bacteria 45452
915 Ga0265339_10296403 3300031249 Bacteria 772
916 Ga0265339_10340507 3300031249 Bacteria 708
917 Ga0265331_10001321 3300031250 Bacteria 18365
918 Ga0265331_10001698 3300031250 Bacteria 15878
919 Ga0265331_10029097 3300031250 Bacteria 2759
920 Ga0265331_10465863 3300031250 Bacteria 568
921 Ga0265327_10144604 3300031251 Bacteria 1109
922 Ga0265327_10234353 3300031251 Bacteria 822
923 Ga0265316_10006117 3300031344 Bacteria 11547
924 Ga0265316_10007778 3300031344 Bacteria 10038
925 Ga0265316_10388872 3300031344 Bacteria 1006
926 Ga0265316_10526059 3300031344 Bacteria 843
927 Ga0307513_10044628 3300031456 Bacteria 4854
928 Ga0307513_10072369 3300031456 Bacteria 3593
929 Ga0307513_10253688 3300031456 Bacteria 1554
930 Ga0307408_100207502 3300031548 Bacteria 1590
931 Ga0307408_102122107 3300031548 Bacteria 542
932 Ga0265313_10000048 3300031595 Bacteria 112723
933 Ga0265313_10000607 3300031595 Bacteria 37291
934 Ga0265313_10001237 3300031595 Bacteria 24347
935 Ga0265313_10005287 3300031595 Bacteria 9554
936 Ga0307508_10064654 3300031616 Bacteria 3225
937 Ga0307508_10611589 3300031616 Bacteria 692
938 Ga0307514_10488764 3300031649 Bacteria 590
939 Ga0316579_10000126 3300031691 Bacteria 21042
940 Ga0265314_10008887 3300031711 Bacteria 8570
941 Ga0265314_10022804 3300031711 Bacteria 4791
942 Ga0265314_10055166 3300031711 Bacteria 2745
943 Ga0265342_10003397 3300031712 Bacteria 13106
944 Ga0265342_10009957 3300031712 Bacteria 6643
945 Ga0265342_10047556 3300031712 Bacteria 2574
946 Ga0265342_10492266 3300031712 Bacteria 626
947 Ga0316576_10031837 3300031727 Bacteria 3745
948 Ga0316576_10176960 3300031727 Bacteria 1609
949 Ga0316578_10146890 3300031728 Bacteria 1420
950 Ga0316578_10248293 3300031728 Bacteria 1068
951 Ga0316578_10490161 3300031728 Bacteria 724
952 Ga0307516_10408343 3300031730 Bacteria 1016
953 Ga0307516_10487964 3300031730 Bacteria 887
954 Ga0307405_10633707 3300031731 Bacteria 877
955 Ga0307405_11268507 3300031731 Bacteria 640
956 Ga0316577_10105005 3300031733 Bacteria 1584
957 Ga0307410_10138584 3300031852 Bacteria 1797
958 Ga0307410_11155700 3300031852 Bacteria 673
959 Ga0307406_10470476 3300031901 Bacteria 1013
960 Ga0307407_10299071 3300031903 Bacteria 1121
961 Ga0307407_10446336 3300031903 Bacteria 938
962 Ga0307407_11054780 3300031903 Bacteria 630
963 Ga0307412_10158793 3300031911 Bacteria 1677
964 Ga0307412_10527409 3300031911 Bacteria 988
965 Ga0315914_1000013 3300031967 Bacteria 133640
966 Ga0307409_100365238 3300031995 Bacteria 1367
967 Ga0307409_101442176 3300031995 Bacteria 715
968 Ga0307409_101888993 3300031995 Bacteria 627
969 Ga0307409_102738865 3300031995 Bacteria 521
970 Ga0307409_102801707 3300031995 Bacteria 515
971 Ga0307416_100595504 3300032002 Bacteria 1185
972 Ga0307416_101527359 3300032002 Bacteria 773
973 Ga0307416_103468031 3300032002 Bacteria 528
974 Ga0307414_10503852 3300032004 Bacteria 1072
975 Ga0307414_10617963 3300032004 Bacteria 974
976 Ga0307411_11022358 3300032005 Bacteria 741
977 Ga0307415_100763298 3300032126 Bacteria 879
978 Ga0307415_102075695 3300032126 Bacteria 555
979 Ga0316583_10090938 3300032133 Bacteria 1064
980 Ga0316583_10103839 3300032133 Bacteria 990
981 Ga0316583_10275044 3300032133 Bacteria 583
982 Ga0316585_10007690 3300032137 Bacteria 3112
983 Ga0316580_10018351 3300032139 Bacteria 2151
984 Ga0307510_10051946 3300033180 Bacteria 4329
985 Ga0315913_1000029 3300033430 Bacteria 76154
986 Ga0315915_1000001 3300033464 Bacteria 481518
987 Ga0316596_1035763 3300033541 Bacteria 1298
988 Ga0373930_0031227 3300034816 Bacteria 1097
989 Ga0373950_0078259 3300034818 Bacteria 687
990 Ga0373958_0013233 3300034819 Bacteria 1425
991 Ga0373958_0024168 3300034819 Bacteria 1148
992 Ga0373958_0056348 3300034819 Bacteria 841
993 Ga0373959_0016613 3300034820 Bacteria 1366
994 Ga0373959_0019346 3300034820 Bacteria 1289
995 Ga0373959_0089746 3300034820 Bacteria 719
996 Ga0373938_0003577 3300034957 Bacteria 2556
997 Ga0373926_0126760 3300035083 Bacteria 965
998 Ga0373929_0019784 3300035085 Bacteria 1351
999 Ga0373929_0074071 3300035085 Bacteria 819
1000 Ga0373934_0123886 3300035086 Bacteria 1052
1001 Ga0373940_0095917 3300035088 Bacteria 894
1002 Ga0373944_0001172 3300035089 Bacteria 6542
1003 Ga0373944_0149636 3300035089 Bacteria 822
1004 Ga0373949_0079583 3300035090 Bacteria 871
1005 Ga0373949_0099077 3300035090 Bacteria 796
1006 Ga0373951_0076772 3300035091 Bacteria 859
1007 Ga0373923_0054182 3300035111 Bacteria 1688
1008 Ga0373923_0669708 3300035111 Bacteria 514
1009 Ga0373936_0051208 3300035113 Bacteria 1671
1010 Ga0373939_0004920 3300035114 Bacteria 3173
1011 Ga0373939_0174791 3300035114 Bacteria 797
1012 Ga0373941_0004775 3300035115 Bacteria 3153
1013 Ga0373941_0005194 3300035115 Bacteria 3049
1014 Ga0373941_0010139 3300035115 Bacteria 2395
1015 Ga0373945_0002545 3300035116 Bacteria 5707
1016 Ga0373945_0005532 3300035116 Bacteria 4047
1017 Ga0373945_0101293 3300035116 Bacteria 1127
1018 Ga0373954_0390787 3300035118 Bacteria 688
1019 Ga0373956_0268986 3300035119 Bacteria 811
1020 Ga0373956_0345126 3300035119 Bacteria 710
1021 Ga0373960_0002540 3300035121 Bacteria 4113
1022 Ga0373960_0007369 3300035121 Bacteria 2605
1023 Ga0373943_0000440 3300035170 Bacteria 17560
1024 Ga0373943_0007823 3300035170 Bacteria 4801
1025 Ga0373943_0104281 3300035170 Bacteria 1487
1026 Ga0373946_0001659 3300035171 Bacteria 7742
1027 Ga0373946_0074628 3300035171 Bacteria 1472
1028 Ga0373946_0652186 3300035171 Bacteria 548
1029 Ga0373955_0272678 3300035172 Bacteria 1017
1030 Ga0373942_0007897 3300035207 Bacteria 2473
1031 Ga0373961_0126347 3300035241 Bacteria 852
1032 Ga0373962_0002597 3300035242 Bacteria 4290
1033 Ga0373962_0003296 3300035242 Bacteria 3883
1034 Ga0316574_0067039 3300035398 Bacteria 2262
1035 Ga0316574_0439981 3300035398 Bacteria 818
1036 Ga0316574_0463497 3300035398 Unclassified 793
1037 Ga0373931_0001417 3300035691 Bacteria 10275
1038 Ga0373931_0004196 3300035691 Bacteria 6561
1039 Ga0373931_0005369 3300035691 Bacteria 5916
1040 Ga0373931_0036833 3300035691 Bacteria 2552
1041 Ga0373935_0016068 3300035692 Bacteria 4529
1042 Ga0373935_0109564 3300035692 Bacteria 1831
1043 Ga0373935_0332934 3300035692 Bacteria 1079
1044 Ga0373935_0511675 3300035692 Bacteria 872
1045 Ga0373927_0000562 3300035695 Bacteria 28305
1046 Ga0373927_0000829 3300035695 Bacteria 23662
1047 Ga0373927_0006747 3300035695 Bacteria 7811
1048 Ga0373927_0034231 3300035695 Bacteria 3305
1049 Ga0373927_0113054 3300035695 Bacteria 1770
1050 Ga0373927_0156494 3300035695 Bacteria 1493
1051 Ga0373927_0483992 3300035695 Bacteria 818
1052 Ga0373933_0975343 3300035724 Bacteria 558
1053 Ga0373947_0000393 3300035725 Bacteria 24647
1054 Ga0373947_0001108 3300035725 Bacteria 16537
1055 Ga0373947_0007372 3300035725 Bacteria 6368
1056 Ga0373947_0258074 3300035725 Bacteria 1154
1057 Ga0373947_0481981 3300035725 Bacteria 842
1058 Ga0373947_0899409 3300035725 Bacteria 604
1059 Ga0373937_0094013 3300036401 Bacteria 2780
1060 Ga0373937_0099414 3300036401 Bacteria 2699
1061 Ga0373937_0102727 3300036401 Bacteria 2654
1062 Ga0373937_1447099 3300036401 Bacteria 635
1063 Ga0316582_0024934 3300036647 Bacteria 3584
1064 Ga0316582_0308770 3300036647 Bacteria 1087
1065 Ga0316582_0525241 3300036647 Bacteria 816
1066 Ga0316582_1243242 3300036647 Bacteria 507
1067 Ga0316584_0009124 3300036712 Bacteria 6867
1068 Ga0316584_0104040 3300036712 Bacteria 2125
1069 Ga0316584_0214478 3300036712 Bacteria 1416
1070 Ga0373925_0001485 3300037068 Bacteria 20124
1071 Ga0373925_0002574 3300037068 Bacteria 14441
1072 Ga0373925_0014355 3300037068 Bacteria 5729
1073 Ga0373925_0014423 3300037068 Bacteria 5713
1074 Ga0373925_0076835 3300037068 Bacteria 2534
1075 Ga0373925_0901473 3300037068 Bacteria 729
1076 Ga0373925_1288436 3300037068 Bacteria 600
1077 Ga0395899_0030159 3300037312 Bacteria 4080
1078 Ga0395899_0041052 3300037312 Bacteria 3458
1079 Ga0395899_0133699 3300037312 Bacteria 1769
1080 Ga0395899_0217771 3300037312 Bacteria 1324
1081 Ga0395900_0115352 3300037418 Bacteria 2756
1082 Ga0395900_0230184 3300037418 Bacteria 1864
1083 Ga0395900_0485875 3300037418 Bacteria 1187
1084 Ga0395900_0509309 3300037418 Bacteria 1153
1085 Ga0395900_0512723 3300037418 Bacteria 1148
1086 Ga0395900_0694616 3300037418 Bacteria 951
1087 Ga0395898_0022566 3300037466 Bacteria 6373
1088 Ga0395898_0031756 3300037466 Bacteria 5275
1089 Ga0395898_0143125 3300037466 Bacteria 2289
1090 Ga0395898_0584713 3300037466 Bacteria 1059
1091 Ga0395905_0005926 3300037471 Bacteria 12389
1092 Ga0395905_0032619 3300037471 Bacteria 4898
1093 Ga0395905_0045429 3300037471 Bacteria 4119
1094 Ga0395905_0053839 3300037471 Bacteria 3766
1095 Ga0395905_0241604 3300037471 Bacteria 1687
1096 Ga0395905_0369742 3300037471 Bacteria 1327
1097 Ga0316581_0003368 3300037588 Bacteria 3974
1098 Ga0436364_0238815 3300037853 Bacteria 8510
1099 Ga0436364_0427356 3300037853 Bacteria 1279
1100 Ga0395901_0024589 3300038443 Bacteria 6185
1101 Ga0395901_0047962 3300038443 Bacteria 4435
1102 Ga0395901_0048965 3300038443 Bacteria 4389
1103 Ga0395901_0204059 3300038443 Bacteria 2071
1104 Ga0395901_1419732 3300038443 Bacteria 652
1105 Ga0242420_024573 3300038996 Bacteria 1092
1106 Ga0400483_051690 3300039062 Bacteria 1376
1107 Ga0400483_055590 3300039062 Bacteria 7774
1108 Ga0400483_085880 3300039062 Bacteria 12851
1109 Ga0400483_096277 3300039062 Bacteria 10950
1110 Ga0400483_140153 3300039062 Bacteria 4828
1111 Ga0400483_143898 3300039062 Bacteria 1409
1112 Ga0400483_149418 3300039062 Bacteria 8010
1113 Ga0400483_172225 3300039062 Bacteria 5105
1114 Ga0400483_193528 3300039062 Bacteria 4677
1115 Ga0400483_205198 3300039062 Bacteria 2075
1116 Ga0400483_215482 3300039062 Bacteria 1516
1117 Ga0436365_0043842 3300039437 Bacteria 3321
1118 Ga0436365_0267511 3300039437 Bacteria 1695
1119 Ga0436365_0400394 3300039437 Bacteria 25450
1120 Ga0436365_0624892 3300039437 Bacteria 4725
1121 Ga0436365_1848951 3300039437 Bacteria 1325
1122 Ga0436360_0015239 3300039438 Bacteria 872
1123 Ga0436360_0040714 3300039438 Bacteria 8920
1124 Ga0436360_0057493 3300039438 Bacteria 729
1125 Ga0436360_0086335 3300039438 Bacteria 7990
1126 Ga0436360_0316578 3300039438 Bacteria 1228
1127 Ga0436360_0490276 3300039438 Bacteria 2192
1128 Ga0436360_0612852 3300039438 Bacteria 751
1129 Ga0436360_0812615 3300039438 Bacteria 637
1130 Ga0436360_0814801 3300039438 Bacteria 903
1131 Ga0436361_0099990 3300039447 Bacteria 26378
1132 Ga0436361_0210285 3300039447 Bacteria 1813
1133 Ga0436361_0300922 3300039447 Bacteria 11064
1134 Ga0436361_0657878 3300039447 Bacteria 680
1135 Ga0436361_1066632 3300039447 Bacteria 709
1136 Ga0436363_0400424 3300039450 Bacteria 636
1137 Ga0436363_0812754 3300039450 Bacteria 1258
1138 Ga0436363_1542246 3300039450 Bacteria 933
1139 Ga0436362_0050792 3300039453 Bacteria 600
1140 Ga0436362_0501340 3300039453 Bacteria 2729
1141 Ga0436362_0516986 3300039453 Bacteria 11871
1142 Ga0436362_0593870 3300039453 Bacteria 1879
1143 Ga0436362_0648250 3300039453 Bacteria 557
1144 Ga0436362_0792407 3300039453 Bacteria 628
1145 Ga0436362_0884606 3300039453 Bacteria 643
1146 Ga0439439_0103696 3300041406 Bacteria 784
1147 Ga0439461_0063450 3300041410 Bacteria 843
1148 Ga0439465_0024789 3300041413 Bacteria 1891
1149 Ga0439465_0050852 3300041413 Bacteria 1357
1150 Ga0439465_0054272 3300041413 Bacteria 1318
1151 Ga0439465_0083973 3300041413 Bacteria 1083
1152 Ga0439465_0120013 3300041413 Bacteria 921
1153 Ga0439465_0133750 3300041413 Bacteria 877
1154 Ga0451789_1093110 3300041443 Bacteria 553
1155 Ga0451791_1668163 3300041451 Bacteria 1569
1156 Ga0451793_1500337 3300041452 Bacteria 760
1157 Ga0451797_1242257 3300041453 Bacteria 526
1158 Ga0451798_1036039 3300041458 Bacteria 606
1159 Ga0451807_2301569 3300041486 Bacteria 570
1160 Ga0451807_2746414 3300041486 Bacteria 515
1161 Ga0451833_0558942 3300041491 Bacteria 1943
1162 Ga0451835_0472559 3300041492 Bacteria 1192
1163 Ga0451835_1252488 3300041492 Bacteria 1479
1164 Ga0451837_0311208 3300041494 Unclassified 642
1165 Ga0451837_0693458 3300041494 Bacteria 1105
1166 Ga0451837_0938409 3300041494 Bacteria 923
1167 Ga0451839_0355707 3300041496 Bacteria 2224
1168 Ga0451841_0129944 3300041498 Bacteria 1557
1169 Ga0451845_0879080 3300041501 Bacteria 2449
1170 Ga0451846_68409 3300041502 Bacteria 1407
1171 Ga0451847_0045439 3300041503 Bacteria 1756
1172 Ga0451849_0166291 3300041505 Bacteria 985
1173 Ga0451849_0215730 3300041505 Bacteria 658
1174 Ga0451849_0512093 3300041505 Bacteria 1251
1175 Ga0451851_0025352 3300041507 Bacteria 536
1176 Ga0451851_0308930 3300041507 Bacteria 1831
1177 Ga0451843_0582198 3300041509 Bacteria 2197
1178 Ga0451843_1304907 3300041509 Bacteria 755
1179 Ga0451855_0255463 3300041511 Bacteria 1198
1180 Ga0451853_2315567 3300041512 Bacteria 2143
1181 Ga0439431_0014282 3300041997 Bacteria 1840
1182 Ga0439443_094579 3300042003 Bacteria 567
1183 Ga0439448_0161973 3300042005 Bacteria 779
1184 Ga0439432_221444 3300042006 Bacteria 546
1185 Ga0439449_0034994 3300042007 Bacteria 1870
1186 Ga0439452_104580 3300042010 Bacteria 607
1187 Ga0439456_055819 3300042013 Bacteria 865
1188 Ga0450890_039473 3300042127 Bacteria 695
1189 Ga0450889_052768 3300042144 Unclassified 502
1190 Ga0439435_0265069 3300042436 Bacteria 581
1191 Ga0451577_0041379 3300042876 Bacteria 4136
1192 Ga0466969_0387552 3300044656 Bacteria 634
1193 Ga0466972_0118518 3300044658 Bacteria 1249
1194 Ga0453683_0049820 3300044673 Bacteria 2625
1195 Ga0453683_0351179 3300044673 Bacteria 947
1196 Ga0466965_0029669 3300044683 Bacteria 2662
1197 Ga0466965_0340240 3300044683 Bacteria 820
1198 Ga0466965_0674251 3300044683 Bacteria 592
1199 Ga0466966_0024456 3300044684 Bacteria 3950
1200 Ga0466966_0146346 3300044684 Bacteria 1442
1201 Ga0466961_0160940 3300044693 Bacteria 1399
1202 Ga0466963_0034785 3300044694 Bacteria 3280
1203 Ga0466963_0110603 3300044694 Bacteria 1886
1204 Ga0453684_0112629 3300044712 Bacteria 3302
1205 Ga0453684_0152017 3300044712 Bacteria 2749
1206 Ga0453684_0234847 3300044712 Bacteria 2114
1207 Ga0453684_0350709 3300044712 Bacteria 1664
1208 Ga0466971_0154069 3300044719 Unclassified 1074
1209 Ga0466968_0041262 3300044735 Bacteria 1947
1210 Ga0466968_0084838 3300044735 Bacteria 1397
1211 Ga0466968_0285025 3300044735 Bacteria 791
1212 Ga0466970_0065659 3300044765 Bacteria 1947
1213 Ga0466957_0125868 3300044842 Bacteria 1637
1214 Ga0466960_0083264 3300044901 Bacteria 1616
1215 Ga0466960_0292673 3300044901 Bacteria 915
1216 Ga0466959_0010929 3300045049 Bacteria 6510
1217 Ga0466959_0084076 3300045049 Bacteria 2291
1218 Ga0466959_0368828 3300045049 Bacteria 978
1219 Ga0451576_0000030 3300045051 Bacteria 403352
1220 Ga0451576_0001017 3300045051 Bacteria 51874
1221 Ga0451576_0008714 3300045051 Bacteria 11870
1222 Ga0451576_0278561 3300045051 Bacteria 1749
1223 Ga0451576_0335889 3300045051 Bacteria 1581
1224 Ga0451576_0594875 3300045051 Bacteria 1163
1225 Ga0466958_0069809 3300045836 Bacteria 2149
1226 Ga0466967_0224330 3300045976 Bacteria 1787
1227 Ga0495592_0250713 3300046454 Bacteria 1170
1228 Ga0495592_0566008 3300046454 Bacteria 697
1229 Ga0495603_0004283 3300046455 Bacteria 8501
1230 Ga0495629_0001030 3300046459 Bacteria 22331
1231 Ga0495629_0069551 3300046459 Bacteria 2456
1232 Ga0495638_0001797 3300046460 Bacteria 18668
1233 Ga0495638_0007099 3300046460 Bacteria 8078
1234 Ga0495638_0205951 3300046460 Bacteria 1108
1235 Ga0495638_0335855 3300046460 Bacteria 802
1236 Ga0495641_0017447 3300046461 Bacteria 3741
1237 Ga0495653_0040896 3300046463 Bacteria 3621
1238 Ga0495650_0208987 3300046471 Bacteria 676
1239 Ga0495580_0006656 3300046472 Bacteria 9384
1240 Ga0495580_0086933 3300046472 Bacteria 2178
1241 Ga0495582_0016780 3300046473 Bacteria 4010
1242 Ga0495605_0008287 3300046474 Bacteria 5879
1243 Ga0495639_0003363 3300046475 Bacteria 6936
1244 Ga0495639_0011594 3300046475 Bacteria 3803
1245 Ga0495662_0096201 3300046476 Bacteria 1447
1246 Ga0495664_0000147 3300046477 Bacteria 35346
1247 Ga0495584_0053571 3300046491 Bacteria 2030
1248 Ga0495584_0107339 3300046491 Bacteria 1412
1249 Ga0495584_0148851 3300046491 Bacteria 1189
1250 Ga0495585_0068419 3300046492 Bacteria 1940
1251 Ga0495585_0108212 3300046492 Bacteria 1481
1252 Ga0495585_0216113 3300046492 Bacteria 969
1253 Ga0495585_0218198 3300046492 Bacteria 963
1254 Ga0495594_0000660 3300046499 Bacteria 17845
1255 Ga0495596_0057571 3300046500 Bacteria 1517
1256 Ga0495607_0052002 3300046501 Bacteria 2375
1257 Ga0495583_0054847 3300046506 Bacteria 1803
1258 Ga0495583_0094804 3300046506 Bacteria 1281
1259 Ga0495583_0127069 3300046506 Bacteria 1069
1260 Ga0495583_0135111 3300046506 Bacteria 1030
1261 Ga0495583_0290170 3300046506 Bacteria 651
1262 Ga0495606_0024330 3300046507 Bacteria 4367
1263 Ga0495606_0326325 3300046507 Bacteria 823
1264 Ga0495608_0220638 3300046511 Bacteria 1190
1265 Ga0495610_0089211 3300046512 Bacteria 1400
1266 Ga0495610_0104268 3300046512 Bacteria 1265
1267 Ga0495610_0225192 3300046512 Bacteria 755
1268 Ga0495616_0046683 3300046513 Bacteria 2185
1269 Ga0495616_0120625 3300046513 Bacteria 1211
1270 Ga0495616_0299784 3300046513 Bacteria 679
1271 Ga0495618_0001877 3300046514 Bacteria 13850
1272 Ga0495620_0002806 3300046515 Bacteria 10016
1273 Ga0495620_0086606 3300046515 Bacteria 1261
1274 Ga0495628_0636587 3300046516 Bacteria 758
1275 Ga0495630_0001952 3300046517 Bacteria 14333
1276 Ga0495630_0078397 3300046517 Bacteria 2491
1277 Ga0495630_0129575 3300046517 Bacteria 1915
1278 Ga0495631_0006319 3300046518 Bacteria 6130
1279 Ga0495631_0276020 3300046518 Bacteria 716
1280 Ga0495632_0151394 3300046519 Bacteria 1072
1281 Ga0495637_0080956 3300046520 Bacteria 1295
1282 Ga0495643_0109273 3300046522 Bacteria 1407
1283 Ga0495643_0112730 3300046522 Bacteria 1381
1284 Ga0495663_0116251 3300046525 Bacteria 892
1285 Ga0495666_0040366 3300046526 Bacteria 2263
1286 Ga0495666_0073453 3300046526 Bacteria 1623
1287 Ga0495654_0092815 3300046530 Bacteria 1399
1288 Ga0495654_0181198 3300046530 Bacteria 912
1289 Ga0495665_0004329 3300046531 Bacteria 7664
1290 Ga0495665_0040986 3300046531 Bacteria 2465
1291 Ga0495665_0109214 3300046531 Bacteria 1451
1292 Ga0495665_0150869 3300046531 Bacteria 1213
1293 Ga0495640_0003988 3300046533 Bacteria 11811
1294 Ga0495586_0355181 3300046535 Bacteria 842
1295 Ga0495597_0138999 3300046542 Bacteria 1003
1296 Ga0495597_0190243 3300046542 Bacteria 826
1297 Ga0495597_0234043 3300046542 Bacteria 726
1298 Ga0495645_0000695 3300046543 Bacteria 23113
1299 Ga0495645_0513057 3300046543 Bacteria 748
1300 Ga0495622_0002880 3300046557 Bacteria 8207
1301 Ga0495633_0266486 3300046558 Bacteria 780
1302 Ga0495633_0319697 3300046558 Bacteria 704
1303 Ga0495656_0036972 3300046615 Bacteria 2014
1304 Ga0495668_0018046 3300046616 Bacteria 4084
1305 Ga0495668_0242178 3300046616 Bacteria 987
1306 Ga0495668_0515027 3300046616 Bacteria 660
1307 Ga0495668_0532221 3300046616 Bacteria 648
1308 Ga0495634_0003638 3300046642 Bacteria 12297
1309 Ga0495634_0005213 3300046642 Bacteria 10041
1310 Ga0495634_0011117 3300046642 Bacteria 6565
1311 Ga0495634_0020760 3300046642 Bacteria 4654
1312 Ga0495611_0323810 3300046648 Bacteria 709
1313 Ga0495625_0024959 3300046660 Bacteria 4541
1314 Ga0495625_0207719 3300046660 Bacteria 1288
1315 Ga0495625_0244859 3300046660 Bacteria 1166
1316 Ga0495625_0404460 3300046660 Bacteria 852
1317 Ga0495625_0499913 3300046660 Bacteria 743
1318 Ga0495635_0001303 3300046663 Bacteria 16659
1319 Ga0495635_0555637 3300046663 Bacteria 752
1320 Ga0495661_0299117 3300046665 Bacteria 806
1321 Ga0495588_0001375 3300046674 Bacteria 10387
1322 Ga0495646_0303451 3300046680 Bacteria 844
1323 Ga0495647_0004526 3300046681 Bacteria 4522
1324 Ga0495647_0168852 3300046681 Bacteria 946
1325 Ga0495658_0000377 3300046683 Bacteria 25042
1326 Ga0495658_0503620 3300046683 Bacteria 775
1327 Ga0495613_0000450 3300046689 Bacteria 35062
1328 Ga0495613_0085828 3300046689 Bacteria 2283
1329 Ga0495613_0565641 3300046689 Bacteria 759
1330 Ga0495613_0640722 3300046689 Bacteria 704
1331 Ga0495613_0779332 3300046689 Bacteria 625
1332 Ga0495624_0006170 3300046690 Bacteria 8526
1333 Ga0495624_0010938 3300046690 Bacteria 6254
1334 Ga0495670_0103565 3300046691 Bacteria 1468
1335 Ga0495671_0257173 3300046692 Bacteria 843
1336 Ga0495671_0282121 3300046692 Bacteria 800
1337 Ga0495649_0081466 3300046694 Bacteria 1730
1338 Ga0495660_0065857 3300046810 Bacteria 1933
1339 Ga0495660_0199487 3300046810 Bacteria 956
1340 Ga0495581_0003417 3300047315 Bacteria 9112
1341 Ga0495581_0079122 3300047315 Bacteria 1902
1342 Ga0495604_0735565 3300047317 Bacteria 625
1343 Ga0495636_0044798 3300047318 Bacteria 1843
1344 Ga0495674_0002888 3300047319 Bacteria 16717
1345 Ga0495674_0104893 3300047319 Bacteria 2403
1346 Ga0495672_0096666 3300047320 Bacteria 1610
1347 Ga0495676_0006720 3300047321 Bacteria 10587
1348 Ga0495676_0037574 3300047321 Bacteria 4029
1349 Ga0495676_0323828 3300047321 Bacteria 1035
1350 Ga0495680_0126808 3300047322 Bacteria 1879
1351 Ga0495680_0584803 3300047322 Bacteria 749
1352 Ga0495687_095892 3300047443 Bacteria 1124
1353 Ga0495684_0002109 3300047471 Bacteria 15957
1354 Ga0495684_0003387 3300047471 Bacteria 12515
1355 Ga0495684_0015482 3300047471 Bacteria 5868
1356 Ga0495684_0241938 3300047471 Bacteria 1316
1357 Ga0495686_0116407 3300047472 Bacteria 1597
1358 Ga0495593_0000407 3300047673 Bacteria 23955
1359 Ga0495593_0179157 3300047673 Bacteria 1067
1360 Ga0495614_0157759 3300048089 Bacteria 1014
1361 Ga0495615_0086040 3300048090 Bacteria 869
1362 Ga0495626_0176554 3300048091 Bacteria 888
1363 Ga0496100_0002344 3300048903 Bacteria 9580
1364 Ga0496100_0002927 3300048903 Bacteria 8771
1365 Ga0496100_0041666 3300048903 Bacteria 2929
1366 Ga0496100_0087441 3300048903 Bacteria 2119
1367 Ga0496100_0462093 3300048903 Bacteria 974
1368 Ga0496100_0677734 3300048903 Bacteria 804
1369 Ga0496100_0726434 3300048903 Bacteria 776
1370 Ga0496101_0029248 3300048904 Bacteria 3853
1371 Ga0496101_0085171 3300048904 Bacteria 2341
1372 Ga0496101_0372611 3300048904 Bacteria 1123
1373 Ga0496101_0625165 3300048904 Bacteria 851
1374 Ga0496102_0036200 3300048905 Bacteria 4446
1375 Ga0496102_0067965 3300048905 Bacteria 3269
1376 Ga0496102_0093568 3300048905 Bacteria 2784
1377 Ga0496102_0108193 3300048905 Bacteria 2589
1378 Ga0496102_0169136 3300048905 Bacteria 2058
1379 Ga0496102_0457749 3300048905 Bacteria 1197
1380 Ga0496102_1298214 3300048905 Bacteria 647
1381 Ga0496102_1928153 3300048905 Bacteria 507
1382 Ga0496103_0001834 3300048906 Bacteria 13809
1383 Ga0496103_0084842 3300048906 Bacteria 1995
1384 Ga0496103_0238225 3300048906 Bacteria 1170
1385 Ga0496103_0329821 3300048906 Bacteria 982
1386 Ga0496104_0001746 3300048907 Bacteria 18778
1387 Ga0496104_0003293 3300048907 Bacteria 13937
1388 Ga0496104_0004254 3300048907 Bacteria 12431
1389 Ga0496104_0017688 3300048907 Bacteria 6498
1390 Ga0496104_0244880 3300048907 Bacteria 1705
1391 Ga0496104_0523125 3300048907 Bacteria 1097
1392 Ga0496104_0757856 3300048907 Bacteria 877
1393 Ga0496105_0008306 3300048908 Bacteria 8069
1394 Ga0496105_0013460 3300048908 Bacteria 6494
1395 Ga0496105_0045927 3300048908 Bacteria 3604
1396 Ga0496105_0165549 3300048908 Bacteria 1814
1397 Ga0496105_0191026 3300048908 Bacteria 1674
1398 Ga0496106_0003888 3300048909 Bacteria 11144
1399 Ga0496106_0028735 3300048909 Bacteria 4142
1400 Ga0496106_0037152 3300048909 Bacteria 3643
1401 Ga0496106_0113418 3300048909 Bacteria 2113
1402 Ga0496106_0131832 3300048909 Bacteria 1961
1403 Ga0496106_0197757 3300048909 Bacteria 1599
1404 Ga0496106_0365071 3300048909 Bacteria 1160
1405 Ga0496106_0645185 3300048909 Bacteria 846
1406 Ga0496107_0014539 3300048910 Bacteria 5509
1407 Ga0496107_0197106 3300048910 Bacteria 1496
1408 Ga0496107_0256430 3300048910 Bacteria 1301
1409 Ga0496107_0591761 3300048910 Bacteria 820
1410 Ga0496107_0976578 3300048910 Bacteria 615
1411 Ga0496108_0002374 3300048911 Bacteria 15065
1412 Ga0496108_0055545 3300048911 Bacteria 3325
1413 Ga0496108_0378244 3300048911 Bacteria 1236
1414 Ga0496108_0461068 3300048911 Bacteria 1110
1415 Ga0496109_0007103 3300048912 Bacteria 9454
1416 Ga0496109_0016146 3300048912 Bacteria 6525
1417 Ga0496109_0032220 3300048912 Bacteria 4710
1418 Ga0496109_0032225 3300048912 Bacteria 4710
1419 Ga0496109_0132067 3300048912 Bacteria 2331
1420 Ga0496109_0132488 3300048912 Bacteria 2327
1421 Ga0496109_0878669 3300048912 Bacteria 834
1422 Ga0496110_0003203 3300048913 Bacteria 12463
1423 Ga0496110_0035239 3300048913 Bacteria 4341
1424 Ga0496110_0042196 3300048913 Bacteria 3981
1425 Ga0496110_0209650 3300048913 Bacteria 1771
1426 Ga0496110_0329050 3300048913 Bacteria 1392
1427 Ga0496110_0657663 3300048913 Bacteria 948
1428 Ga0496110_0822440 3300048913 Bacteria 834
1429 Ga0496111_0011401 3300048914 Bacteria 5985
1430 Ga0496111_0096361 3300048914 Bacteria 2171
1431 Ga0496111_0162709 3300048914 Bacteria 1657
1432 Ga0496112_0024936 3300048915 Bacteria 5738
1433 Ga0496112_0114129 3300048915 Bacteria 2672
1434 Ga0496112_0181227 3300048915 Bacteria 2070
1435 Ga0496112_0252099 3300048915 Bacteria 1716
1436 Ga0496112_0417700 3300048915 Bacteria 1280
1437 Ga0496112_0610637 3300048915 Bacteria 1022
1438 Ga0496112_0745814 3300048915 Bacteria 906
1439 Ga0496112_1757327 3300048915 Bacteria 532
1440 Ga0496113_0024278 3300048916 Bacteria 4306
1441 Ga0496113_0024776 3300048916 Bacteria 4270
1442 Ga0496113_0108292 3300048916 Bacteria 2160
1443 Ga0496113_0203089 3300048916 Bacteria 1575
1444 Ga0496113_0247005 3300048916 Bacteria 1424
1445 Ga0496113_1499120 3300048916 Bacteria 521
1446 Ga0496114_0004157 3300048917 Bacteria 11197
1447 Ga0496114_0090844 3300048917 Bacteria 2592
1448 Ga0496114_0269680 3300048917 Bacteria 1500
1449 Ga0496114_0607069 3300048917 Bacteria 964
1450 Ga0496114_0886526 3300048917 Bacteria 773
1451 Ga0496114_0892333 3300048917 Bacteria 770
1452 Ga0496115_0007483 3300048918 Bacteria 8037
1453 Ga0496115_0041928 3300048918 Bacteria 3645
1454 Ga0496115_0123044 3300048918 Bacteria 2135
1455 Ga0496115_0182414 3300048918 Bacteria 1735
1456 Ga0496115_0321003 3300048918 Bacteria 1267
1457 Ga0496115_0647315 3300048918 Bacteria 836
1458 Ga0496115_0754358 3300048918 Bacteria 761
1459 Ga0496115_0950879 3300048918 Bacteria 660
1460 Ga0496116_0062167 3300048919 Bacteria 2412
1461 Ga0496116_0115140 3300048919 Bacteria 1569
1462 Ga0496116_0479950 3300048919 Bacteria 523
1463 Ga0496117_0071883 3300048920 Bacteria 2316
1464 Ga0496117_0121756 3300048920 Bacteria 1601
1465 Ga0496117_0360183 3300048920 Bacteria 748
1466 Ga0496118_0021327 3300048921 Bacteria 5707
1467 Ga0496118_0290527 3300048921 Unclassified 904
1468 Ga0496119_0006731 3300048922 Bacteria 10560
1469 Ga0496119_0014390 3300048922 Bacteria 6197
1470 Ga0496120_0003776 3300048923 Bacteria 13379
1471 Ga0496120_0054682 3300048923 Bacteria 2261
1472 Ga0496121_0024992 3300048924 Bacteria 5688
1473 Ga0496121_0060947 3300048924 Bacteria 3100
1474 Ga0496121_0138568 3300048924 Bacteria 1809
1475 Ga0496121_0165786 3300048924 Bacteria 1610
1476 Ga0496121_0241639 3300048924 Bacteria 1258
1477 Ga0496121_0270860 3300048924 Bacteria 1167
1478 Ga0496121_0327623 3300048924 Bacteria 1029
1479 Ga0496121_0447834 3300048924 Bacteria 833
1480 Ga0496121_0484174 3300048924 Bacteria 789
1481 Ga0496121_0536852 3300048924 Bacteria 734
1482 Ga0496121_0639215 3300048924 Bacteria 650
1483 Ga0496121_0703401 3300048924 Bacteria 608
1484 Ga0496122_0000042 3300048925 Bacteria 280482
1485 Ga0496122_0077865 3300048925 Bacteria 2325
1486 Ga0496122_0119204 3300048925 Bacteria 1707
1487 Ga0496122_0137344 3300048925 Bacteria 1537
1488 Ga0496122_0169047 3300048925 Bacteria 1321
1489 Ga0496123_0000030 3300048926 Bacteria 291764
1490 Ga0496123_0074427 3300048926 Bacteria 2102
1491 Ga0496123_0080937 3300048926 Bacteria 1976
1492 Ga0496123_0183543 3300048926 Bacteria 1090
1493 Ga0496124_0052783 3300048927 Bacteria 3452
1494 Ga0496124_0141690 3300048927 Bacteria 1896
1495 Ga0496124_0262244 3300048927 Bacteria 1271
1496 Ga0496124_0399639 3300048927 Bacteria 954
1497 Ga0496125_0041776 3300048928 Bacteria 3915
1498 Ga0496125_0100032 3300048928 Bacteria 2139
1499 Ga0496125_0577658 3300048928 Bacteria 618
1500 Ga0496126_0044485 3300048929 Bacteria 4088
1501 Ga0496126_0084839 3300048929 Bacteria 2793
1502 Ga0495678_023772 3300049459 Bacteria 2658
1503 Ga0495682_0055206 3300049460 Bacteria 1441
1504 Ga0501031_0000019 3300049568 Bacteria 104793
1505 Ga0501031_0026639 3300049568 Bacteria 3768
1506 Ga0501031_0068905 3300049568 Bacteria 2305
1507 Ga0501031_0079937 3300049568 Bacteria 2131
1508 Ga0501031_0083626 3300049568 Bacteria 2080
1509 Ga0501031_0118889 3300049568 Bacteria 1727
1510 Ga0501031_0158498 3300049568 Bacteria 1479
1511 Ga0501031_0169482 3300049568 Bacteria 1427
1512 Ga0501031_0423900 3300049568 Bacteria 860
1513 Ga0501031_0491700 3300049568 Bacteria 791
1514 Ga0501031_0645534 3300049568 Bacteria 680
1515 Ga0501031_0695679 3300049568 Bacteria 653
1516 Ga0501031_0902162 3300049568 Bacteria 566
1517 Ga0501032_0000009 3300049569 Bacteria 228107
1518 Ga0501032_0000133 3300049569 Bacteria 60434
1519 Ga0501032_0005157 3300049569 Bacteria 9743
1520 Ga0501032_0017717 3300049569 Bacteria 4999
1521 Ga0501032_0033886 3300049569 Bacteria 3498
1522 Ga0501032_0050429 3300049569 Bacteria 2807
1523 Ga0501032_0060297 3300049569 Bacteria 2544
1524 Ga0501032_0075072 3300049569 Bacteria 2252
1525 Ga0501032_0128007 3300049569 Bacteria 1676
1526 Ga0501032_0250133 3300049569 Bacteria 1151
1527 Ga0501032_0261444 3300049569 Bacteria 1122
1528 Ga0501032_0567133 3300049569 Bacteria 723
1529 Ga0501032_0657420 3300049569 Bacteria 665
1530 Ga0501032_0892993 3300049569 Bacteria 560
1531 Ga0501032_0925992 3300049569 Bacteria 548
1532 Ga0501033_0000019 3300049570 Bacteria 204699
1533 Ga0501033_0000744 3300049570 Bacteria 29957
1534 Ga0501033_0010281 3300049570 Bacteria 7179
1535 Ga0501033_0011783 3300049570 Bacteria 6683
1536 Ga0501033_0011941 3300049570 Bacteria 6636
1537 Ga0501033_0012332 3300049570 Bacteria 6523
1538 Ga0501033_0023529 3300049570 Bacteria 4646
1539 Ga0501033_0029914 3300049570 Bacteria 4093
1540 Ga0501033_0041595 3300049570 Bacteria 3428
1541 Ga0501033_0047494 3300049570 Bacteria 3191
1542 Ga0501033_0052722 3300049570 Bacteria 3015
1543 Ga0501033_0059463 3300049570 Bacteria 2822
1544 Ga0501033_0146219 3300049570 Bacteria 1707
1545 Ga0501034_0000044 3300049571 Bacteria 227982
1546 Ga0501034_0000064 3300049571 Bacteria 189461
1547 Ga0501034_0000160 3300049571 Bacteria 126787
1548 Ga0501034_0000538 3300049571 Bacteria 60200
1549 Ga0501034_0008123 3300049571 Bacteria 11131
