F496509
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2174 | 591 | 4344 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300061734|Ga0530510_0091635|Ga0530510_0091635_455_1261 |
| Length | 268 |
| Sequence | MLYFARRAGPGSAESLPDRAGMGKSGVIGLCKAVPVQDREMTNTRKILIVDXXXELRAALVEQLALHEEFESVAVENGTKGVQAARAGQIDLVIMDVGLPDVDGREAVRILRKNGFKAPIIMLTGHDTDSDTILGLESGANDYVTKPFRFAVLLARIRAQLRQHEASEDAVFSIGPYTFRPSSKILLNPKGNKVRLTEKETAILRYLYRAGQRPVTRETLLQEVWGYNSGVTTHTLETHIYRLRQKVEKDAASPSILVTEAGGYKLVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 10 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 11 | 3300001224 | Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_1 | Metagenome | Rhizosphere |
| 12 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 13 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 14 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 15 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 19 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 20 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 21 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 22 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 23 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 24 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 25 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 26 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 27 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 28 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 29 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 30 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 33 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 39 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 42 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 51 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 86 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 91 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 93 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 96 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 104 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 106 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 110 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 111 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 112 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 113 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 114 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 115 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 116 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 117 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 118 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 119 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 120 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 121 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 122 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 123 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 124 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 126 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 127 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 128 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 129 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 131 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 133 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 134 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 135 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 136 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 137 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 139 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 140 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 141 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 142 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 143 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 144 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 145 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 146 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 147 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 148 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 150 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 151 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 152 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 153 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 169 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 172 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 173 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 174 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 190 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 191 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 192 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 193 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 194 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 271 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 282 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 286 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 287 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 288 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 289 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 293 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 294 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 295 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 296 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 297 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 298 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 299 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 300 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 301 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 302 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 303 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 304 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 305 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 306 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 307 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 308 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 309 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 310 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 311 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 312 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 313 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 314 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 315 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 316 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 317 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 318 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 319 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 320 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 321 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 322 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 323 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 324 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 325 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 326 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 327 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 328 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 329 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 330 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 331 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 332 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 333 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 334 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 335 