1550 Ga0501034_0050945 3300049571 Bacteria 4175
1551 Ga0501034_0113684 3300049571 Bacteria 2697
1552 Ga0501034_0124034 3300049571 Bacteria 2568
1553 Ga0501034_0124659 3300049571 Bacteria 2561
1554 Ga0501034_0160935 3300049571 Bacteria 2216
1555 Ga0501034_0205106 3300049571 Bacteria 1928
1556 Ga0501034_0257022 3300049571 Bacteria 1690
1557 Ga0501034_0261982 3300049571 Bacteria 1671
1558 Ga0501034_0301493 3300049571 Bacteria 1539
1559 Ga0501034_0335974 3300049571 Bacteria 1441
1560 Ga0501034_0357526 3300049571 Bacteria 1388
1561 Ga0501034_0390962 3300049571 Bacteria 1315
1562 Ga0501034_0400791 3300049571 Bacteria 1295
1563 Ga0501034_0464415 3300049571 Bacteria 1182
1564 Ga0501034_0677070 3300049571 Bacteria 931
1565 Ga0501034_0696266 3300049571 Bacteria 915
1566 Ga0501034_0818286 3300049571 Bacteria 823
1567 Ga0501034_0834458 3300049571 Bacteria 813
1568 Ga0501036_0000008 3300049572 Bacteria 228106
1569 Ga0501036_0000084 3300049572 Bacteria 58568
1570 Ga0501036_0021531 3300049572 Bacteria 5421
1571 Ga0501036_0029728 3300049572 Bacteria 4616
1572 Ga0501036_0042932 3300049572 Bacteria 3828
1573 Ga0501036_0101129 3300049572 Bacteria 2438
1574 Ga0501036_0160257 3300049572 Bacteria 1897
1575 Ga0501036_0339173 3300049572 Bacteria 1255
1576 Ga0501036_0424438 3300049572 Bacteria 1108
1577 Ga0501036_0534537 3300049572 Bacteria 974
1578 Ga0501036_0617515 3300049572 Bacteria 899
1579 Ga0501036_0720451 3300049572 Bacteria 824
1580 Ga0501037_0000035 3300049573 Bacteria 125589
1581 Ga0501037_0000055 3300049573 Bacteria 109790
1582 Ga0501037_0000148 3300049573 Bacteria 65185
1583 Ga0501037_0008967 3300049573 Bacteria 7325
1584 Ga0501037_0026841 3300049573 Bacteria 4254
1585 Ga0501037_0053350 3300049573 Bacteria 2957
1586 Ga0501037_0112189 3300049573 Bacteria 1964
1587 Ga0501037_0133016 3300049573 Bacteria 1783
1588 Ga0501037_0138113 3300049573 Bacteria 1745
1589 Ga0501037_0209012 3300049573 Bacteria 1377
1590 Ga0501037_0344153 3300049573 Bacteria 1030
1591 Ga0501037_0348604 3300049573 Bacteria 1022
1592 Ga0501037_0365376 3300049573 Bacteria 993
1593 Ga0501037_0395124 3300049573 Bacteria 949
1594 Ga0501037_0449940 3300049573 Bacteria 878
1595 Ga0501037_0695838 3300049573 Bacteria 677
1596 Ga0501037_0709492 3300049573 Bacteria 669
1597 Ga0501037_0992464 3300049573 Bacteria 547
1598 Ga0501038_0000006 3300049574 Bacteria 228107
1599 Ga0501038_0000055 3300049574 Bacteria 93761
1600 Ga0501038_0001195 3300049574 Bacteria 23611
1601 Ga0501038_0046710 3300049574 Bacteria 3754
1602 Ga0501038_0098750 3300049574 Bacteria 2434
1603 Ga0501038_0151065 3300049574 Bacteria 1893
1604 Ga0501038_0153767 3300049574 Bacteria 1874
1605 Ga0501038_0169549 3300049574 Bacteria 1768
1606 Ga0501038_0284115 3300049574 Bacteria 1302
1607 Ga0501038_0421485 3300049574 Bacteria 1030
1608 Ga0501038_0964354 3300049574 Bacteria 627
1609 Ga0501038_1204912 3300049574 Bacteria 550
1610 Ga0501038_1253265 3300049574 Bacteria 537
1611 Ga0501039_0000014 3300049575 Bacteria 228107
1612 Ga0501039_0000103 3300049575 Bacteria 57916
1613 Ga0501039_0001824 3300049575 Bacteria 15749
1614 Ga0501039_0023598 3300049575 Bacteria 4721
1615 Ga0501039_0028302 3300049575 Bacteria 4313
1616 Ga0501039_0052315 3300049575 Bacteria 3160
1617 Ga0501039_0180638 3300049575 Bacteria 1659
1618 Ga0501039_0246288 3300049575 Bacteria 1406
1619 Ga0501039_0304185 3300049575 Bacteria 1254
1620 Ga0501039_0322338 3300049575 Bacteria 1214
1621 Ga0501039_0402574 3300049575 Bacteria 1075
1622 Ga0501039_0426486 3300049575 Bacteria 1042
1623 Ga0501039_0506453 3300049575 Bacteria 948
1624 Ga0501039_0637333 3300049575 Bacteria 835
1625 Ga0501039_0857210 3300049575 Bacteria 708
1626 Ga0501039_1007558 3300049575 Bacteria 647
1627 Ga0501039_1121797 3300049575 Bacteria 609
1628 Ga0501039_1550366 3300049575 Bacteria 509
1629 Ga0501040_0031370 3300049576 Bacteria 3591
1630 Ga0501040_0061480 3300049576 Bacteria 2583
1631 Ga0501040_0105167 3300049576 Bacteria 1971
1632 Ga0501040_0155180 3300049576 Bacteria 1616
1633 Ga0501040_0200302 3300049576 Bacteria 1417
1634 Ga0501040_0272673 3300049576 Bacteria 1208
1635 Ga0501040_0376662 3300049576 Bacteria 1018
1636 Ga0501040_0379801 3300049576 Bacteria 1014
1637 Ga0501040_0554949 3300049576 Bacteria 829
1638 Ga0501040_0571613 3300049576 Bacteria 816
1639 Ga0501040_0672551 3300049576 Bacteria 748
1640 Ga0501040_0746097 3300049576 Bacteria 708
1641 Ga0501041_0027272 3300049577 Bacteria 3442
1642 Ga0501041_0036875 3300049577 Bacteria 2962
1643 Ga0501041_0037795 3300049577 Bacteria 2926
1644 Ga0501041_0195495 3300049577 Bacteria 1267
1645 Ga0501041_0363692 3300049577 Bacteria 915
1646 Ga0501041_0660004 3300049577 Bacteria 669
1647 Ga0501041_0679459 3300049577 Bacteria 658
1648 Ga0501042_0016217 3300049578 Bacteria 5111
1649 Ga0501042_0017375 3300049578 Bacteria 4960
1650 Ga0501042_0261445 3300049578 Bacteria 1249
1651 Ga0501042_0551546 3300049578 Bacteria 838
1652 Ga0501042_0574883 3300049578 Bacteria 819
1653 Ga0501042_0575080 3300049578 Bacteria 819
1654 Ga0501042_0690196 3300049578 Bacteria 742
1655 Ga0501043_0000015 3300049579 Bacteria 175932
1656 Ga0501043_0000830 3300049579 Bacteria 27448
1657 Ga0501043_0001247 3300049579 Bacteria 22431
1658 Ga0501043_0006125 3300049579 Bacteria 9659
1659 Ga0501043_0074842 3300049579 Bacteria 2660
1660 Ga0501043_0079827 3300049579 Bacteria 2570
1661 Ga0501043_0082461 3300049579 Bacteria 2527
1662 Ga0501043_0126689 3300049579 Bacteria 2002
1663 Ga0501043_0130954 3300049579 Bacteria 1966
1664 Ga0501043_0183646 3300049579 Bacteria 1629
1665 Ga0501043_0201172 3300049579 Bacteria 1546
1666 Ga0501043_0278210 3300049579 Bacteria 1283
1667 Ga0501043_0409057 3300049579 Bacteria 1024
1668 Ga0501043_0567419 3300049579 Bacteria 841
1669 Ga0501043_0655320 3300049579 Bacteria 771
1670 Ga0501043_0865545 3300049579 Bacteria 650
1671 Ga0501043_1039550 3300049579 Bacteria 581
1672 Ga0501046_0003040 3300049580 Bacteria 15501
1673 Ga0501046_0008789 3300049580 Bacteria 8774
1674 Ga0501046_0143153 3300049580 Bacteria 1808
1675 Ga0501046_0149405 3300049580 Bacteria 1763
1676 Ga0501046_0150897 3300049580 Bacteria 1753
1677 Ga0501046_0176435 3300049580 Bacteria 1600
1678 Ga0501046_0252773 3300049580 Bacteria 1297
1679 Ga0501046_0305669 3300049580 Bacteria 1161
1680 Ga0501046_0310738 3300049580 Bacteria 1150
1681 Ga0501046_0348841 3300049580 Bacteria 1075
1682 Ga0501046_0422812 3300049580 Bacteria 960
1683 Ga0501046_0466627 3300049580 Bacteria 907
1684 Ga0501046_0545156 3300049580 Bacteria 827
1685 Ga0501047_0001009 3300049581 Bacteria 28425
1686 Ga0501047_0003461 3300049581 Bacteria 14913
1687 Ga0501047_0007416 3300049581 Bacteria 10320
1688 Ga0501047_0011280 3300049581 Bacteria 8459
1689 Ga0501047_0020900 3300049581 Bacteria 6287
1690 Ga0501047_0044279 3300049581 Bacteria 4300
1691 Ga0501047_0067056 3300049581 Bacteria 3459
1692 Ga0501047_0067608 3300049581 Bacteria 3443
1693 Ga0501047_0126698 3300049581 Bacteria 2434
1694 Ga0501047_0139115 3300049581 Bacteria 2307
1695 Ga0501047_0259213 3300049581 Bacteria 1587
1696 Ga0501047_0467779 3300049581 Bacteria 1089
1697 Ga0501047_0491653 3300049581 Unclassified 1054
1698 Ga0501047_0491911 3300049581 Bacteria 1054
1699 Ga0501047_0554893 3300049581 Bacteria 973
1700 Ga0501047_0566307 3300049581 Bacteria 959
1701 Ga0501047_0805027 3300049581 Bacteria 754
1702 Ga0501047_0866155 3300049581 Bacteria 717
1703 Ga0501047_1139664 3300049581 Bacteria 593
1704 Ga0501048_0042136 3300049582 Bacteria 3270
1705 Ga0501048_0049359 3300049582 Bacteria 2999
1706 Ga0501048_0107426 3300049582 Bacteria 1970
1707 Ga0501048_0312709 3300049582 Bacteria 1118
1708 Ga0501048_0367533 3300049582 Bacteria 1026
1709 Ga0501048_0504626 3300049582 Bacteria 867
1710 Ga0501048_0582296 3300049582 Bacteria 803
1711 Ga0501048_1210257 3300049582 Bacteria 543
1712 Ga0501067_0030072 3300049583 Bacteria 3012
1713 Ga0501067_0114819 3300049583 Bacteria 1497
1714 Ga0501067_0142722 3300049583 Bacteria 1334
1715 Ga0501067_0255124 3300049583 Bacteria 976
1716 Ga0501067_0380312 3300049583 Bacteria 787
1717 Ga0501067_0435651 3300049583 Bacteria 732
1718 Ga0501067_0495543 3300049583 Bacteria 683
1719 Ga0501067_0560764 3300049583 Bacteria 640
1720 Ga0501068_0035620 3300049584 Bacteria 2971
1721 Ga0501068_0043441 3300049584 Bacteria 2704
1722 Ga0501068_0066941 3300049584 Bacteria 2188
1723 Ga0501068_0070584 3300049584 Bacteria 2131
1724 Ga0501068_0110819 3300049584 Bacteria 1706
1725 Ga0501068_0118623 3300049584 Bacteria 1649
1726 Ga0501068_0189874 3300049584 Bacteria 1301
1727 Ga0501068_0241962 3300049584 Bacteria 1149
1728 Ga0501068_0487215 3300049584 Bacteria 799
1729 Ga0501068_0546989 3300049584 Bacteria 753
1730 Ga0501068_0917514 3300049584 Bacteria 576
1731 Ga0501069_0000056 3300049585 Bacteria 65784
1732 Ga0501069_0004657 3300049585 Bacteria 7089
1733 Ga0501069_0005107 3300049585 Bacteria 6815
1734 Ga0501069_0023158 3300049585 Bacteria 3384
1735 Ga0501069_0028934 3300049585 Bacteria 3039
1736 Ga0501069_0059088 3300049585 Bacteria 2140
1737 Ga0501069_0072995 3300049585 Bacteria 1924
1738 Ga0501069_0197315 3300049585 Bacteria 1166
1739 Ga0501069_0272692 3300049585 Bacteria 989
1740 Ga0501069_0830566 3300049585 Bacteria 561
1741 Ga0501069_0879005 3300049585 Bacteria 545
1742 Ga0501069_0951981 3300049585 Bacteria 523
1743 Ga0501070_0000141 3300049586 Bacteria 65875
1744 Ga0501070_0002106 3300049586 Bacteria 17461
1745 Ga0501070_0003485 3300049586 Bacteria 13645
1746 Ga0501070_0004026 3300049586 Bacteria 12619
1747 Ga0501070_0019063 3300049586 Bacteria 5755
1748 Ga0501070_0021875 3300049586 Bacteria 5357
1749 Ga0501070_0043015 3300049586 Bacteria 3760
1750 Ga0501070_0045779 3300049586 Bacteria 3638
1751 Ga0501070_0055397 3300049586 Bacteria 3286
1752 Ga0501070_0071674 3300049586 Bacteria 2869
1753 Ga0501070_0076896 3300049586 Bacteria 2763
1754 Ga0501070_0085608 3300049586 Bacteria 2610
1755 Ga0501070_0107354 3300049586 Bacteria 2307
1756 Ga0501070_0164833 3300049586 Bacteria 1826
1757 Ga0501070_0182453 3300049586 Bacteria 1727
1758 Ga0501070_0254853 3300049586 Bacteria 1435
1759 Ga0501070_0332826 3300049586 Bacteria 1234
1760 Ga0501070_0345429 3300049586 Bacteria 1208
1761 Ga0501070_0351631 3300049586 Bacteria 1196
1762 Ga0501070_0397627 3300049586 Bacteria 1115
1763 Ga0501070_0463776 3300049586 Bacteria 1020
1764 Ga0501070_1026080 3300049586 Bacteria 639
1765 Ga0501070_1129142 3300049586 Bacteria 604
1766 Ga0501071_0008384 3300049587 Bacteria 6828
1767 Ga0501071_0019384 3300049587 Bacteria 4720
1768 Ga0501071_0042854 3300049587 Bacteria 3244
1769 Ga0501071_0044165 3300049587 Bacteria 3196
1770 Ga0501071_0099526 3300049587 Bacteria 2142
1771 Ga0501071_0383579 3300049587 Bacteria 1072
1772 Ga0501071_1029265 3300049587 Bacteria 636
1773 Ga0501071_1062725 3300049587 Bacteria 625
1774 Ga0501071_1426754 3300049587 Bacteria 534
1775 Ga0501072_0017162 3300049588 Bacteria 5562
1776 Ga0501072_0048521 3300049588 Bacteria 3344
1777 Ga0501072_0054989 3300049588 Bacteria 3138
1778 Ga0501072_0094800 3300049588 Bacteria 2371
1779 Ga0501072_0142143 3300049588 Bacteria 1914
1780 Ga0501072_0282538 3300049588 Bacteria 1320
1781 Ga0501072_0396796 3300049588 Bacteria 1094
1782 Ga0501072_0471301 3300049588 Bacteria 994
1783 Ga0501072_0476067 3300049588 Bacteria 988
1784 Ga0501072_0493298 3300049588 Bacteria 969
1785 Ga0501072_0608888 3300049588 Bacteria 861
1786 Ga0501072_0689103 3300049588 Bacteria 803
1787 Ga0501072_0999981 3300049588 Bacteria 652
1788 Ga0501072_1284616 3300049588 Bacteria 567
1789 Ga0501072_1491887 3300049588 Bacteria 522
1790 Ga0501073_0002365 3300049589 Bacteria 14124
1791 Ga0501073_0002750 3300049589 Bacteria 13184
1792 Ga0501073_0040998 3300049589 Bacteria 3273
1793 Ga0501073_0045557 3300049589 Bacteria 3089
1794 Ga0501073_0047043 3300049589 Bacteria 3033
1795 Ga0501073_0054880 3300049589 Bacteria 2789
1796 Ga0501073_0056016 3300049589 Bacteria 2758
1797 Ga0501073_0068806 3300049589 Bacteria 2467
1798 Ga0501073_0107580 3300049589 Bacteria 1935
1799 Ga0501073_0183389 3300049589 Bacteria 1449
1800 Ga0501073_0245615 3300049589 Bacteria 1236
1801 Ga0501074_0000616 3300049590 Bacteria 22186
1802 Ga0501074_0005602 3300049590 Bacteria 9035
1803 Ga0501074_0049363 3300049590 Bacteria 3038
1804 Ga0501074_0128814 3300049590 Bacteria 1811
1805 Ga0501074_0199260 3300049590 Bacteria 1427
1806 Ga0501074_0215351 3300049590 Bacteria 1368
1807 Ga0501074_0256445 3300049590 Bacteria 1244
1808 Ga0501074_0433904 3300049590 Bacteria 932
1809 Ga0501074_0620282 3300049590 Bacteria 764
1810 Ga0501074_1009172 3300049590 Bacteria 585
1811 Ga0501074_1055885 3300049590 Bacteria 571
1812 Ga0501075_0035102 3300049591 Bacteria 3739
1813 Ga0501075_0043343 3300049591 Bacteria 3375
1814 Ga0501075_0066572 3300049591 Bacteria 2718
1815 Ga0501075_0069454 3300049591 Bacteria 2662
1816 Ga0501075_0073976 3300049591 Bacteria 2577
1817 Ga0501075_0117440 3300049591 Bacteria 2022
1818 Ga0501075_0135020 3300049591 Bacteria 1879
1819 Ga0501075_0296820 3300049591 Bacteria 1231
1820 Ga0501076_0054451 3300049592 Bacteria 3170
1821 Ga0501076_0075746 3300049592 Bacteria 2697
1822 Ga0501076_0102545 3300049592 Bacteria 2307
1823 Ga0501076_0135738 3300049592 Bacteria 1997
1824 Ga0501076_0246983 3300049592 Bacteria 1460
1825 Ga0501076_0521789 3300049592 Bacteria 979
1826 Ga0501076_0590957 3300049592 Bacteria 916
1827 Ga0501076_0603908 3300049592 Bacteria 905
1828 Ga0501076_0856264 3300049592 Bacteria 750
1829 Ga0501077_0011445 3300049593 Bacteria 5541
1830 Ga0501077_0033201 3300049593 Bacteria 3285
1831 Ga0501077_0093706 3300049593 Bacteria 1904
1832 Ga0501077_0193387 3300049593 Bacteria 1292
1833 Ga0501077_0269173 3300049593 Bacteria 1084
1834 Ga0501077_0466305 3300049593 Bacteria 809
1835 Ga0501077_0629728 3300049593 Bacteria 689
1836 Ga0501077_1132537 3300049593 Bacteria 504
1837 Ga0501238_004789 3300049671 Bacteria 1703
1838 Ga0501079_0008707 3300049741 Bacteria 7694
1839 Ga0501079_0008850 3300049741 Bacteria 7621
1840 Ga0501079_0042452 3300049741 Bacteria 3512
1841 Ga0501079_0058862 3300049741 Bacteria 2965
1842 Ga0501079_0068937 3300049741 Bacteria 2730
1843 Ga0501079_0092767 3300049741 Bacteria 2339
1844 Ga0501079_0137361 3300049741 Bacteria 1904
1845 Ga0501079_0612468 3300049741 Bacteria 857
1846 Ga0501079_0636647 3300049741 Bacteria 840
1847 Ga0501079_1184953 3300049741 Bacteria 602
1848 Ga0501079_1295217 3300049741 Bacteria 574
1849 Ga0501080_0004705 3300049742 Bacteria 12181
1850 Ga0501080_0011412 3300049742 Bacteria 8136
1851 Ga0501080_0017268 3300049742 Bacteria 6669
1852 Ga0501080_0025164 3300049742 Bacteria 5524
1853 Ga0501080_0025866 3300049742 Bacteria 5452
1854 Ga0501080_0064491 3300049742 Bacteria 3407
1855 Ga0501080_0074106 3300049742 Bacteria 3167
1856 Ga0501080_0096691 3300049742 Bacteria 2742
1857 Ga0501080_0123492 3300049742 Bacteria 2398
1858 Ga0501080_0175086 3300049742 Bacteria 1977
1859 Ga0501080_0184064 3300049742 Bacteria 1921
1860 Ga0501080_0267366 3300049742 Bacteria 1557
1861 Ga0501080_0301102 3300049742 Bacteria 1454
1862 Ga0501080_0322952 3300049742 Bacteria 1397
1863 Ga0501080_0429360 3300049742 Bacteria 1186
1864 Ga0501080_0450717 3300049742 Bacteria 1154
1865 Ga0501080_0610867 3300049742 Bacteria 967
1866 Ga0501080_0611626 3300049742 Bacteria 967
1867 Ga0501080_1054334 3300049742 Bacteria 703
1868 Ga0501080_1135035 3300049742 Bacteria 674
1869 Ga0501080_1489986 3300049742 Bacteria 575
1870 Ga0501080_1687412 3300049742 Bacteria 535
1871 Ga0501081_0016416 3300049743 Bacteria 4894
1872 Ga0501081_0054088 3300049743 Bacteria 2773
1873 Ga0501081_0079355 3300049743 Bacteria 2296
1874 Ga0501081_0096246 3300049743 Bacteria 2088
1875 Ga0501081_0171113 3300049743 Bacteria 1568
1876 Ga0501081_0198752 3300049743 Bacteria 1453
1877 Ga0501081_0305444 3300049743 Bacteria 1167
1878 Ga0501081_0435416 3300049743 Bacteria 973
1879 Ga0501081_0548472 3300049743 Bacteria 864
1880 Ga0501083_0000098 3300049744 Bacteria 59246
1881 Ga0501083_0006468 3300049744 Bacteria 8311
1882 Ga0501083_0011101 3300049744 Bacteria 6326
1883 Ga0501083_0011157 3300049744 Bacteria 6306
1884 Ga0501083_0022048 3300049744 Bacteria 4421
1885 Ga0501083_0064310 3300049744 Bacteria 2445
1886 Ga0501083_0104131 3300049744 Bacteria 1870
1887 Ga0501083_0120036 3300049744 Bacteria 1724
1888 Ga0501083_0249067 3300049744 Bacteria 1156
1889 Ga0501083_0331950 3300049744 Bacteria 989
1890 Ga0501083_0411159 3300049744 Bacteria 880
1891 Ga0501083_0707520 3300049744 Bacteria 655
1892 Ga0501083_0779347 3300049744 Bacteria 622
1893 Ga0501035_0000036 3300049822 Bacteria 165008
1894 Ga0501035_0000096 3300049822 Bacteria 110635
1895 Ga0501035_0000105 3300049822 Bacteria 104877
1896 Ga0501035_0007132 3300049822 Bacteria 10449
1897 Ga0501035_0011774 3300049822 Bacteria 8098
1898 Ga0501035_0014814 3300049822 Bacteria 7198
1899 Ga0501035_0018174 3300049822 Bacteria 6475
1900 Ga0501035_0019433 3300049822 Bacteria 6247
1901 Ga0501035_0030316 3300049822 Bacteria 4931
1902 Ga0501035_0039748 3300049822 Bacteria 4256
1903 Ga0501035_0058916 3300049822 Bacteria 3420
1904 Ga0501035_0076248 3300049822 Bacteria 2965
1905 Ga0501035_0091995 3300049822 Bacteria 2669
1906 Ga0501035_0101136 3300049822 Bacteria 2530
1907 Ga0501035_0107454 3300049822 Bacteria 2446
1908 Ga0501035_0121037 3300049822 Bacteria 2288
1909 Ga0501035_0164994 3300049822 Bacteria 1916
1910 Ga0501035_0176668 3300049822 Bacteria 1842
1911 Ga0501035_0210721 3300049822 Bacteria 1662
1912 Ga0501035_0216942 3300049822 Bacteria 1635
1913 Ga0501035_0235440 3300049822 Bacteria 1559
1914 Ga0501035_0308745 3300049822 Bacteria 1331
1915 Ga0501035_0380335 3300049822 Bacteria 1178
1916 Ga0501035_0443937 3300049822 Bacteria 1074
1917 Ga0501035_0471664 3300049822 Bacteria 1036
1918 Ga0501044_0000017 3300049823 Bacteria 228107
1919 Ga0501044_0003970 3300049823 Bacteria 16568
1920 Ga0501044_0004614 3300049823 Bacteria 15414
1921 Ga0501044_0005206 3300049823 Bacteria 14478
1922 Ga0501044_0018252 3300049823 Bacteria 7522
1923 Ga0501044_0038641 3300049823 Bacteria 4984
1924 Ga0501044_0057278 3300049823 Bacteria 3999
1925 Ga0501044_0070198 3300049823 Bacteria 3564
1926 Ga0501044_0087909 3300049823 Bacteria 3138
1927 Ga0501044_0105066 3300049823 Bacteria 2837
1928 Ga0501044_0107218 3300049823 Bacteria 2805
1929 Ga0501044_0109223 3300049823 Bacteria 2775
1930 Ga0501044_0125889 3300049823 Bacteria 2560
1931 Ga0501044_0126772 3300049823 Bacteria 2549
1932 Ga0501044_0190398 3300049823 Bacteria 2014
1933 Ga0501044_0255493 3300049823 Bacteria 1692
1934 Ga0501044_0300705 3300049823 Bacteria 1533
1935 Ga0501044_0311651 3300049823 Bacteria 1500
1936 Ga0501044_0578933 3300049823 Bacteria 1017
1937 Ga0501044_0732039 3300049823 Bacteria 872
1938 Ga0501044_0824565 3300049823 Bacteria 806
1939 Ga0501044_1226282 3300049823 Bacteria 618
1940 Ga0501045_0065249 3300049824 Bacteria 2673
1941 Ga0501045_0123898 3300049824 Bacteria 1919
1942 Ga0501045_0207880 3300049824 Bacteria 1458
1943 Ga0501045_0286618 3300049824 Bacteria 1226
1944 Ga0501045_0372658 3300049824 Bacteria 1062
1945 Ga0501045_0381817 3300049824 Bacteria 1049
1946 Ga0501045_0541155 3300049824 Bacteria 864
1947 Ga0501045_0611061 3300049824 Bacteria 807
1948 Ga0501045_1278341 3300049824 Bacteria 534
1949 Ga0501045_1285151 3300049824 Bacteria 533
1950 Ga0501045_1321120 3300049824 Bacteria 524
1951 nmdc:mga03683_104172_c1 3300050489 Bacteria 1249
1952 nmdc:mga03683_1209_c1 3300050489 Bacteria 7627
1953 nmdc:mga03683_3012_c1 3300050489 Bacteria 3886
1954 nmdc:mga03683_413945_c1 3300050489 Bacteria 645
1955 nmdc:mga03683_53313_c1 3300050489 Bacteria 1693
1956 nmdc:mga03683_610309_c1 3300050489 Bacteria 535
1957 nmdc:mga03n38_13377_c1 3300050490 Bacteria 3115
1958 nmdc:mga03n38_15127_c1 3300050490 Bacteria 2973
1959 nmdc:mga03n38_271506_c1 3300050490 Bacteria 902
1960 nmdc:mga03n38_9941_c1 3300050490 Bacteria 3481
1961 nmdc:mga00v17_23770_c1 3300050491 Bacteria 3549
1962 nmdc:mga00v17_246709_c1 3300050491 Unclassified 1158
1963 nmdc:mga00v17_271438_c1 3300050491 Bacteria 1101
1964 nmdc:mga00v17_427770_c1 3300050491 Bacteria 860
1965 nmdc:mga00v17_684331_c1 3300050491 Bacteria 658
1966 nmdc:mga00v17_92623_c1 3300050491 Bacteria 1900
1967 nmdc:mga00v17_942489_c1 3300050491 Bacteria 545
1968 nmdc:mga0yw44_137878_c1 3300050492 Bacteria 1584
1969 nmdc:mga0yw44_37357_c1 3300050492 Bacteria 2867
1970 nmdc:mga0yw44_3739_c1 3300050492 Bacteria 6817
1971 nmdc:mga0yw44_445325_c1 3300050492 Bacteria 877
1972 nmdc:mga0yw44_508111_c1 3300050492 Bacteria 818
1973 nmdc:mga0yw44_6537_c1 3300050492 Bacteria 5643
1974 nmdc:mga0yw44_744063_c1 3300050492 Bacteria 666
1975 nmdc:mga0yw44_863670_c1 3300050492 Bacteria 614
1976 nmdc:mga0k408_193437_c1 3300050493 Bacteria 1214
1977 nmdc:mga06z11_116807_c1 3300050494 Bacteria 1484
1978 nmdc:mga06z11_127197_c1 3300050494 Bacteria 1427
1979 nmdc:mga06z11_194099_c1 3300050494 Bacteria 1177
1980 nmdc:mga06z11_317_c1 3300050494 Bacteria 18237
1981 nmdc:mga06z11_769579_c1 3300050494 Bacteria 587
1982 nmdc:mga04h51_119946_c1 3300050495 Bacteria 979
1983 nmdc:mga04h51_14645_c1 3300050495 Bacteria 2245
1984 nmdc:mga04h51_202627_c1 3300050495 Bacteria 780
1985 nmdc:mga04h51_244838_c1 3300050495 Bacteria 717
1986 nmdc:mga04h51_269948_c1 3300050495 Bacteria 686
1987 nmdc:mga04h51_44685_c1 3300050495 Bacteria 1462
1988 nmdc:mga04h51_5970_c1 3300050495 Bacteria 3131
1989 nmdc:mga04h51_64866_c1 3300050495 Bacteria 1261
1990 nmdc:mga07m45_122184_c1 3300050496 Bacteria 1504
1991 nmdc:mga07m45_190657_c1 3300050496 Bacteria 1192
1992 nmdc:mga07m45_340908_c1 3300050496 Bacteria 871
1993 nmdc:mga07m45_510755_c1 3300050496 Bacteria 696
1994 nmdc:mga07m45_58067_c1 3300050496 Bacteria 2189
1995 nmdc:mga07m45_59426_c1 3300050496 Bacteria 2163
1996 nmdc:mga07m45_67960_c1 3300050496 Bacteria 2026
1997 nmdc:mga05p37_1016407_c1 3300050507 Bacteria 879
1998 nmdc:mga05p37_104847_c1 3300050507 Bacteria 3478
1999 nmdc:mga05p37_1125226_c1 3300050507 Bacteria 820
2000 nmdc:mga05p37_1268897_c1 3300050507 Bacteria 754
2001 nmdc:mga05p37_1290076_c1 3300050507 Bacteria 745
2002 nmdc:mga05p37_1351132_c1 3300050507 Bacteria 722
2003 nmdc:mga05p37_1396028_c1 3300050507 Bacteria 706
2004 nmdc:mga05p37_23888_c1 3300050507 Bacteria 7422
2005 nmdc:mga05p37_283881_c1 3300050507 Bacteria 1973
2006 nmdc:mga05p37_354892_c1 3300050507 Bacteria 1725
2007 nmdc:mga05p37_586161_c1 3300050507 Bacteria 1262
2008 nmdc:mga05p37_711507_c1 3300050507 Bacteria 1114
2009 nmdc:mga09592_155675_c1 3300050508 Bacteria 1973
2010 nmdc:mga09592_219791_c1 3300050508 Bacteria 1646
2011 nmdc:mga09592_3261_c1 3300050508 Bacteria 13129
2012 nmdc:mga0qj67_1232624_c1 3300050509 Bacteria 581
2013 nmdc:mga0qj67_1254863_c1 3300050509 Bacteria 575
2014 nmdc:mga0qj67_142171_c1 3300050509 Bacteria 1946
2015 nmdc:mga0qj67_208750_c1 3300050509 Bacteria 1586
2016 nmdc:mga0qj67_22662_c1 3300050509 Bacteria 4825
2017 nmdc:mga0qj67_350113_c1 3300050509 Bacteria 1194
2018 nmdc:mga0qj67_36870_c1 3300050509 Bacteria 3828
2019 nmdc:mga0qj67_4146_c1 3300050509 Bacteria 10506
2020 nmdc:mga0qj67_617666_c1 3300050509 Bacteria 866
2021 nmdc:mga0qj67_676500_c1 3300050509 Bacteria 822
2022 nmdc:mga06r32_1515_c1 3300050510 Bacteria 20880
2023 nmdc:mga06r32_316753_c1 3300050510 Bacteria 1545
2024 nmdc:mga06r32_33096_c1 3300050510 Bacteria 4867
2025 nmdc:mga06r32_402339_c1 3300050510 Bacteria 1351
2026 nmdc:mga06r32_51391_c1 3300050510 Bacteria 3945
2027 nmdc:mga06r32_5448_c1 3300050510 Bacteria 11458
2028 nmdc:mga06r32_553872_c1 3300050510 Bacteria 1124
2029 nmdc:mga08y16_1148749_c1 3300050511 Bacteria 749
2030 nmdc:mga08y16_151309_c1 3300050511 Bacteria 2412
2031 nmdc:mga08y16_253527_c1 3300050511 Bacteria 1818
2032 nmdc:mga08y16_35_c1 3300050511 Bacteria 157578
2033 nmdc:mga08y16_450909_c1 3300050511 Bacteria 1312
2034 nmdc:mga08y16_481651_c1 3300050511 Bacteria 1263
2035 nmdc:mga08y16_8826_c1 3300050511 Bacteria 10580
2036 nmdc:mga08y16_920617_c1 3300050511 Bacteria 859
2037 nmdc:mga0n895_4009_c1 3300050512 Bacteria 11978
2038 nmdc:mga0n895_52659_c1 3300050512 Bacteria 3996
2039 nmdc:mga0n895_671132_c1 3300050512 Bacteria 1034
2040 nmdc:mga0n895_67429_c1 3300050512 Bacteria 3544
2041 nmdc:mga0n895_695238_c1 3300050512 Bacteria 1013
2042 nmdc:mga0n895_75923_c1 3300050512 Bacteria 3342
2043 nmdc:mga0rr50_165680_c1 3300050513 Bacteria 1797
2044 nmdc:mga08x19_244529_c1 3300050514 Bacteria 1238
2045 nmdc:mga0a205_10265_c1 3300050515 Bacteria 8602
2046 nmdc:mga0a205_196971_c1 3300050515 Bacteria 1905
2047 nmdc:mga0a205_280057_c1 3300050515 Bacteria 1543
2048 nmdc:mga0a205_53269_c1 3300050515 Bacteria 1163
2049 nmdc:mga0a205_7557_c1 3300050515 Bacteria 9847
2050 nmdc:mga0sz30_123965_c1 3300050516 Bacteria 1136
2051 nmdc:mga0sz30_254013_c1 3300050516 Bacteria 783
2052 nmdc:mga0sz30_38122_c1 3300050516 Bacteria 2013
2053 Ga0495601_0000763 3300053077 Bacteria 17371
2054 Ga0495601_0525514 3300053077 Bacteria 762
2055 Ga0495601_0854337 3300053077 Bacteria 576
2056 Ga0495612_0007350 3300053078 Bacteria 4503
2057 Ga0500610_0039322 3300053079 Bacteria 2440
2058 Ga0495655_0001691 3300053083 Bacteria 3412
2059 Ga0495655_0017393 3300053083 Bacteria 1565
2060 Ga0495595_0138063 3300053084 Bacteria 1195
2061 Ga0495619_0001194 3300053085 Bacteria 17106
2062 Ga0495619_0004882 3300053085 Bacteria 8515
2063 Ga0495619_1109663 3300053085 Bacteria 526
2064 Ga0500578_0030675 3300053086 Bacteria 3455
2065 Ga0500578_0058305 3300053086 Bacteria 2467
2066 Ga0500578_0373563 3300053086 Bacteria 828
2067 Ga0500643_082620 3300053087 Bacteria 881
2068 Ga0500644_0004440 3300053088 Bacteria 3509
2069 Ga0500644_0022920 3300053088 Bacteria 1890
2070 Ga0500644_0202993 3300053088 Bacteria 821
2071 Ga0500646_0081645 3300053090 Bacteria 987
2072 Ga0500646_0361994 3300053090 Bacteria 530
2073 Ga0500646_0406745 3300053090 Bacteria 503
2074 Ga0500647_0192091 3300053091 Bacteria 931
2075 Ga0500583_0162114 3300053092 Bacteria 1114
2076 Ga0500651_0011193 3300053093 Bacteria 5403
2077 Ga0500651_0577382 3300053093 Bacteria 612
2078 Ga0500651_0639534 3300053093 Bacteria 574
2079 Ga0500651_0656408 3300053093 Bacteria 564
2080 Ga0500566_0236043 3300053094 Bacteria 899
2081 Ga0500641_0015295 3300053096 Bacteria 2845
2082 Ga0500555_050975 3300053103 Bacteria 1133
2083 Ga0500557_082945 3300053105 Bacteria 1059
2084 Ga0500562_018054 3300053108 Bacteria 1821
2085 Ga0500569_154263 3300053109 Bacteria 775
2086 Ga0500618_001028 3300053125 Bacteria 13992
2087 Ga0500618_013707 3300053125 Bacteria 2088
2088 Ga0500618_034210 3300053125 Bacteria 1182
2089 Ga0500621_184808 3300053126 Bacteria 752
2090 Ga0500642_0004342 3300053130 Bacteria 4425
2091 Ga0500658_0158509 3300053134 Bacteria 1023
2092 Ga0500658_0383963 3300053134 Bacteria 643
2093 Ga0500658_0407595 3300053134 Bacteria 622
2094 Ga0500568_0005282 3300053139 Bacteria 6711
2095 Ga0500568_0010207 3300053139 Bacteria 4409
2096 Ga0500568_0010471 3300053139 Bacteria 4342
2097 Ga0500568_0050308 3300053139 Bacteria 1643
2098 Ga0500568_0187171 3300053139 Bacteria 760
2099 Ga0500568_0325449 3300053139 Bacteria 557
2100 Ga0500577_0047546 3300053142 Bacteria 1595
2101 Ga0500577_0091905 3300053142 Bacteria 1228
2102 Ga0500577_0169217 3300053142 Bacteria 934
2103 Ga0500577_0264319 3300053142 Bacteria 749
2104 Ga0500577_0526406 3300053142 Bacteria 516
2105 Ga0500588_0005875 3300053146 Bacteria 2748
2106 Ga0500588_0021299 3300053146 Bacteria 1749
2107 Ga0500588_0082704 3300053146 Bacteria 1077
2108 Ga0500616_0002326 3300053153 Bacteria 16037
2109 Ga0500616_0012309 3300053153 Bacteria 5008
2110 Ga0500616_0031836 3300053153 Bacteria 2885
2111 Ga0500622_0000189 3300053156 Bacteria 65129
2112 Ga0500622_0002478 3300053156 Bacteria 13291
2113 Ga0500622_0063378 3300053156 Bacteria 1882
2114 Ga0500622_0193039 3300053156 Bacteria 932
2115 Ga0500627_0027898 3300053158 Bacteria 2341
2116 Ga0500633_0013026 3300053160 Bacteria 2317
2117 Ga0500633_0280990 3300053160 Bacteria 615
2118 Ga0500611_260503 3300053727 Bacteria 501
2119 Ga0500657_225044 3300053728 Bacteria 590
2120 Ga0500645_003580 3300053730 Bacteria 6237
2121 Ga0500609_002519 3300053731 Bacteria 2612
2122 Ga0500599_020557 3300053736 Bacteria 934
2123 Ga0500587_011337 3300053739 Bacteria 1127
2124 Ga0501084_0023703 3300054114 Bacteria 5118
2125 Ga0501084_0028674 3300054114 Bacteria 4654
2126 Ga0501084_0057143 3300054114 Bacteria 3265
2127 Ga0501084_0059310 3300054114 Bacteria 3203
2128 Ga0501084_0116943 3300054114 Bacteria 2241
2129 Ga0501084_0122547 3300054114 Bacteria 2186
2130 Ga0501084_0187649 3300054114 Bacteria 1745
2131 Ga0501084_0202216 3300054114 Bacteria 1676
2132 Ga0501084_0233829 3300054114 Bacteria 1551
2133 Ga0501084_0283660 3300054114 Bacteria 1399
2134 Ga0501084_0301057 3300054114 Bacteria 1354
2135 Ga0501084_0315569 3300054114 Bacteria 1320
2136 Ga0501084_0439703 3300054114 Bacteria 1102
2137 Ga0501084_0489129 3300054114 Bacteria 1040
2138 Ga0501084_0502635 3300054114 Bacteria 1024
2139 Ga0501084_0844766 3300054114 Bacteria 771
2140 Ga0501084_1307196 3300054114 Bacteria 608
2141 Ga0501084_1313950 3300054114 Bacteria 606
2142 Ga0587117_095774 3300059627 Bacteria 560
2143 Ga0501082_0012303 3300060353 Bacteria 7353
2144 Ga0501082_0013442 3300060353 Bacteria 7034
2145 Ga0501082_0019461 3300060353 Bacteria 5852
2146 Ga0501082_0032343 3300060353 Bacteria 4511
2147 Ga0501082_0046670 3300060353 Bacteria 3733
2148 Ga0501082_0118344 3300060353 Bacteria 2295
2149 Ga0501082_0141915 3300060353 Bacteria 2085
2150 Ga0501082_0144424 3300060353 Bacteria 2065
2151 Ga0501082_0273752 3300060353 Bacteria 1469
2152 Ga0501082_0315082 3300060353 Bacteria 1363
2153 Ga0501082_0373482 3300060353 Bacteria 1244
2154 Ga0501082_0491560 3300060353 Bacteria 1072
2155 Ga0501082_0809430 3300060353 Bacteria 820
2156 Ga0501082_1037057 3300060353 Bacteria 717
2157 Ga0501082_1077589 3300060353 Bacteria 702
2158 Ga0501082_1147914 3300060353 Bacteria 679
2159 Ga0501082_1562878 3300060353 Bacteria 576
2160 Ga0530510_0009093 3300061734 Bacteria 6962
2161 Ga0530510_0055018 3300061734 Bacteria 2875
2162 Ga0530510_0103703 3300061734 Bacteria 2080
2163 Ga0530510_0105025 3300061734 Bacteria 2067
2164 Ga0530510_0192940 3300061734 Bacteria 1512
2165 Ga0530510_0301745 3300061734 Bacteria 1198
2166 Ga0530510_0442024 3300061734 Bacteria 983
2167 Ga0530510_0485951 3300061734 Bacteria 936
2168 Ga0530510_0488617 3300061734 Bacteria 933
2169 Ga0530510_0639519 3300061734 Bacteria 810
2170 Ga0530510_0652877 3300061734 Bacteria 801
2171 Ga0530510_0772134 3300061734 Bacteria 733
2172 Ga0530510_0862375 3300061734 Bacteria 691

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10765432 Ga0157380_107654322 123
2 3300048924 Ga0496121_0703401 Ga0496121_0703401_37_462 127
3 iso_pu_bacteria 2643221599 2644008126 129
4 iso_pu_bacteria 2738541293 2738802899 129
5 iso_pu_bacteria 2995392953 2995396087 129
6 3300049588 Ga0501072_0471301 Ga0501072_0471301_592_984 130
7 3300029957 Ga0265324_10004826 Ga0265324_100048262 132
8 3300031239 Ga0265328_10011592 Ga0265328_100115925 132
9 3300031250 Ga0265331_10001321 Ga0265331_100013218 132
10 3300031251 Ga0265327_10234353 Ga0265327_102343532 132
11 3300031344 Ga0265316_10006117 Ga0265316_1000611710 132
12 3300031595 Ga0265313_10005287 Ga0265313_100052872 132
13 3300031712 Ga0265342_10003397 Ga0265342_100033979 132
14 3300041494 Ga0451837_0311208 Ga0451837_0311208_204_605 132
15 3300044712 Ga0453684_0112629 Ga0453684_0112629_662_1066 132
16 3300048919 Ga0496116_0115140 Ga0496116_0115140_867_1337 132
17 3300048921 Ga0496118_0290527 Ga0496118_0290527_207_677 132
18 3300048924 Ga0496121_0327623 Ga0496121_0327623_372_842 132
19 3300049569 Ga0501032_0567133 Ga0501032_0567133_96_506 132
20 3300049742 Ga0501080_0610867 Ga0501080_0610867_338_757 132
21 3300013306 Ga0163162_10830754 Ga0163162_108307541 133
22 3300046507 Ga0495606_0024330 Ga0495606_0024330_1182_1586 133
23 3300048917 Ga0496114_0607069 Ga0496114_0607069_326_730 133
24 3300048924 Ga0496121_0138568 Ga0496121_0138568_1265_1696 133
25 3300048929 Ga0496126_0044485 Ga0496126_0044485_2613_3041 133
26 3300000041 ARcpr5oldR_c006516 ARcpr5oldR_0065162 134
27 3300000044 ARSoilOldRDRAFT_c010326 ARSoilOldRDRAFT_0103262 134
28 3300000652 ARCol0yngRDRAFT_1006355 ARCol0yngRDRAFT_10063552 134
29 3300001915 JGI24741J21665_1052059 JGI24741J21665_10520592 134
30 3300001978 JGI24747J21853_1011662 JGI24747J21853_10116622 134
31 3300001979 JGI24740J21852_10000083 JGI24740J21852_1000008329 134
32 3300001979 JGI24740J21852_10039826 JGI24740J21852_100398262 134
33 3300001990 JGI24737J22298_10009690 JGI24737J22298_100096902 134
34 3300001991 JGI24743J22301_10003961 JGI24743J22301_100039614 134
35 3300002070 JGI24750J21931_1003673 JGI24750J21931_10036732 134
36 3300002075 JGI24738J21930_10002342 JGI24738J21930_100023426 134
37 3300002076 JGI24749J21850_1018712 JGI24749J21850_10187121 134
38 3300002077 JGI24744J21845_10022170 JGI24744J21845_100221702 134
39 3300002244 JGI24742J22300_10018848 JGI24742J22300_100188482 134
40 3300002705 JGI25156J39149_1003138 JGI25156J39149_10031382 134
41 3300002737 JGI25162J39368_1002012 JGI25162J39368_10020127 134
42 3300002737 JGI25162J39368_1002022 JGI25162J39368_10020227 134
43 3300002739 JGI25158J39367_1000077 JGI25158J39367_100007710 134
44 3300002739 JGI25158J39367_1000102 JGI25158J39367_100010210 134
45 3300002741 JGI25157J39369_1000707 JGI25157J39369_100070712 134
46 3300002773 JGI25152J39213_1002631 JGI25152J39213_10026314 134
47 3300002773 JGI25152J39213_1019402 JGI25152J39213_10194022 134
48 3300002773 JGI25152J39213_1023749 JGI25152J39213_10237492 134
49 3300002774 JGI25150J39212_1002649 JGI25150J39212_10026494 134
50 3300002774 JGI25150J39212_1023588 JGI25150J39212_10235882 134
51 3300002987 JGI25159J45721_1000221 JGI25159J45721_100022124 134
52 3300003187 JGI25151J46595_10005507 JGI25151J46595_100055073 134
53 3300003187 JGI25151J46595_10045011 JGI25151J46595_100450112 134
54 3300003214 JGI25165J46597_1001766 JGI25165J46597_10017668 134
55 3300003214 JGI25165J46597_1005983 JGI25165J46597_10059832 134
56 3300003215 JGI25153J46596_10000103 JGI25153J46596_100001036 134
57 3300003215 JGI25153J46596_10000907 JGI25153J46596_1000090713 134
58 3300003215 JGI25153J46596_10035654 JGI25153J46596_100356542 134
59 3300003215 JGI25153J46596_10059911 JGI25153J46596_100599112 134
60 3300003215 JGI25153J46596_10068010 JGI25153J46596_100680102 134
61 3300003322 rootL2_10017653 rootL2_100176534 134
62 3300003354 JGI25160J50197_1027462 JGI25160J50197_10274623 134
63 3300003374 JGI25161J50226_1000179 JGI25161J50226_10001795 134
64 3300003374 JGI25161J50226_1026812 JGI25161J50226_10268121 134
65 3300003771 Ga0055526_1001350 Ga0055526_10013502 134
66 3300003771 Ga0055526_1014418 Ga0055526_10144183 134
67 3300003771 Ga0055526_1021565 Ga0055526_10215655 134
68 3300003775 Ga0055524_1013595 Ga0055524_10135954 134
69 3300003775 Ga0055524_1018944 Ga0055524_10189442 134
70 3300003775 Ga0055524_1019140 Ga0055524_10191402 134
71 3300003775 Ga0055524_1051751 Ga0055524_10517512 134
72 3300003790 Ga0055528_1009191 Ga0055528_10091914 134
73 3300003790 Ga0055528_1023889 Ga0055528_10238892 134
74 3300003792 Ga0055540_1000703 Ga0055540_100070315 134
75 3300003792 Ga0055540_1005247 Ga0055540_10052473 134
76 3300003792 Ga0055540_1064648 Ga0055540_10646481 134
77 3300003856 Ga0058692_1017595 Ga0058692_10175952 134
78 3300003911 JGI25405J52794_10062364 JGI25405J52794_100623641 134
79 3300004625 Ga0055543_1000193 Ga0055543_100019346 134
80 3300004625 Ga0055543_1003259 Ga0055543_10032593 134
81 3300005262 Ga0065165_1014067 Ga0065165_10140674 134
82 3300005262 Ga0065165_1067380 Ga0065165_10673801 134
83 3300005295 Ga0065707_10153478 Ga0065707_101534783 134
84 3300005327 Ga0070658_10312800 Ga0070658_103128002 134
85 3300005327 Ga0070658_10722100 Ga0070658_107221001 134
86 3300005328 Ga0070676_10099362 Ga0070676_100993621 134
87 3300005328 Ga0070676_10584771 Ga0070676_105847711 134
88 3300005328 Ga0070676_11531364 Ga0070676_115313641 134
89 3300005329 Ga0070683_100019702 Ga0070683_1000197022 134
90 3300005330 Ga0070690_100056685 Ga0070690_1000566853 134
91 3300005330 Ga0070690_100720260 Ga0070690_1007202602 134
92 3300005331 Ga0070670_100002769 Ga0070670_1000027699 134
93 3300005331 Ga0070670_101153336 Ga0070670_1011533361 134
94 3300005333 Ga0070677_10023304 Ga0070677_100233042 134
95 3300005334 Ga0068869_100053474 Ga0068869_1000534743 134
96 3300005335 Ga0070666_10002383 Ga0070666_100023832 134
97 3300005335 Ga0070666_10124759 Ga0070666_101247593 134
98 3300005336 Ga0070680_100012695 Ga0070680_1000126956 134
99 3300005337 Ga0070682_100006057 Ga0070682_1000060576 134
100 3300005337 Ga0070682_100308447 Ga0070682_1003084472 134
101 3300005337 Ga0070682_100875862 Ga0070682_1008758622 134
102 3300005337 Ga0070682_101650778 Ga0070682_1016507781 134
103 3300005338 Ga0068868_100012734 Ga0068868_1000127344 134
104 3300005339 Ga0070660_100000318 Ga0070660_1000003185 134
105 3300005339 Ga0070660_100426754 Ga0070660_1004267542 134
106 3300005339 Ga0070660_100595414 Ga0070660_1005954142 134
107 3300005339 Ga0070660_101940167 Ga0070660_1019401671 134
108 3300005340 Ga0070689_100000208 Ga0070689_10000020834 134
109 3300005340 Ga0070689_100018148 Ga0070689_1000181484 134
110 3300005340 Ga0070689_100256990 Ga0070689_1002569902 134
111 3300005341 Ga0070691_10003057 Ga0070691_100030572 134
112 3300005341 Ga0070691_10122209 Ga0070691_101222091 134
113 3300005341 Ga0070691_10526745 Ga0070691_105267451 134
114 3300005343 Ga0070687_100016938 Ga0070687_1000169382 134
115 3300005343 Ga0070687_100318846 Ga0070687_1003188461 134
116 3300005344 Ga0070661_100000444 Ga0070661_10000044432 134
117 3300005344 Ga0070661_100008945 Ga0070661_1000089453 134
118 3300005344 Ga0070661_100869603 Ga0070661_1008696032 134
119 3300005344 Ga0070661_101120535 Ga0070661_1011205351 134
120 3300005345 Ga0070692_10003029 Ga0070692_100030292 134
121 3300005345 Ga0070692_10041783 Ga0070692_100417832 134
122 3300005347 Ga0070668_100000073 Ga0070668_10000007345 134
123 3300005347 Ga0070668_100137509 Ga0070668_1001375093 134
124 3300005347 Ga0070668_100142120 Ga0070668_1001421202 134
125 3300005347 Ga0070668_100209628 Ga0070668_1002096283 134
126 3300005347 Ga0070668_100715357 Ga0070668_1007153572 134
127 3300005353 Ga0070669_100002859 Ga0070669_1000028594 134
128 3300005353 Ga0070669_100102921 Ga0070669_1001029213 134
129 3300005353 Ga0070669_100357395 Ga0070669_1003573952 134
130 3300005353 Ga0070669_101583542 Ga0070669_1015835421 134
131 3300005354 Ga0070675_100002210 Ga0070675_10000221013 134
132 3300005354 Ga0070675_100587946 Ga0070675_1005879462 134
133 3300005355 Ga0070671_100002558 Ga0070671_10000255810 134
134 3300005356 Ga0070674_100000803 Ga0070674_1000008033 134
135 3300005356 Ga0070674_100058928 Ga0070674_1000589283 134
136 3300005356 Ga0070674_100403016 Ga0070674_1004030161 134
137 3300005364 Ga0070673_100000548 Ga0070673_10000054821 134
138 3300005364 Ga0070673_100246579 Ga0070673_1002465792 134
139 3300005364 Ga0070673_101405635 Ga0070673_1014056352 134
140 3300005365 Ga0070688_100000195 Ga0070688_10000019530 134
141 3300005366 Ga0070659_100012915 Ga0070659_1000129152 134
142 3300005366 Ga0070659_100071718 Ga0070659_1000717184 134
143 3300005366 Ga0070659_100687870 Ga0070659_1006878702 134
144 3300005366 Ga0070659_100753404 Ga0070659_1007534041 134
145 3300005367 Ga0070667_100000825 Ga0070667_10000082526 134
146 3300005367 Ga0070667_100038293 Ga0070667_1000382933 134
147 3300005367 Ga0070667_100101214 Ga0070667_1001012142 134
148 3300005367 Ga0070667_100114725 Ga0070667_1001147251 134
149 3300005367 Ga0070667_100176581 Ga0070667_1001765813 134
150 3300005406 Ga0070703_10238623 Ga0070703_102386232 134
151 3300005434 Ga0070709_10001744 Ga0070709_100017444 134
152 3300005435 Ga0070714_100002521 Ga0070714_1000025217 134
153 3300005435 Ga0070714_100270049 Ga0070714_1002700492 134
154 3300005435 Ga0070714_100767363 Ga0070714_1007673631 134
155 3300005435 Ga0070714_101174079 Ga0070714_1011740792 134
156 3300005436 Ga0070713_100005338 Ga0070713_1000053387 134
157 3300005437 Ga0070710_10083769 Ga0070710_100837692 134
158 3300005437 Ga0070710_10119858 Ga0070710_101198581 134
159 3300005438 Ga0070701_10001093 Ga0070701_100010935 134
160 3300005438 Ga0070701_10214788 Ga0070701_102147882 134
161 3300005438 Ga0070701_10315305 Ga0070701_103153051 134
162 3300005439 Ga0070711_100000336 Ga0070711_1000003365 134
163 3300005439 Ga0070711_100134006 Ga0070711_1001340062 134
164 3300005439 Ga0070711_100163419 Ga0070711_1001634191 134
165 3300005439 Ga0070711_101058416 Ga0070711_1010584162 134
166 3300005440 Ga0070705_100002821 Ga0070705_1000028217 134
167 3300005440 Ga0070705_100080646 Ga0070705_1000806462 134
168 3300005440 Ga0070705_100319670 Ga0070705_1003196702 134
169 3300005440 Ga0070705_100755693 Ga0070705_1007556931 134
170 3300005440 Ga0070705_100945211 Ga0070705_1009452111 134
171 3300005441 Ga0070700_100000209 Ga0070700_10000020914 134
172 3300005441 Ga0070700_100175171 Ga0070700_1001751713 134
173 3300005441 Ga0070700_100213715 Ga0070700_1002137152 134
174 3300005441 Ga0070700_100285642 Ga0070700_1002856421 134
175 3300005441 Ga0070700_100287755 Ga0070700_1002877553 134
176 3300005441 Ga0070700_100408313 Ga0070700_1004083133 134
177 3300005444 Ga0070694_100000343 Ga0070694_1000003436 134
178 3300005444 Ga0070694_100495712 Ga0070694_1004957122 134
179 3300005445 Ga0070708_100146828 Ga0070708_1001468282 134
180 3300005445 Ga0070708_100153886 Ga0070708_1001538864 134
181 3300005445 Ga0070708_100184634 Ga0070708_1001846341 134
182 3300005445 Ga0070708_101308262 Ga0070708_1013082621 134
183 3300005455 Ga0070663_100000990 Ga0070663_10000099014 134
184 3300005455 Ga0070663_100562118 Ga0070663_1005621182 134
185 3300005455 Ga0070663_100578101 Ga0070663_1005781012 134
186 3300005455 Ga0070663_101066098 Ga0070663_1010660982 134
187 3300005456 Ga0070678_100000082 Ga0070678_10000008215 134
188 3300005456 Ga0070678_100369833 Ga0070678_1003698332 134
189 3300005456 Ga0070678_100494750 Ga0070678_1004947502 134
190 3300005456 Ga0070678_101711773 Ga0070678_1017117732 134
191 3300005457 Ga0070662_100003057 Ga0070662_10000305711 134
192 3300005457 Ga0070662_100203188 Ga0070662_1002031882 134
193 3300005457 Ga0070662_100753421 Ga0070662_1007534211 134
194 3300005458 Ga0070681_10136538 Ga0070681_101365382 134
195 3300005458 Ga0070681_10295245 Ga0070681_102952452 134
196 3300005458 Ga0070681_11478074 Ga0070681_114780741 134
197 3300005459 Ga0068867_100192658 Ga0068867_1001926582 134
198 3300005459 Ga0068867_100361451 Ga0068867_1003614512 134
199 3300005459 Ga0068867_100978050 Ga0068867_1009780502 134
200 3300005466 Ga0070685_10006974 Ga0070685_100069747 134
201 3300005466 Ga0070685_10151797 Ga0070685_101517972 134
202 3300005466 Ga0070685_10306487 Ga0070685_103064872 134
203 3300005467 Ga0070706_100060410 Ga0070706_1000604103 134
204 3300005467 Ga0070706_100267711 Ga0070706_1002677113 134
205 3300005468 Ga0070707_100413720 Ga0070707_1004137202 134
206 3300005471 Ga0070698_100028688 Ga0070698_1000286885 134
207 3300005471 Ga0070698_100088455 Ga0070698_1000884553 134
208 3300005471 Ga0070698_100580718 Ga0070698_1005807182 134
209 3300005518 Ga0070699_100035800 Ga0070699_1000358002 134
210 3300005518 Ga0070699_100037544 Ga0070699_1000375442 134
211 3300005518 Ga0070699_100056411 Ga0070699_1000564112 134
212 3300005518 Ga0070699_100123280 Ga0070699_1001232801 134
213 3300005518 Ga0070699_100481950 Ga0070699_1004819503 134
214 3300005530 Ga0070679_100019831 Ga0070679_1000198315 134
215 3300005530 Ga0070679_100337230 Ga0070679_1003372301 134
216 3300005530 Ga0070679_100826334 Ga0070679_1008263342 134
217 3300005530 Ga0070679_101553329 Ga0070679_1015533291 134
218 3300005535 Ga0070684_100001344 Ga0070684_10000134416 134
219 3300005535 Ga0070684_100677444 Ga0070684_1006774442 134
220 3300005536 Ga0070697_100065896 Ga0070697_1000658964 134
221 3300005536 Ga0070697_100289002 Ga0070697_1002890022 134
222 3300005536 Ga0070697_100685122 Ga0070697_1006851222 134
223 3300005536 Ga0070697_100777717 Ga0070697_1007777172 134
224 3300005539 Ga0068853_100000284 Ga0068853_10000028429 134
225 3300005539 Ga0068853_100181378 Ga0068853_1001813782 134
226 3300005539 Ga0068853_100360020 Ga0068853_1003600202 134
227 3300005539 Ga0068853_100644837 Ga0068853_1006448372 134
228 3300005539 Ga0068853_101809410 Ga0068853_1018094101 134
229 3300005543 Ga0070672_100000995 Ga0070672_10000099512 134
230 3300005543 Ga0070672_100572347 Ga0070672_1005723472 134
231 3300005543 Ga0070672_101288473 Ga0070672_1012884732 134
232 3300005543 Ga0070672_101306838 Ga0070672_1013068381 134
233 3300005544 Ga0070686_100001059 Ga0070686_10000105915 134
234 3300005544 Ga0070686_100342815 Ga0070686_1003428152 134
235 3300005545 Ga0070695_100000199 Ga0070695_1000001996 134
236 3300005545 Ga0070695_100003365 Ga0070695_1000033652 134
237 3300005545 Ga0070695_100041745 Ga0070695_1000417452 134
238 3300005546 Ga0070696_100010712 Ga0070696_1000107125 134
239 3300005546 Ga0070696_100012550 Ga0070696_1000125502 134
240 3300005546 Ga0070696_100036086 Ga0070696_1000360865 134
241 3300005546 Ga0070696_100059170 Ga0070696_1000591704 134
242 3300005547 Ga0070693_100056724 Ga0070693_1000567242 134
243 3300005548 Ga0070665_100024824 Ga0070665_1000248246 134
244 3300005548 Ga0070665_100061611 Ga0070665_1000616114 134
245 3300005548 Ga0070665_100211409 Ga0070665_1002114092 134
246 3300005548 Ga0070665_100236487 Ga0070665_1002364872 134
247 3300005548 Ga0070665_100291948 Ga0070665_1002919483 134
248 3300005548 Ga0070665_100437687 Ga0070665_1004376872 134
249 3300005548 Ga0070665_100629521 Ga0070665_1006295212 134
250 3300005548 Ga0070665_100894256 Ga0070665_1008942562 134
251 3300005548 Ga0070665_101057404 Ga0070665_1010574042 134
252 3300005548 Ga0070665_101135375 Ga0070665_1011353752 134
253 3300005548 Ga0070665_101280510 Ga0070665_1012805102 134
254 3300005549 Ga0070704_100000781 Ga0070704_10000078112 134
255 3300005549 Ga0070704_100063201 Ga0070704_1000632012 134
256 3300005549 Ga0070704_100130838 Ga0070704_1001308383 134
257 3300005549 Ga0070704_100343943 Ga0070704_1003439432 134
258 3300005563 Ga0068855_100014591 Ga0068855_1000145912 134
259 3300005563 Ga0068855_100111148 Ga0068855_1001111482 134
260 3300005563 Ga0068855_100400012 Ga0068855_1004000122 134
261 3300005563 Ga0068855_101506011 Ga0068855_1015060111 134
262 3300005564 Ga0070664_100002678 Ga0070664_10000267811 134
263 3300005577 Ga0068857_100009106 Ga0068857_1000091067 134
264 3300005577 Ga0068857_100807160 Ga0068857_1008071602 134
265 3300005577 Ga0068857_101215030 Ga0068857_1012150302 134
266 3300005578 Ga0068854_100000361 Ga0068854_10000036127 134
267 3300005578 Ga0068854_100078109 Ga0068854_1000781092 134
268 3300005578 Ga0068854_100306054 Ga0068854_1003060542 134
269 3300005578 Ga0068854_100372304 Ga0068854_1003723042 134
270 3300005578 Ga0068854_100771534 Ga0068854_1007715342 134
271 3300005578 Ga0068854_100803414 Ga0068854_1008034141 134
272 3300005614 Ga0068856_100012765 Ga0068856_1000127657 134
273 3300005614 Ga0068856_100049297 Ga0068856_1000492973 134
274 3300005614 Ga0068856_100239439 Ga0068856_1002394392 134
275 3300005614 Ga0068856_100462965 Ga0068856_1004629652 134
276 3300005614 Ga0068856_102559477 Ga0068856_1025594771 134
277 3300005615 Ga0070702_100000174 Ga0070702_10000017417 134
278 3300005615 Ga0070702_100051678 Ga0070702_1000516782 134
279 3300005615 Ga0070702_100467003 Ga0070702_1004670033 134
280 3300005615 Ga0070702_101023942 Ga0070702_1010239422 134
281 3300005616 Ga0068852_100019573 Ga0068852_1000195732 134
282 3300005616 Ga0068852_100026703 Ga0068852_1000267032 134
283 3300005616 Ga0068852_100059801 Ga0068852_1000598014 134
284 3300005616 Ga0068852_102044570 Ga0068852_1020445702 134
285 3300005617 Ga0068859_100105524 Ga0068859_1001055244 134
286 3300005617 Ga0068859_100240869 Ga0068859_1002408692 134
287 3300005617 Ga0068859_100483147 Ga0068859_1004831473 134
288 3300005617 Ga0068859_100493666 Ga0068859_1004936662 134
289 3300005618 Ga0068864_100001077 Ga0068864_1000010775 134
290 3300005618 Ga0068864_100440246 Ga0068864_1004402462 134
291 3300005718 Ga0068866_10001495 Ga0068866_1000149510 134
292 3300005718 Ga0068866_10018641 Ga0068866_100186415 134
293 3300005718 Ga0068866_10122630 Ga0068866_101226302 134
294 3300005718 Ga0068866_10548811 Ga0068866_105488112 134
295 3300005719 Ga0068861_100000276 Ga0068861_10000027621 134
296 3300005719 Ga0068861_100042348 Ga0068861_1000423483 134
297 3300005719 Ga0068861_100126282 Ga0068861_1001262823 134
298 3300005719 Ga0068861_100128108 Ga0068861_1001281083 134
299 3300005719 Ga0068861_100195481 Ga0068861_1001954811 134
300 3300005841 Ga0068863_100146967 Ga0068863_1001469672 134
301 3300005841 Ga0068863_100686448 Ga0068863_1006864481 134
302 3300005842 Ga0068858_100002002 Ga0068858_10000200215 134
303 3300005842 Ga0068858_100022397 Ga0068858_1000223974 134
304 3300005842 Ga0068858_100328072 Ga0068858_1003280722 134
305 3300005843 Ga0068860_100001413 Ga0068860_1000014134 134
306 3300005843 Ga0068860_102150036 Ga0068860_1021500362 134
307 3300005844 Ga0068862_100006220 Ga0068862_1000062208 134
308 3300005844 Ga0068862_100034737 Ga0068862_1000347374 134
309 3300005844 Ga0068862_100173038 Ga0068862_1001730383 134
310 3300005844 Ga0068862_100359519 Ga0068862_1003595192 134
311 3300005844 Ga0068862_100434921 Ga0068862_1004349212 134
312 3300005844 Ga0068862_100529540 Ga0068862_1005295403 134
313 3300005844 Ga0068862_100690547 Ga0068862_1006905472 134
314 3300005844 Ga0068862_100817124 Ga0068862_1008171241 134
315 3300005844 Ga0068862_100919812 Ga0068862_1009198122 134
316 3300005844 Ga0068862_101124499 Ga0068862_1011244992 134
317 3300005844 Ga0068862_101258374 Ga0068862_1012583741 134
318 3300005844 Ga0068862_101392317 Ga0068862_1013923171 134
319 3300005844 Ga0068862_102162917 Ga0068862_1021629172 134
320 3300005937 Ga0081455_10001182 Ga0081455_1000118213 134
321 3300005937 Ga0081455_10002564 Ga0081455_1000256411 134
322 3300005937 Ga0081455_10030415 Ga0081455_100304155 134
323 3300005937 Ga0081455_10043812 Ga0081455_100438124 134
324 3300005937 Ga0081455_10043891 Ga0081455_100438913 134
325 3300005937 Ga0081455_10303224 Ga0081455_103032242 134
326 3300005937 Ga0081455_10399085 Ga0081455_103990851 134
327 3300005981 Ga0081538_10000854 Ga0081538_1000085417 134
328 3300005981 Ga0081538_10013129 Ga0081538_100131292 134
329 3300005981 Ga0081538_10084825 Ga0081538_100848252 134
330 3300005981 Ga0081538_10098196 Ga0081538_100981962 134
331 3300005983 Ga0081540_1005617 Ga0081540_10056174 134
332 3300005983 Ga0081540_1035413 Ga0081540_10354132 134
333 3300005983 Ga0081540_1197296 Ga0081540_11972962 134
334 3300005985 Ga0081539_10001574 Ga0081539_100015742 134
335 3300005985 Ga0081539_10034959 Ga0081539_100349593 134
336 3300005985 Ga0081539_10087478 Ga0081539_100874782 134
337 3300005985 Ga0081539_10344536 Ga0081539_103445361 134
338 3300006038 Ga0075365_10016328 Ga0075365_100163284 134
339 3300006038 Ga0075365_10076256 Ga0075365_100762566 134
340 3300006038 Ga0075365_10097788 Ga0075365_100977883 134
341 3300006038 Ga0075365_10136522 Ga0075365_101365223 134
342 3300006038 Ga0075365_10150703 Ga0075365_101507031 134
343 3300006042 Ga0075368_10003310 Ga0075368_100033104 134
344 3300006042 Ga0075368_10010512 Ga0075368_100105124 134
345 3300006042 Ga0075368_10028944 Ga0075368_100289443 134
346 3300006042 Ga0075368_10053922 Ga0075368_100539222 134
347 3300006042 Ga0075368_10173111 Ga0075368_101731112 134
348 3300006042 Ga0075368_10497162 Ga0075368_104971622 134
349 3300006048 Ga0075363_100002909 Ga0075363_1000029095 134
350 3300006048 Ga0075363_100003593 Ga0075363_1000035931 134
351 3300006048 Ga0075363_100081322 Ga0075363_1000813222 134
352 3300006048 Ga0075363_100086438 Ga0075363_1000864383 134
353 3300006048 Ga0075363_100121899 Ga0075363_1001218992 134
354 3300006051 Ga0075364_10015965 Ga0075364_100159651 134
355 3300006051 Ga0075364_10159291 Ga0075364_101592912 134
356 3300006051 Ga0075364_10266756 Ga0075364_102667562 134
357 3300006051 Ga0075364_10478759 Ga0075364_104787592 134
358 3300006051 Ga0075364_10591690 Ga0075364_105916902 134
359 3300006058 Ga0075432_10052710 Ga0075432_100527103 134
360 3300006163 Ga0070715_10000281 Ga0070715_100002818 134
361 3300006163 Ga0070715_10476391 Ga0070715_104763912 134
362 3300006163 Ga0070715_10914209 Ga0070715_109142091 134
363 3300006173 Ga0070716_100000175 Ga0070716_1000001757 134
364 3300006173 Ga0070716_100557641 Ga0070716_1005576411 134
365 3300006173 Ga0070716_100910993 Ga0070716_1009109932 134
366 3300006175 Ga0070712_100000328 Ga0070712_10000032824 134
367 3300006175 Ga0070712_100073260 Ga0070712_1000732604 134
368 3300006175 Ga0070712_100098776 Ga0070712_1000987762 134
369 3300006177 Ga0075362_10024284 Ga0075362_100242843 134
370 3300006177 Ga0075362_10040674 Ga0075362_100406743 134
371 3300006177 Ga0075362_10128941 Ga0075362_101289413 134
372 3300006178 Ga0075367_10023248 Ga0075367_100232484 134
373 3300006178 Ga0075367_10040605 Ga0075367_100406052 134
374 3300006178 Ga0075367_10051202 Ga0075367_100512022 134
375 3300006178 Ga0075367_10082511 Ga0075367_100825112 134
376 3300006178 Ga0075367_10111561 Ga0075367_101115611 134
377 3300006178 Ga0075367_10314294 Ga0075367_103142942 134
378 3300006178 Ga0075367_10489283 Ga0075367_104892832 134
379 3300006178 Ga0075367_10542181 Ga0075367_105421812 134
380 3300006186 Ga0075369_10021229 Ga0075369_100212292 134
381 3300006186 Ga0075369_10022491 Ga0075369_100224912 134
382 3300006186 Ga0075369_10076671 Ga0075369_100766712 134
383 3300006195 Ga0075366_10042755 Ga0075366_100427552 134
384 3300006237 Ga0097621_100034761 Ga0097621_1000347613 134
385 3300006237 Ga0097621_100327454 Ga0097621_1003274542 134
386 3300006353 Ga0075370_10027368 Ga0075370_100273686 134
387 3300006353 Ga0075370_10050107 Ga0075370_100501072 134
388 3300006353 Ga0075370_10056630 Ga0075370_100566303 134
389 3300006353 Ga0075370_10166573 Ga0075370_101665732 134
390 3300006353 Ga0075370_10252212 Ga0075370_102522122 134
391 3300006353 Ga0075370_10635801 Ga0075370_106358012 134
392 3300006353 Ga0075370_10906456 Ga0075370_109064561 134
393 3300006358 Ga0068871_100023489 Ga0068871_1000234894 134
394 3300006358 Ga0068871_101767777 Ga0068871_1017677771 134
395 3300006844 Ga0075428_100004322 Ga0075428_1000043227 134
396 3300006844 Ga0075428_100016545 Ga0075428_1000165453 134
397 3300006844 Ga0075428_100055073 Ga0075428_1000550733 134
398 3300006844 Ga0075428_100233523 Ga0075428_1002335232 134
399 3300006844 Ga0075428_100238213 Ga0075428_1002382133 134
400 3300006844 Ga0075428_100239643 Ga0075428_1002396432 134
401 3300006844 Ga0075428_100308376 Ga0075428_1003083762 134
402 3300006844 Ga0075428_100409648 Ga0075428_1004096482 134
403 3300006844 Ga0075428_100522615 Ga0075428_1005226151 134
404 3300006844 Ga0075428_101312299 Ga0075428_1013122991 134
405 3300006844 Ga0075428_102162329 Ga0075428_1021623291 134
406 3300006846 Ga0075430_100099479 Ga0075430_1000994792 134
407 3300006846 Ga0075430_100315754 Ga0075430_1003157542 134
408 3300006846 Ga0075430_100356357 Ga0075430_1003563572 134
409 3300006846 Ga0075430_100958991 Ga0075430_1009589912 134
410 3300006847 Ga0075431_100004355 Ga0075431_10000435513 134
411 3300006847 Ga0075431_100005312 Ga0075431_1000053129 134
412 3300006847 Ga0075431_100016376 Ga0075431_1000163762 134
413 3300006847 Ga0075431_100264735 Ga0075431_1002647353 134
414 3300006847 Ga0075431_100916349 Ga0075431_1009163492 134
415 3300006847 Ga0075431_101137963 Ga0075431_1011379632 134
416 3300006847 Ga0075431_101644180 Ga0075431_1016441801 134
417 3300006852 Ga0075433_10051063 Ga0075433_100510633 134
418 3300006852 Ga0075433_10053333 Ga0075433_100533333 134
419 3300006852 Ga0075433_10284501 Ga0075433_102845013 134
420 3300006852 Ga0075433_10315625 Ga0075433_103156253 134
421 3300006871 Ga0075434_100052327 Ga0075434_1000523272 134
422 3300006871 Ga0075434_100585877 Ga0075434_1005858772 134
423 3300006871 Ga0075434_101650010 Ga0075434_1016500102 134
424 3300006880 Ga0075429_100013278 Ga0075429_1000132785 134
425 3300006880 Ga0075429_100247701 Ga0075429_1002477012 134
426 3300006880 Ga0075429_100544996 Ga0075429_1005449962 134
427 3300006880 Ga0075429_100806910 Ga0075429_1008069102 134
428 3300006881 Ga0068865_100002259 Ga0068865_1000022597 134
429 3300006881 Ga0068865_100052231 Ga0068865_1000522313 134
430 3300006881 Ga0068865_100379610 Ga0068865_1003796102 134
431 3300006931 Ga0097620_100105528 Ga0097620_1001055284 134
432 3300006931 Ga0097620_100240870 Ga0097620_1002408703 134
433 3300006931 Ga0097620_100483146 Ga0097620_1004831461 134
434 3300006931 Ga0097620_100493668 Ga0097620_1004936682 134
435 3300006946 Ga0079104_1000185 Ga0079104_10001858 134
436 3300006946 Ga0079104_1000353 Ga0079104_100035311 134
437 3300007076 Ga0075435_100056569 Ga0075435_1000565693 134
438 3300007076 Ga0075435_100095190 Ga0075435_1000951902 134
439 3300007076 Ga0075435_100666740 Ga0075435_1006667401 134
440 3300007265 Ga0099794_10659711 Ga0099794_106597111 134
441 3300007788 Ga0099795_10046084 Ga0099795_100460843 134
442 3300009092 Ga0105250_10024900 Ga0105250_100249002 134
443 3300009093 Ga0105240_10020529 Ga0105240_100205293 134
444 3300009093 Ga0105240_10323184 Ga0105240_103231842 134
445 3300009093 Ga0105240_11942824 Ga0105240_119428241 134
446 3300009094 Ga0111539_10000445 Ga0111539_1000044513 134
447 3300009094 Ga0111539_10008643 Ga0111539_100086435 134
448 3300009094 Ga0111539_10032510 Ga0111539_100325102 134
449 3300009094 Ga0111539_10146093 Ga0111539_101460932 134
450 3300009094 Ga0111539_10149105 Ga0111539_101491052 134
451 3300009094 Ga0111539_10244598 Ga0111539_102445982 134
452 3300009094 Ga0111539_10852175 Ga0111539_108521752 134
453 3300009094 Ga0111539_11210830 Ga0111539_112108301 134
454 3300009094 Ga0111539_12484893 Ga0111539_124848931 134
455 3300009098 Ga0105245_10002842 Ga0105245_100028423 134