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 336 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 337 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 338 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 339 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 340 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 341 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 342 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 343 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 344 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 345 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 346 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 347 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 348 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 349 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 350 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 351 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 352 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 353 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 354 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 355 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 356 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 357 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 358 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 359 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 360 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 361 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 362 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 363 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 364 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 365 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 366 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 367 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 368 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 369 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 370 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 371 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 372 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 373 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 374 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 375 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 376 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 377 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 378 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 379 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 380 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 381 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 382 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 383 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 384 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 385 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 386 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 387 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 388 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 389 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 390 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 391 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 392 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 393 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 394 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 395 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 396 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 397 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 398 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 474 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 475 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 476 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 477 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 478 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 479 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 480 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 481 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 482 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 483 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 484 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 485 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 486 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 487 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 488 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 489 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 490 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 491 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 492 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 493 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 494 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 495 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 517 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 518 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 519 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 520 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 522 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 523 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 525 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 528 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 529 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 530 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 531 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 532 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 533 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 534 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 535 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 536 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 537 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 538 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 539 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 540 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 544 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 547 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 551 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 552 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 553 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 554 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 555 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 556 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 557 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 558 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 559 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 560 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 561 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 562 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 563 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 564 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 565 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 566 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 567 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 568 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 569 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 570 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 571 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 572 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 573 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 574 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 577 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 578 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 579 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 580 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 581 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 582 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 583 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 584 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 585 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 586 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 587 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 588 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 589 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 590 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 591 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.08 |