456 3300009098 Ga0105245_10088851 Ga0105245_100888514 134
457 3300009098 Ga0105245_10284165 Ga0105245_102841652 134
458 3300009098 Ga0105245_10844111 Ga0105245_108441112 134
459 3300009098 Ga0105245_11104802 Ga0105245_111048021 134
460 3300009098 Ga0105245_12751329 Ga0105245_127513291 134
461 3300009101 Ga0105247_10000149 Ga0105247_1000014950 134
462 3300009101 Ga0105247_10026167 Ga0105247_100261674 134
463 3300009101 Ga0105247_10111436 Ga0105247_101114363 134
464 3300009101 Ga0105247_10116867 Ga0105247_101168672 134
465 3300009101 Ga0105247_10249908 Ga0105247_102499083 134
466 3300009101 Ga0105247_10445919 Ga0105247_104459192 134
467 3300009101 Ga0105247_10950940 Ga0105247_109509401 134
468 3300009147 Ga0114129_10008972 Ga0114129_100089722 134
469 3300009147 Ga0114129_10016344 Ga0114129_100163449 134
470 3300009147 Ga0114129_10128670 Ga0114129_101286702 134
471 3300009147 Ga0114129_10254109 Ga0114129_102541092 134
472 3300009147 Ga0114129_10284266 Ga0114129_102842662 134
473 3300009147 Ga0114129_10417152 Ga0114129_104171522 134
474 3300009147 Ga0114129_10426300 Ga0114129_104263002 134
475 3300009147 Ga0114129_10442908 Ga0114129_104429082 134
476 3300009147 Ga0114129_10539031 Ga0114129_105390311 134
477 3300009147 Ga0114129_12101603 Ga0114129_121016031 134
478 3300009147 Ga0114129_12113672 Ga0114129_121136722 134
479 3300009147 Ga0114129_12655690 Ga0114129_126556901 134
480 3300009148 Ga0105243_10000599 Ga0105243_1000059913 134
481 3300009148 Ga0105243_10128179 Ga0105243_101281793 134
482 3300009148 Ga0105243_10405872 Ga0105243_104058723 134
483 3300009148 Ga0105243_10421770 Ga0105243_104217702 134
484 3300009148 Ga0105243_10529136 Ga0105243_105291363 134
485 3300009148 Ga0105243_10792697 Ga0105243_107926971 134
486 3300009148 Ga0105243_12704115 Ga0105243_127041152 134
487 3300009174 Ga0105241_10002361 Ga0105241_1000236113 134
488 3300009174 Ga0105241_10181440 Ga0105241_101814403 134
489 3300009174 Ga0105241_10586242 Ga0105241_105862422 134
490 3300009174 Ga0105241_10836364 Ga0105241_108363642 134
491 3300009174 Ga0105241_11095849 Ga0105241_110958491 134
492 3300009174 Ga0105241_11346691 Ga0105241_113466912 134
493 3300009174 Ga0105241_11798672 Ga0105241_117986722 134
494 3300009176 Ga0105242_10001949 Ga0105242_100019496 134
495 3300009176 Ga0105242_10161900 Ga0105242_101619003 134
496 3300009176 Ga0105242_11383604 Ga0105242_113836042 134
497 3300009177 Ga0105248_10009531 Ga0105248_100095314 134
498 3300009177 Ga0105248_10590630 Ga0105248_105906302 134
499 3300009177 Ga0105248_10684338 Ga0105248_106843381 134
500 3300009177 Ga0105248_11343240 Ga0105248_113432401 134
501 3300009545 Ga0105237_10001906 Ga0105237_1000190621 134
502 3300009545 Ga0105237_10004796 Ga0105237_100047966 134
503 3300009545 Ga0105237_10053656 Ga0105237_100536567 134
504 3300009545 Ga0105237_10140443 Ga0105237_101404431 134
505 3300009545 Ga0105237_10260723 Ga0105237_102607233 134
506 3300009545 Ga0105237_10962258 Ga0105237_109622582 134
507 3300009551 Ga0105238_10043003 Ga0105238_100430032 134
508 3300009551 Ga0105238_10043272 Ga0105238_100432724 134
509 3300009551 Ga0105238_10103748 Ga0105238_101037483 134
510 3300009551 Ga0105238_10107438 Ga0105238_101074383 134
511 3300009551 Ga0105238_10800209 Ga0105238_108002091 134
512 3300009551 Ga0105238_10868370 Ga0105238_108683702 134
513 3300009551 Ga0105238_11652240 Ga0105238_116522401 134
514 3300009553 Ga0105249_10152381 Ga0105249_101523812 134
515 3300009553 Ga0105249_10236562 Ga0105249_102365623 134
516 3300009553 Ga0105249_10928354 Ga0105249_109283542 134
517 3300009553 Ga0105249_11988307 Ga0105249_119883071 134
518 3300009553 Ga0105249_13561508 Ga0105249_135615081 134
519 3300009765 Ga0123341_1000026 Ga0123341_100002628 134
520 3300009766 Ga0123342_1013897 Ga0123342_10138979 134
521 3300009984 Ga0105029_102828 Ga0105029_1028281 134
522 3300009987 Ga0105030_102461 Ga0105030_1024613 134
523 3300009993 Ga0105028_100754 Ga0105028_1007544 134
524 3300010159 Ga0099796_10096179 Ga0099796_100961792 134
525 3300010375 Ga0105239_10001103 Ga0105239_100011032 134
526 3300010375 Ga0105239_10032834 Ga0105239_100328349 134
527 3300010375 Ga0105239_10071050 Ga0105239_100710502 134
528 3300010375 Ga0105239_10299316 Ga0105239_102993163 134
529 3300010375 Ga0105239_10458221 Ga0105239_104582212 134
530 3300010375 Ga0105239_11817178 Ga0105239_118171782 134
531 3300010375 Ga0105239_12062693 Ga0105239_120626931 134
532 3300010375 Ga0105239_12265175 Ga0105239_122651752 134
533 3300011119 Ga0105246_10000551 Ga0105246_100005513 134
534 3300011119 Ga0105246_10038166 Ga0105246_100381662 134
535 3300011119 Ga0105246_10220497 Ga0105246_102204972 134
536 3300011119 Ga0105246_10754804 Ga0105246_107548042 134
537 3300011119 Ga0105246_11784586 Ga0105246_117845861 134
538 3300011119 Ga0105246_12253111 Ga0105246_122531111 134
539 3300012473 Ga0157340_1005610 Ga0157340_10056102 134
540 3300012475 Ga0157317_1015233 Ga0157317_10152331 134
541 3300012492 Ga0157335_1006305 Ga0157335_10063052 134
542 3300012495 Ga0157323_1009262 Ga0157323_10092622 134
543 3300012513 Ga0157326_1057689 Ga0157326_10576891 134
544 3300013100 Ga0157373_10002184 Ga0157373_100021846 134
545 3300013100 Ga0157373_10121171 Ga0157373_101211715 134
546 3300013102 Ga0157371_10019238 Ga0157371_100192385 134
547 3300013102 Ga0157371_10157860 Ga0157371_101578602 134
548 3300013102 Ga0157371_10229987 Ga0157371_102299871 134
549 3300013104 Ga0157370_10026493 Ga0157370_100264932 134
550 3300013105 Ga0157369_10032038 Ga0157369_100320382 134
551 3300013105 Ga0157369_10061261 Ga0157369_100612612 134
552 3300013105 Ga0157369_10490782 Ga0157369_104907822 134
553 3300013105 Ga0157369_11180726 Ga0157369_111807261 134
554 3300013296 Ga0157374_10022700 Ga0157374_100227005 134
555 3300013296 Ga0157374_10545521 Ga0157374_105455212 134
556 3300013296 Ga0157374_10813613 Ga0157374_108136131 134
557 3300013297 Ga0157378_10000562 Ga0157378_1000056215 134
558 3300013297 Ga0157378_10006236 Ga0157378_100062367 134
559 3300013297 Ga0157378_11039669 Ga0157378_110396691 134
560 3300013297 Ga0157378_13273914 Ga0157378_132739141 134
561 3300013306 Ga0163162_10010813 Ga0163162_100108136 134
562 3300013306 Ga0163162_11282399 Ga0163162_112823991 134
563 3300013306 Ga0163162_11330581 Ga0163162_113305811 134
564 3300013306 Ga0163162_13353961 Ga0163162_133539611 134
565 3300013307 Ga0157372_10001660 Ga0157372_1000166015 134
566 3300013307 Ga0157372_10278053 Ga0157372_102780532 134
567 3300013307 Ga0157372_10313756 Ga0157372_103137562 134
568 3300013307 Ga0157372_10627681 Ga0157372_106276812 134
569 3300013307 Ga0157372_11096922 Ga0157372_110969222 134
570 3300013308 Ga0157375_10010085 Ga0157375_100100854 134
571 3300013308 Ga0157375_10023408 Ga0157375_100234082 134
572 3300013308 Ga0157375_10025986 Ga0157375_100259863 134
573 3300013308 Ga0157375_10422607 Ga0157375_104226072 134
574 3300013308 Ga0157375_12581689 Ga0157375_125816891 134
575 3300014325 Ga0163163_10058906 Ga0163163_100589062 134
576 3300014325 Ga0163163_10091048 Ga0163163_100910482 134
577 3300014325 Ga0163163_10747608 Ga0163163_107476082 134
578 3300014325 Ga0163163_11150267 Ga0163163_111502672 134
579 3300014325 Ga0163163_11235835 Ga0163163_112358351 134
580 3300014325 Ga0163163_11400737 Ga0163163_114007371 134
581 3300014325 Ga0163163_11405372 Ga0163163_114053722 134
582 3300014326 Ga0157380_10002796 Ga0157380_100027963 134
583 3300014326 Ga0157380_10018982 Ga0157380_100189823 134
584 3300014326 Ga0157380_10113274 Ga0157380_101132744 134
585 3300014326 Ga0157380_10279531 Ga0157380_102795311 134
586 3300014326 Ga0157380_10689233 Ga0157380_106892332 134
587 3300014326 Ga0157380_11042057 Ga0157380_110420572 134
588 3300014326 Ga0157380_11194777 Ga0157380_111947771 134
589 3300014497 Ga0182008_10051065 Ga0182008_100510652 134
590 3300014497 Ga0182008_10091566 Ga0182008_100915662 134
591 3300014745 Ga0157377_10002752 Ga0157377_100027522 134
592 3300014968 Ga0157379_10002389 Ga0157379_100023894 134
593 3300014968 Ga0157379_10065378 Ga0157379_100653783 134
594 3300014968 Ga0157379_10202659 Ga0157379_102026592 134
595 3300014968 Ga0157379_10208906 Ga0157379_102089062 134
596 3300014968 Ga0157379_10616880 Ga0157379_106168802 134
597 3300014968 Ga0157379_10676750 Ga0157379_106767501 134
598 3300014968 Ga0157379_10856455 Ga0157379_108564551 134
599 3300014968 Ga0157379_10919432 Ga0157379_109194321 134
600 3300014969 Ga0157376_10000431 Ga0157376_1000043114 134
601 3300014969 Ga0157376_10000924 Ga0157376_100009244 134
602 3300015262 Ga0182007_10051961 Ga0182007_100519612 134
603 3300017792 Ga0163161_10001894 Ga0163161_100018945 134
604 3300017792 Ga0163161_10128791 Ga0163161_101287911 134
605 3300020070 Ga0206356_10357052 Ga0206356_103570522 134
606 3300020082 Ga0206353_10988117 Ga0206353_109881172 134
607 3300021320 Ga0214544_1002722 Ga0214544_100272215 134
608 3300021321 Ga0214542_1000006 Ga0214542_1000006253 134
609 3300021327 Ga0214543_1000003 Ga0214543_1000003636 134
610 3300021327 Ga0214543_1000014 Ga0214543_100001470 134
611 3300021358 Ga0213873_10000537 Ga0213873_100005372 134
612 3300021361 Ga0213872_10005597 Ga0213872_100055974 134
613 3300021377 Ga0213874_10114079 Ga0213874_101140792 134
614 3300021384 Ga0213876_10003346 Ga0213876_100033462 134
615 3300021384 Ga0213876_10013484 Ga0213876_100134844 134
616 3300021388 Ga0213875_10124551 Ga0213875_101245513 134
617 3300021388 Ga0213875_10236941 Ga0213875_102369412 134
618 3300021441 Ga0213871_10027552 Ga0213871_100275522 134
619 3300022739 Ga0228711_1000015 Ga0228711_1000015127 134
620 3300022740 Ga0228710_1000015 Ga0228710_100001522 134
621 3300024227 Ga0228598_1092825 Ga0228598_10928251 134
622 3300025206 Ga0209435_100024 Ga0209435_100024104 134
623 3300025208 Ga0209436_100141 Ga0209436_10014118 134
624 3300025231 Ga0207427_103054 Ga0207427_1030542 134
625 3300025233 Ga0209437_100033 Ga0209437_100033441 134
626 3300025242 Ga0209258_116945 Ga0209258_1169452 134
627 3300025245 Ga0207425_1002787 Ga0207425_10027879 134
628 3300025245 Ga0207425_1003038 Ga0207425_10030382 134
629 3300025245 Ga0207425_1008511 Ga0207425_10085112 134
630 3300025245 Ga0207425_1020020 Ga0207425_10200202 134
631 3300025246 Ga0209646_1000064 Ga0209646_1000064104 134
632 3300025250 Ga0209026_1000024 Ga0209026_10000246 134
633 3300025250 Ga0209026_1000053 Ga0209026_1000053104 134
634 3300025254 Ga0209148_1000636 Ga0209148_100063610 134
635 3300025256 Ga0209759_1000042 Ga0209759_1000042104 134
636 3300025256 Ga0209759_1000057 Ga0209759_1000057104 134
637 3300025258 Ga0209129_1003089 Ga0209129_10030893 134
638 3300025258 Ga0209129_1004073 Ga0209129_10040732 134
639 3300025258 Ga0209129_1004523 Ga0209129_10045235 134
640 3300025261 Ga0209233_1000262 Ga0209233_100026211 134
641 3300025261 Ga0209233_1000983 Ga0209233_10009833 134
642 3300025261 Ga0209233_1072236 Ga0209233_10722362 134
643 3300025272 Ga0209455_1002662 Ga0209455_10026623 134
644 3300025273 Ga0209673_1000429 Ga0209673_100042948 134
645 3300025273 Ga0209673_1002264 Ga0209673_10022648 134
646 3300025273 Ga0209673_1003567 Ga0209673_10035674 134
647 3300025273 Ga0209673_1007109 Ga0209673_10071093 134
648 3300025273 Ga0209673_1034831 Ga0209673_10348312 134
649 3300025273 Ga0209673_1109770 Ga0209673_11097702 134
650 3300025284 Ga0209130_1000006 Ga0209130_1000006365 134
651 3300025284 Ga0209130_1000167 Ga0209130_100016739 134
652 3300025291 Ga0209675_1049273 Ga0209675_10492731 134
653 3300025291 Ga0209675_1053025 Ga0209675_10530252 134
654 3300025292 Ga0209676_1057684 Ga0209676_10576842 134
655 3300025294 Ga0209025_1000077 Ga0209025_100007747 134
656 3300025294 Ga0209025_1000440 Ga0209025_100044037 134
657 3300025294 Ga0209025_1006741 Ga0209025_10067412 134
658 3300025294 Ga0209025_1101625 Ga0209025_11016252 134
659 3300025294 Ga0209025_1170932 Ga0209025_11709321 134
660 3300025295 Ga0209564_1000640 Ga0209564_100064044 134
661 3300025295 Ga0209564_1000652 Ga0209564_100065248 134
662 3300025295 Ga0209564_1002555 Ga0209564_10025559 134
663 3300025295 Ga0209564_1041902 Ga0209564_10419022 134
664 3300025297 Ga0209758_1000239 Ga0209758_100023928 134
665 3300025297 Ga0209758_1000717 Ga0209758_100071743 134
666 3300025297 Ga0209758_1001231 Ga0209758_100123120 134
667 3300025297 Ga0209758_1002395 Ga0209758_100239515 134
668 3300025297 Ga0209758_1002533 Ga0209758_10025335 134
669 3300025297 Ga0209758_1009634 Ga0209758_10096342 134
670 3300025297 Ga0209758_1009763 Ga0209758_10097635 134
671 3300025297 Ga0209758_1010363 Ga0209758_10103634 134
672 3300025298 Ga0209050_1005108 Ga0209050_100510811 134
673 3300025298 Ga0209050_1006425 Ga0209050_10064253 134
674 3300025299 Ga0209256_1001672 Ga0209256_10016726 134
675 3300025299 Ga0209256_1012032 Ga0209256_10120324 134
676 3300025299 Ga0209256_1016818 Ga0209256_10168184 134
677 3300025299 Ga0209256_1034357 Ga0209256_10343572 134
678 3300025302 Ga0207426_1000119 Ga0207426_100011944 134
679 3300025302 Ga0207426_1000231 Ga0207426_100023157 134
680 3300025302 Ga0207426_1000239 Ga0207426_1000239101 134
681 3300025303 Ga0209051_1001893 Ga0209051_10018938 134
682 3300025303 Ga0209051_1009712 Ga0209051_10097122 134
683 3300025303 Ga0209051_1010508 Ga0209051_10105082 134
684 3300025303 Ga0209051_1055446 Ga0209051_10554462 134
685 3300025303 Ga0209051_1084505 Ga0209051_10845052 134
686 3300025303 Ga0209051_1089326 Ga0209051_10893262 134
687 3300025304 Ga0209257_1002840 Ga0209257_100284015 134
688 3300025304 Ga0209257_1003626 Ga0209257_10036268 134
689 3300025304 Ga0209257_1041979 Ga0209257_10419793 134
690 3300025315 Ga0207697_10015917 Ga0207697_100159173 134
691 3300025321 Ga0207656_10060607 Ga0207656_100606071 134
692 3300025711 Ga0207696_1024847 Ga0207696_10248472 134
693 3300025885 Ga0207653_10091147 Ga0207653_100911472 134
694 3300025893 Ga0207682_10114763 Ga0207682_101147633 134
695 3300025898 Ga0207692_10075824 Ga0207692_100758242 134
696 3300025899 Ga0207642_10062563 Ga0207642_100625632 134
697 3300025899 Ga0207642_10096332 Ga0207642_100963322 134
698 3300025900 Ga0207710_10004411 Ga0207710_100044115 134
699 3300025900 Ga0207710_10006878 Ga0207710_100068782 134
700 3300025900 Ga0207710_10051289 Ga0207710_100512892 134
701 3300025901 Ga0207688_10021415 Ga0207688_100214153 134
702 3300025901 Ga0207688_10234459 Ga0207688_102344592 134
703 3300025901 Ga0207688_10567147 Ga0207688_105671472 134
704 3300025901 Ga0207688_10671875 Ga0207688_106718752 134
705 3300025901 Ga0207688_10956123 Ga0207688_109561231 134
706 3300025903 Ga0207680_10006188 Ga0207680_100061885 134
707 3300025903 Ga0207680_10334214 Ga0207680_103342141 134
708 3300025904 Ga0207647_10000860 Ga0207647_1000086026 134
709 3300025904 Ga0207647_10051264 Ga0207647_100512643 134
710 3300025904 Ga0207647_10187860 Ga0207647_101878602 134
711 3300025905 Ga0207685_10000138 Ga0207685_100001386 134
712 3300025905 Ga0207685_10025794 Ga0207685_100257942 134
713 3300025905 Ga0207685_10419336 Ga0207685_104193362 134
714 3300025906 Ga0207699_10002265 Ga0207699_100022655 134
715 3300025907 Ga0207645_10001877 Ga0207645_1000187713 134
716 3300025907 Ga0207645_10298847 Ga0207645_102988472 134
717 3300025907 Ga0207645_10493097 Ga0207645_104930971 134
718 3300025910 Ga0207684_10020270 Ga0207684_100202703 134
719 3300025910 Ga0207684_10253463 Ga0207684_102534633 134
720 3300025910 Ga0207684_10304410 Ga0207684_103044103 134
721 3300025911 Ga0207654_10221736 Ga0207654_102217362 134
722 3300025911 Ga0207654_10601635 Ga0207654_106016352 134
723 3300025911 Ga0207654_11429113 Ga0207654_114291131 134
724 3300025912 Ga0207707_10013646 Ga0207707_100136465 134
725 3300025912 Ga0207707_10174883 Ga0207707_101748833 134
726 3300025913 Ga0207695_10080032 Ga0207695_100800323 134
727 3300025913 Ga0207695_10174922 Ga0207695_101749222 134
728 3300025913 Ga0207695_10293117 Ga0207695_102931172 134
729 3300025914 Ga0207671_10000168 Ga0207671_1000016831 134
730 3300025914 Ga0207671_10079774 Ga0207671_100797742 134
731 3300025914 Ga0207671_10529185 Ga0207671_105291852 134
732 3300025914 Ga0207671_10693874 Ga0207671_106938742 134
733 3300025914 Ga0207671_10727846 Ga0207671_107278462 134
734 3300025915 Ga0207693_10000529 Ga0207693_1000052926 134
735 3300025915 Ga0207693_10044401 Ga0207693_100444013 134
736 3300025916 Ga0207663_10000644 Ga0207663_1000064412 134
737 3300025916 Ga0207663_10403681 Ga0207663_104036812 134
738 3300025916 Ga0207663_11170198 Ga0207663_111701981 134
739 3300025916 Ga0207663_11208345 Ga0207663_112083451 134
740 3300025917 Ga0207660_10009058 Ga0207660_100090585 134
741 3300025918 Ga0207662_10006259 Ga0207662_100062594 134
742 3300025919 Ga0207657_10000034 Ga0207657_1000003477 134
743 3300025919 Ga0207657_10460369 Ga0207657_104603692 134
744 3300025919 Ga0207657_10693413 Ga0207657_106934132 134
745 3300025919 Ga0207657_11127274 Ga0207657_111272741 134
746 3300025920 Ga0207649_10011798 Ga0207649_100117987 134
747 3300025920 Ga0207649_10134641 Ga0207649_101346412 134
748 3300025920 Ga0207649_10392238 Ga0207649_103922381 134
749 3300025920 Ga0207649_10460093 Ga0207649_104600932 134
750 3300025920 Ga0207649_10628496 Ga0207649_106284961 134
751 3300025921 Ga0207652_10574364 Ga0207652_105743642 134
752 3300025921 Ga0207652_11125747 Ga0207652_111257472 134
753 3300025922 Ga0207646_10171311 Ga0207646_101713112 134
754 3300025922 Ga0207646_10475132 Ga0207646_104751322 134
755 3300025923 Ga0207681_10002140 Ga0207681_1000214012 134
756 3300025923 Ga0207681_10129422 Ga0207681_101294222 134
757 3300025923 Ga0207681_10318373 Ga0207681_103183731 134
758 3300025924 Ga0207694_10043477 Ga0207694_100434772 134
759 3300025924 Ga0207694_10089016 Ga0207694_100890162 134
760 3300025924 Ga0207694_10099887 Ga0207694_100998872 134
761 3300025924 Ga0207694_10120504 Ga0207694_101205043 134
762 3300025924 Ga0207694_10361424 Ga0207694_103614242 134
763 3300025924 Ga0207694_10374573 Ga0207694_103745732 134
764 3300025925 Ga0207650_10006785 Ga0207650_100067856 134
765 3300025926 Ga0207659_10083082 Ga0207659_100830822 134
766 3300025926 Ga0207659_10288875 Ga0207659_102888752 134
767 3300025927 Ga0207687_10003044 Ga0207687_100030442 134
768 3300025927 Ga0207687_10266171 Ga0207687_102661712 134
769 3300025927 Ga0207687_10364349 Ga0207687_103643492 134
770 3300025927 Ga0207687_11047489 Ga0207687_110474892 134
771 3300025928 Ga0207700_10060723 Ga0207700_100607231 134
772 3300025928 Ga0207700_10248934 Ga0207700_102489342 134
773 3300025929 Ga0207664_10002200 Ga0207664_100022004 134
774 3300025929 Ga0207664_10433158 Ga0207664_104331582 134
775 3300025929 Ga0207664_10541173 Ga0207664_105411732 134
776 3300025929 Ga0207664_10811266 Ga0207664_108112662 134
777 3300025931 Ga0207644_10003446 Ga0207644_100034469 134
778 3300025932 Ga0207690_10000053 Ga0207690_1000005395 134
779 3300025932 Ga0207690_10170305 Ga0207690_101703052 134
780 3300025932 Ga0207690_10856718 Ga0207690_108567182 134
781 3300025932 Ga0207690_10921998 Ga0207690_109219982 134
782 3300025932 Ga0207690_11274016 Ga0207690_112740161 134
783 3300025933 Ga0207706_10000076 Ga0207706_1000007676 134
784 3300025933 Ga0207706_10541497 Ga0207706_105414972 134
785 3300025933 Ga0207706_10742453 Ga0207706_107424531 134
786 3300025933 Ga0207706_10833592 Ga0207706_108335921 134
787 3300025934 Ga0207686_10038878 Ga0207686_100388783 134
788 3300025935 Ga0207709_10006904 Ga0207709_100069042 134
789 3300025935 Ga0207709_10085876 Ga0207709_100858762 134
790 3300025935 Ga0207709_10092768 Ga0207709_100927683 134
791 3300025935 Ga0207709_10628079 Ga0207709_106280792 134
792 3300025935 Ga0207709_11357948 Ga0207709_113579481 134
793 3300025935 Ga0207709_11512264 Ga0207709_115122642 134
794 3300025936 Ga0207670_10218658 Ga0207670_102186582 134
795 3300025937 Ga0207669_10080154 Ga0207669_100801542 134
796 3300025937 Ga0207669_10268345 Ga0207669_102683451 134
797 3300025937 Ga0207669_10338009 Ga0207669_103380092 134
798 3300025938 Ga0207704_10011920 Ga0207704_100119202 134
799 3300025938 Ga0207704_10159751 Ga0207704_101597512 134
800 3300025938 Ga0207704_10171183 Ga0207704_101711832 134
801 3300025938 Ga0207704_10333965 Ga0207704_103339652 134
802 3300025939 Ga0207665_10000911 Ga0207665_100009116 134
803 3300025940 Ga0207691_10001503 Ga0207691_100015035 134
804 3300025940 Ga0207691_10170940 Ga0207691_101709402 134
805 3300025940 Ga0207691_10441710 Ga0207691_104417102 134
806 3300025940 Ga0207691_10577986 Ga0207691_105779863 134
807 3300025940 Ga0207691_11219689 Ga0207691_112196892 134
808 3300025941 Ga0207711_10063574 Ga0207711_100635742 134
809 3300025941 Ga0207711_10221358 Ga0207711_102213582 134
810 3300025941 Ga0207711_10911747 Ga0207711_109117472 134
811 3300025942 Ga0207689_10066767 Ga0207689_100667672 134
812 3300025942 Ga0207689_10295284 Ga0207689_102952842 134
813 3300025944 Ga0207661_10774004 Ga0207661_107740041 134
814 3300025945 Ga0207679_10002471 Ga0207679_100024712 134
815 3300025949 Ga0207667_10006980 Ga0207667_1000698013 134
816 3300025949 Ga0207667_10021802 Ga0207667_100218022 134
817 3300025949 Ga0207667_10110607 Ga0207667_101106073 134
818 3300025949 Ga0207667_11255486 Ga0207667_112554861 134
819 3300025960 Ga0207651_10001023 Ga0207651_1000102312 134
820 3300025960 Ga0207651_10924687 Ga0207651_109246871 134
821 3300025961 Ga0207712_10063637 Ga0207712_100636372 134
822 3300025961 Ga0207712_10075087 Ga0207712_100750872 134
823 3300025961 Ga0207712_10158719 Ga0207712_101587192 134
824 3300025972 Ga0207668_10000608 Ga0207668_100006084 134
825 3300025972 Ga0207668_10107250 Ga0207668_101072502 134
826 3300025972 Ga0207668_10130699 Ga0207668_101306991 134
827 3300025972 Ga0207668_10134257 Ga0207668_101342573 134
828 3300025972 Ga0207668_10524385 Ga0207668_105243852 134
829 3300025972 Ga0207668_11044594 Ga0207668_110445941 134
830 3300025972 Ga0207668_11358729 Ga0207668_113587291 134
831 3300025981 Ga0207640_10028940 Ga0207640_100289402 134
832 3300025981 Ga0207640_10058081 Ga0207640_100580812 134
833 3300025981 Ga0207640_10197430 Ga0207640_101974302 134
834 3300025981 Ga0207640_10221007 Ga0207640_102210072 134
835 3300025981 Ga0207640_10332807 Ga0207640_103328072 134
836 3300025986 Ga0207658_10002570 Ga0207658_1000257011 134
837 3300025986 Ga0207658_10674948 Ga0207658_106749481 134
838 3300026023 Ga0207677_10021947 Ga0207677_100219471 134
839 3300026023 Ga0207677_10356755 Ga0207677_103567552 134
840 3300026023 Ga0207677_10560129 Ga0207677_105601292 134
841 3300026023 Ga0207677_10682606 Ga0207677_106826062 134
842 3300026035 Ga0207703_10011879 Ga0207703_100118796 134
843 3300026035 Ga0207703_10107765 Ga0207703_101077652 134
844 3300026035 Ga0207703_10156666 Ga0207703_101566662 134
845 3300026035 Ga0207703_10228636 Ga0207703_102286362 134
846 3300026035 Ga0207703_11183360 Ga0207703_111833602 134
847 3300026041 Ga0207639_10018434 Ga0207639_100184348 134
848 3300026041 Ga0207639_10104254 Ga0207639_101042542 134
849 3300026041 Ga0207639_10131200 Ga0207639_101312003 134
850 3300026041 Ga0207639_10152647 Ga0207639_101526472 134
851 3300026041 Ga0207639_10790749 Ga0207639_107907492 134
852 3300026067 Ga0207678_10000036 Ga0207678_1000003626 134
853 3300026067 Ga0207678_10994797 Ga0207678_109947972 134
854 3300026067 Ga0207678_11094689 Ga0207678_110946892 134
855 3300026075 Ga0207708_10027653 Ga0207708_100276531 134
856 3300026075 Ga0207708_10157797 Ga0207708_101577972 134
857 3300026075 Ga0207708_10178883 Ga0207708_101788831 134
858 3300026075 Ga0207708_10408059 Ga0207708_104080592 134
859 3300026075 Ga0207708_10422291 Ga0207708_104222912 134
860 3300026075 Ga0207708_10911220 Ga0207708_109112202 134
861 3300026078 Ga0207702_10123895 Ga0207702_101238952 134
862 3300026078 Ga0207702_10609028 Ga0207702_106090282 134
863 3300026078 Ga0207702_12239168 Ga0207702_122391681 134
864 3300026089 Ga0207648_10048718 Ga0207648_100487182 134
865 3300026089 Ga0207648_10166544 Ga0207648_101665442 134
866 3300026089 Ga0207648_10271261 Ga0207648_102712613 134
867 3300026095 Ga0207676_10104953 Ga0207676_101049532 134
868 3300026095 Ga0207676_10950359 Ga0207676_109503592 134
869 3300026116 Ga0207674_10006679 Ga0207674_100066796 134
870 3300026116 Ga0207674_10164554 Ga0207674_101645543 134
871 3300026118 Ga0207675_100000970 Ga0207675_1000009708 134
872 3300026118 Ga0207675_100057278 Ga0207675_1000572783 134
873 3300026118 Ga0207675_100067662 Ga0207675_1000676624 134
874 3300026118 Ga0207675_100070419 Ga0207675_1000704192 134
875 3300026118 Ga0207675_100251380 Ga0207675_1002513802 134
876 3300026121 Ga0207683_10000015 Ga0207683_10000015102 134
877 3300026121 Ga0207683_10121226 Ga0207683_101212263 134
878 3300026121 Ga0207683_10273725 Ga0207683_102737252 134
879 3300026121 Ga0207683_11399963 Ga0207683_113999631 134
880 3300026142 Ga0207698_10014923 Ga0207698_100149232 134
881 3300026142 Ga0207698_10033333 Ga0207698_100333334 134
882 3300026142 Ga0207698_10048186 Ga0207698_100481862 134
883 3300026142 Ga0207698_11639245 Ga0207698_116392451 134
884 3300026142 Ga0207698_11931934 Ga0207698_119319342 134
885 3300027111 Ga0209281_1000211 Ga0209281_100021140 134
886 3300027111 Ga0209281_1000339 Ga0209281_100033911 134
887 3300027666 Ga0209282_1000022 Ga0209282_100002260 134
888 3300027717 Ga0209998_10004998 Ga0209998_100049984 134
889 3300027717 Ga0209998_10068743 Ga0209998_100687432 134
890 3300027866 Ga0209813_10000485 Ga0209813_100004858 134
891 3300027866 Ga0209813_10011873 Ga0209813_100118733 134
892 3300027866 Ga0209813_10022129 Ga0209813_100221292 134
893 3300027866 Ga0209813_10096322 Ga0209813_100963222 134
894 3300027866 Ga0209813_10285739 Ga0209813_102857391 134
895 3300027876 Ga0209974_10135044 Ga0209974_101350442 134
896 3300027876 Ga0209974_10315918 Ga0209974_103159181 134
897 3300027907 Ga0207428_10000242 Ga0207428_1000024258 134
898 3300027907 Ga0207428_10009524 Ga0207428_100095246 134
899 3300027907 Ga0207428_10047529 Ga0207428_100475292 134
900 3300027907 Ga0207428_10053128 Ga0207428_100531282 134
901 3300027907 Ga0207428_10055600 Ga0207428_100556004 134
902 3300027907 Ga0207428_10155648 Ga0207428_101556482 134
903 3300028379 Ga0268266_10000691 Ga0268266_100006913 134
904 3300028379 Ga0268266_10012981 Ga0268266_100129812 134
905 3300028379 Ga0268266_10175048 Ga0268266_101750483 134
906 3300028379 Ga0268266_10720511 Ga0268266_107205112 134
907 3300028379 Ga0268266_11383133 Ga0268266_113831331 134
908 3300028380 Ga0268265_10014961 Ga0268265_100149612 134
909 3300028380 Ga0268265_10030568 Ga0268265_100305683 134
910 3300028380 Ga0268265_12329449 Ga0268265_123294492 134
911 3300028380 Ga0268265_12684840 Ga0268265_126848401 134
912 3300028381 Ga0268264_10011840 Ga0268264_100118403 134
913 3300028381 Ga0268264_10406113 Ga0268264_104061132 134
914 3300028381 Ga0268264_10434852 Ga0268264_104348522 134
915 3300028381 Ga0268264_11046090 Ga0268264_110460902 134
916 3300028381 Ga0268264_11601848 Ga0268264_116018482 134
917 3300028577 Ga0265318_10009830 Ga0265318_100098302 134
918 3300028786 Ga0307517_10159381 Ga0307517_101593813 134
919 3300028794 Ga0307515_10053381 Ga0307515_100533814 134
920 3300028800 Ga0265338_10635806 Ga0265338_106358062 134
921 3300029276 Ga0311004_122382 Ga0311004_1223821 134
922 3300030878 Ga0265770_1100144 Ga0265770_11001442 134
923 3300031090 Ga0265760_10085058 Ga0265760_100850582 134
924 3300031235 Ga0265330_10006199 Ga0265330_100061993 134
925 3300031238 Ga0265332_10088414 Ga0265332_100884141 134
926 3300031239 Ga0265328_10000857 Ga0265328_100008573 134
927 3300031239 Ga0265328_10004107 Ga0265328_100041073 134
928 3300031239 Ga0265328_10450642 Ga0265328_104506421 134
929 3300031240 Ga0265320_10196465 Ga0265320_101964651 134
930 3300031241 Ga0265325_10004328 Ga0265325_100043285 134
931 3300031241 Ga0265325_10011278 Ga0265325_100112785 134
932 3300031241 Ga0265325_10051774 Ga0265325_100517742 134
933 3300031247 Ga0265340_10043927 Ga0265340_100439273 134
934 3300031247 Ga0265340_10148605 Ga0265340_101486052 134
935 3300031249 Ga0265339_10000227 Ga0265339_1000022739 134
936 3300031249 Ga0265339_10296403 Ga0265339_102964032 134
937 3300031249 Ga0265339_10340507 Ga0265339_103405071 134
938 3300031250 Ga0265331_10001698 Ga0265331_1000169810 134
939 3300031250 Ga0265331_10029097 Ga0265331_100290974 134
940 3300031250 Ga0265331_10465863 Ga0265331_104658632 134
941 3300031251 Ga0265327_10144604 Ga0265327_101446042 134
942 3300031344 Ga0265316_10007778 Ga0265316_100077787 134
943 3300031344 Ga0265316_10388872 Ga0265316_103888722 134
944 3300031344 Ga0265316_10526059 Ga0265316_105260592 134
945 3300031456 Ga0307513_10044628 Ga0307513_100446282 134
946 3300031456 Ga0307513_10072369 Ga0307513_100723696 134
947 3300031456 Ga0307513_10253688 Ga0307513_102536883 134
948 3300031548 Ga0307408_100207502 Ga0307408_1002075023 134
949 3300031548 Ga0307408_102122107 Ga0307408_1021221072 134
950 3300031595 Ga0265313_10000048 Ga0265313_1000004845 134
951 3300031595 Ga0265313_10000607 Ga0265313_1000060723 134
952 3300031595 Ga0265313_10001237 Ga0265313_1000123721 134
953 3300031616 Ga0307508_10064654 Ga0307508_100646542 134
954 3300031616 Ga0307508_10611589 Ga0307508_106115892 134
955 3300031649 Ga0307514_10488764 Ga0307514_104887642 134
956 3300031691 Ga0316579_10000126 Ga0316579_1000012615 134
957 3300031711 Ga0265314_10008887 Ga0265314_100088876 134
958 3300031711 Ga0265314_10022804 Ga0265314_100228044 134
959 3300031711 Ga0265314_10055166 Ga0265314_100551662 134
960 3300031712 Ga0265342_10009957 Ga0265342_100099575 134
961 3300031712 Ga0265342_10047556 Ga0265342_100475564 134
962 3300031712 Ga0265342_10492266 Ga0265342_104922661 134
963 3300031727 Ga0316576_10031837 Ga0316576_100318372 134
964 3300031727 Ga0316576_10176960 Ga0316576_101769602 134
965 3300031728 Ga0316578_10146890 Ga0316578_101468902 134
966 3300031728 Ga0316578_10248293 Ga0316578_102482931 134
967 3300031728 Ga0316578_10490161 Ga0316578_104901611 134
968 3300031730 Ga0307516_10408343 Ga0307516_104083432 134
969 3300031730 Ga0307516_10487964 Ga0307516_104879642 134
970 3300031731 Ga0307405_10633707 Ga0307405_106337072 134
971 3300031731 Ga0307405_11268507 Ga0307405_112685071 134
972 3300031733 Ga0316577_10105005 Ga0316577_101050051 134
973 3300031852 Ga0307410_10138584 Ga0307410_101385841 134
974 3300031852 Ga0307410_11155700 Ga0307410_111557002 134
975 3300031901 Ga0307406_10470476 Ga0307406_104704762 134
976 3300031903 Ga0307407_10299071 Ga0307407_102990712 134
977 3300031903 Ga0307407_10446336 Ga0307407_104463362 134
978 3300031903 Ga0307407_11054780 Ga0307407_110547802 134
979 3300031911 Ga0307412_10158793 Ga0307412_101587932 134
980 3300031911 Ga0307412_10527409 Ga0307412_105274091 134
981 3300031967 Ga0315914_1000013 Ga0315914_1000013126 134
982 3300031995 Ga0307409_100365238 Ga0307409_1003652382 134
983 3300031995 Ga0307409_101442176 Ga0307409_1014421762 134
984 3300031995 Ga0307409_101888993 Ga0307409_1018889931 134
985 3300031995 Ga0307409_102738865 Ga0307409_1027388651 134
986 3300031995 Ga0307409_102801707 Ga0307409_1028017071 134
987 3300032002 Ga0307416_100595504 Ga0307416_1005955042 134
988 3300032002 Ga0307416_101527359 Ga0307416_1015273591 134
989 3300032002 Ga0307416_103468031 Ga0307416_1034680311 134
990 3300032004 Ga0307414_10503852 Ga0307414_105038522 134
991 3300032004 Ga0307414_10617963 Ga0307414_106179632 134
992 3300032005 Ga0307411_11022358 Ga0307411_110223581 134
993 3300032126 Ga0307415_100763298 Ga0307415_1007632981 134
994 3300032126 Ga0307415_102075695 Ga0307415_1020756951 134
995 3300032133 Ga0316583_10090938 Ga0316583_100909383 134
996 3300032133 Ga0316583_10103839 Ga0316583_101038393 134
997 3300032133 Ga0316583_10275044 Ga0316583_102750442 134
998 3300032137 Ga0316585_10007690 Ga0316585_100076902 134
999 3300032139 Ga0316580_10018351 Ga0316580_100183512 134
1000 3300033180 Ga0307510_10051946 Ga0307510_100519463 134
1001 3300033430 Ga0315913_1000029 Ga0315913_100002912 134
1002 3300033464 Ga0315915_1000001 Ga0315915_1000001126 134
1003 3300033541 Ga0316596_1035763 Ga0316596_10357632 134
1004 3300034816 Ga0373930_0031227 Ga0373930_0031227_456_860 134
1005 3300034818 Ga0373950_0078259 Ga0373950_0078259_61_465 134
1006 3300034819 Ga0373958_0013233 Ga0373958_0013233_651_1055 134
1007 3300034819 Ga0373958_0024168 Ga0373958_0024168_359_787 134
1008 3300034819 Ga0373958_0056348 Ga0373958_0056348_63_467 134
1009 3300034820 Ga0373959_0016613 Ga0373959_0016613_768_1172 134
1010 3300034820 Ga0373959_0019346 Ga0373959_0019346_581_985 134
1011 3300034820 Ga0373959_0089746 Ga0373959_0089746_134_538 134
1012 3300034957 Ga0373938_0003577 Ga0373938_0003577_350_754 134
1013 3300035083 Ga0373926_0126760 Ga0373926_0126760_65_469 134
1014 3300035085 Ga0373929_0019784 Ga0373929_0019784_517_921 134
1015 3300035085 Ga0373929_0074071 Ga0373929_0074071_84_488 134
1016 3300035086 Ga0373934_0123886 Ga0373934_0123886_13_417 134
1017 3300035088 Ga0373940_0095917 Ga0373940_0095917_446_850 134
1018 3300035089 Ga0373944_0001172 Ga0373944_0001172_3532_3936 134
1019 3300035089 Ga0373944_0149636 Ga0373944_0149636_313_717 134
1020 3300035090 Ga0373949_0079583 Ga0373949_0079583_300_704 134
1021 3300035090 Ga0373949_0099077 Ga0373949_0099077_189_593 134
1022 3300035091 Ga0373951_0076772 Ga0373951_0076772_244_648 134
1023 3300035111 Ga0373923_0054182 Ga0373923_0054182_1190_1594 134
1024 3300035111 Ga0373923_0669708 Ga0373923_0669708_62_466 134
1025 3300035113 Ga0373936_0051208 Ga0373936_0051208_352_756 134
1026 3300035114 Ga0373939_0004920 Ga0373939_0004920_585_989 134
1027 3300035114 Ga0373939_0174791 Ga0373939_0174791_187_591 134
1028 3300035115 Ga0373941_0004775 Ga0373941_0004775_2210_2614 134
1029 3300035115 Ga0373941_0005194 Ga0373941_0005194_123_527 134
1030 3300035115 Ga0373941_0010139 Ga0373941_0010139_241_645 134
1031 3300035116 Ga0373945_0002545 Ga0373945_0002545_4247_4651 134
1032 3300035116 Ga0373945_0005532 Ga0373945_0005532_2365_2769 134
1033 3300035116 Ga0373945_0101293 Ga0373945_0101293_292_696 134
1034 3300035118 Ga0373954_0390787 Ga0373954_0390787_111_515 134
1035 3300035119 Ga0373956_0268986 Ga0373956_0268986_232_636 134
1036 3300035119 Ga0373956_0345126 Ga0373956_0345126_168_572 134
1037 3300035121 Ga0373960_0002540 Ga0373960_0002540_1765_2169 134
1038 3300035121 Ga0373960_0007369 Ga0373960_0007369_609_1013 134
1039 3300035170 Ga0373943_0000440 Ga0373943_0000440_9890_10294 134
1040 3300035170 Ga0373943_0007823 Ga0373943_0007823_2495_2899 134
1041 3300035170 Ga0373943_0104281 Ga0373943_0104281_503_907 134
1042 3300035171 Ga0373946_0001659 Ga0373946_0001659_408_812 134
1043 3300035171 Ga0373946_0074628 Ga0373946_0074628_902_1306 134
1044 3300035171 Ga0373946_0652186 Ga0373946_0652186_98_526 134
1045 3300035172 Ga0373955_0272678 Ga0373955_0272678_269_673 134
1046 3300035207 Ga0373942_0007897 Ga0373942_0007897_107_511 134
1047 3300035241 Ga0373961_0126347 Ga0373961_0126347_10_414 134
1048 3300035242 Ga0373962_0002597 Ga0373962_0002597_2381_2785 134
1049 3300035242 Ga0373962_0003296 Ga0373962_0003296_468_872 134
1050 3300035398 Ga0316574_0067039 Ga0316574_0067039_1483_1887 134
1051 3300035398 Ga0316574_0439981 Ga0316574_0439981_113_565 134
1052 3300035398 Ga0316574_0463497 Ga0316574_0463497_123_527 134
1053 3300035691 Ga0373931_0001417 Ga0373931_0001417_4694_5098 134
1054 3300035691 Ga0373931_0004196 Ga0373931_0004196_5151_5555 134
1055 3300035691 Ga0373931_0005369 Ga0373931_0005369_5005_5409 134
1056 3300035691 Ga0373931_0036833 Ga0373931_0036833_1260_1688 134
1057 3300035692 Ga0373935_0016068 Ga0373935_0016068_590_994 134
1058 3300035692 Ga0373935_0109564 Ga0373935_0109564_1283_1687 134
1059 3300035692 Ga0373935_0332934 Ga0373935_0332934_597_1025 134
1060 3300035692 Ga0373935_0511675 Ga0373935_0511675_288_692 134
1061 3300035695 Ga0373927_0000562 Ga0373927_0000562_17233_17661 134
1062 3300035695 Ga0373927_0000829 Ga0373927_0000829_9115_9519 134
1063 3300035695 Ga0373927_0006747 Ga0373927_0006747_5212_5616 134
1064 3300035695 Ga0373927_0034231 Ga0373927_0034231_579_983 134
1065 3300035695 Ga0373927_0113054 Ga0373927_0113054_1194_1598 134
1066 3300035695 Ga0373927_0156494 Ga0373927_0156494_802_1206 134
1067 3300035695 Ga0373927_0483992 Ga0373927_0483992_261_665 134
1068 3300035724 Ga0373933_0975343 Ga0373933_0975343_106_510 134
1069 3300035725 Ga0373947_0000393 Ga0373947_0000393_13456_13860 134
1070 3300035725 Ga0373947_0001108 Ga0373947_0001108_9692_10096 134
1071 3300035725 Ga0373947_0007372 Ga0373947_0007372_5785_6189 134
1072 3300035725 Ga0373947_0258074 Ga0373947_0258074_279_707 134
1073 3300035725 Ga0373947_0481981 Ga0373947_0481981_57_461 134
1074 3300035725 Ga0373947_0899409 Ga0373947_0899409_11_415 134
1075 3300036401 Ga0373937_0094013 Ga0373937_0094013_700_1104 134
1076 3300036401 Ga0373937_0099414 Ga0373937_0099414_1816_2220 134
1077 3300036401 Ga0373937_0102727 Ga0373937_0102727_681_1085 134
1078 3300036401 Ga0373937_1447099 Ga0373937_1447099_210_614 134
1079 3300036647 Ga0316582_0024934 Ga0316582_0024934_1292_1696 134
1080 3300036647 Ga0316582_0308770 Ga0316582_0308770_175_579 134
1081 3300036647 Ga0316582_0525241 Ga0316582_0525241_317_721 134
1082 3300036647 Ga0316582_1243242 Ga0316582_1243242_23_427 134
1083 3300036712 Ga0316584_0009124 Ga0316584_0009124_2324_2728 134
1084 3300036712 Ga0316584_0104040 Ga0316584_0104040_1024_1428 134
1085 3300036712 Ga0316584_0214478 Ga0316584_0214478_558_962 134
1086 3300037068 Ga0373925_0001485 Ga0373925_0001485_14151_14579 134
1087 3300037068 Ga0373925_0002574 Ga0373925_0002574_7343_7747 134
1088 3300037068 Ga0373925_0014355 Ga0373925_0014355_3027_3431 134
1089 3300037068 Ga0373925_0014423 Ga0373925_0014423_121_525 134
1090 3300037068 Ga0373925_0076835 Ga0373925_0076835_935_1339 134
1091 3300037068 Ga0373925_0901473 Ga0373925_0901473_31_456 134
1092 3300037068 Ga0373925_1288436 Ga0373925_1288436_59_463 134
1093 3300037312 Ga0395899_0030159 Ga0395899_0030159_3214_3618 134
1094 3300037312 Ga0395899_0041052 Ga0395899_0041052_176_601 134
1095 3300037312 Ga0395899_0133699 Ga0395899_0133699_1327_1752 134
1096 3300037312 Ga0395899_0217771 Ga0395899_0217771_663_1067 134
1097 3300037418 Ga0395900_0115352 Ga0395900_0115352_1938_2342 134
1098 3300037418 Ga0395900_0230184 Ga0395900_0230184_804_1208 134
1099 3300037418 Ga0395900_0485875 Ga0395900_0485875_679_1083 134
1100 3300037418 Ga0395900_0509309 Ga0395900_0509309_294_698 134
1101 3300037418 Ga0395900_0512723 Ga0395900_0512723_199_603 134
1102 3300037418 Ga0395900_0694616 Ga0395900_0694616_108_512 134
1103 3300037466 Ga0395898_0022566 Ga0395898_0022566_2835_3260 134
1104 3300037466 Ga0395898_0031756 Ga0395898_0031756_4218_4622 134
1105 3300037466 Ga0395898_0143125 Ga0395898_0143125_962_1366 134
1106 3300037466 Ga0395898_0584713 Ga0395898_0584713_504_908 134
1107 3300037471 Ga0395905_0005926 Ga0395905_0005926_4772_5176 134
1108 3300037471 Ga0395905_0032619 Ga0395905_0032619_2596_3000 134
1109 3300037471 Ga0395905_0045429 Ga0395905_0045429_571_975 134
1110 3300037471 Ga0395905_0053839 Ga0395905_0053839_787_1191 134
1111 3300037471 Ga0395905_0241604 Ga0395905_0241604_151_555 134
1112 3300037471 Ga0395905_0369742 Ga0395905_0369742_649_1053 134
1113 3300037588 Ga0316581_0003368 Ga0316581_0003368_2530_2934 134
1114 3300037853 Ga0436364_0238815 Ga0436364_0238815_531_935 134
1115 3300037853 Ga0436364_0427356 Ga0436364_0427356_568_972 134
1116 3300038443 Ga0395901_0024589 Ga0395901_0024589_1839_2243 134
1117 3300038443 Ga0395901_0047962 Ga0395901_0047962_3516_3920 134
1118 3300038443 Ga0395901_0048965 Ga0395901_0048965_2801_3226 134
1119 3300038443 Ga0395901_0204059 Ga0395901_0204059_683_1108 134
1120 3300038443 Ga0395901_1419732 Ga0395901_1419732_200_604 134
1121 3300038996 Ga0242420_024573 Ga0242420_024573_382_786 134
1122 3300039062 Ga0400483_051690 Ga0400483_051690_312_716 134
1123 3300039062 Ga0400483_055590 Ga0400483_055590_5704_6108 134
1124 3300039062 Ga0400483_085880 Ga0400483_085880_4796_5200 134
1125 3300039062 Ga0400483_096277 Ga0400483_096277_8741_9145 134
1126 3300039062 Ga0400483_140153 Ga0400483_140153_835_1239 134
1127 3300039062 Ga0400483_143898 Ga0400483_143898_811_1215 134
1128 3300039062 Ga0400483_149418 Ga0400483_149418_5281_5685 134
1129 3300039062 Ga0400483_172225 Ga0400483_172225_647_1051 134
1130 3300039062 Ga0400483_193528 Ga0400483_193528_3305_3709 134
1131 3300039062 Ga0400483_205198 Ga0400483_205198_548_952 134
1132 3300039062 Ga0400483_215482 Ga0400483_215482_243_647 134
1133 3300039437 Ga0436365_0043842 Ga0436365_0043842_1801_2205 134
1134 3300039437 Ga0436365_0267511 Ga0436365_0267511_561_965 134
1135 3300039437 Ga0436365_0400394 Ga0436365_0400394_12906_13310 134
1136 3300039437 Ga0436365_0624892 Ga0436365_0624892_1473_1877 134
1137 3300039437 Ga0436365_1848951 Ga0436365_1848951_241_645 134
1138 3300039438 Ga0436360_0015239 Ga0436360_0015239_365_769 134
1139 3300039438 Ga0436360_0040714 Ga0436360_0040714_3207_3611 134
1140 3300039438 Ga0436360_0057493 Ga0436360_0057493_88_492 134
1141 3300039438 Ga0436360_0086335 Ga0436360_0086335_6135_6539 134
1142 3300039438 Ga0436360_0316578 Ga0436360_0316578_33_437 134
1143 3300039438 Ga0436360_0490276 Ga0436360_0490276_245_649 134
1144 3300039438 Ga0436360_0612852 Ga0436360_0612852_256_660 134
1145 3300039438 Ga0436360_0812615 Ga0436360_0812615_148_552 134
1146 3300039438 Ga0436360_0814801 Ga0436360_0814801_375_779 134
1147 3300039447 Ga0436361_0099990 Ga0436361_0099990_7071_7550 134
1148 3300039447 Ga0436361_0210285 Ga0436361_0210285_1334_1738 134
1149 3300039447 Ga0436361_0300922 Ga0436361_0300922_7169_7573 134
1150 3300039447 Ga0436361_0657878 Ga0436361_0657878_191_595 134
1151 3300039447 Ga0436361_1066632 Ga0436361_1066632_126_530 134
1152 3300039450 Ga0436363_0400424 Ga0436363_0400424_81_485 134
1153 3300039450 Ga0436363_0812754 Ga0436363_0812754_476_880 134
1154 3300039450 Ga0436363_1542246 Ga0436363_1542246_428_832 134
1155 3300039453 Ga0436362_0050792 Ga0436362_0050792_92_496 134
1156 3300039453 Ga0436362_0501340 Ga0436362_0501340_1209_1613 134
1157 3300039453 Ga0436362_0516986 Ga0436362_0516986_6493_6897 134
1158 3300039453 Ga0436362_0593870 Ga0436362_0593870_111_515 134
1159 3300039453 Ga0436362_0648250 Ga0436362_0648250_36_440 134
1160 3300039453 Ga0436362_0792407 Ga0436362_0792407_137_541 134
1161 3300039453 Ga0436362_0884606 Ga0436362_0884606_41_445 134
1162 3300041406 Ga0439439_0103696 Ga0439439_0103696_136_540 134
1163 3300041410 Ga0439461_0063450 Ga0439461_0063450_303_707 134
1164 3300041413 Ga0439465_0024789 Ga0439465_0024789_263_667 134
1165 3300041413 Ga0439465_0050852 Ga0439465_0050852_409_813 134
1166 3300041413 Ga0439465_0054272 Ga0439465_0054272_235_642 134
1167 3300041413 Ga0439465_0083973 Ga0439465_0083973_70_474 134
1168 3300041413 Ga0439465_0120013 Ga0439465_0120013_463_867 134
1169 3300041413 Ga0439465_0133750 Ga0439465_0133750_394_798 134
1170 3300041443 Ga0451789_1093110 Ga0451789_1093110_117_521 134
1171 3300041451 Ga0451791_1668163 Ga0451791_1668163_1114_1518 134
1172 3300041452 Ga0451793_1500337 Ga0451793_1500337_20_424 134
1173 3300041453 Ga0451797_1242257 Ga0451797_1242257_71_475 134
1174 3300041458 Ga0451798_1036039 Ga0451798_1036039_17_421 134
1175 3300041486 Ga0451807_2301569 Ga0451807_2301569_130_534 134
1176 3300041486 Ga0451807_2746414 Ga0451807_2746414_80_484 134
1177 3300041491 Ga0451833_0558942 Ga0451833_0558942_1114_1518 134
1178 3300041492 Ga0451835_0472559 Ga0451835_0472559_121_525 134
1179 3300041492 Ga0451835_1252488 Ga0451835_1252488_395_799 134
1180 3300041494 Ga0451837_0693458 Ga0451837_0693458_681_1085 134
1181 3300041494 Ga0451837_0938409 Ga0451837_0938409_315_719 134
1182 3300041496 Ga0451839_0355707 Ga0451839_0355707_1140_1544 134
1183 3300041498 Ga0451841_0129944 Ga0451841_0129944_473_877 134
1184 3300041501 Ga0451845_0879080 Ga0451845_0879080_1365_1769 134
1185 3300041502 Ga0451846_68409 Ga0451846_68409_56_460 134
1186 3300041503 Ga0451847_0045439 Ga0451847_0045439_672_1076 134
1187 3300041505 Ga0451849_0166291 Ga0451849_0166291_346_750 134
1188 3300041505 Ga0451849_0215730 Ga0451849_0215730_229_633 134
1189 3300041505 Ga0451849_0512093 Ga0451849_0512093_612_1016 134
1190 3300041507 Ga0451851_0025352 Ga0451851_0025352_87_491 134
1191 3300041507 Ga0451851_0308930 Ga0451851_0308930_747_1151 134
1192 3300041509 Ga0451843_0582198 Ga0451843_0582198_59_463 134
1193 3300041509 Ga0451843_1304907 Ga0451843_1304907_189_593 134
1194 3300041511 Ga0451855_0255463 Ga0451855_0255463_686_1090 134
1195 3300041512 Ga0451853_2315567 Ga0451853_2315567_685_1089 134
1196 3300041997 Ga0439431_0014282 Ga0439431_0014282_738_1142 134
1197 3300042003 Ga0439443_094579 Ga0439443_094579_16_420 134
1198 3300042005 Ga0439448_0161973 Ga0439448_0161973_131_535 134
1199 3300042006 Ga0439432_221444 Ga0439432_221444_14_418 134
1200 3300042007 Ga0439449_0034994 Ga0439449_0034994_722_1126 134
1201 3300042010 Ga0439452_104580 Ga0439452_104580_82_486 134
1202 3300042013 Ga0439456_055819 Ga0439456_055819_163_567 134
1203 3300042127 Ga0450890_039473 Ga0450890_039473_195_599 134
1204 3300042144 Ga0450889_052768 Ga0450889_052768_68_472 134
1205 3300042436 Ga0439435_0265069 Ga0439435_0265069_114_518 134
1206 3300042876 Ga0451577_0041379 Ga0451577_0041379_3131_3535 134
1207 3300044656 Ga0466969_0387552 Ga0466969_0387552_215_619 134
1208 3300044658 Ga0466972_0118518 Ga0466972_0118518_566_970 134
1209 3300044673 Ga0453683_0049820 Ga0453683_0049820_827_1231 134
1210 3300044673 Ga0453683_0351179 Ga0453683_0351179_504_908 134
1211 3300044683 Ga0466965_0029669 Ga0466965_0029669_361_765 134
1212 3300044683 Ga0466965_0340240 Ga0466965_0340240_198_602 134
1213 3300044683 Ga0466965_0674251 Ga0466965_0674251_175_579 134
1214 3300044684 Ga0466966_0024456 Ga0466966_0024456_465_869 134
1215 3300044684 Ga0466966_0146346 Ga0466966_0146346_346_750 134
1216 3300044693 Ga0466961_0160940 Ga0466961_0160940_453_857 134
1217 3300044694 Ga0466963_0034785 Ga0466963_0034785_324_728 134
1218 3300044694 Ga0466963_0110603 Ga0466963_0110603_373_777 134
1219 3300044712 Ga0453684_0152017 Ga0453684_0152017_2254_2658 134
1220 3300044712 Ga0453684_0234847 Ga0453684_0234847_1235_1639 134
1221 3300044712 Ga0453684_0350709 Ga0453684_0350709_855_1259 134
1222 3300044719 Ga0466971_0154069 Ga0466971_0154069_365_775 134
1223 3300044735 Ga0466968_0041262 Ga0466968_0041262_568_972 134
1224 3300044735 Ga0466968_0084838 Ga0466968_0084838_442_846 134
1225 3300044735 Ga0466968_0285025 Ga0466968_0285025_366_770 134
1226 3300044765 Ga0466970_0065659 Ga0466970_0065659_119_523 134
1227 3300044842 Ga0466957_0125868 Ga0466957_0125868_1189_1593 134
1228 3300044901 Ga0466960_0083264 Ga0466960_0083264_768_1172 134
1229 3300044901 Ga0466960_0292673 Ga0466960_0292673_345_749 134
1230 3300045049 Ga0466959_0010929 Ga0466959_0010929_332_736 134
1231 3300045049 Ga0466959_0084076 Ga0466959_0084076_1789_2193 134
1232 3300045049 Ga0466959_0368828 Ga0466959_0368828_459_863 134
1233 3300045051 Ga0451576_0000030 Ga0451576_0000030_70097_70501 134
1234 3300045051 Ga0451576_0001017 Ga0451576_0001017_41810_42214 134
1235 3300045051 Ga0451576_0008714 Ga0451576_0008714_8673_9077 134
1236 3300045051 Ga0451576_0278561 Ga0451576_0278561_537_941 134
1237 3300045051 Ga0451576_0335889 Ga0451576_0335889_225_629 134
1238 3300045051 Ga0451576_0594875 Ga0451576_0594875_331_735 134
1239 3300045836 Ga0466958_0069809 Ga0466958_0069809_372_776 134
1240 3300045976 Ga0466967_0224330 Ga0466967_0224330_98_502 134
1241 3300046454 Ga0495592_0250713 Ga0495592_0250713_509_913 134
1242 3300046454 Ga0495592_0566008 Ga0495592_0566008_151_555 134
1243 3300046455 Ga0495603_0004283 Ga0495603_0004283_2920_3324 134
1244 3300046459 Ga0495629_0001030 Ga0495629_0001030_13769_14173 134
1245 3300046459 Ga0495629_0069551 Ga0495629_0069551_1278_1682 134
1246 3300046460 Ga0495638_0001797 Ga0495638_0001797_11406_11810 134
1247 3300046460 Ga0495638_0007099 Ga0495638_0007099_129_533 134
1248 3300046460 Ga0495638_0205951 Ga0495638_0205951_331_735 134
1249 3300046460 Ga0495638_0335855 Ga0495638_0335855_116_520 134
1250 3300046461 Ga0495641_0017447 Ga0495641_0017447_1777_2181 134
1251 3300046463 Ga0495653_0040896 Ga0495653_0040896_1678_2082 134
1252 3300046471 Ga0495650_0208987 Ga0495650_0208987_138_542 134
1253 3300046472 Ga0495580_0006656 Ga0495580_0006656_139_543 134
1254 3300046472 Ga0495580_0086933 Ga0495580_0086933_648_1052 134
1255 3300046473 Ga0495582_0016780 Ga0495582_0016780_3190_3594 134
1256 3300046474 Ga0495605_0008287 Ga0495605_0008287_4134_4538 134
1257 3300046475 Ga0495639_0003363 Ga0495639_0003363_2954_3358 134
1258 3300046475 Ga0495639_0011594 Ga0495639_0011594_354_758 134
1259 3300046476 Ga0495662_0096201 Ga0495662_0096201_776_1180 134
1260 3300046477 Ga0495664_0000147 Ga0495664_0000147_14584_14988 134
1261 3300046491 Ga0495584_0053571 Ga0495584_0053571_1483_1911 134
1262 3300046491 Ga0495584_0107339 Ga0495584_0107339_988_1392 134
1263 3300046491 Ga0495584_0148851 Ga0495584_0148851_761_1165 134
1264 3300046492 Ga0495585_0068419 Ga0495585_0068419_231_635 134
1265 3300046492 Ga0495585_0108212 Ga0495585_0108212_966_1370 134
1266 3300046492 Ga0495585_0216113 Ga0495585_0216113_246_650 134
1267 3300046492 Ga0495585_0218198 Ga0495585_0218198_542_946 134
1268 3300046499 Ga0495594_0000660 Ga0495594_0000660_16435_16839 134
1269 3300046500 Ga0495596_0057571 Ga0495596_0057571_998_1402 134
1270 3300046501 Ga0495607_0052002 Ga0495607_0052002_1082_1486 134
1271 3300046506 Ga0495583_0054847 Ga0495583_0054847_223_627 134
1272 3300046506 Ga0495583_0094804 Ga0495583_0094804_140_544 134
1273 3300046506 Ga0495583_0127069 Ga0495583_0127069_210_638 134
1274 3300046506 Ga0495583_0135111 Ga0495583_0135111_423_827 134
1275 3300046506 Ga0495583_0290170 Ga0495583_0290170_195_602 134
1276 3300046507 Ga0495606_0326325 Ga0495606_0326325_124_528 134
1277 3300046511 Ga0495608_0220638 Ga0495608_0220638_262_666 134
1278 3300046512 Ga0495610_0089211 Ga0495610_0089211_288_692 134
1279 3300046512 Ga0495610_0104268 Ga0495610_0104268_274_678 134
1280 3300046512 Ga0495610_0225192 Ga0495610_0225192_277_681 134
1281 3300046513 Ga0495616_0046683 Ga0495616_0046683_440_844 134
1282 3300046513 Ga0495616_0120625 Ga0495616_0120625_420_824 134
1283 3300046513 Ga0495616_0299784 Ga0495616_0299784_217_645 134
1284 3300046514 Ga0495618_0001877 Ga0495618_0001877_7183_7587 134
1285 3300046515 Ga0495620_0002806 Ga0495620_0002806_6692_7096 134
1286 3300046515 Ga0495620_0086606 Ga0495620_0086606_258_662 134
1287 3300046516 Ga0495628_0636587 Ga0495628_0636587_48_452 134
1288 3300046517 Ga0495630_0001952 Ga0495630_0001952_3188_3592 134
1289 3300046517 Ga0495630_0078397 Ga0495630_0078397_1496_1900 134
1290 3300046517 Ga0495630_0129575 Ga0495630_0129575_1104_1508 134
1291 3300046518 Ga0495631_0006319 Ga0495631_0006319_4427_4831 134
1292 3300046518 Ga0495631_0276020 Ga0495631_0276020_207_611 134
1293 3300046519 Ga0495632_0151394 Ga0495632_0151394_198_602 134
1294 3300046520 Ga0495637_0080956 Ga0495637_0080956_716_1120 134
1295 3300046522 Ga0495643_0109273 Ga0495643_0109273_285_692 134
1296 3300046522 Ga0495643_0112730 Ga0495643_0112730_715_1119 134
1297 3300046525 Ga0495663_0116251 Ga0495663_0116251_447_851 134
1298 3300046526 Ga0495666_0040366 Ga0495666_0040366_554_958 134
1299 3300046526 Ga0495666_0073453 Ga0495666_0073453_867_1271 134
1300 3300046530 Ga0495654_0092815 Ga0495654_0092815_388_792 134
1301 3300046530 Ga0495654_0181198 Ga0495654_0181198_340_744 134
1302 3300046531 Ga0495665_0004329 Ga0495665_0004329_721_1125 134
1303 3300046531 Ga0495665_0040986 Ga0495665_0040986_983_1387 134
1304 3300046531 Ga0495665_0109214 Ga0495665_0109214_52_456 134
1305 3300046531 Ga0495665_0150869 Ga0495665_0150869_661_1065 134
1306 3300046533 Ga0495640_0003988 Ga0495640_0003988_6332_6736 134
1307 3300046535 Ga0495586_0355181 Ga0495586_0355181_194_598 134
1308 3300046542 Ga0495597_0138999 Ga0495597_0138999_81_485 134
1309 3300046542 Ga0495597_0190243 Ga0495597_0190243_210_614 134
1310 3300046542 Ga0495597_0234043 Ga0495597_0234043_190_597 134
1311 3300046543 Ga0495645_0000695 Ga0495645_0000695_18631_19035 134
1312 3300046543 Ga0495645_0513057 Ga0495645_0513057_303_707 134
1313 3300046557 Ga0495622_0002880 Ga0495622_0002880_706_1110 134
1314 3300046558 Ga0495633_0266486 Ga0495633_0266486_274_678 134
1315 3300046558 Ga0495633_0319697 Ga0495633_0319697_127_531 134
1316 3300046615 Ga0495656_0036972 Ga0495656_0036972_1217_1621 134
1317 3300046616 Ga0495668_0018046 Ga0495668_0018046_2453_2857 134
1318 3300046616 Ga0495668_0242178 Ga0495668_0242178_299_703 134
1319 3300046616 Ga0495668_0515027 Ga0495668_0515027_143_547 134
1320 3300046616 Ga0495668_0532221 Ga0495668_0532221_182_619 134
1321 3300046642 Ga0495634_0003638 Ga0495634_0003638_7108_7512 134
1322 3300046642 Ga0495634_0005213 Ga0495634_0005213_8877_9281 134
1323 3300046642 Ga0495634_0011117 Ga0495634_0011117_2200_2604 134
1324 3300046642 Ga0495634_0020760 Ga0495634_0020760_2620_3024 134
1325 3300046648 Ga0495611_0323810 Ga0495611_0323810_54_458 134
1326 3300046660 Ga0495625_0024959 Ga0495625_0024959_2891_3295 134
1327 3300046660 Ga0495625_0207719 Ga0495625_0207719_114_518 134
1328 3300046660 Ga0495625_0244859 Ga0495625_0244859_136_570 134
1329 3300046660 Ga0495625_0404460 Ga0495625_0404460_214_618 134
1330 3300046660 Ga0495625_0499913 Ga0495625_0499913_28_432 134
1331 3300046663 Ga0495635_0001303 Ga0495635_0001303_6310_6714 134
1332 3300046663 Ga0495635_0555637 Ga0495635_0555637_99_503 134
1333 3300046665 Ga0495661_0299117 Ga0495661_0299117_55_459 134
1334 3300046674 Ga0495588_0001375 Ga0495588_0001375_7016_7420 134
1335 3300046680 Ga0495646_0303451 Ga0495646_0303451_273_677 134
1336 3300046681 Ga0495647_0004526 Ga0495647_0004526_2438_2842 134
1337 3300046681 Ga0495647_0168852 Ga0495647_0168852_530_934 134
1338 3300046683 Ga0495658_0000377 Ga0495658_0000377_9991_10395 134
1339 3300046683 Ga0495658_0503620 Ga0495658_0503620_86_490 134
1340 3300046689 Ga0495613_0000450 Ga0495613_0000450_22146_22550 134
1341 3300046689 Ga0495613_0085828 Ga0495613_0085828_1516_1920 134
1342 3300046689 Ga0495613_0565641 Ga0495613_0565641_139_543 134
1343 3300046689 Ga0495613_0640722 Ga0495613_0640722_196_600 134
1344 3300046689 Ga0495613_0779332 Ga0495613_0779332_172_576 134
1345 3300046690 Ga0495624_0006170 Ga0495624_0006170_537_941 134
1346 3300046690 Ga0495624_0010938 Ga0495624_0010938_2561_2965 134
1347 3300046691 Ga0495670_0103565 Ga0495670_0103565_100_504 134
1348 3300046692 Ga0495671_0257173 Ga0495671_0257173_72_476 134
1349 3300046692 Ga0495671_0282121 Ga0495671_0282121_165_569 134
1350 3300046694 Ga0495649_0081466 Ga0495649_0081466_86_493 134
1351 3300046810 Ga0495660_0065857 Ga0495660_0065857_520_924 134
1352 3300046810 Ga0495660_0199487 Ga0495660_0199487_269_673 134
1353 3300047315 Ga0495581_0003417 Ga0495581_0003417_4066_4470 134