| Metatranscriptomes | 0.23 |
| Isolates | 0.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.29 |
| Nodule | 0.37 |
| Rhizoplane | 7.5 |
| Rhizosphere | 84.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0530510_0091635 | 3300061734 | Bacteria | 2218 |
| 2 | SwRhRL2b_contig_103294 | 2162886007 | Bacteria | 4113 |
| 3 | 2214828525 | 2209111006 | Bacteria | 9988 |
| 4 | ARcpr5oldR_c000051 | 3300000041 | Bacteria | 21598 |
| 5 | ARSoilYngRDRAFT_c00005 | 3300000042 | Bacteria | 35497 |
| 6 | ARcpr5yngRDRAFT_c000005 | 3300000043 | Bacteria | 45740 |
| 7 | ARSoilOldRDRAFT_c000003 | 3300000044 | Bacteria | 63923 |
| 8 | ARCol0oldRDRAFT_c00049 | 3300000045 | Bacteria | 9332 |
| 9 | CNBas_1002440 | 3300000531 | Bacteria | 1025 |
| 10 | ARCol0yngRDRAFT_1000007 | 3300000652 | Bacteria | 46089 |
| 11 | SwM_106758 | 3300001224 | Bacteria | 828 |
| 12 | JGI24032J14994_100411 | 3300001430 | Bacteria | 2245 |
| 13 | JGI24741J21665_1003075 | 3300001915 | Bacteria | 4102 |
| 14 | JGI24752J21851_1002865 | 3300001976 | Bacteria | 2288 |
| 15 | JGI24752J21851_1003059 | 3300001976 | Bacteria | 2213 |
| 16 | JGI24746J21847_1000487 | 3300001977 | Bacteria | 5944 |
| 17 | JGI24746J21847_1005435 | 3300001977 | Bacteria | 1987 |
| 18 | JGI24739J22299_10000027 | 3300001989 | Bacteria | 42306 |
| 19 | JGI24739J22299_10047696 | 3300001989 | Bacteria | 1396 |
| 20 | JGI24739J22299_10081951 | 3300001989 | Bacteria | 990 |
| 21 | JGI24737J22298_10006724 | 3300001990 | Bacteria | 3912 |
| 22 | JGI24737J22298_10008091 | 3300001990 | Bacteria | 3533 |
| 23 | JGI24743J22301_10001138 | 3300001991 | Bacteria | 3570 |
| 24 | JGI24743J22301_10008358 | 3300001991 | Bacteria | 1815 |
| 25 | JGI24750J21931_1000003 | 3300002070 | Bacteria | 26303 |
| 26 | JGI24745J21846_1000027 | 3300002073 | Bacteria | 9524 |
| 27 | JGI24745J21846_1006416 | 3300002073 | Bacteria | 1305 |
| 28 | JGI24748J21848_1000421 | 3300002074 | Bacteria | 4723 |
| 29 | JGI24738J21930_10000032 | 3300002075 | Bacteria | 26331 |
| 30 | JGI24749J21850_1000320 | 3300002076 | Bacteria | 7353 |
| 31 | JGI24749J21850_1004740 | 3300002076 | Bacteria | 1905 |
| 32 | JGI24749J21850_1008927 | 3300002076 | Bacteria | 1400 |
| 33 | JGI24744J21845_10001709 | 3300002077 | Bacteria | 4402 |
| 34 | JGI24035J26624_1000017 | 3300002126 | Bacteria | 12601 |
| 35 | JGI24033J26618_1000528 | 3300002155 | Bacteria | 3715 |
| 36 | JGI24033J26618_1006673 | 3300002155 | Bacteria | 1300 |
| 37 | JGI24034J26672_10002708 | 3300002239 | Bacteria | 2441 |
| 38 | JGI24034J26672_10004055 | 3300002239 | Bacteria | 2064 |
| 39 | JGI24034J26672_10004686 | 3300002239 | Bacteria | 1945 |
| 40 | JGI24742J22300_10000479 | 3300002244 | Bacteria | 5952 |
| 41 | JGI24742J22300_10006180 | 3300002244 | Bacteria | 1975 |
| 42 | JGI24742J22300_10014308 | 3300002244 | Bacteria | 1333 |
| 43 | JGI24751J29686_10002694 | 3300002459 | Bacteria | 3578 |
| 44 | JGI24751J29686_10007181 | 3300002459 | Bacteria | 2276 |
| 45 | JGI25406J46586_10044912 | 3300003203 | Bacteria | 1526 |
| 46 | JGI25153J46596_10026532 | 3300003215 | Bacteria | 2048 |
| 47 | JGI25404J52841_10020892 | 3300003659 | Bacteria | 1417 |
| 48 | Ga0055524_1026287 | 3300003775 | Bacteria | 1803 |
| 49 | Ga0055536_1001690 | 3300003781 | Bacteria | 13057 |
| 50 | Ga0055540_1009128 | 3300003792 | Bacteria | 3471 |
| 51 | Ga0055531_10006983 | 3300003794 | Bacteria | 6271 |
| 52 | JGI25405J52794_10002320 | 3300003911 | Bacteria | 3268 |
| 53 | JGI25405J52794_10008886 | 3300003911 | Bacteria | 1886 |
| 54 | Ga0065717_1001936 | 3300005276 | Bacteria | 9530 |
| 55 | Ga0065716_1001733 | 3300005277 | Bacteria | 3727 |
| 56 | Ga0065704_10071648 | 3300005289 | Bacteria | 10386 |
| 57 | Ga0065712_10069491 | 3300005290 | Bacteria | 7192 |
| 58 | Ga0065712_10069860 | 3300005290 | Bacteria | 6603 |
| 59 | Ga0065712_10071460 | 3300005290 | Bacteria | 5250 |
| 60 | Ga0065715_10002372 | 3300005293 | Bacteria | 8813 |
| 61 | Ga0065715_10089909 | 3300005293 | Bacteria | 8156 |
| 62 | Ga0065707_10089899 | 3300005295 | Bacteria | 4256 |
| 63 | Ga0065707_10237060 | 3300005295 | Bacteria | 1169 |
| 64 | Ga0070658_10060574 | 3300005327 | Bacteria | 3083 |
| 65 | Ga0070658_10112610 | 3300005327 | Bacteria | 2255 |
| 66 | Ga0070676_10001346 | 3300005328 | Bacteria | 12342 |
| 67 | Ga0070676_10064265 | 3300005328 | Bacteria | 2188 |
| 68 | Ga0070676_10172931 | 3300005328 | Bacteria | 1399 |
| 69 | Ga0070676_10188218 | 3300005328 | Bacteria | 1346 |
| 70 | Ga0070676_10215012 | 3300005328 | Bacteria | 1267 |
| 71 | Ga0070683_100002452 | 3300005329 | Bacteria | 14754 |
| 72 | Ga0070683_100396768 | 3300005329 | Bacteria | 1315 |
| 73 | Ga0070690_100006735 | 3300005330 | Bacteria | 6528 |
| 74 | Ga0070690_100038138 | 3300005330 | Bacteria | 3030 |
| 75 | Ga0070690_100038458 | 3300005330 | Bacteria | 3020 |
| 76 | Ga0070690_100056679 | 3300005330 | Bacteria | 2513 |
| 77 | Ga0070690_100082686 | 3300005330 | Bacteria | 2102 |
| 78 | Ga0070690_100325641 | 3300005330 | Bacteria | 1109 |
| 79 | Ga0070690_100427276 | 3300005330 | Bacteria | 978 |
| 80 | Ga0070690_100550881 | 3300005330 | Bacteria | 869 |
| 81 | Ga0070670_100019209 | 3300005331 | Bacteria | 5860 |
| 82 | Ga0070670_100020107 | 3300005331 | Bacteria | 5735 |
| 83 | Ga0070670_100035824 | 3300005331 | Bacteria | 4272 |
| 84 | Ga0070670_100037375 | 3300005331 | Bacteria | 4178 |
| 85 | Ga0070677_10000240 | 3300005333 | Bacteria | 19034 |
| 86 | Ga0068869_100000013 | 3300005334 | Bacteria | 73970 |
| 87 | Ga0070666_10014037 | 3300005335 | Bacteria | 5094 |
| 88 | Ga0070666_10146036 | 3300005335 | Bacteria | 1648 |
| 89 | Ga0070680_100001807 | 3300005336 | Bacteria | 15715 |
| 90 | Ga0070680_100015245 | 3300005336 | Bacteria | 6022 |
| 91 | Ga0070680_100022501 | 3300005336 | Bacteria | 5021 |
| 92 | Ga0070680_100091598 | 3300005336 | Bacteria | 2516 |
| 93 | Ga0070680_100267422 | 3300005336 | Bacteria | 1447 |
| 94 | Ga0070680_100484131 | 3300005336 | Bacteria | 1058 |
| 95 | Ga0070682_100000611 | 3300005337 | Bacteria | 21716 |
| 96 | Ga0070682_100066793 | 3300005337 | Bacteria | 2289 |
| 97 | Ga0070682_100121945 | 3300005337 | Bacteria | 1752 |
| 98 | Ga0070682_100191438 | 3300005337 | Bacteria | 1436 |
| 99 | Ga0070682_100192842 | 3300005337 | Bacteria | 1432 |
| 100 | Ga0068868_100010701 | 3300005338 | Bacteria | 6650 |
| 101 | Ga0068868_100018781 | 3300005338 | Bacteria | 5171 |
| 102 | Ga0068868_100050631 | 3300005338 | Bacteria | 3263 |
| 103 | Ga0068868_100428396 | 3300005338 | Bacteria | 1147 |
| 104 | Ga0070660_100000554 | 3300005339 | Bacteria | 25071 |
| 105 | Ga0070660_100013100 | 3300005339 | Bacteria | 5938 |
| 106 | Ga0070660_100023479 | 3300005339 | Bacteria | 4568 |
| 107 | Ga0070660_100137260 | 3300005339 | Bacteria | 1960 |
| 108 | Ga0070660_100355120 | 3300005339 | Bacteria | 1208 |
| 109 | Ga0070660_100441865 | 3300005339 | Bacteria | 1078 |
| 110 | Ga0070689_100005543 | 3300005340 | Bacteria | 8632 |
| 111 | Ga0070689_100007858 | 3300005340 | Bacteria | 7478 |
| 112 | Ga0070689_100014756 | 3300005340 | Bacteria | 5684 |