1354 3300047315 Ga0495581_0079122 Ga0495581_0079122_1113_1517 134
1355 3300047317 Ga0495604_0735565 Ga0495604_0735565_100_504 134
1356 3300047318 Ga0495636_0044798 Ga0495636_0044798_309_713 134
1357 3300047319 Ga0495674_0002888 Ga0495674_0002888_11227_11631 134
1358 3300047319 Ga0495674_0104893 Ga0495674_0104893_1852_2256 134
1359 3300047320 Ga0495672_0096666 Ga0495672_0096666_191_595 134
1360 3300047321 Ga0495676_0006720 Ga0495676_0006720_103_507 134
1361 3300047321 Ga0495676_0037574 Ga0495676_0037574_1574_1978 134
1362 3300047321 Ga0495676_0323828 Ga0495676_0323828_328_732 134
1363 3300047322 Ga0495680_0126808 Ga0495680_0126808_453_857 134
1364 3300047322 Ga0495680_0584803 Ga0495680_0584803_19_423 134
1365 3300047443 Ga0495687_095892 Ga0495687_095892_531_935 134
1366 3300047471 Ga0495684_0002109 Ga0495684_0002109_5772_6176 134
1367 3300047471 Ga0495684_0003387 Ga0495684_0003387_4837_5241 134
1368 3300047471 Ga0495684_0015482 Ga0495684_0015482_4469_4873 134
1369 3300047471 Ga0495684_0241938 Ga0495684_0241938_889_1293 134
1370 3300047472 Ga0495686_0116407 Ga0495686_0116407_1139_1543 134
1371 3300047673 Ga0495593_0000407 Ga0495593_0000407_2850_3254 134
1372 3300047673 Ga0495593_0179157 Ga0495593_0179157_468_872 134
1373 3300048089 Ga0495614_0157759 Ga0495614_0157759_32_436 134
1374 3300048090 Ga0495615_0086040 Ga0495615_0086040_227_631 134
1375 3300048091 Ga0495626_0176554 Ga0495626_0176554_205_612 134
1376 3300048903 Ga0496100_0002344 Ga0496100_0002344_655_1059 134
1377 3300048903 Ga0496100_0002927 Ga0496100_0002927_7529_7933 134
1378 3300048903 Ga0496100_0041666 Ga0496100_0041666_2416_2820 134
1379 3300048903 Ga0496100_0087441 Ga0496100_0087441_152_580 134
1380 3300048903 Ga0496100_0462093 Ga0496100_0462093_174_578 134
1381 3300048903 Ga0496100_0677734 Ga0496100_0677734_153_557 134
1382 3300048903 Ga0496100_0726434 Ga0496100_0726434_223_627 134
1383 3300048904 Ga0496101_0029248 Ga0496101_0029248_1048_1452 134
1384 3300048904 Ga0496101_0085171 Ga0496101_0085171_813_1217 134
1385 3300048904 Ga0496101_0372611 Ga0496101_0372611_270_674 134
1386 3300048904 Ga0496101_0625165 Ga0496101_0625165_435_839 134
1387 3300048905 Ga0496102_0036200 Ga0496102_0036200_3237_3641 134
1388 3300048905 Ga0496102_0067965 Ga0496102_0067965_255_659 134
1389 3300048905 Ga0496102_0093568 Ga0496102_0093568_1827_2255 134
1390 3300048905 Ga0496102_0108193 Ga0496102_0108193_538_942 134
1391 3300048905 Ga0496102_0169136 Ga0496102_0169136_824_1228 134
1392 3300048905 Ga0496102_0457749 Ga0496102_0457749_391_795 134
1393 3300048905 Ga0496102_1298214 Ga0496102_1298214_156_560 134
1394 3300048905 Ga0496102_1928153 Ga0496102_1928153_91_495 134
1395 3300048906 Ga0496103_0001834 Ga0496103_0001834_10100_10504 134
1396 3300048906 Ga0496103_0084842 Ga0496103_0084842_1252_1656 134
1397 3300048906 Ga0496103_0238225 Ga0496103_0238225_166_594 134
1398 3300048906 Ga0496103_0329821 Ga0496103_0329821_512_916 134
1399 3300048907 Ga0496104_0001746 Ga0496104_0001746_12319_12723 134
1400 3300048907 Ga0496104_0003293 Ga0496104_0003293_3434_3838 134
1401 3300048907 Ga0496104_0004254 Ga0496104_0004254_5305_5709 134
1402 3300048907 Ga0496104_0017688 Ga0496104_0017688_2294_2698 134
1403 3300048907 Ga0496104_0244880 Ga0496104_0244880_841_1245 134
1404 3300048907 Ga0496104_0523125 Ga0496104_0523125_182_586 134
1405 3300048907 Ga0496104_0757856 Ga0496104_0757856_62_466 134
1406 3300048908 Ga0496105_0008306 Ga0496105_0008306_562_966 134
1407 3300048908 Ga0496105_0013460 Ga0496105_0013460_1491_1895 134
1408 3300048908 Ga0496105_0045927 Ga0496105_0045927_2309_2713 134
1409 3300048908 Ga0496105_0165549 Ga0496105_0165549_924_1328 134
1410 3300048908 Ga0496105_0191026 Ga0496105_0191026_1076_1480 134
1411 3300048909 Ga0496106_0003888 Ga0496106_0003888_10531_10935 134
1412 3300048909 Ga0496106_0028735 Ga0496106_0028735_866_1270 134
1413 3300048909 Ga0496106_0037152 Ga0496106_0037152_623_1030 134
1414 3300048909 Ga0496106_0113418 Ga0496106_0113418_30_434 134
1415 3300048909 Ga0496106_0131832 Ga0496106_0131832_694_1098 134
1416 3300048909 Ga0496106_0197757 Ga0496106_0197757_201_629 134
1417 3300048909 Ga0496106_0365071 Ga0496106_0365071_405_809 134
1418 3300048909 Ga0496106_0645185 Ga0496106_0645185_385_789 134
1419 3300048910 Ga0496107_0014539 Ga0496107_0014539_3487_3891 134
1420 3300048910 Ga0496107_0197106 Ga0496107_0197106_330_758 134
1421 3300048910 Ga0496107_0256430 Ga0496107_0256430_21_425 134
1422 3300048910 Ga0496107_0591761 Ga0496107_0591761_238_642 134
1423 3300048910 Ga0496107_0976578 Ga0496107_0976578_77_481 134
1424 3300048911 Ga0496108_0002374 Ga0496108_0002374_7424_7828 134
1425 3300048911 Ga0496108_0055545 Ga0496108_0055545_1950_2354 134
1426 3300048911 Ga0496108_0378244 Ga0496108_0378244_361_765 134
1427 3300048911 Ga0496108_0461068 Ga0496108_0461068_130_558 134
1428 3300048912 Ga0496109_0007103 Ga0496109_0007103_931_1335 134
1429 3300048912 Ga0496109_0016146 Ga0496109_0016146_4946_5350 134
1430 3300048912 Ga0496109_0032220 Ga0496109_0032220_210_614 134
1431 3300048912 Ga0496109_0032225 Ga0496109_0032225_3206_3610 134
1432 3300048912 Ga0496109_0132067 Ga0496109_0132067_1908_2312 134
1433 3300048912 Ga0496109_0132488 Ga0496109_0132488_303_707 134
1434 3300048912 Ga0496109_0878669 Ga0496109_0878669_58_462 134
1435 3300048913 Ga0496110_0003203 Ga0496110_0003203_783_1187 134
1436 3300048913 Ga0496110_0035239 Ga0496110_0035239_2787_3215 134
1437 3300048913 Ga0496110_0042196 Ga0496110_0042196_1176_1580 134
1438 3300048913 Ga0496110_0209650 Ga0496110_0209650_362_766 134
1439 3300048913 Ga0496110_0329050 Ga0496110_0329050_846_1250 134
1440 3300048913 Ga0496110_0657663 Ga0496110_0657663_388_792 134
1441 3300048913 Ga0496110_0822440 Ga0496110_0822440_269_673 134
1442 3300048914 Ga0496111_0011401 Ga0496111_0011401_185_589 134
1443 3300048914 Ga0496111_0096361 Ga0496111_0096361_1753_2160 134
1444 3300048914 Ga0496111_0162709 Ga0496111_0162709_580_984 134
1445 3300048915 Ga0496112_0024936 Ga0496112_0024936_271_675 134
1446 3300048915 Ga0496112_0114129 Ga0496112_0114129_1341_1745 134
1447 3300048915 Ga0496112_0181227 Ga0496112_0181227_870_1274 134
1448 3300048915 Ga0496112_0252099 Ga0496112_0252099_855_1259 134
1449 3300048915 Ga0496112_0417700 Ga0496112_0417700_672_1076 134
1450 3300048915 Ga0496112_0610637 Ga0496112_0610637_28_432 134
1451 3300048915 Ga0496112_0745814 Ga0496112_0745814_459_863 134
1452 3300048915 Ga0496112_1757327 Ga0496112_1757327_118_522 134
1453 3300048916 Ga0496113_0024278 Ga0496113_0024278_2204_2608 134
1454 3300048916 Ga0496113_0024776 Ga0496113_0024776_3127_3531 134
1455 3300048916 Ga0496113_0108292 Ga0496113_0108292_276_680 134
1456 3300048916 Ga0496113_0203089 Ga0496113_0203089_1048_1452 134
1457 3300048916 Ga0496113_0247005 Ga0496113_0247005_144_548 134
1458 3300048916 Ga0496113_1499120 Ga0496113_1499120_33_437 134
1459 3300048917 Ga0496114_0004157 Ga0496114_0004157_5717_6121 134
1460 3300048917 Ga0496114_0090844 Ga0496114_0090844_2123_2527 134
1461 3300048917 Ga0496114_0269680 Ga0496114_0269680_682_1086 134
1462 3300048917 Ga0496114_0886526 Ga0496114_0886526_31_459 134
1463 3300048917 Ga0496114_0892333 Ga0496114_0892333_311_715 134
1464 3300048918 Ga0496115_0007483 Ga0496115_0007483_6795_7199 134
1465 3300048918 Ga0496115_0041928 Ga0496115_0041928_2145_2549 134
1466 3300048918 Ga0496115_0123044 Ga0496115_0123044_836_1240 134
1467 3300048918 Ga0496115_0182414 Ga0496115_0182414_115_519 134
1468 3300048918 Ga0496115_0321003 Ga0496115_0321003_328_732 134
1469 3300048918 Ga0496115_0647315 Ga0496115_0647315_236_640 134
1470 3300048918 Ga0496115_0754358 Ga0496115_0754358_156_560 134
1471 3300048918 Ga0496115_0950879 Ga0496115_0950879_162_566 134
1472 3300048919 Ga0496116_0062167 Ga0496116_0062167_64_471 134
1473 3300048919 Ga0496116_0479950 Ga0496116_0479950_15_419 134
1474 3300048920 Ga0496117_0071883 Ga0496117_0071883_731_1138 134
1475 3300048920 Ga0496117_0121756 Ga0496117_0121756_259_663 134
1476 3300048920 Ga0496117_0360183 Ga0496117_0360183_221_625 134
1477 3300048921 Ga0496118_0021327 Ga0496118_0021327_4197_4601 134
1478 3300048922 Ga0496119_0006731 Ga0496119_0006731_9148_9552 134
1479 3300048922 Ga0496119_0014390 Ga0496119_0014390_1175_1579 134
1480 3300048923 Ga0496120_0003776 Ga0496120_0003776_9187_9591 134
1481 3300048923 Ga0496120_0054682 Ga0496120_0054682_559_963 134
1482 3300048924 Ga0496121_0024992 Ga0496121_0024992_5068_5472 134
1483 3300048924 Ga0496121_0060947 Ga0496121_0060947_2112_2516 134
1484 3300048924 Ga0496121_0165786 Ga0496121_0165786_42_449 134
1485 3300048924 Ga0496121_0241639 Ga0496121_0241639_472_876 134
1486 3300048924 Ga0496121_0270860 Ga0496121_0270860_594_998 134
1487 3300048924 Ga0496121_0447834 Ga0496121_0447834_232_636 134
1488 3300048924 Ga0496121_0484174 Ga0496121_0484174_178_585 134
1489 3300048924 Ga0496121_0536852 Ga0496121_0536852_12_416 134
1490 3300048924 Ga0496121_0639215 Ga0496121_0639215_194_598 134
1491 3300048925 Ga0496122_0000042 Ga0496122_0000042_234559_234963 134
1492 3300048925 Ga0496122_0077865 Ga0496122_0077865_569_973 134
1493 3300048925 Ga0496122_0119204 Ga0496122_0119204_45_452 134
1494 3300048925 Ga0496122_0137344 Ga0496122_0137344_684_1088 134
1495 3300048925 Ga0496122_0169047 Ga0496122_0169047_339_743 134
1496 3300048926 Ga0496123_0000030 Ga0496123_0000030_56797_57201 134
1497 3300048926 Ga0496123_0074427 Ga0496123_0074427_1644_2048 134
1498 3300048926 Ga0496123_0080937 Ga0496123_0080937_342_749 134
1499 3300048926 Ga0496123_0183543 Ga0496123_0183543_80_484 134
1500 3300048927 Ga0496124_0052783 Ga0496124_0052783_1350_1754 134
1501 3300048927 Ga0496124_0141690 Ga0496124_0141690_246_653 134
1502 3300048927 Ga0496124_0262244 Ga0496124_0262244_821_1225 134
1503 3300048927 Ga0496124_0399639 Ga0496124_0399639_73_477 134
1504 3300048928 Ga0496125_0041776 Ga0496125_0041776_1112_1519 134
1505 3300048928 Ga0496125_0100032 Ga0496125_0100032_1283_1696 134
1506 3300048928 Ga0496125_0577658 Ga0496125_0577658_36_440 134
1507 3300048929 Ga0496126_0084839 Ga0496126_0084839_572_976 134
1508 3300049459 Ga0495678_023772 Ga0495678_023772_944_1348 134
1509 3300049460 Ga0495682_0055206 Ga0495682_0055206_658_1062 134
1510 3300049568 Ga0501031_0000019 Ga0501031_0000019_35507_35911 134
1511 3300049568 Ga0501031_0026639 Ga0501031_0026639_1023_1427 134
1512 3300049568 Ga0501031_0068905 Ga0501031_0068905_731_1135 134
1513 3300049568 Ga0501031_0079937 Ga0501031_0079937_1018_1443 134
1514 3300049568 Ga0501031_0083626 Ga0501031_0083626_1151_1555 134
1515 3300049568 Ga0501031_0118889 Ga0501031_0118889_1252_1656 134
1516 3300049568 Ga0501031_0158498 Ga0501031_0158498_1028_1432 134
1517 3300049568 Ga0501031_0169482 Ga0501031_0169482_710_1114 134
1518 3300049568 Ga0501031_0423900 Ga0501031_0423900_64_468 134
1519 3300049568 Ga0501031_0491700 Ga0501031_0491700_84_488 134
1520 3300049568 Ga0501031_0645534 Ga0501031_0645534_168_572 134
1521 3300049568 Ga0501031_0695679 Ga0501031_0695679_112_516 134
1522 3300049568 Ga0501031_0902162 Ga0501031_0902162_82_507 134
1523 3300049569 Ga0501032_0000009 Ga0501032_0000009_92077_92481 134
1524 3300049569 Ga0501032_0000133 Ga0501032_0000133_53279_53683 134
1525 3300049569 Ga0501032_0005157 Ga0501032_0005157_8774_9178 134
1526 3300049569 Ga0501032_0017717 Ga0501032_0017717_822_1226 134
1527 3300049569 Ga0501032_0033886 Ga0501032_0033886_2650_3054 134
1528 3300049569 Ga0501032_0050429 Ga0501032_0050429_1781_2206 134
1529 3300049569 Ga0501032_0060297 Ga0501032_0060297_695_1099 134
1530 3300049569 Ga0501032_0075072 Ga0501032_0075072_432_836 134
1531 3300049569 Ga0501032_0128007 Ga0501032_0128007_880_1305 134
1532 3300049569 Ga0501032_0250133 Ga0501032_0250133_86_490 134
1533 3300049569 Ga0501032_0261444 Ga0501032_0261444_313_717 134
1534 3300049569 Ga0501032_0657420 Ga0501032_0657420_88_492 134
1535 3300049569 Ga0501032_0892993 Ga0501032_0892993_79_483 134
1536 3300049569 Ga0501032_0925992 Ga0501032_0925992_35_439 134
1537 3300049570 Ga0501033_0000019 Ga0501033_0000019_135627_136031 134
1538 3300049570 Ga0501033_0000744 Ga0501033_0000744_16042_16446 134
1539 3300049570 Ga0501033_0010281 Ga0501033_0010281_5177_5581 134
1540 3300049570 Ga0501033_0011783 Ga0501033_0011783_34_459 134
1541 3300049570 Ga0501033_0011941 Ga0501033_0011941_2321_2725 134
1542 3300049570 Ga0501033_0012332 Ga0501033_0012332_1326_1730 134
1543 3300049570 Ga0501033_0023529 Ga0501033_0023529_2121_2525 134
1544 3300049570 Ga0501033_0029914 Ga0501033_0029914_788_1192 134
1545 3300049570 Ga0501033_0041595 Ga0501033_0041595_2441_2866 134
1546 3300049570 Ga0501033_0047494 Ga0501033_0047494_981_1385 134
1547 3300049570 Ga0501033_0052722 Ga0501033_0052722_2291_2695 134
1548 3300049570 Ga0501033_0059463 Ga0501033_0059463_59_463 134
1549 3300049570 Ga0501033_0146219 Ga0501033_0146219_603_1007 134
1550 3300049571 Ga0501034_0000044 Ga0501034_0000044_92077_92481 134
1551 3300049571 Ga0501034_0000064 Ga0501034_0000064_52229_52633 134
1552 3300049571 Ga0501034_0000160 Ga0501034_0000160_111432_111836 134
1553 3300049571 Ga0501034_0000538 Ga0501034_0000538_28640_29044 134
1554 3300049571 Ga0501034_0008123 Ga0501034_0008123_982_1407 134
1555 3300049571 Ga0501034_0050945 Ga0501034_0050945_503_994 134
1556 3300049571 Ga0501034_0113684 Ga0501034_0113684_945_1352 134
1557 3300049571 Ga0501034_0124034 Ga0501034_0124034_149_553 134
1558 3300049571 Ga0501034_0124659 Ga0501034_0124659_67_471 134
1559 3300049571 Ga0501034_0160935 Ga0501034_0160935_17_421 134
1560 3300049571 Ga0501034_0205106 Ga0501034_0205106_974_1378 134
1561 3300049571 Ga0501034_0257022 Ga0501034_0257022_325_810 134
1562 3300049571 Ga0501034_0261982 Ga0501034_0261982_1159_1563 134
1563 3300049571 Ga0501034_0301493 Ga0501034_0301493_669_1073 134
1564 3300049571 Ga0501034_0335974 Ga0501034_0335974_1001_1405 134
1565 3300049571 Ga0501034_0357526 Ga0501034_0357526_233_637 134
1566 3300049571 Ga0501034_0390962 Ga0501034_0390962_380_784 134
1567 3300049571 Ga0501034_0400791 Ga0501034_0400791_873_1277 134
1568 3300049571 Ga0501034_0464415 Ga0501034_0464415_144_569 134
1569 3300049571 Ga0501034_0677070 Ga0501034_0677070_181_585 134
1570 3300049571 Ga0501034_0696266 Ga0501034_0696266_102_506 134
1571 3300049571 Ga0501034_0818286 Ga0501034_0818286_301_705 134
1572 3300049571 Ga0501034_0834458 Ga0501034_0834458_215_709 134
1573 3300049572 Ga0501036_0000008 Ga0501036_0000008_92077_92481 134
1574 3300049572 Ga0501036_0000084 Ga0501036_0000084_52229_52633 134
1575 3300049572 Ga0501036_0021531 Ga0501036_0021531_4560_4964 134
1576 3300049572 Ga0501036_0029728 Ga0501036_0029728_3600_4004 134
1577 3300049572 Ga0501036_0042932 Ga0501036_0042932_526_930 134
1578 3300049572 Ga0501036_0101129 Ga0501036_0101129_1019_1423 134
1579 3300049572 Ga0501036_0160257 Ga0501036_0160257_1146_1550 134
1580 3300049572 Ga0501036_0339173 Ga0501036_0339173_734_1138 134
1581 3300049572 Ga0501036_0424438 Ga0501036_0424438_350_775 134
1582 3300049572 Ga0501036_0534537 Ga0501036_0534537_461_865 134
1583 3300049572 Ga0501036_0617515 Ga0501036_0617515_42_446 134
1584 3300049572 Ga0501036_0720451 Ga0501036_0720451_184_588 134
1585 3300049573 Ga0501037_0000035 Ga0501037_0000035_122865_123269 134
1586 3300049573 Ga0501037_0000055 Ga0501037_0000055_102613_103017 134
1587 3300049573 Ga0501037_0000148 Ga0501037_0000148_53279_53683 134
1588 3300049573 Ga0501037_0008967 Ga0501037_0008967_434_838 134
1589 3300049573 Ga0501037_0026841 Ga0501037_0026841_2245_2649 134
1590 3300049573 Ga0501037_0053350 Ga0501037_0053350_2126_2530 134
1591 3300049573 Ga0501037_0112189 Ga0501037_0112189_731_1135 134
1592 3300049573 Ga0501037_0133016 Ga0501037_0133016_776_1180 134
1593 3300049573 Ga0501037_0138113 Ga0501037_0138113_755_1180 134
1594 3300049573 Ga0501037_0209012 Ga0501037_0209012_68_472 134
1595 3300049573 Ga0501037_0344153 Ga0501037_0344153_563_967 134
1596 3300049573 Ga0501037_0348604 Ga0501037_0348604_362_766 134
1597 3300049573 Ga0501037_0365376 Ga0501037_0365376_354_758 134
1598 3300049573 Ga0501037_0395124 Ga0501037_0395124_151_576 134
1599 3300049573 Ga0501037_0449940 Ga0501037_0449940_83_508 134
1600 3300049573 Ga0501037_0695838 Ga0501037_0695838_115_519 134
1601 3300049573 Ga0501037_0709492 Ga0501037_0709492_89_586 134
1602 3300049573 Ga0501037_0992464 Ga0501037_0992464_132_536 134
1603 3300049574 Ga0501038_0000006 Ga0501038_0000006_92077_92481 134
1604 3300049574 Ga0501038_0000055 Ga0501038_0000055_82703_83107 134
1605 3300049574 Ga0501038_0001195 Ga0501038_0001195_12948_13352 134
1606 3300049574 Ga0501038_0046710 Ga0501038_0046710_2680_3084 134
1607 3300049574 Ga0501038_0098750 Ga0501038_0098750_1019_1423 134
1608 3300049574 Ga0501038_0151065 Ga0501038_0151065_787_1212 134
1609 3300049574 Ga0501038_0153767 Ga0501038_0153767_250_654 134
1610 3300049574 Ga0501038_0169549 Ga0501038_0169549_131_625 134
1611 3300049574 Ga0501038_0284115 Ga0501038_0284115_297_722 134
1612 3300049574 Ga0501038_0421485 Ga0501038_0421485_339_743 134
1613 3300049574 Ga0501038_0964354 Ga0501038_0964354_150_554 134
1614 3300049574 Ga0501038_1204912 Ga0501038_1204912_86_490 134
1615 3300049574 Ga0501038_1253265 Ga0501038_1253265_47_451 134
1616 3300049575 Ga0501039_0000014 Ga0501039_0000014_135627_136031 134
1617 3300049575 Ga0501039_0000103 Ga0501039_0000103_5284_5688 134
1618 3300049575 Ga0501039_0001824 Ga0501039_0001824_6851_7255 134
1619 3300049575 Ga0501039_0023598 Ga0501039_0023598_482_886 134
1620 3300049575 Ga0501039_0028302 Ga0501039_0028302_1072_1476 134
1621 3300049575 Ga0501039_0052315 Ga0501039_0052315_1717_2142 134
1622 3300049575 Ga0501039_0180638 Ga0501039_0180638_116_520 134
1623 3300049575 Ga0501039_0246288 Ga0501039_0246288_461_865 134
1624 3300049575 Ga0501039_0304185 Ga0501039_0304185_208_612 134
1625 3300049575 Ga0501039_0322338 Ga0501039_0322338_279_683 134
1626 3300049575 Ga0501039_0402574 Ga0501039_0402574_646_1050 134
1627 3300049575 Ga0501039_0426486 Ga0501039_0426486_116_520 134
1628 3300049575 Ga0501039_0506453 Ga0501039_0506453_245_649 134
1629 3300049575 Ga0501039_0637333 Ga0501039_0637333_331_735 134
1630 3300049575 Ga0501039_0857210 Ga0501039_0857210_55_459 134
1631 3300049575 Ga0501039_1007558 Ga0501039_1007558_223_627 134
1632 3300049575 Ga0501039_1121797 Ga0501039_1121797_12_416 134
1633 3300049575 Ga0501039_1550366 Ga0501039_1550366_80_484 134
1634 3300049576 Ga0501040_0031370 Ga0501040_0031370_2209_2613 134
1635 3300049576 Ga0501040_0061480 Ga0501040_0061480_1588_1992 134
1636 3300049576 Ga0501040_0105167 Ga0501040_0105167_246_650 134
1637 3300049576 Ga0501040_0155180 Ga0501040_0155180_216_620 134
1638 3300049576 Ga0501040_0200302 Ga0501040_0200302_866_1270 134
1639 3300049576 Ga0501040_0272673 Ga0501040_0272673_367_771 134
1640 3300049576 Ga0501040_0376662 Ga0501040_0376662_151_555 134
1641 3300049576 Ga0501040_0379801 Ga0501040_0379801_451_861 134
1642 3300049576 Ga0501040_0554949 Ga0501040_0554949_242_646 134
1643 3300049576 Ga0501040_0571613 Ga0501040_0571613_153_557 134
1644 3300049576 Ga0501040_0672551 Ga0501040_0672551_216_620 134
1645 3300049576 Ga0501040_0746097 Ga0501040_0746097_137_541 134
1646 3300049577 Ga0501041_0027272 Ga0501041_0027272_1363_1767 134
1647 3300049577 Ga0501041_0036875 Ga0501041_0036875_2301_2705 134
1648 3300049577 Ga0501041_0037795 Ga0501041_0037795_88_492 134
1649 3300049577 Ga0501041_0195495 Ga0501041_0195495_761_1165 134
1650 3300049577 Ga0501041_0363692 Ga0501041_0363692_486_890 134
1651 3300049577 Ga0501041_0660004 Ga0501041_0660004_134_538 134
1652 3300049577 Ga0501041_0679459 Ga0501041_0679459_208_612 134
1653 3300049578 Ga0501042_0016217 Ga0501042_0016217_737_1141 134
1654 3300049578 Ga0501042_0017375 Ga0501042_0017375_2092_2496 134
1655 3300049578 Ga0501042_0261445 Ga0501042_0261445_766_1170 134
1656 3300049578 Ga0501042_0551546 Ga0501042_0551546_337_741 134
1657 3300049578 Ga0501042_0574883 Ga0501042_0574883_57_467 134
1658 3300049578 Ga0501042_0575080 Ga0501042_0575080_48_452 134
1659 3300049578 Ga0501042_0690196 Ga0501042_0690196_219_623 134
1660 3300049579 Ga0501043_0000015 Ga0501043_0000015_156550_156954 134
1661 3300049579 Ga0501043_0000830 Ga0501043_0000830_14223_14627 134
1662 3300049579 Ga0501043_0001247 Ga0501043_0001247_17871_18275 134
1663 3300049579 Ga0501043_0006125 Ga0501043_0006125_2321_2725 134
1664 3300049579 Ga0501043_0074842 Ga0501043_0074842_1421_1918 134
1665 3300049579 Ga0501043_0079827 Ga0501043_0079827_187_612 134
1666 3300049579 Ga0501043_0082461 Ga0501043_0082461_1383_1787 134
1667 3300049579 Ga0501043_0126689 Ga0501043_0126689_1334_1738 134
1668 3300049579 Ga0501043_0130954 Ga0501043_0130954_1252_1656 134
1669 3300049579 Ga0501043_0183646 Ga0501043_0183646_579_983 134
1670 3300049579 Ga0501043_0201172 Ga0501043_0201172_269_673 134
1671 3300049579 Ga0501043_0278210 Ga0501043_0278210_850_1254 134
1672 3300049579 Ga0501043_0409057 Ga0501043_0409057_371_775 134
1673 3300049579 Ga0501043_0567419 Ga0501043_0567419_188_682 134
1674 3300049579 Ga0501043_0655320 Ga0501043_0655320_342_746 134
1675 3300049579 Ga0501043_0865545 Ga0501043_0865545_165_569 134
1676 3300049579 Ga0501043_1039550 Ga0501043_1039550_69_473 134
1677 3300049580 Ga0501046_0003040 Ga0501046_0003040_10178_10582 134
1678 3300049580 Ga0501046_0008789 Ga0501046_0008789_8299_8703 134
1679 3300049580 Ga0501046_0143153 Ga0501046_0143153_686_1090 134
1680 3300049580 Ga0501046_0149405 Ga0501046_0149405_1271_1675 134
1681 3300049580 Ga0501046_0150897 Ga0501046_0150897_955_1359 134
1682 3300049580 Ga0501046_0176435 Ga0501046_0176435_767_1171 134
1683 3300049580 Ga0501046_0252773 Ga0501046_0252773_331_828 134
1684 3300049580 Ga0501046_0305669 Ga0501046_0305669_286_690 134
1685 3300049580 Ga0501046_0310738 Ga0501046_0310738_15_419 134
1686 3300049580 Ga0501046_0348841 Ga0501046_0348841_595_999 134
1687 3300049580 Ga0501046_0422812 Ga0501046_0422812_151_555 134
1688 3300049580 Ga0501046_0466627 Ga0501046_0466627_85_489 134
1689 3300049580 Ga0501046_0545156 Ga0501046_0545156_88_513 134
1690 3300049581 Ga0501047_0001009 Ga0501047_0001009_5077_5481 134
1691 3300049581 Ga0501047_0003461 Ga0501047_0003461_7566_7970 134
1692 3300049581 Ga0501047_0007416 Ga0501047_0007416_6283_6687 134
1693 3300049581 Ga0501047_0011280 Ga0501047_0011280_786_1211 134
1694 3300049581 Ga0501047_0020900 Ga0501047_0020900_5190_5594 134
1695 3300049581 Ga0501047_0044279 Ga0501047_0044279_1608_2012 134
1696 3300049581 Ga0501047_0067056 Ga0501047_0067056_1465_1869 134
1697 3300049581 Ga0501047_0067608 Ga0501047_0067608_535_939 134
1698 3300049581 Ga0501047_0126698 Ga0501047_0126698_1919_2323 134
1699 3300049581 Ga0501047_0139115 Ga0501047_0139115_343_747 134
1700 3300049581 Ga0501047_0259213 Ga0501047_0259213_325_729 134
1701 3300049581 Ga0501047_0467779 Ga0501047_0467779_595_999 134
1702 3300049581 Ga0501047_0491653 Ga0501047_0491653_295_699 134
1703 3300049581 Ga0501047_0491911 Ga0501047_0491911_44_448 134
1704 3300049581 Ga0501047_0554893 Ga0501047_0554893_193_597 134
1705 3300049581 Ga0501047_0566307 Ga0501047_0566307_437_841 134
1706 3300049581 Ga0501047_0805027 Ga0501047_0805027_204_608 134
1707 3300049581 Ga0501047_0866155 Ga0501047_0866155_145_549 134
1708 3300049581 Ga0501047_1139664 Ga0501047_1139664_155_559 134
1709 3300049582 Ga0501048_0042136 Ga0501048_0042136_2821_3225 134
1710 3300049582 Ga0501048_0049359 Ga0501048_0049359_2123_2527 134
1711 3300049582 Ga0501048_0107426 Ga0501048_0107426_767_1171 134
1712 3300049582 Ga0501048_0312709 Ga0501048_0312709_180_584 134
1713 3300049582 Ga0501048_0367533 Ga0501048_0367533_468_872 134
1714 3300049582 Ga0501048_0504626 Ga0501048_0504626_414_818 134
1715 3300049582 Ga0501048_0582296 Ga0501048_0582296_268_672 134
1716 3300049582 Ga0501048_1210257 Ga0501048_1210257_95_499 134
1717 3300049583 Ga0501067_0030072 Ga0501067_0030072_922_1326 134
1718 3300049583 Ga0501067_0114819 Ga0501067_0114819_705_1109 134
1719 3300049583 Ga0501067_0142722 Ga0501067_0142722_355_765 134
1720 3300049583 Ga0501067_0255124 Ga0501067_0255124_84_488 134
1721 3300049583 Ga0501067_0380312 Ga0501067_0380312_292_696 134
1722 3300049583 Ga0501067_0435651 Ga0501067_0435651_99_503 134
1723 3300049583 Ga0501067_0495543 Ga0501067_0495543_190_594 134
1724 3300049583 Ga0501067_0560764 Ga0501067_0560764_41_466 134
1725 3300049584 Ga0501068_0035620 Ga0501068_0035620_211_615 134
1726 3300049584 Ga0501068_0043441 Ga0501068_0043441_2255_2659 134
1727 3300049584 Ga0501068_0066941 Ga0501068_0066941_1574_1978 134
1728 3300049584 Ga0501068_0070584 Ga0501068_0070584_482_886 134
1729 3300049584 Ga0501068_0110819 Ga0501068_0110819_338_742 134
1730 3300049584 Ga0501068_0118623 Ga0501068_0118623_858_1262 134
1731 3300049584 Ga0501068_0189874 Ga0501068_0189874_450_854 134
1732 3300049584 Ga0501068_0241962 Ga0501068_0241962_72_497 134
1733 3300049584 Ga0501068_0487215 Ga0501068_0487215_183_680 134
1734 3300049584 Ga0501068_0546989 Ga0501068_0546989_222_626 134
1735 3300049584 Ga0501068_0917514 Ga0501068_0917514_25_429 134
1736 3300049585 Ga0501069_0000056 Ga0501069_0000056_1269_1673 134
1737 3300049585 Ga0501069_0004657 Ga0501069_0004657_5127_5531 134
1738 3300049585 Ga0501069_0005107 Ga0501069_0005107_2326_2730 134
1739 3300049585 Ga0501069_0023158 Ga0501069_0023158_2306_2710 134
1740 3300049585 Ga0501069_0028934 Ga0501069_0028934_378_782 134
1741 3300049585 Ga0501069_0059088 Ga0501069_0059088_487_891 134
1742 3300049585 Ga0501069_0072995 Ga0501069_0072995_990_1394 134
1743 3300049585 Ga0501069_0197315 Ga0501069_0197315_117_521 134
1744 3300049585 Ga0501069_0272692 Ga0501069_0272692_376_780 134
1745 3300049585 Ga0501069_0830566 Ga0501069_0830566_129_533 134
1746 3300049585 Ga0501069_0879005 Ga0501069_0879005_122_526 134
1747 3300049585 Ga0501069_0951981 Ga0501069_0951981_36_440 134
1748 3300049586 Ga0501070_0000141 Ga0501070_0000141_1271_1675 134
1749 3300049586 Ga0501070_0002106 Ga0501070_0002106_10761_11165 134
1750 3300049586 Ga0501070_0003485 Ga0501070_0003485_5281_5685 134
1751 3300049586 Ga0501070_0004026 Ga0501070_0004026_8892_9296 134
1752 3300049586 Ga0501070_0019063 Ga0501070_0019063_2779_3183 134
1753 3300049586 Ga0501070_0021875 Ga0501070_0021875_2214_2618 134
1754 3300049586 Ga0501070_0043015 Ga0501070_0043015_387_812 134
1755 3300049586 Ga0501070_0045779 Ga0501070_0045779_56_460 134
1756 3300049586 Ga0501070_0055397 Ga0501070_0055397_862_1266 134
1757 3300049586 Ga0501070_0071674 Ga0501070_0071674_874_1278 134
1758 3300049586 Ga0501070_0076896 Ga0501070_0076896_1933_2337 134
1759 3300049586 Ga0501070_0085608 Ga0501070_0085608_169_666 134
1760 3300049586 Ga0501070_0107354 Ga0501070_0107354_596_1090 134
1761 3300049586 Ga0501070_0164833 Ga0501070_0164833_1107_1511 134
1762 3300049586 Ga0501070_0182453 Ga0501070_0182453_159_563 134
1763 3300049586 Ga0501070_0254853 Ga0501070_0254853_161_565 134
1764 3300049586 Ga0501070_0332826 Ga0501070_0332826_427_831 134
1765 3300049586 Ga0501070_0345429 Ga0501070_0345429_212_649 134
1766 3300049586 Ga0501070_0351631 Ga0501070_0351631_665_1069 134
1767 3300049586 Ga0501070_0397627 Ga0501070_0397627_234_638 134
1768 3300049586 Ga0501070_0463776 Ga0501070_0463776_536_940 134
1769 3300049586 Ga0501070_1026080 Ga0501070_1026080_80_484 134
1770 3300049586 Ga0501070_1129142 Ga0501070_1129142_128_532 134
1771 3300049587 Ga0501071_0008384 Ga0501071_0008384_943_1347 134
1772 3300049587 Ga0501071_0019384 Ga0501071_0019384_2951_3355 134
1773 3300049587 Ga0501071_0042854 Ga0501071_0042854_914_1318 134