| 113 | Ga0070689_100037914 | 3300005340 | Bacteria | 3686 |
| 114 | Ga0070689_100059973 | 3300005340 | Bacteria | 2957 |
| 115 | Ga0070691_10000093 | 3300005341 | Bacteria | 25708 |
| 116 | Ga0070691_10012176 | 3300005341 | Bacteria | 3939 |
| 117 | Ga0070691_10025049 | 3300005341 | Bacteria | 2776 |
| 118 | Ga0070691_10026914 | 3300005341 | Bacteria | 2682 |
| 119 | Ga0070687_100000097 | 3300005343 | Bacteria | 28900 |
| 120 | Ga0070687_100014202 | 3300005343 | Bacteria | 3572 |
| 121 | Ga0070687_100064527 | 3300005343 | Bacteria | 1946 |
| 122 | Ga0070687_100071834 | 3300005343 | Bacteria | 1861 |
| 123 | Ga0070687_100267592 | 3300005343 | Bacteria | 1070 |
| 124 | Ga0070661_100000228 | 3300005344 | Bacteria | 46622 |
| 125 | Ga0070661_100056368 | 3300005344 | Bacteria | 2879 |
| 126 | Ga0070661_100443636 | 3300005344 | Bacteria | 1032 |
| 127 | Ga0070692_10052614 | 3300005345 | Bacteria | 2121 |
| 128 | Ga0070668_100004073 | 3300005347 | Bacteria | 10828 |
| 129 | Ga0070668_100047757 | 3300005347 | Bacteria | 3291 |
| 130 | Ga0070668_100072567 | 3300005347 | Bacteria | 2682 |
| 131 | Ga0070668_100155362 | 3300005347 | Bacteria | 1853 |
| 132 | Ga0070669_100000368 | 3300005353 | Bacteria | 34899 |
| 133 | Ga0070669_100079252 | 3300005353 | Bacteria | 2442 |
| 134 | Ga0070675_100000752 | 3300005354 | Bacteria | 22581 |
| 135 | Ga0070675_100008586 | 3300005354 | Bacteria | 7931 |
| 136 | Ga0070675_100149971 | 3300005354 | Bacteria | 1999 |
| 137 | Ga0070675_100272096 | 3300005354 | Bacteria | 1487 |
| 138 | Ga0070675_100342940 | 3300005354 | Bacteria | 1323 |
| 139 | Ga0070671_100000142 | 3300005355 | Bacteria | 46386 |
| 140 | Ga0070671_100010354 | 3300005355 | Bacteria | 7480 |
| 141 | Ga0070671_100011531 | 3300005355 | Bacteria | 7107 |
| 142 | Ga0070671_100071428 | 3300005355 | Bacteria | 2897 |
| 143 | Ga0070671_100095786 | 3300005355 | Bacteria | 2488 |
| 144 | Ga0070671_100099630 | 3300005355 | Bacteria | 2437 |
| 145 | Ga0070674_100090668 | 3300005356 | Bacteria | 2205 |
| 146 | Ga0070673_100007057 | 3300005364 | Bacteria | 7369 |
| 147 | Ga0070673_100142110 | 3300005364 | Bacteria | 2026 |
| 148 | Ga0070673_100151560 | 3300005364 | Bacteria | 1964 |
| 149 | Ga0070673_100269417 | 3300005364 | Bacteria | 1490 |
| 150 | Ga0070673_100435297 | 3300005364 | Bacteria | 1178 |
| 151 | Ga0070688_100020344 | 3300005365 | Bacteria | 3857 |
| 152 | Ga0070688_100056806 | 3300005365 | Bacteria | 2459 |
| 153 | Ga0070688_100107996 | 3300005365 | Bacteria | 1846 |
| 154 | Ga0070659_100000183 | 3300005366 | Bacteria | 47789 |
| 155 | Ga0070659_100025219 | 3300005366 | Bacteria | 4563 |
| 156 | Ga0070659_100054734 | 3300005366 | Bacteria | 3143 |
| 157 | Ga0070659_100094213 | 3300005366 | Bacteria | 2404 |
| 158 | Ga0070659_100390899 | 3300005366 | Bacteria | 1173 |
| 159 | Ga0070667_100005458 | 3300005367 | Bacteria | 10620 |
| 160 | Ga0070667_100074773 | 3300005367 | Bacteria | 2891 |
| 161 | Ga0070703_10014438 | 3300005406 | Bacteria | 2250 |
| 162 | Ga0070709_10014058 | 3300005434 | Bacteria | 4518 |
| 163 | Ga0070709_10053514 | 3300005434 | Bacteria | 2542 |
| 164 | Ga0070709_10088689 | 3300005434 | Bacteria | 2035 |
| 165 | Ga0070714_100108241 | 3300005435 | Bacteria | 2457 |
| 166 | Ga0070714_100356557 | 3300005435 | Bacteria | 1374 |
| 167 | Ga0070714_100567442 | 3300005435 | Bacteria | 1088 |
| 168 | Ga0070713_100026299 | 3300005436 | Bacteria | 4566 |
| 169 | Ga0070713_100051151 | 3300005436 | Bacteria | 3416 |
| 170 | Ga0070713_100103256 | 3300005436 | Bacteria | 2473 |
| 171 | Ga0070713_100117558 | 3300005436 | Bacteria | 2327 |
| 172 | Ga0070713_100126719 | 3300005436 | Bacteria | 2247 |
| 173 | Ga0070713_100128660 | 3300005436 | Bacteria | 2231 |
| 174 | Ga0070713_100153972 | 3300005436 | Bacteria | 2047 |
| 175 | Ga0070713_100250349 | 3300005436 | Bacteria | 1616 |
| 176 | Ga0070710_10021492 | 3300005437 | Bacteria | 3364 |
| 177 | Ga0070710_10035682 | 3300005437 | Bacteria | 2713 |
| 178 | Ga0070710_10096932 | 3300005437 | Bacteria | 1749 |
| 179 | Ga0070710_10218412 | 3300005437 | Bacteria | 1212 |
| 180 | Ga0070710_10259224 | 3300005437 | Bacteria | 1120 |
| 181 | Ga0070701_10000008 | 3300005438 | Bacteria | 53317 |
| 182 | Ga0070701_10049861 | 3300005438 | Bacteria | 2166 |
| 183 | Ga0070701_10061601 | 3300005438 | Bacteria | 1979 |
| 184 | Ga0070711_100003097 | 3300005439 | Bacteria | 9618 |
| 185 | Ga0070711_100026562 | 3300005439 | Bacteria | 3794 |
| 186 | Ga0070711_100029559 | 3300005439 | Bacteria | 3617 |
| 187 | Ga0070711_100033924 | 3300005439 | Bacteria | 3401 |
| 188 | Ga0070711_100062238 | 3300005439 | Bacteria | 2601 |
| 189 | Ga0070711_100069294 | 3300005439 | Bacteria | 2481 |
| 190 | Ga0070711_100124194 | 3300005439 | Bacteria | 1914 |
| 191 | Ga0070711_100187201 | 3300005439 | Bacteria | 1588 |
| 192 | Ga0070705_100074101 | 3300005440 | Bacteria | 2068 |
| 193 | Ga0070700_100001950 | 3300005441 | Bacteria | 10465 |
| 194 | Ga0070700_100005827 | 3300005441 | Bacteria | 6539 |
| 195 | Ga0070700_100008830 | 3300005441 | Bacteria | 5507 |
| 196 | Ga0070700_100045582 | 3300005441 | Bacteria | 2705 |
| 197 | Ga0070700_100276060 | 3300005441 | Bacteria | 1216 |
| 198 | Ga0070700_100667213 | 3300005441 | Bacteria | 823 |
| 199 | Ga0070694_100001186 | 3300005444 | Bacteria | 14984 |
| 200 | Ga0070694_100080518 | 3300005444 | Bacteria | 2263 |
| 201 | Ga0070694_100089169 | 3300005444 | Bacteria | 2161 |
| 202 | Ga0070708_100099590 | 3300005445 | Bacteria | 2659 |
| 203 | Ga0070708_100100031 | 3300005445 | Bacteria | 2653 |
| 204 | Ga0070708_100239063 | 3300005445 | Bacteria | 1705 |
| 205 | Ga0070708_100251856 | 3300005445 | Bacteria | 1659 |
| 206 | Ga0070708_100283793 | 3300005445 | Bacteria | 1558 |
| 207 | Ga0070708_100353560 | 3300005445 | Bacteria | 1385 |
| 208 | Ga0070708_100645067 | 3300005445 | Bacteria | 998 |
| 209 | Ga0070663_100000385 | 3300005455 | Bacteria | 23230 |
| 210 | Ga0070663_100036093 | 3300005455 | Bacteria | 3433 |
| 211 | Ga0070678_100001994 | 3300005456 | Bacteria | 11025 |
| 212 | Ga0070678_100012171 | 3300005456 | Bacteria | 5337 |
| 213 | Ga0070678_100215214 | 3300005456 | Bacteria | 1594 |
| 214 | Ga0070678_100271298 | 3300005456 | Bacteria | 1431 |
| 215 | Ga0070662_100003682 | 3300005457 | Bacteria | 9580 |
| 216 | Ga0070662_100009811 | 3300005457 | Bacteria | 6272 |
| 217 | Ga0070662_100010178 | 3300005457 | Bacteria | 6165 |
| 218 | Ga0070662_100059826 | 3300005457 | Bacteria | 2776 |
| 219 | Ga0070662_100129850 | 3300005457 | Bacteria | 1941 |
| 220 | Ga0070681_10008332 | 3300005458 | Bacteria | 10153 |
| 221 | Ga0070681_10047059 | 3300005458 | Bacteria | 4311 |
| 222 | Ga0070681_10145682 | 3300005458 | Bacteria | 2297 |
| 223 | Ga0070681_10217724 | 3300005458 | Bacteria | 1825 |
| 224 | Ga0070681_10252174 | 3300005458 | Bacteria | 1677 |
| 225 | Ga0068867_100000160 | 3300005459 | Bacteria | 43656 |
| 226 | Ga0070685_10128882 | 3300005466 | Bacteria | 1580 |
| 227 | Ga0070685_10321057 | 3300005466 | Bacteria | 1049 |
| 228 | Ga0070706_100040915 | 3300005467 | Bacteria | 4279 |
| 229 | Ga0070706_100526234 | 3300005467 | Bacteria | 1100 |
| 230 | Ga0070706_100556637 | 3300005467 | Bacteria | 1067 |
| 231 | Ga0070707_100219196 | 3300005468 | Bacteria | 1853 |
| 232 | Ga0070707_100522148 | 3300005468 | Bacteria | 1149 |
| 233 | Ga0070698_100722378 | 3300005471 | Bacteria | 939 |
| 234 | Ga0074259_10011108 | 3300005507 | Bacteria | 1266 |
| 235 | Ga0070699_100065122 | 3300005518 | Bacteria | 3162 |
| 236 | Ga0070699_100552794 | 3300005518 | Bacteria | 1048 |
| 237 | Ga0070679_100017517 | 3300005530 | Bacteria | 6935 |
| 238 | Ga0070679_100048351 | 3300005530 | Bacteria | 4238 |
| 239 | Ga0070679_100077883 | 3300005530 | Bacteria | 3304 |
| 240 | Ga0070679_100104854 | 3300005530 | Bacteria | 2813 |