1774 3300049587 Ga0501071_0044165 Ga0501071_0044165_2303_2707 134
1775 3300049587 Ga0501071_0099526 Ga0501071_0099526_849_1253 134
1776 3300049587 Ga0501071_0383579 Ga0501071_0383579_81_485 134
1777 3300049587 Ga0501071_1029265 Ga0501071_1029265_216_620 134
1778 3300049587 Ga0501071_1062725 Ga0501071_1062725_85_489 134
1779 3300049587 Ga0501071_1426754 Ga0501071_1426754_101_505 134
1780 3300049588 Ga0501072_0017162 Ga0501072_0017162_2679_3083 134
1781 3300049588 Ga0501072_0048521 Ga0501072_0048521_2059_2463 134
1782 3300049588 Ga0501072_0054989 Ga0501072_0054989_2708_3112 134
1783 3300049588 Ga0501072_0094800 Ga0501072_0094800_588_992 134
1784 3300049588 Ga0501072_0142143 Ga0501072_0142143_240_644 134
1785 3300049588 Ga0501072_0282538 Ga0501072_0282538_54_458 134
1786 3300049588 Ga0501072_0396796 Ga0501072_0396796_466_870 134
1787 3300049588 Ga0501072_0476067 Ga0501072_0476067_231_635 134
1788 3300049588 Ga0501072_0493298 Ga0501072_0493298_314_718 134
1789 3300049588 Ga0501072_0608888 Ga0501072_0608888_354_758 134
1790 3300049588 Ga0501072_0689103 Ga0501072_0689103_210_614 134
1791 3300049588 Ga0501072_0999981 Ga0501072_0999981_216_620 134
1792 3300049588 Ga0501072_1284616 Ga0501072_1284616_11_415 134
1793 3300049588 Ga0501072_1491887 Ga0501072_1491887_51_455 134
1794 3300049589 Ga0501073_0002365 Ga0501073_0002365_11601_12005 134
1795 3300049589 Ga0501073_0002750 Ga0501073_0002750_9070_9474 134
1796 3300049589 Ga0501073_0040998 Ga0501073_0040998_2463_2867 134
1797 3300049589 Ga0501073_0045557 Ga0501073_0045557_1035_1460 134
1798 3300049589 Ga0501073_0047043 Ga0501073_0047043_303_707 134
1799 3300049589 Ga0501073_0054880 Ga0501073_0054880_865_1269 134
1800 3300049589 Ga0501073_0056016 Ga0501073_0056016_463_957 134
1801 3300049589 Ga0501073_0068806 Ga0501073_0068806_1423_1827 134
1802 3300049589 Ga0501073_0107580 Ga0501073_0107580_1396_1800 134
1803 3300049589 Ga0501073_0183389 Ga0501073_0183389_88_492 134
1804 3300049589 Ga0501073_0245615 Ga0501073_0245615_248_652 134
1805 3300049590 Ga0501074_0000616 Ga0501074_0000616_20553_20957 134
1806 3300049590 Ga0501074_0005602 Ga0501074_0005602_4033_4437 134
1807 3300049590 Ga0501074_0049363 Ga0501074_0049363_2186_2590 134
1808 3300049590 Ga0501074_0128814 Ga0501074_0128814_641_1045 134
1809 3300049590 Ga0501074_0199260 Ga0501074_0199260_152_556 134
1810 3300049590 Ga0501074_0215351 Ga0501074_0215351_192_596 134
1811 3300049590 Ga0501074_0256445 Ga0501074_0256445_793_1197 134
1812 3300049590 Ga0501074_0433904 Ga0501074_0433904_52_456 134
1813 3300049590 Ga0501074_0620282 Ga0501074_0620282_223_627 134
1814 3300049590 Ga0501074_1009172 Ga0501074_1009172_85_489 134
1815 3300049590 Ga0501074_1055885 Ga0501074_1055885_86_490 134
1816 3300049591 Ga0501075_0035102 Ga0501075_0035102_2349_2753 134
1817 3300049591 Ga0501075_0043343 Ga0501075_0043343_567_971 134
1818 3300049591 Ga0501075_0066572 Ga0501075_0066572_332_736 134
1819 3300049591 Ga0501075_0069454 Ga0501075_0069454_1425_1829 134
1820 3300049591 Ga0501075_0073976 Ga0501075_0073976_103_507 134
1821 3300049591 Ga0501075_0117440 Ga0501075_0117440_191_595 134
1822 3300049591 Ga0501075_0135020 Ga0501075_0135020_814_1218 134
1823 3300049591 Ga0501075_0296820 Ga0501075_0296820_551_955 134
1824 3300049592 Ga0501076_0054451 Ga0501076_0054451_294_698 134
1825 3300049592 Ga0501076_0075746 Ga0501076_0075746_286_690 134
1826 3300049592 Ga0501076_0102545 Ga0501076_0102545_1726_2130 134
1827 3300049592 Ga0501076_0135738 Ga0501076_0135738_396_800 134
1828 3300049592 Ga0501076_0246983 Ga0501076_0246983_795_1199 134
1829 3300049592 Ga0501076_0521789 Ga0501076_0521789_321_725 134
1830 3300049592 Ga0501076_0590957 Ga0501076_0590957_108_512 134
1831 3300049592 Ga0501076_0603908 Ga0501076_0603908_332_736 134
1832 3300049592 Ga0501076_0856264 Ga0501076_0856264_174_578 134
1833 3300049593 Ga0501077_0011445 Ga0501077_0011445_4813_5217 134
1834 3300049593 Ga0501077_0033201 Ga0501077_0033201_1441_1845 134
1835 3300049593 Ga0501077_0093706 Ga0501077_0093706_66_470 134
1836 3300049593 Ga0501077_0193387 Ga0501077_0193387_74_478 134
1837 3300049593 Ga0501077_0269173 Ga0501077_0269173_547_951 134
1838 3300049593 Ga0501077_0466305 Ga0501077_0466305_58_462 134
1839 3300049593 Ga0501077_0629728 Ga0501077_0629728_170_574 134
1840 3300049593 Ga0501077_1132537 Ga0501077_1132537_18_422 134
1841 3300049671 Ga0501238_004789 Ga0501238_004789_825_1229 134
1842 3300049741 Ga0501079_0008707 Ga0501079_0008707_1249_1653 134
1843 3300049741 Ga0501079_0008850 Ga0501079_0008850_3650_4054 134
1844 3300049741 Ga0501079_0042452 Ga0501079_0042452_1810_2214 134
1845 3300049741 Ga0501079_0058862 Ga0501079_0058862_40_444 134
1846 3300049741 Ga0501079_0068937 Ga0501079_0068937_1517_1921 134
1847 3300049741 Ga0501079_0092767 Ga0501079_0092767_353_757 134
1848 3300049741 Ga0501079_0137361 Ga0501079_0137361_590_994 134
1849 3300049741 Ga0501079_0612468 Ga0501079_0612468_435_839 134
1850 3300049741 Ga0501079_0636647 Ga0501079_0636647_170_574 134
1851 3300049741 Ga0501079_1184953 Ga0501079_1184953_66_470 134
1852 3300049741 Ga0501079_1295217 Ga0501079_1295217_28_432 134
1853 3300049742 Ga0501080_0004705 Ga0501080_0004705_3021_3425 134
1854 3300049742 Ga0501080_0011412 Ga0501080_0011412_5002_5406 134
1855 3300049742 Ga0501080_0017268 Ga0501080_0017268_2321_2725 134
1856 3300049742 Ga0501080_0025164 Ga0501080_0025164_5050_5454 134
1857 3300049742 Ga0501080_0025866 Ga0501080_0025866_4810_5304 134
1858 3300049742 Ga0501080_0064491 Ga0501080_0064491_2110_2514 134
1859 3300049742 Ga0501080_0074106 Ga0501080_0074106_288_692 134
1860 3300049742 Ga0501080_0096691 Ga0501080_0096691_239_643 134
1861 3300049742 Ga0501080_0123492 Ga0501080_0123492_395_799 134
1862 3300049742 Ga0501080_0175086 Ga0501080_0175086_1414_1824 134
1863 3300049742 Ga0501080_0184064 Ga0501080_0184064_62_466 134
1864 3300049742 Ga0501080_0267366 Ga0501080_0267366_1055_1459 134
1865 3300049742 Ga0501080_0301102 Ga0501080_0301102_71_475 134
1866 3300049742 Ga0501080_0322952 Ga0501080_0322952_826_1230 134
1867 3300049742 Ga0501080_0429360 Ga0501080_0429360_211_615 134
1868 3300049742 Ga0501080_0450717 Ga0501080_0450717_734_1138 134
1869 3300049742 Ga0501080_0611626 Ga0501080_0611626_29_433 134
1870 3300049742 Ga0501080_1054334 Ga0501080_1054334_119_544 134
1871 3300049742 Ga0501080_1135035 Ga0501080_1135035_97_501 134
1872 3300049742 Ga0501080_1489986 Ga0501080_1489986_29_433 134
1873 3300049742 Ga0501080_1687412 Ga0501080_1687412_34_438 134
1874 3300049743 Ga0501081_0016416 Ga0501081_0016416_1165_1569 134
1875 3300049743 Ga0501081_0054088 Ga0501081_0054088_617_1021 134
1876 3300049743 Ga0501081_0079355 Ga0501081_0079355_1020_1424 134
1877 3300049743 Ga0501081_0096246 Ga0501081_0096246_950_1354 134
1878 3300049743 Ga0501081_0171113 Ga0501081_0171113_376_780 134
1879 3300049743 Ga0501081_0198752 Ga0501081_0198752_599_1003 134
1880 3300049743 Ga0501081_0305444 Ga0501081_0305444_587_991 134
1881 3300049743 Ga0501081_0435416 Ga0501081_0435416_229_633 134
1882 3300049743 Ga0501081_0548472 Ga0501081_0548472_45_449 134
1883 3300049744 Ga0501083_0000098 Ga0501083_0000098_15193_15597 134
1884 3300049744 Ga0501083_0006468 Ga0501083_0006468_2671_3075 134
1885 3300049744 Ga0501083_0011101 Ga0501083_0011101_1131_1535 134
1886 3300049744 Ga0501083_0011157 Ga0501083_0011157_5356_5850 134
1887 3300049744 Ga0501083_0022048 Ga0501083_0022048_3793_4197 134
1888 3300049744 Ga0501083_0064310 Ga0501083_0064310_331_735 134
1889 3300049744 Ga0501083_0104131 Ga0501083_0104131_264_668 134
1890 3300049744 Ga0501083_0120036 Ga0501083_0120036_136_540 134
1891 3300049744 Ga0501083_0249067 Ga0501083_0249067_470_874 134
1892 3300049744 Ga0501083_0331950 Ga0501083_0331950_460_864 134
1893 3300049744 Ga0501083_0411159 Ga0501083_0411159_38_442 134
1894 3300049744 Ga0501083_0707520 Ga0501083_0707520_149_553 134
1895 3300049744 Ga0501083_0779347 Ga0501083_0779347_175_579 134
1896 3300049822 Ga0501035_0000036 Ga0501035_0000036_162284_162688 134
1897 3300049822 Ga0501035_0000096 Ga0501035_0000096_7591_7995 134
1898 3300049822 Ga0501035_0000105 Ga0501035_0000105_52262_52666 134
1899 3300049822 Ga0501035_0007132 Ga0501035_0007132_1630_2034 134
1900 3300049822 Ga0501035_0011774 Ga0501035_0011774_377_781 134
1901 3300049822 Ga0501035_0014814 Ga0501035_0014814_6288_6692 134
1902 3300049822 Ga0501035_0018174 Ga0501035_0018174_5670_6095 134
1903 3300049822 Ga0501035_0019433 Ga0501035_0019433_1523_1927 134
1904 3300049822 Ga0501035_0030316 Ga0501035_0030316_1280_1684 134
1905 3300049822 Ga0501035_0039748 Ga0501035_0039748_3042_3446 134
1906 3300049822 Ga0501035_0058916 Ga0501035_0058916_160_585 134
1907 3300049822 Ga0501035_0076248 Ga0501035_0076248_2400_2804 134
1908 3300049822 Ga0501035_0091995 Ga0501035_0091995_2047_2451 134
1909 3300049822 Ga0501035_0101136 Ga0501035_0101136_1005_1409 134
1910 3300049822 Ga0501035_0107454 Ga0501035_0107454_309_734 134
1911 3300049822 Ga0501035_0121037 Ga0501035_0121037_866_1351 134
1912 3300049822 Ga0501035_0164994 Ga0501035_0164994_1383_1787 134
1913 3300049822 Ga0501035_0176668 Ga0501035_0176668_306_710 134
1914 3300049822 Ga0501035_0210721 Ga0501035_0210721_784_1188 134
1915 3300049822 Ga0501035_0216942 Ga0501035_0216942_568_972 134
1916 3300049822 Ga0501035_0235440 Ga0501035_0235440_861_1358 134
1917 3300049822 Ga0501035_0308745 Ga0501035_0308745_58_462 134
1918 3300049822 Ga0501035_0380335 Ga0501035_0380335_502_906 134
1919 3300049822 Ga0501035_0443937 Ga0501035_0443937_186_590 134
1920 3300049822 Ga0501035_0471664 Ga0501035_0471664_99_503 134
1921 3300049823 Ga0501044_0000017 Ga0501044_0000017_135627_136031 134
1922 3300049823 Ga0501044_0003970 Ga0501044_0003970_11383_11787 134
1923 3300049823 Ga0501044_0004614 Ga0501044_0004614_13740_14144 134
1924 3300049823 Ga0501044_0005206 Ga0501044_0005206_4920_5324 134
1925 3300049823 Ga0501044_0018252 Ga0501044_0018252_6753_7157 134
1926 3300049823 Ga0501044_0038641 Ga0501044_0038641_2897_3301 134
1927 3300049823 Ga0501044_0057278 Ga0501044_0057278_3353_3757 134
1928 3300049823 Ga0501044_0070198 Ga0501044_0070198_937_1341 134
1929 3300049823 Ga0501044_0087909 Ga0501044_0087909_775_1260 134
1930 3300049823 Ga0501044_0105066 Ga0501044_0105066_103_507 134
1931 3300049823 Ga0501044_0107218 Ga0501044_0107218_202_606 134
1932 3300049823 Ga0501044_0109223 Ga0501044_0109223_1181_1606 134
1933 3300049823 Ga0501044_0125889 Ga0501044_0125889_1062_1466 134
1934 3300049823 Ga0501044_0126772 Ga0501044_0126772_461_865 134
1935 3300049823 Ga0501044_0190398 Ga0501044_0190398_523_948 134
1936 3300049823 Ga0501044_0255493 Ga0501044_0255493_1202_1606 134
1937 3300049823 Ga0501044_0300705 Ga0501044_0300705_91_495 134
1938 3300049823 Ga0501044_0311651 Ga0501044_0311651_896_1321 134
1939 3300049823 Ga0501044_0578933 Ga0501044_0578933_172_576 134
1940 3300049823 Ga0501044_0732039 Ga0501044_0732039_119_523 134
1941 3300049823 Ga0501044_0824565 Ga0501044_0824565_59_463 134
1942 3300049823 Ga0501044_1226282 Ga0501044_1226282_34_438 134
1943 3300049824 Ga0501045_0065249 Ga0501045_0065249_714_1118 134
1944 3300049824 Ga0501045_0123898 Ga0501045_0123898_683_1087 134
1945 3300049824 Ga0501045_0207880 Ga0501045_0207880_184_588 134
1946 3300049824 Ga0501045_0286618 Ga0501045_0286618_743_1147 134
1947 3300049824 Ga0501045_0372658 Ga0501045_0372658_267_671 134
1948 3300049824 Ga0501045_0381817 Ga0501045_0381817_65_481 134
1949 3300049824 Ga0501045_0541155 Ga0501045_0541155_50_454 134
1950 3300049824 Ga0501045_0611061 Ga0501045_0611061_347_751 134
1951 3300049824 Ga0501045_1278341 Ga0501045_1278341_69_473 134
1952 3300049824 Ga0501045_1285151 Ga0501045_1285151_17_421 134
1953 3300049824 Ga0501045_1321120 Ga0501045_1321120_54_458 134
1954 3300050489 nmdc:mga03683_104172_c1 nmdc:mga03683_104172_c1_232_636 134
1955 3300050489 nmdc:mga03683_1209_c1 nmdc:mga03683_1209_c1_5727_6131 134
1956 3300050489 nmdc:mga03683_3012_c1 nmdc:mga03683_3012_c1_1832_2236 134
1957 3300050489 nmdc:mga03683_413945_c1 nmdc:mga03683_413945_c1_216_620 134
1958 3300050489 nmdc:mga03683_53313_c1 nmdc:mga03683_53313_c1_1208_1633 134
1959 3300050489 nmdc:mga03683_610309_c1 nmdc:mga03683_610309_c1_57_461 134
1960 3300050490 nmdc:mga03n38_13377_c1 nmdc:mga03n38_13377_c1_2522_3019 134
1961 3300050490 nmdc:mga03n38_15127_c1 nmdc:mga03n38_15127_c1_2314_2718 134
1962 3300050490 nmdc:mga03n38_271506_c1 nmdc:mga03n38_271506_c1_216_620 134
1963 3300050490 nmdc:mga03n38_9941_c1 nmdc:mga03n38_9941_c1_1826_2230 134
1964 3300050491 nmdc:mga00v17_23770_c1 nmdc:mga00v17_23770_c1_97_594 134
1965 3300050491 nmdc:mga00v17_246709_c1 nmdc:mga00v17_246709_c1_584_1009 134
1966 3300050491 nmdc:mga00v17_271438_c1 nmdc:mga00v17_271438_c1_171_575 134
1967 3300050491 nmdc:mga00v17_427770_c1 nmdc:mga00v17_427770_c1_118_522 134
1968 3300050491 nmdc:mga00v17_684331_c1 nmdc:mga00v17_684331_c1_43_447 134
1969 3300050491 nmdc:mga00v17_92623_c1 nmdc:mga00v17_92623_c1_216_623 134
1970 3300050491 nmdc:mga00v17_942489_c1 nmdc:mga00v17_942489_c1_51_455 134
1971 3300050492 nmdc:mga0yw44_137878_c1 nmdc:mga0yw44_137878_c1_1126_1563 134
1972 3300050492 nmdc:mga0yw44_37357_c1 nmdc:mga0yw44_37357_c1_15_419 134
1973 3300050492 nmdc:mga0yw44_3739_c1 nmdc:mga0yw44_3739_c1_2747_3151 134
1974 3300050492 nmdc:mga0yw44_445325_c1 nmdc:mga0yw44_445325_c1_246_650 134
1975 3300050492 nmdc:mga0yw44_508111_c1 nmdc:mga0yw44_508111_c1_306_710 134
1976 3300050492 nmdc:mga0yw44_6537_c1 nmdc:mga0yw44_6537_c1_2607_3011 134
1977 3300050492 nmdc:mga0yw44_744063_c1 nmdc:mga0yw44_744063_c1_248_652 134
1978 3300050492 nmdc:mga0yw44_863670_c1 nmdc:mga0yw44_863670_c1_50_457 134
1979 3300050493 nmdc:mga0k408_193437_c1 nmdc:mga0k408_193437_c1_613_1017 134
1980 3300050494 nmdc:mga06z11_116807_c1 nmdc:mga06z11_116807_c1_658_1062 134
1981 3300050494 nmdc:mga06z11_127197_c1 nmdc:mga06z11_127197_c1_985_1389 134
1982 3300050494 nmdc:mga06z11_194099_c1 nmdc:mga06z11_194099_c1_134_631 134
1983 3300050494 nmdc:mga06z11_317_c1 nmdc:mga06z11_317_c1_7933_8337 134
1984 3300050494 nmdc:mga06z11_769579_c1 nmdc:mga06z11_769579_c1_171_575 134
1985 3300050495 nmdc:mga04h51_119946_c1 nmdc:mga04h51_119946_c1_337_741 134
1986 3300050495 nmdc:mga04h51_14645_c1 nmdc:mga04h51_14645_c1_886_1290 134
1987 3300050495 nmdc:mga04h51_202627_c1 nmdc:mga04h51_202627_c1_362_766 134
1988 3300050495 nmdc:mga04h51_244838_c1 nmdc:mga04h51_244838_c1_259_663 134
1989 3300050495 nmdc:mga04h51_269948_c1 nmdc:mga04h51_269948_c1_39_443 134
1990 3300050495 nmdc:mga04h51_44685_c1 nmdc:mga04h51_44685_c1_859_1356 134
1991 3300050495 nmdc:mga04h51_5970_c1 nmdc:mga04h51_5970_c1_1220_1624 134
1992 3300050495 nmdc:mga04h51_64866_c1 nmdc:mga04h51_64866_c1_176_580 134
1993 3300050496 nmdc:mga07m45_122184_c1 nmdc:mga07m45_122184_c1_241_666 134
1994 3300050496 nmdc:mga07m45_190657_c1 nmdc:mga07m45_190657_c1_325_750 134
1995 3300050496 nmdc:mga07m45_340908_c1 nmdc:mga07m45_340908_c1_83_487 134
1996 3300050496 nmdc:mga07m45_510755_c1 nmdc:mga07m45_510755_c1_139_636 134
1997 3300050496 nmdc:mga07m45_58067_c1 nmdc:mga07m45_58067_c1_1604_2008 134
1998 3300050496 nmdc:mga07m45_59426_c1 nmdc:mga07m45_59426_c1_1127_1531 134
1999 3300050496 nmdc:mga07m45_67960_c1 nmdc:mga07m45_67960_c1_198_602 134
2000 3300050507 nmdc:mga05p37_1016407_c1 nmdc:mga05p37_1016407_c1_151_555 134
2001 3300050507 nmdc:mga05p37_104847_c1 nmdc:mga05p37_104847_c1_1659_2063 134
2002 3300050507 nmdc:mga05p37_1125226_c1 nmdc:mga05p37_1125226_c1_108_512 134
2003 3300050507 nmdc:mga05p37_1268897_c1 nmdc:mga05p37_1268897_c1_73_477 134
2004 3300050507 nmdc:mga05p37_1290076_c1 nmdc:mga05p37_1290076_c1_302_706 134
2005 3300050507 nmdc:mga05p37_1351132_c1 nmdc:mga05p37_1351132_c1_262_666 134
2006 3300050507 nmdc:mga05p37_1396028_c1 nmdc:mga05p37_1396028_c1_23_427 134
2007 3300050507 nmdc:mga05p37_23888_c1 nmdc:mga05p37_23888_c1_2431_2835 134
2008 3300050507 nmdc:mga05p37_283881_c1 nmdc:mga05p37_283881_c1_1255_1659 134
2009 3300050507 nmdc:mga05p37_354892_c1 nmdc:mga05p37_354892_c1_663_1067 134
2010 3300050507 nmdc:mga05p37_586161_c1 nmdc:mga05p37_586161_c1_602_1006 134
2011 3300050507 nmdc:mga05p37_711507_c1 nmdc:mga05p37_711507_c1_673_1077 134
2012 3300050508 nmdc:mga09592_155675_c1 nmdc:mga09592_155675_c1_1511_1915 134
2013 3300050508 nmdc:mga09592_219791_c1 nmdc:mga09592_219791_c1_438_869 134
2014 3300050508 nmdc:mga09592_3261_c1 nmdc:mga09592_3261_c1_4184_4588 134
2015 3300050509 nmdc:mga0qj67_1232624_c1 nmdc:mga0qj67_1232624_c1_94_498 134
2016 3300050509 nmdc:mga0qj67_1254863_c1 nmdc:mga0qj67_1254863_c1_86_490 134
2017 3300050509 nmdc:mga0qj67_142171_c1 nmdc:mga0qj67_142171_c1_49_453 134
2018 3300050509 nmdc:mga0qj67_208750_c1 nmdc:mga0qj67_208750_c1_637_1041 134
2019 3300050509 nmdc:mga0qj67_22662_c1 nmdc:mga0qj67_22662_c1_1918_2322 134
2020 3300050509 nmdc:mga0qj67_350113_c1 nmdc:mga0qj67_350113_c1_387_791 134
2021 3300050509 nmdc:mga0qj67_36870_c1 nmdc:mga0qj67_36870_c1_1073_1477 134
2022 3300050509 nmdc:mga0qj67_4146_c1 nmdc:mga0qj67_4146_c1_8984_9415 134
2023 3300050509 nmdc:mga0qj67_617666_c1 nmdc:mga0qj67_617666_c1_385_789 134
2024 3300050509 nmdc:mga0qj67_676500_c1 nmdc:mga0qj67_676500_c1_247_651 134
2025 3300050510 nmdc:mga06r32_1515_c1 nmdc:mga06r32_1515_c1_10971_11402 134
2026 3300050510 nmdc:mga06r32_316753_c1 nmdc:mga06r32_316753_c1_425_829 134
2027 3300050510 nmdc:mga06r32_33096_c1 nmdc:mga06r32_33096_c1_2448_2852 134
2028 3300050510 nmdc:mga06r32_402339_c1 nmdc:mga06r32_402339_c1_565_969 134
2029 3300050510 nmdc:mga06r32_51391_c1 nmdc:mga06r32_51391_c1_3120_3524 134
2030 3300050510 nmdc:mga06r32_5448_c1 nmdc:mga06r32_5448_c1_7716_8120 134
2031 3300050510 nmdc:mga06r32_553872_c1 nmdc:mga06r32_553872_c1_43_447 134
2032 3300050511 nmdc:mga08y16_1148749_c1 nmdc:mga08y16_1148749_c1_95_499 134
2033 3300050511 nmdc:mga08y16_151309_c1 nmdc:mga08y16_151309_c1_1868_2272 134
2034 3300050511 nmdc:mga08y16_253527_c1 nmdc:mga08y16_253527_c1_581_985 134
2035 3300050511 nmdc:mga08y16_35_c1 nmdc:mga08y16_35_c1_13442_13846 134
2036 3300050511 nmdc:mga08y16_450909_c1 nmdc:mga08y16_450909_c1_193_597 134
2037 3300050511 nmdc:mga08y16_481651_c1 nmdc:mga08y16_481651_c1_603_1007 134
2038 3300050511 nmdc:mga08y16_8826_c1 nmdc:mga08y16_8826_c1_5773_6177 134
2039 3300050511 nmdc:mga08y16_920617_c1 nmdc:mga08y16_920617_c1_300_704 134
2040 3300050512 nmdc:mga0n895_4009_c1 nmdc:mga0n895_4009_c1_11375_11779 134
2041 3300050512 nmdc:mga0n895_52659_c1 nmdc:mga0n895_52659_c1_2636_3040 134
2042 3300050512 nmdc:mga0n895_671132_c1 nmdc:mga0n895_671132_c1_615_1019 134
2043 3300050512 nmdc:mga0n895_67429_c1 nmdc:mga0n895_67429_c1_220_624 134
2044 3300050512 nmdc:mga0n895_695238_c1 nmdc:mga0n895_695238_c1_421_825 134
2045 3300050512 nmdc:mga0n895_75923_c1 nmdc:mga0n895_75923_c1_2373_2777 134
2046 3300050513 nmdc:mga0rr50_165680_c1 nmdc:mga0rr50_165680_c1_229_633 134
2047 3300050514 nmdc:mga08x19_244529_c1 nmdc:mga08x19_244529_c1_480_884 134
2048 3300050515 nmdc:mga0a205_10265_c1 nmdc:mga0a205_10265_c1_6909_7313 134
2049 3300050515 nmdc:mga0a205_196971_c1 nmdc:mga0a205_196971_c1_580_984 134
2050 3300050515 nmdc:mga0a205_280057_c1 nmdc:mga0a205_280057_c1_397_801 134
2051 3300050515 nmdc:mga0a205_53269_c1 nmdc:mga0a205_53269_c1_692_1096 134
2052 3300050515 nmdc:mga0a205_7557_c1 nmdc:mga0a205_7557_c1_7486_7890 134
2053 3300050516 nmdc:mga0sz30_123965_c1 nmdc:mga0sz30_123965_c1_462_866 134
2054 3300050516 nmdc:mga0sz30_254013_c1 nmdc:mga0sz30_254013_c1_176_580 134
2055 3300050516 nmdc:mga0sz30_38122_c1 nmdc:mga0sz30_38122_c1_571_978 134
2056 3300053077 Ga0495601_0000763 Ga0495601_0000763_5537_5941 134
2057 3300053077 Ga0495601_0525514 Ga0495601_0525514_315_719 134
2058 3300053077 Ga0495601_0854337 Ga0495601_0854337_54_458 134
2059 3300053078 Ga0495612_0007350 Ga0495612_0007350_1864_2268 134
2060 3300053079 Ga0500610_0039322 Ga0500610_0039322_956_1360 134
2061 3300053083 Ga0495655_0001691 Ga0495655_0001691_1691_2095 134
2062 3300053083 Ga0495655_0017393 Ga0495655_0017393_863_1291 134
2063 3300053084 Ga0495595_0138063 Ga0495595_0138063_290_694 134
2064 3300053085 Ga0495619_0001194 Ga0495619_0001194_10287_10691 134
2065 3300053085 Ga0495619_0004882 Ga0495619_0004882_313_717 134
2066 3300053085 Ga0495619_1109663 Ga0495619_1109663_41_445 134
2067 3300053086 Ga0500578_0030675 Ga0500578_0030675_2068_2472 134
2068 3300053086 Ga0500578_0058305 Ga0500578_0058305_670_1074 134
2069 3300053086 Ga0500578_0373563 Ga0500578_0373563_159_563 134
2070 3300053087 Ga0500643_082620 Ga0500643_082620_339_743 134
2071 3300053088 Ga0500644_0004440 Ga0500644_0004440_1542_1967 134
2072 3300053088 Ga0500644_0022920 Ga0500644_0022920_450_854 134
2073 3300053088 Ga0500644_0202993 Ga0500644_0202993_139_543 134
2074 3300053090 Ga0500646_0081645 Ga0500646_0081645_115_519 134
2075 3300053090 Ga0500646_0361994 Ga0500646_0361994_45_449 134
2076 3300053090 Ga0500646_0406745 Ga0500646_0406745_80_484 134
2077 3300053091 Ga0500647_0192091 Ga0500647_0192091_238_642 134
2078 3300053092 Ga0500583_0162114 Ga0500583_0162114_150_554 134
2079 3300053093 Ga0500651_0011193 Ga0500651_0011193_663_1067 134
2080 3300053093 Ga0500651_0577382 Ga0500651_0577382_189_596 134
2081 3300053093 Ga0500651_0639534 Ga0500651_0639534_135_539 134
2082 3300053093 Ga0500651_0656408 Ga0500651_0656408_95_499 134
2083 3300053094 Ga0500566_0236043 Ga0500566_0236043_345_749 134
2084 3300053096 Ga0500641_0015295 Ga0500641_0015295_1171_1575 134
2085 3300053103 Ga0500555_050975 Ga0500555_050975_387_791 134
2086 3300053105 Ga0500557_082945 Ga0500557_082945_115_519 134
2087 3300053108 Ga0500562_018054 Ga0500562_018054_337_741 134
2088 3300053109 Ga0500569_154263 Ga0500569_154263_295_699 134
2089 3300053125 Ga0500618_001028 Ga0500618_001028_7284_7688 134
2090 3300053125 Ga0500618_013707 Ga0500618_013707_608_1012 134
2091 3300053125 Ga0500618_034210 Ga0500618_034210_324_728 134
2092 3300053126 Ga0500621_184808 Ga0500621_184808_38_442 134
2093 3300053130 Ga0500642_0004342 Ga0500642_0004342_2984_3388 134
2094 3300053134 Ga0500658_0158509 Ga0500658_0158509_245_652 134
2095 3300053134 Ga0500658_0383963 Ga0500658_0383963_109_513 134
2096 3300053134 Ga0500658_0407595 Ga0500658_0407595_181_585 134
2097 3300053139 Ga0500568_0005282 Ga0500568_0005282_1959_2375 134
2098 3300053139 Ga0500568_0010207 Ga0500568_0010207_1158_1562 134
2099 3300053139 Ga0500568_0010471 Ga0500568_0010471_2846_3253 134
2100 3300053139 Ga0500568_0050308 Ga0500568_0050308_444_848 134
2101 3300053139 Ga0500568_0187171 Ga0500568_0187171_128_535 134
2102 3300053139 Ga0500568_0325449 Ga0500568_0325449_130_534 134
2103 3300053142 Ga0500577_0047546 Ga0500577_0047546_25_429 134
2104 3300053142 Ga0500577_0091905 Ga0500577_0091905_273_677 134
2105 3300053142 Ga0500577_0169217 Ga0500577_0169217_338_742 134
2106 3300053142 Ga0500577_0264319 Ga0500577_0264319_61_465 134
2107 3300053142 Ga0500577_0526406 Ga0500577_0526406_88_492 134
2108 3300053146 Ga0500588_0005875 Ga0500588_0005875_671_1075 134
2109 3300053146 Ga0500588_0021299 Ga0500588_0021299_587_991 134
2110 3300053146 Ga0500588_0082704 Ga0500588_0082704_514_918 134
2111 3300053153 Ga0500616_0002326 Ga0500616_0002326_10851_11255 134
2112 3300053153 Ga0500616_0012309 Ga0500616_0012309_753_1157 134
2113 3300053153 Ga0500616_0031836 Ga0500616_0031836_1693_2097 134
2114 3300053156 Ga0500622_0000189 Ga0500622_0000189_32216_32641 134
2115 3300053156 Ga0500622_0002478 Ga0500622_0002478_11414_11821 134
2116 3300053156 Ga0500622_0063378 Ga0500622_0063378_922_1326 134
2117 3300053156 Ga0500622_0193039 Ga0500622_0193039_329_733 134
2118 3300053158 Ga0500627_0027898 Ga0500627_0027898_986_1390 134
2119 3300053160 Ga0500633_0013026 Ga0500633_0013026_1193_1600 134
2120 3300053160 Ga0500633_0280990 Ga0500633_0280990_187_591 134
2121 3300053727 Ga0500611_260503 Ga0500611_260503_45_449 134
2122 3300053728 Ga0500657_225044 Ga0500657_225044_149_553 134
2123 3300053730 Ga0500645_003580 Ga0500645_003580_2502_2906 134
2124 3300053731 Ga0500609_002519 Ga0500609_002519_65_469 134
2125 3300053736 Ga0500599_020557 Ga0500599_020557_196_600 134
2126 3300053739 Ga0500587_011337 Ga0500587_011337_276_680 134
2127 3300054114 Ga0501084_0023703 Ga0501084_0023703_996_1400 134
2128 3300054114 Ga0501084_0028674 Ga0501084_0028674_2944_3348 134
2129 3300054114 Ga0501084_0057143 Ga0501084_0057143_1241_1645 134
2130 3300054114 Ga0501084_0059310 Ga0501084_0059310_1022_1426 134
2131 3300054114 Ga0501084_0116943 Ga0501084_0116943_1237_1641 134
2132 3300054114 Ga0501084_0122547 Ga0501084_0122547_1132_1536 134
2133 3300054114 Ga0501084_0187649 Ga0501084_0187649_1245_1649 134
2134 3300054114 Ga0501084_0202216 Ga0501084_0202216_711_1115 134
2135 3300054114 Ga0501084_0233829 Ga0501084_0233829_575_979 134
2136 3300054114 Ga0501084_0283660 Ga0501084_0283660_673_1077 134
2137 3300054114 Ga0501084_0301057 Ga0501084_0301057_27_431 134
2138 3300054114 Ga0501084_0315569 Ga0501084_0315569_49_453 134
2139 3300054114 Ga0501084_0439703 Ga0501084_0439703_643_1047 134
2140 3300054114 Ga0501084_0489129 Ga0501084_0489129_340_744 134
2141 3300054114 Ga0501084_0502635 Ga0501084_0502635_86_490 134
2142 3300054114 Ga0501084_0844766 Ga0501084_0844766_181_585 134
2143 3300054114 Ga0501084_1307196 Ga0501084_1307196_132_536 134
2144 3300054114 Ga0501084_1313950 Ga0501084_1313950_159_563 134
2145 3300059627 Ga0587117_095774 Ga0587117_095774_96_500 134
2146 3300060353 Ga0501082_0012303 Ga0501082_0012303_2743_3147 134
2147 3300060353 Ga0501082_0013442 Ga0501082_0013442_1442_1846 134
2148 3300060353 Ga0501082_0019461 Ga0501082_0019461_2394_2798 134
2149 3300060353 Ga0501082_0032343 Ga0501082_0032343_2933_3337 134
2150 3300060353 Ga0501082_0046670 Ga0501082_0046670_134_538 134
2151 3300060353 Ga0501082_0118344 Ga0501082_0118344_1107_1511 134
2152 3300060353 Ga0501082_0141915 Ga0501082_0141915_713_1117 134
2153 3300060353 Ga0501082_0144424 Ga0501082_0144424_284_688 134
2154 3300060353 Ga0501082_0273752 Ga0501082_0273752_626_1030 134
2155 3300060353 Ga0501082_0315082 Ga0501082_0315082_165_659 134
2156 3300060353 Ga0501082_0373482 Ga0501082_0373482_735_1139 134
2157 3300060353 Ga0501082_0491560 Ga0501082_0491560_470_874 134
2158 3300060353 Ga0501082_0809430 Ga0501082_0809430_213_617 134
2159 3300060353 Ga0501082_1037057 Ga0501082_1037057_82_486 134
2160 3300060353 Ga0501082_1077589 Ga0501082_1077589_214_618 134
2161 3300060353 Ga0501082_1147914 Ga0501082_1147914_101_505 134
2162 3300060353 Ga0501082_1562878 Ga0501082_1562878_77_481 134
2163 3300061734 Ga0530510_0009093 Ga0530510_0009093_4790_5194 134
2164 3300061734 Ga0530510_0055018 Ga0530510_0055018_2203_2607 134
2165 3300061734 Ga0530510_0103703 Ga0530510_0103703_503_907 134
2166 3300061734 Ga0530510_0105025 Ga0530510_0105025_1252_1656 134
2167 3300061734 Ga0530510_0192940 Ga0530510_0192940_637_1041 134
2168 3300061734 Ga0530510_0301745 Ga0530510_0301745_42_446 134
2169 3300061734 Ga0530510_0442024 Ga0530510_0442024_409_813 134
2170 3300061734 Ga0530510_0485951 Ga0530510_0485951_105_509 134
2171 3300061734 Ga0530510_0488617 Ga0530510_0488617_152_556 134
2172 3300061734 Ga0530510_0639519 Ga0530510_0639519_214_618 134
2173 3300061734 Ga0530510_0652877 Ga0530510_0652877_363_767 134
2174 3300061734 Ga0530510_0772134 Ga0530510_0772134_25_429 134
2175 3300061734 Ga0530510_0862375 Ga0530510_0862375_182_586 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