| 241 | Ga0070679_100115052 | 3300005530 | Bacteria | 2675 |
| 242 | Ga0070679_100156421 | 3300005530 | Bacteria | 2254 |
| 243 | Ga0070679_100276899 | 3300005530 | Bacteria | 1631 |
| 244 | Ga0070679_100407853 | 3300005530 | Bacteria | 1304 |
| 245 | Ga0070679_100523416 | 3300005530 | Bacteria | 1130 |
| 246 | Ga0070684_100004278 | 3300005535 | Bacteria | 10824 |
| 247 | Ga0070684_100256293 | 3300005535 | Bacteria | 1600 |
| 248 | Ga0070697_100210394 | 3300005536 | Bacteria | 1655 |
| 249 | Ga0070697_100401129 | 3300005536 | Bacteria | 1190 |
| 250 | Ga0070697_100403873 | 3300005536 | Bacteria | 1186 |
| 251 | Ga0068853_100017859 | 3300005539 | Bacteria | 5860 |
| 252 | Ga0068853_100065138 | 3300005539 | Bacteria | 3162 |
| 253 | Ga0068853_100258612 | 3300005539 | Bacteria | 1600 |
| 254 | Ga0068853_100614488 | 3300005539 | Bacteria | 1033 |
| 255 | Ga0070672_100000348 | 3300005543 | Bacteria | 26680 |
| 256 | Ga0070672_100009899 | 3300005543 | Bacteria | 6591 |
| 257 | Ga0070672_100127133 | 3300005543 | Bacteria | 2091 |
| 258 | Ga0070686_100000688 | 3300005544 | Bacteria | 19665 |
| 259 | Ga0070686_100056657 | 3300005544 | Bacteria | 2514 |
| 260 | Ga0070686_100066046 | 3300005544 | Bacteria | 2351 |
| 261 | Ga0070695_100008662 | 3300005545 | Bacteria | 6045 |
| 262 | Ga0070695_100018808 | 3300005545 | Bacteria | 4199 |
| 263 | Ga0070695_100196585 | 3300005545 | Bacteria | 1438 |
| 264 | Ga0070696_100007141 | 3300005546 | Bacteria | 7460 |
| 265 | Ga0070696_100047322 | 3300005546 | Bacteria | 2984 |
| 266 | Ga0070696_100134936 | 3300005546 | Bacteria | 1799 |
| 267 | Ga0070696_100373843 | 3300005546 | Bacteria | 1109 |
| 268 | Ga0070693_100001722 | 3300005547 | Bacteria | 9947 |
| 269 | Ga0070693_100043419 | 3300005547 | Bacteria | 2539 |
| 270 | Ga0070693_100049011 | 3300005547 | Bacteria | 2408 |
| 271 | Ga0070693_100167687 | 3300005547 | Bacteria | 1404 |
| 272 | Ga0070665_100023397 | 3300005548 | Bacteria | 6219 |
| 273 | Ga0070665_100025642 | 3300005548 | Bacteria | 5939 |
| 274 | Ga0070665_100042480 | 3300005548 | Bacteria | 4570 |
| 275 | Ga0070665_100084962 | 3300005548 | Bacteria | 3170 |
| 276 | Ga0070665_100154853 | 3300005548 | Bacteria | 2294 |
| 277 | Ga0070665_100618980 | 3300005548 | Bacteria | 1096 |
| 278 | Ga0070704_100008342 | 3300005549 | Bacteria | 6207 |
| 279 | Ga0070704_100077073 | 3300005549 | Bacteria | 2441 |
| 280 | Ga0070704_100147222 | 3300005549 | Bacteria | 1847 |
| 281 | Ga0070704_100345255 | 3300005549 | Bacteria | 1255 |
| 282 | Ga0070704_100374657 | 3300005549 | Bacteria | 1208 |
| 283 | Ga0068855_100005199 | 3300005563 | Bacteria | 15872 |
| 284 | Ga0068855_100014630 | 3300005563 | Bacteria | 9450 |
| 285 | Ga0068855_100028763 | 3300005563 | Bacteria | 6649 |
| 286 | Ga0068855_100167649 | 3300005563 | Bacteria | 2488 |
| 287 | Ga0068855_100261036 | 3300005563 | Bacteria | 1929 |
| 288 | Ga0070664_100021119 | 3300005564 | Bacteria | 5364 |
| 289 | Ga0070664_100033837 | 3300005564 | Bacteria | 4284 |
| 290 | Ga0070664_100255936 | 3300005564 | Bacteria | 1575 |
| 291 | Ga0068857_100000307 | 3300005577 | Bacteria | 33926 |
| 292 | Ga0068854_100000131 | 3300005578 | Bacteria | 51521 |
| 293 | Ga0068854_100032775 | 3300005578 | Bacteria | 3617 |
| 294 | Ga0068856_100001866 | 3300005614 | Bacteria | 21986 |
| 295 | Ga0068856_100355506 | 3300005614 | Bacteria | 1484 |
| 296 | Ga0068856_100658686 | 3300005614 | Bacteria | 1067 |
| 297 | Ga0070702_100000197 | 3300005615 | Bacteria | 19661 |
| 298 | Ga0070702_100093165 | 3300005615 | Bacteria | 1831 |
| 299 | Ga0068852_100000151 | 3300005616 | Bacteria | 46414 |
| 300 | Ga0068852_100036565 | 3300005616 | Bacteria | 4110 |
| 301 | Ga0068852_100219594 | 3300005616 | Bacteria | 1807 |
| 302 | Ga0068852_100255172 | 3300005616 | Bacteria | 1681 |
| 303 | Ga0068859_100018300 | 3300005617 | Bacteria | 7043 |
| 304 | Ga0068859_100100457 | 3300005617 | Bacteria | 2948 |
| 305 | Ga0068859_100227137 | 3300005617 | Bacteria | 1955 |
| 306 | Ga0068859_100445267 | 3300005617 | Bacteria | 1391 |
| 307 | Ga0068859_100479110 | 3300005617 | Bacteria | 1340 |
| 308 | Ga0068859_101154642 | 3300005617 | Bacteria | 852 |
| 309 | Ga0068864_100001095 | 3300005618 | Bacteria | 22704 |
| 310 | Ga0068864_100024767 | 3300005618 | Bacteria | 5048 |
| 311 | Ga0068866_10001144 | 3300005718 | Bacteria | 11653 |
| 312 | Ga0068866_10188871 | 3300005718 | Bacteria | 1223 |
| 313 | Ga0068861_100000436 | 3300005719 | Bacteria | 24224 |
| 314 | Ga0068861_100101811 | 3300005719 | Bacteria | 2286 |
| 315 | Ga0068861_100151746 | 3300005719 | Bacteria | 1902 |
| 316 | Ga0068861_100237244 | 3300005719 | Bacteria | 1549 |
| 317 | Ga0068861_100295240 | 3300005719 | Bacteria | 1401 |
| 318 | Ga0068851_10043282 | 3300005834 | Bacteria | 2269 |
| 319 | Ga0068851_10092720 | 3300005834 | Bacteria | 1592 |
| 320 | Ga0068870_10000120 | 3300005840 | Bacteria | 26776 |
| 321 | Ga0068870_10000985 | 3300005840 | Bacteria | 11236 |
| 322 | Ga0068870_10075164 | 3300005840 | Bacteria | 1853 |
| 323 | Ga0068863_100000418 | 3300005841 | Bacteria | 43162 |
| 324 | Ga0068863_100119754 | 3300005841 | Bacteria | 2509 |
| 325 | Ga0068863_100290787 | 3300005841 | Bacteria | 1584 |
| 326 | Ga0068858_100015337 | 3300005842 | Bacteria | 7208 |
| 327 | Ga0068858_100086580 | 3300005842 | Bacteria | 2914 |
| 328 | Ga0068858_100126013 | 3300005842 | Bacteria | 2398 |
| 329 | Ga0068858_100145088 | 3300005842 | Bacteria | 2229 |
| 330 | Ga0068858_100306920 | 3300005842 | Bacteria | 1515 |
| 331 | Ga0068860_100004963 | 3300005843 | Bacteria | 13563 |
| 332 | Ga0068860_100103776 | 3300005843 | Bacteria | 2714 |
| 333 | Ga0068860_100106624 | 3300005843 | Bacteria | 2676 |
| 334 | Ga0068860_100148273 | 3300005843 | Bacteria | 2258 |
| 335 | Ga0068862_100029273 | 3300005844 | Bacteria | 4639 |
| 336 | Ga0068862_100483181 | 3300005844 | Bacteria | 1173 |
| 337 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 338 | Ga0081455_10001354 | 3300005937 | Bacteria | 30285 |
| 339 | Ga0081455_10006240 | 3300005937 | Bacteria | 12834 |
| 340 | Ga0081455_10012128 | 3300005937 | Bacteria | 8612 |
| 341 | Ga0081455_10027662 | 3300005937 | Bacteria | 5194 |
| 342 | Ga0081455_10053652 | 3300005937 | Bacteria | 3443 |
| 343 | Ga0081455_10343110 | 3300005937 | Bacteria | 1056 |
| 344 | Ga0081538_10011656 | 3300005981 | Bacteria | 7108 |
| 345 | Ga0081538_10053528 | 3300005981 | Bacteria | 2398 |
| 346 | Ga0081540_1000166 | 3300005983 | Bacteria | 68242 |
| 347 | Ga0081540_1002025 | 3300005983 | Bacteria | 16912 |
| 348 | Ga0081540_1015548 | 3300005983 | Bacteria | 4813 |
| 349 | Ga0081540_1016475 | 3300005983 | Bacteria | 4622 |
| 350 | Ga0081540_1061250 | 3300005983 | Bacteria | 1795 |
| 351 | Ga0081540_1113203 | 3300005983 | Bacteria | 1142 |
| 352 | Ga0081540_1156102 | 3300005983 | Bacteria | 892 |
| 353 | Ga0081539_10010724 | 3300005985 | Bacteria | 7384 |
| 354 | Ga0081539_10044788 | 3300005985 | Bacteria | 2551 |
| 355 | Ga0081539_10140099 | 3300005985 | Bacteria | 1176 |
| 356 | Ga0070717_10013275 | 3300006028 | Bacteria | 6306 |
| 357 | Ga0070717_10036603 | 3300006028 | Bacteria | 3981 |
| 358 | Ga0070717_10040398 | 3300006028 | Bacteria | 3799 |
| 359 | Ga0070717_10043212 | 3300006028 | Bacteria | 3677 |
| 360 | Ga0070717_10185683 | 3300006028 | Bacteria | 1814 |
| 361 | Ga0070717_10267089 | 3300006028 | Bacteria | 1515 |
| 362 | Ga0070717_10390143 | 3300006028 | Bacteria | 1249 |
| 363 | Ga0070717_10896061 | 3300006028 | Bacteria | 807 |
| 364 | Ga0075365_10002199 | 3300006038 | Bacteria | 9406 |
| 365 | Ga0075365_10007282 | 3300006038 | Bacteria | 6186 |
| 366 | Ga0075365_10015116 | 3300006038 | Bacteria | 4661 |
| 367 | Ga0075365_10079674 | 3300006038 | Bacteria | 2216 |
| 368 | Ga0075365_10293793 | 3300006038 | Bacteria | 1143 |