37

149

0.96

PF13468

Glyoxalase_3

Glyoxalase-like domain

36

160

0.87

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

35

162

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qh4-assembly2.cif.gz_B crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.9795 1 134
6qh4-assembly2.cif.gz_D-2 crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.9774 1 134
6qh4-assembly1.cif.gz_A crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.9766 1 134
6qh4-assembly1.cif.gz_C crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.9763 1 134
6qh4-assembly2.cif.gz_B crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.9722 1 134
ID Description Score Start End Superfamily
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9766 1 134 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.962 1 134 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9444 4 134 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9106 4 134 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9065 2 133 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7V2RTH0-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 1 31 134 GO:0004493
GO:0046491
GO:0046872
AF-A0A059LAD0-F1-model_v4 VOC domain-containing protein 0.9991 2 86 GO:0004493
GO:0046491
GO:0046872
AF-A0A2H6AVW6-F1-model_v4 VOC domain-containing protein 0.9986 26 134 GO:0004493
GO:0046491
GO:0046872
AF-A0A0F9H529-F1-model_v4 VOC domain-containing protein 0.9984 1 103 GO:0004493
GO:0046491
GO:0046872
AF-A0A6I9KFL1-F1-model_v4 deleted 0.9982 2 83

Feature Viewer

pLDDT pTM Quality
96.51 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map