| 369 | Ga0075368_10050125 | 3300006042 | Bacteria | 1657 |
| 370 | Ga0075363_100003290 | 3300006048 | Bacteria | 6844 |
| 371 | Ga0075363_100046416 | 3300006048 | Bacteria | 2304 |
| 372 | Ga0075363_100117367 | 3300006048 | Bacteria | 1483 |
| 373 | Ga0075364_10003576 | 3300006051 | Bacteria | 8850 |
| 374 | Ga0075364_10048755 | 3300006051 | Bacteria | 2760 |
| 375 | Ga0075364_10048826 | 3300006051 | Bacteria | 2759 |
| 376 | Ga0075364_10156148 | 3300006051 | Bacteria | 1539 |
| 377 | Ga0075364_10160278 | 3300006051 | Bacteria | 1518 |
| 378 | Ga0070715_10004035 | 3300006163 | Bacteria | 4763 |
| 379 | Ga0070715_10071020 | 3300006163 | Bacteria | 1555 |
| 380 | Ga0070715_10082331 | 3300006163 | Bacteria | 1464 |
| 381 | Ga0070715_10134237 | 3300006163 | Bacteria | 1195 |
| 382 | Ga0070716_100032365 | 3300006173 | Bacteria | 2851 |
| 383 | Ga0070716_100167105 | 3300006173 | Bacteria | 1432 |
| 384 | Ga0070716_100303562 | 3300006173 | Bacteria | 1111 |
| 385 | Ga0070712_100021809 | 3300006175 | Bacteria | 4213 |
| 386 | Ga0070712_100022609 | 3300006175 | Bacteria | 4144 |
| 387 | Ga0070712_100037456 | 3300006175 | Bacteria | 3306 |
| 388 | Ga0070712_100054250 | 3300006175 | Bacteria | 2802 |
| 389 | Ga0070712_100065597 | 3300006175 | Bacteria | 2577 |
| 390 | Ga0070712_100069678 | 3300006175 | Bacteria | 2510 |
| 391 | Ga0070712_100104739 | 3300006175 | Bacteria | 2100 |
| 392 | Ga0070712_100111932 | 3300006175 | Bacteria | 2039 |
| 393 | Ga0070712_100150909 | 3300006175 | Bacteria | 1784 |
| 394 | Ga0070712_100234045 | 3300006175 | Bacteria | 1460 |
| 395 | Ga0070712_100257634 | 3300006175 | Bacteria | 1397 |
| 396 | Ga0070712_100323361 | 3300006175 | Bacteria | 1255 |
| 397 | Ga0070712_100435213 | 3300006175 | Bacteria | 1089 |
| 398 | Ga0070712_100616661 | 3300006175 | Bacteria | 919 |
| 399 | Ga0070712_100657811 | 3300006175 | Bacteria | 891 |
| 400 | Ga0075362_10011461 | 3300006177 | Bacteria | 3492 |
| 401 | Ga0075362_10037226 | 3300006177 | Bacteria | 2132 |
| 402 | Ga0075362_10103811 | 3300006177 | Bacteria | 1332 |
| 403 | Ga0075362_10128187 | 3300006177 | Bacteria | 1205 |
| 404 | Ga0075367_10011511 | 3300006178 | Bacteria | 4685 |
| 405 | Ga0075367_10017973 | 3300006178 | Bacteria | 3893 |
| 406 | Ga0075367_10032143 | 3300006178 | Bacteria | 3017 |
| 407 | Ga0075367_10045294 | 3300006178 | Bacteria | 2581 |
| 408 | Ga0075367_10124301 | 3300006178 | Bacteria | 1591 |
| 409 | Ga0075367_10243531 | 3300006178 | Bacteria | 1127 |
| 410 | Ga0075367_10335353 | 3300006178 | Bacteria | 954 |
| 411 | Ga0075369_10076405 | 3300006186 | Bacteria | 1480 |
| 412 | Ga0075369_10080932 | 3300006186 | Bacteria | 1440 |
| 413 | Ga0075427_10000036 | 3300006194 | Bacteria | 9339 |
| 414 | Ga0075366_10001260 | 3300006195 | Bacteria | 12585 |
| 415 | Ga0075366_10018230 | 3300006195 | Bacteria | 4050 |
| 416 | Ga0075366_10266495 | 3300006195 | Bacteria | 1046 |
| 417 | Ga0075366_10338888 | 3300006195 | Bacteria | 922 |
| 418 | Ga0097621_100000887 | 3300006237 | Bacteria | 20959 |
| 419 | Ga0097621_100113804 | 3300006237 | Bacteria | 2288 |
| 420 | Ga0097621_100208933 | 3300006237 | Bacteria | 1697 |
| 421 | Ga0097621_100224616 | 3300006237 | Bacteria | 1637 |
| 422 | Ga0075370_10077581 | 3300006353 | Bacteria | 1906 |
| 423 | Ga0075370_10335825 | 3300006353 | Bacteria | 901 |
| 424 | Ga0068871_100000484 | 3300006358 | Bacteria | 27198 |
| 425 | Ga0068871_100001991 | 3300006358 | Bacteria | 13829 |
| 426 | Ga0068871_100020759 | 3300006358 | Bacteria | 5037 |
| 427 | Ga0068871_100023143 | 3300006358 | Bacteria | 4800 |
| 428 | Ga0068871_100308560 | 3300006358 | Bacteria | 1390 |
| 429 | Ga0075428_100001081 | 3300006844 | Bacteria | 28974 |
| 430 | Ga0075428_100002972 | 3300006844 | Bacteria | 18477 |
| 431 | Ga0075428_100023291 | 3300006844 | Bacteria | 6852 |
| 432 | Ga0075428_100103169 | 3300006844 | Bacteria | 3110 |
| 433 | Ga0075428_100302813 | 3300006844 | Bacteria | 1718 |
| 434 | Ga0075428_100365093 | 3300006844 | Bacteria | 1548 |
| 435 | Ga0075428_100423317 | 3300006844 | Bacteria | 1427 |
| 436 | Ga0075428_100555795 | 3300006844 | Bacteria | 1227 |
| 437 | Ga0075430_100000045 | 3300006846 | Bacteria | 64983 |
| 438 | Ga0075430_100000274 | 3300006846 | Bacteria | 36446 |
| 439 | Ga0075430_100144888 | 3300006846 | Bacteria | 1979 |
| 440 | Ga0075431_100000059 | 3300006847 | Bacteria | 61740 |
| 441 | Ga0075431_100000219 | 3300006847 | Bacteria | 42587 |
| 442 | Ga0075431_100258813 | 3300006847 | Bacteria | 1766 |
| 443 | Ga0075431_100310825 | 3300006847 | Bacteria | 1591 |
| 444 | Ga0075431_100331438 | 3300006847 | Bacteria | 1533 |
| 445 | Ga0075433_10001892 | 3300006852 | Bacteria | 15744 |
| 446 | Ga0075433_10034114 | 3300006852 | Bacteria | 4369 |
| 447 | Ga0075433_10043556 | 3300006852 | Bacteria | 3896 |
| 448 | Ga0075433_10186304 | 3300006852 | Bacteria | 1847 |
| 449 | Ga0075433_10221632 | 3300006852 | Bacteria | 1680 |
| 450 | Ga0075433_10232214 | 3300006852 | Bacteria | 1638 |
| 451 | Ga0075434_100003622 | 3300006871 | Bacteria | 13791 |
| 452 | Ga0075434_100006246 | 3300006871 | Bacteria | 10914 |
| 453 | Ga0075434_100078022 | 3300006871 | Bacteria | 3307 |
| 454 | Ga0075434_100243412 | 3300006871 | Bacteria | 1818 |
| 455 | Ga0075434_100363060 | 3300006871 | Bacteria | 1469 |
| 456 | Ga0075434_100372665 | 3300006871 | Bacteria | 1448 |
| 457 | Ga0075429_100003392 | 3300006880 | Bacteria | 13582 |
| 458 | Ga0075429_100014917 | 3300006880 | Bacteria | 6740 |
| 459 | Ga0075429_100133092 | 3300006880 | Bacteria | 2175 |
| 460 | Ga0075429_100446866 | 3300006880 | Bacteria | 1133 |
| 461 | Ga0068865_100000613 | 3300006881 | Bacteria | 20015 |
| 462 | Ga0075436_100005027 | 3300006914 | Bacteria | 9091 |
| 463 | Ga0075436_100060170 | 3300006914 | Bacteria | 2623 |
| 464 | Ga0075436_100125224 | 3300006914 | Bacteria | 1800 |
| 465 | Ga0075436_100216483 | 3300006914 | Bacteria | 1358 |
| 466 | Ga0075436_100408373 | 3300006914 | Bacteria | 985 |
| 467 | Ga0097620_100018301 | 3300006931 | Bacteria | 7043 |
| 468 | Ga0097620_100100460 | 3300006931 | Bacteria | 2948 |
| 469 | Ga0097620_100227140 | 3300006931 | Bacteria | 1955 |
| 470 | Ga0097620_100445249 | 3300006931 | Bacteria | 1391 |
| 471 | Ga0097620_100479046 | 3300006931 | Bacteria | 1340 |
| 472 | Ga0097620_101154661 | 3300006931 | Bacteria | 852 |
| 473 | Ga0079104_1000195 | 3300006946 | Bacteria | 85244 |
| 474 | Ga0075435_100044561 | 3300007076 | Bacteria | 3553 |
| 475 | Ga0075435_100052359 | 3300007076 | Bacteria | 3291 |
| 476 | Ga0075435_100072187 | 3300007076 | Bacteria | 2820 |
| 477 | Ga0075435_100090548 | 3300007076 | Bacteria | 2523 |
| 478 | Ga0075435_100114913 | 3300007076 | Bacteria | 2241 |
| 479 | Ga0075435_100174407 | 3300007076 | Bacteria | 1815 |
| 480 | Ga0075435_100322592 | 3300007076 | Bacteria | 1322 |
| 481 | Ga0075435_100426336 | 3300007076 | Bacteria | 1143 |
| 482 | Ga0075435_100591792 | 3300007076 | Bacteria | 962 |
| 483 | Ga0099794_10007909 | 3300007265 | Bacteria | 4395 |
| 484 | Ga0099794_10031163 | 3300007265 | Bacteria | 2495 |
| 485 | Ga0099795_10110463 | 3300007788 | Bacteria | 1089 |
| 486 | Ga0099795_10154416 | 3300007788 | Bacteria | 942 |
| 487 | Ga0099795_10175236 | 3300007788 | Bacteria | 893 |
| 488 | Ga0105251_10031791 | 3300009011 | Bacteria | 2637 |
| 489 | Ga0105251_10048048 | 3300009011 | Bacteria | 2048 |
| 490 | Ga0105244_10017634 | 3300009036 | Bacteria | 4030 |
| 491 | Ga0105250_10012131 | 3300009092 | Bacteria | 3565 |
| 492 | Ga0105240_10023181 | 3300009093 | Bacteria | 8219 |
| 493 | Ga0105240_10189033 | 3300009093 | Bacteria | 2423 |
| 494 | Ga0105240_10609018 | 3300009093 | Bacteria | 1202 |
| 495 | Ga0105240_10915440 | 3300009093 | Bacteria | 942 |
| 496 | Ga0105240_11245333 | 3300009093 | Bacteria | 786 |
| 497 | Ga0111539_10000679 | 3300009094 | Bacteria | 44034 |
| 498 | Ga0111539_10000693 | 3300009094 | Bacteria | 43665 |
| 499 | Ga0111539_10000925 | 3300009094 | Bacteria | 38387 |
| 500 | Ga0111539_10001296 | 3300009094 | Bacteria | 33381 |
| 501 | Ga0111539_10048622 | 3300009094 | Bacteria | 5063 |
| 502 | Ga0111539_10123739 | 3300009094 | Bacteria | 3031 |
| 503 | Ga0111539_10132601 | 3300009094 | Bacteria | 2918 |
| 504 | Ga0111539_10165942 | 3300009094 | Bacteria | 2582 |
| 505 | Ga0111539_10220232 | 3300009094 | Bacteria | 2210 |
| 506 | Ga0111539_10274557 | 3300009094 | Bacteria | 1962 |
| 507 | Ga0111539_10863039 | 3300009094 | Bacteria | 1053 |
| 508 | Ga0111539_11275377 | 3300009094 | Bacteria | 853 |
| 509 | Ga0111539_11339110 | 3300009094 | Bacteria | 831 |
| 510 | Ga0111539_11411435 | 3300009094 | Bacteria | 808 |
| 511 | Ga0105245_10000090 | 3300009098 | Bacteria | 90378 |
| 512 | Ga0105245_10010517 | 3300009098 | Bacteria | 8050 |
| 513 | Ga0105245_10036531 | 3300009098 | Bacteria | 4365 |
| 514 | Ga0105245_10071370 | 3300009098 | Bacteria | 3154 |
| 515 | Ga0105245_10409644 | 3300009098 | Bacteria | 1357 |
| 516 | Ga0105245_10512313 | 3300009098 | Bacteria | 1217 |
| 517 | Ga0105245_10945090 | 3300009098 | Bacteria | 905 |
| 518 | Ga0105245_11005301 | 3300009098 | Bacteria | 878 |
| 519 | Ga0105247_10003560 | 3300009101 | Bacteria | 10122 |
| 520 | Ga0105247_10007854 | 3300009101 | Bacteria | 6528 |
| 521 | Ga0105247_10019461 | 3300009101 | Bacteria | 4076 |
| 522 | Ga0105247_10115510 | 3300009101 | Bacteria | 1732 |
| 523 | Ga0114129_10006313 | 3300009147 | Bacteria | 16810 |
| 524 | Ga0114129_10008707 | 3300009147 | Bacteria | 14466 |
| 525 | Ga0114129_10024738 | 3300009147 | Bacteria | 8512 |
| 526 | Ga0114129_10037360 | 3300009147 | Bacteria | 6857 |
| 527 | Ga0114129_10381844 | 3300009147 | Bacteria | 1860 |
| 528 | Ga0114129_10544573 | 3300009147 | Bacteria | 1510 |
| 529 | Ga0114129_10664413 | 3300009147 | Bacteria | 1343 |
| 530 | Ga0114129_10783267 | 3300009147 | Bacteria | 1218 |
| 531 | Ga0114129_10908682 | 3300009147 | Bacteria | 1115 |
| 532 | Ga0105243_10001004 | 3300009148 | Bacteria | 26090 |
| 533 | Ga0105243_10027743 | 3300009148 | Bacteria | 4341 |
| 534 | Ga0105243_10037418 | 3300009148 | Bacteria | 3772 |
| 535 | Ga0105243_10077516 | 3300009148 | Bacteria | 2703 |
| 536 | Ga0105243_11178051 | 3300009148 | Bacteria | 778 |
| 537 | Ga0105241_10000053 | 3300009174 | Bacteria | 94578 |
| 538 | Ga0105241_10309814 | 3300009174 | Bacteria | 1358 |
| 539 | Ga0105241_10555788 | 3300009174 | Bacteria | 1031 |
| 540 | Ga0105242_10004018 | 3300009176 | Bacteria | 11437 |
| 541 | Ga0105242_10171984 | 3300009176 | Bacteria | 1904 |
| 542 | Ga0105242_10187774 | 3300009176 | Bacteria | 1828 |
| 543 | Ga0105242_10381302 | 3300009176 | Bacteria | 1311 |
| 544 | Ga0105242_11219152 | 3300009176 | Bacteria | 772 |
| 545 | Ga0105248_10000964 | 3300009177 | Bacteria | 32048 |
| 546 | Ga0105248_10020015 | 3300009177 | Bacteria | 7409 |
| 547 | Ga0105248_10020708 | 3300009177 | Bacteria | 7288 |
| 548 | Ga0105248_10022530 | 3300009177 | Bacteria | 6987 |
| 549 | Ga0105248_10027546 | 3300009177 | Bacteria | 6328 |
| 550 | Ga0105248_10149687 | 3300009177 | Bacteria | 2633 |
| 551 | Ga0105248_10216999 | 3300009177 | Bacteria | 2154 |
| 552 | Ga0105237_10005610 | 3300009545 | Bacteria | 14144 |
| 553 | Ga0105237_10045785 | 3300009545 | Bacteria | 4401 |
| 554 | Ga0105237_10116760 | 3300009545 | Bacteria | 2662 |
| 555 | Ga0105237_10126352 | 3300009545 | Bacteria | 2551 |
| 556 | Ga0105237_10296065 | 3300009545 | Bacteria | 1621 |
| 557 | Ga0105238_10068323 | 3300009551 | Bacteria | 3555 |
| 558 | Ga0105238_10079941 | 3300009551 | Bacteria | 3259 |
| 559 | Ga0105238_10454156 | 3300009551 | Bacteria | 1278 |
| 560 | Ga0105249_10009773 | 3300009553 | Bacteria | 8402 |
| 561 | Ga0099796_10009779 | 3300010159 | Bacteria | 2610 |
| 562 | Ga0099796_10042857 | 3300010159 | Bacteria | 1539 |
| 563 | Ga0099796_10113552 | 3300010159 | Bacteria | 1034 |
| 564 | Ga0099796_10146835 | 3300010159 | Bacteria | 926 |
| 565 | Ga0105239_10007674 | 3300010375 | Bacteria | 12357 |
| 566 | Ga0105239_10092138 | 3300010375 | Bacteria | 3345 |
| 567 | Ga0105239_10097118 | 3300010375 | Bacteria | 3256 |
| 568 | Ga0105239_10462312 | 3300010375 | Bacteria | 1440 |
| 569 | Ga0105239_10644202 | 3300010375 | Bacteria | 1210 |
| 570 | Ga0105246_10000052 | 3300011119 | Bacteria | 46290 |
| 571 | Ga0105246_10075238 | 3300011119 | Bacteria | 2390 |
| 572 | Ga0105246_10095324 | 3300011119 | Bacteria | 2154 |
| 573 | Ga0105246_10379958 | 3300011119 | Bacteria | 1167 |
| 574 | Ga0157339_1001686 | 3300012505 | Bacteria | 1394 |
| 575 | Ga0157342_1000555 | 3300012507 | Bacteria | 2343 |
| 576 | Ga0157338_1000120 | 3300012515 | Bacteria | 3636 |
| 577 | Ga0157373_10039051 | 3300013100 | Bacteria | 3399 |
| 578 | Ga0157371_10006781 | 3300013102 | Bacteria | 9363 |
| 579 | Ga0157371_10177791 | 3300013102 | Bacteria | 1521 |
| 580 | Ga0157370_10237622 | 3300013104 | Bacteria | 1686 |
| 581 | Ga0157370_10282380 | 3300013104 | Bacteria | 1534 |
| 582 | Ga0157370_10582633 | 3300013104 | Bacteria | 1025 |
| 583 | Ga0157369_10508677 | 3300013105 | Bacteria | 1246 |
| 584 | Ga0157369_10541970 | 3300013105 | Bacteria | 1203 |
| 585 | Ga0157374_10000476 | 3300013296 | Bacteria | 36354 |
| 586 | Ga0157374_10055453 | 3300013296 | Bacteria | 3699 |
| 587 | Ga0157374_10105147 | 3300013296 | Bacteria | 2711 |
| 588 | Ga0157374_10567490 | 3300013296 | Bacteria | 1143 |
| 589 | Ga0157374_10951380 | 3300013296 | Bacteria | 877 |
| 590 | Ga0157378_10002229 | 3300013297 | Bacteria | 17200 |
| 591 | Ga0157378_10294896 | 3300013297 | Bacteria | 1567 |
| 592 | Ga0157378_10348777 | 3300013297 | Bacteria | 1445 |
| 593 | Ga0157378_10397742 | 3300013297 | Bacteria | 1357 |
| 594 | Ga0163162_10000308 | 3300013306 | Bacteria | 45253 |
| 595 | Ga0163162_10050166 | 3300013306 | Bacteria | 4185 |
| 596 | Ga0163162_10146941 | 3300013306 | Bacteria | 2474 |
| 597 | Ga0163162_10193333 | 3300013306 | Bacteria | 2162 |
| 598 | Ga0163162_10242765 | 3300013306 | Bacteria | 1932 |
| 599 | Ga0163162_10268386 | 3300013306 | Bacteria | 1838 |
| 600 | Ga0163162_10570554 | 3300013306 | Bacteria | 1259 |
| 601 | Ga0157372_10572295 | 3300013307 | Bacteria | 1317 |
| 602 | Ga0157375_10000414 | 3300013308 | Bacteria | 38778 |
| 603 | Ga0157375_10056632 | 3300013308 | Bacteria | 3872 |
| 604 | Ga0157375_10090677 | 3300013308 | Bacteria | 3116 |
| 605 | Ga0157375_10257419 | 3300013308 | Bacteria | 1907 |
| 606 | Ga0157375_10796255 | 3300013308 | Bacteria | 1094 |
| 607 | Ga0163163_10002595 | 3300014325 | Bacteria | 15315 |
| 608 | Ga0163163_10003463 | 3300014325 | Bacteria | 13415 |
| 609 | Ga0163163_10010358 | 3300014325 | Bacteria | 8376 |
| 610 | Ga0163163_10029326 | 3300014325 | Bacteria | 5292 |
| 611 | Ga0157380_10000122 | 3300014326 | Bacteria | 43303 |
| 612 | Ga0157380_10208227 | 3300014326 | Bacteria | 1741 |
| 613 | Ga0157380_10225848 | 3300014326 | Bacteria | 1678 |
| 614 | Ga0157377_10001747 | 3300014745 | Bacteria | 9469 |
| 615 | Ga0157377_10037359 | 3300014745 | Bacteria | 2675 |
| 616 | Ga0157377_10058897 | 3300014745 | Bacteria | 2187 |
| 617 | Ga0157377_10069104 | 3300014745 | Bacteria | 2037 |
| 618 | Ga0157379_10000261 | 3300014968 | Bacteria | 41455 |
| 619 | Ga0157379_10028513 | 3300014968 | Bacteria | 4965 |
| 620 | Ga0157379_10047295 | 3300014968 | Bacteria | 3838 |
| 621 | Ga0157379_10049326 | 3300014968 | Bacteria | 3759 |
| 622 | Ga0157379_10059283 | 3300014968 | Bacteria | 3422 |
| 623 | Ga0157379_10832212 | 3300014968 | Bacteria | 873 |
| 624 | Ga0157376_10000283 | 3300014969 | Bacteria | 34227 |
| 625 | Ga0157376_10147361 | 3300014969 | Bacteria | 2119 |
| 626 | Ga0157376_10249144 | 3300014969 | Bacteria | 1658 |
| 627 | Ga0157376_10972670 | 3300014969 | Bacteria | 870 |
| 628 | Ga0163161_10000199 | 3300017792 | Bacteria | 55004 |
| 629 | Ga0206356_11625837 | 3300020070 | Bacteria | 2442 |
| 630 | Ga0206356_11859219 | 3300020070 | Bacteria | 2029 |
| 631 | Ga0213872_10041990 | 3300021361 | Bacteria | 2086 |
| 632 | Ga0213876_10052325 | 3300021384 | Bacteria | 2158 |
| 633 | Ga0213876_10086180 | 3300021384 | Bacteria | 1662 |
| 634 | Ga0213876_10241168 | 3300021384 | Bacteria | 961 |
| 635 | Ga0213875_10000053 | 3300021388 | Bacteria | 141791 |
| 636 | Ga0213875_10078217 | 3300021388 | Bacteria | 1543 |
| 637 | Ga0213875_10158350 | 3300021388 | Bacteria | 1062 |
| 638 | Ga0224572_1003469 | 3300024225 | Bacteria | 2661 |
| 639 | Ga0209233_1007144 | 3300025261 | Bacteria | 3556 |
| 640 | Ga0207666_1000861 | 3300025271 | Bacteria | 3639 |
| 641 | Ga0207666_1002383 | 3300025271 | Bacteria | 2263 |
| 642 | Ga0207673_1000489 | 3300025290 | Bacteria | 4157 |
| 643 | Ga0209676_1032510 | 3300025292 | Bacteria | 1568 |
| 644 | Ga0209758_1001119 | 3300025297 | Bacteria | 34539 |
| 645 | Ga0209758_1004320 | 3300025297 | Bacteria | 11948 |
| 646 | Ga0209050_1025171 | 3300025298 | Bacteria | 2032 |
| 647 | Ga0209256_1009023 | 3300025299 | Bacteria | 4467 |
| 648 | Ga0209051_1009812 | 3300025303 | Bacteria | 4902 |
| 649 | Ga0209257_1010796 | 3300025304 | Bacteria | 4535 |
| 650 | Ga0207697_10000335 | 3300025315 | Bacteria | 26204 |
| 651 | Ga0207697_10004744 | 3300025315 | Bacteria | 6439 |
| 652 | Ga0207653_10001210 | 3300025885 | Bacteria | 8432 |
| 653 | Ga0207682_10000042 | 3300025893 | Bacteria | 52333 |
| 654 | Ga0207692_10007314 | 3300025898 | Bacteria | 4520 |
| 655 | Ga0207692_10010700 | 3300025898 | Bacteria | 3878 |
| 656 | Ga0207692_10038756 | 3300025898 | Bacteria | 2339 |
| 657 | Ga0207692_10141611 | 3300025898 | Bacteria | 1368 |
| 658 | Ga0207642_10000725 | 3300025899 | Bacteria | 10195 |
| 659 | Ga0207642_10080842 | 3300025899 | Bacteria | 1577 |
| 660 | Ga0207710_10002054 | 3300025900 | Bacteria | 9549 |
| 661 | Ga0207710_10038983 | 3300025900 | Bacteria | 2102 |
| 662 | Ga0207710_10062509 | 3300025900 | Bacteria | 1692 |
| 663 | Ga0207710_10098804 | 3300025900 | Bacteria | 1374 |
| 664 | Ga0207688_10000053 | 3300025901 | Bacteria | 41441 |
| 665 | Ga0207688_10000303 | 3300025901 | Bacteria | 22604 |
| 666 | Ga0207688_10021480 | 3300025901 | Bacteria | 3527 |
| 667 | Ga0207688_10046434 | 3300025901 | Bacteria | 2425 |
| 668 | Ga0207688_10089188 | 3300025901 | Bacteria | 1769 |
| 669 | Ga0207680_10001204 | 3300025903 | Bacteria | 12248 |
| 670 | Ga0207680_10022210 | 3300025903 | Bacteria | 3447 |
| 671 | Ga0207680_10045668 | 3300025903 | Bacteria | 2584 |
| 672 | Ga0207647_10003927 | 3300025904 | Bacteria | 11107 |
| 673 | Ga0207647_10004389 | 3300025904 | Bacteria | 10462 |
| 674 | Ga0207647_10053679 | 3300025904 | Bacteria | 2482 |
| 675 | Ga0207685_10062000 | 3300025905 | Bacteria | 1484 |
| 676 | Ga0207685_10063480 | 3300025905 | Bacteria | 1471 |
| 677 | Ga0207685_10064913 | 3300025905 | Bacteria | 1460 |
| 678 | Ga0207699_10055238 | 3300025906 | Bacteria | 2362 |
| 679 | Ga0207699_10177379 | 3300025906 | Bacteria | 1430 |
| 680 | Ga0207699_10192061 | 3300025906 | Bacteria | 1378 |
| 681 | Ga0207699_10661932 | 3300025906 | Bacteria | 763 |
| 682 | Ga0207645_10000090 | 3300025907 | Bacteria | 65569 |
| 683 | Ga0207645_10027127 | 3300025907 | Bacteria | 3701 |
| 684 | Ga0207645_10044860 | 3300025907 | Bacteria | 2828 |
| 685 | Ga0207645_10079551 | 3300025907 | Bacteria | 2101 |
| 686 | Ga0207645_10151056 | 3300025907 | Bacteria | 1516 |
| 687 | Ga0207645_10428663 | 3300025907 | Bacteria | 891 |
| 688 | Ga0207645_10429959 | 3300025907 | Bacteria | 890 |
| 689 | Ga0207643_10000044 | 3300025908 | Bacteria | 82217 |
| 690 | Ga0207643_10001489 | 3300025908 | Bacteria | 13420 |
| 691 | Ga0207643_10143305 | 3300025908 | Bacteria | 1428 |
| 692 | Ga0207705_10059249 | 3300025909 | Bacteria | 2763 |
| 693 | Ga0207705_10168933 | 3300025909 | Bacteria | 1646 |
| 694 | Ga0207684_10006762 | 3300025910 | Bacteria | 10405 |
| 695 | Ga0207684_10035923 | 3300025910 | Bacteria | 4206 |
| 696 | Ga0207684_10099712 | 3300025910 | Bacteria | 2481 |
| 697 | Ga0207684_10187027 | 3300025910 | Bacteria | 1786 |
| 698 | Ga0207684_10288055 | 3300025910 | Bacteria | 1416 |
| 699 | Ga0207684_10613266 | 3300025910 | Bacteria | 929 |
| 700 | Ga0207654_10000397 | 3300025911 | Bacteria | 25317 |
| 701 | Ga0207654_10029294 | 3300025911 | Bacteria | 3012 |
| 702 | Ga0207654_10057163 | 3300025911 | Bacteria | 2266 |
| 703 | Ga0207707_10001536 | 3300025912 | Bacteria | 21265 |
| 704 | Ga0207707_10187436 | 3300025912 | Bacteria | 1805 |
| 705 | Ga0207707_10301162 | 3300025912 | Bacteria | 1386 |
| 706 | Ga0207707_10436914 | 3300025912 | Bacteria | 1121 |
| 707 | Ga0207695_10156553 | 3300025913 | Bacteria | 2213 |
| 708 | Ga0207695_10183913 | 3300025913 | Bacteria | 2010 |
| 709 | Ga0207671_10007530 | 3300025914 | Bacteria | 9435 |
| 710 | Ga0207671_10136584 | 3300025914 | Bacteria | 1886 |
| 711 | Ga0207671_10341351 | 3300025914 | Bacteria | 1187 |
| 712 | Ga0207671_10429836 | 3300025914 | Bacteria | 1051 |
| 713 | Ga0207693_10002841 | 3300025915 | Bacteria | 15002 |
| 714 | Ga0207693_10023723 | 3300025915 | Bacteria | 4867 |
| 715 | Ga0207693_10024688 | 3300025915 | Bacteria | 4767 |
| 716 | Ga0207693_10033027 | 3300025915 | Bacteria | 4084 |
| 717 | Ga0207693_10065540 | 3300025915 | Bacteria | 2844 |
| 718 | Ga0207693_10088650 | 3300025915 | Bacteria | 2425 |
| 719 | Ga0207693_10097277 | 3300025915 | Bacteria | 2308 |
| 720 | Ga0207693_10127778 | 3300025915 | Bacteria | 1998 |
| 721 | Ga0207693_10161041 | 3300025915 | Bacteria | 1765 |
| 722 | Ga0207693_10175786 | 3300025915 | Bacteria | 1685 |
| 723 | Ga0207693_10221353 | 3300025915 | Bacteria | 1487 |
| 724 | Ga0207693_10496113 | 3300025915 | Bacteria | 953 |
| 725 | Ga0207693_10529246 | 3300025915 | Bacteria | 920 |
| 726 | Ga0207693_10547110 | 3300025915 | Bacteria | 903 |
| 727 | Ga0207693_10614071 | 3300025915 | Bacteria | 846 |
| 728 | Ga0207693_10676278 | 3300025915 | Bacteria | 801 |
| 729 | Ga0207663_10012583 | 3300025916 | Bacteria | 4580 |
| 730 | Ga0207663_10078915 | 3300025916 | Bacteria | 2148 |
| 731 | Ga0207663_10093246 | 3300025916 | Bacteria | 2004 |
| 732 | Ga0207663_10120068 | 3300025916 | Bacteria | 1798 |
| 733 | Ga0207663_10315585 | 3300025916 | Bacteria | 1173 |
| 734 | Ga0207663_10508650 | 3300025916 | Bacteria | 936 |
| 735 | Ga0207660_10000083 | 3300025917 | Bacteria | 50279 |
| 736 | Ga0207660_10014742 | 3300025917 | Bacteria | 5151 |
| 737 | Ga0207660_10038833 | 3300025917 | Bacteria | 3325 |
| 738 | Ga0207660_10085535 | 3300025917 | Bacteria | 2326 |
| 739 | Ga0207660_10355796 | 3300025917 | Bacteria | 1174 |
| 740 | Ga0207662_10000230 | 3300025918 | Bacteria | 25941 |
| 741 | Ga0207662_10025780 | 3300025918 | Bacteria | 3387 |
| 742 | Ga0207662_10029808 | 3300025918 | Bacteria | 3164 |
| 743 | Ga0207662_10076174 | 3300025918 | Bacteria | 2038 |
| 744 | Ga0207657_10001336 | 3300025919 | Bacteria | 26204 |
| 745 | Ga0207657_10043359 | 3300025919 | Bacteria | 3963 |
| 746 | Ga0207657_10051527 | 3300025919 | Bacteria | 3578 |
| 747 | Ga0207657_10057189 | 3300025919 | Bacteria | 3362 |
| 748 | Ga0207657_10118613 | 3300025919 | Bacteria | 2178 |
| 749 | Ga0207657_10238867 | 3300025919 | Bacteria | 1451 |
| 750 | Ga0207657_10379870 | 3300025919 | Bacteria | 1113 |
| 751 | Ga0207649_10000260 | 3300025920 | Bacteria | 41709 |
| 752 | Ga0207649_10062643 | 3300025920 | Bacteria | 2345 |
| 753 | Ga0207652_10002829 | 3300025921 | Bacteria | 14558 |
| 754 | Ga0207652_10041895 | 3300025921 | Bacteria | 3895 |
| 755 | Ga0207652_10048055 | 3300025921 | Bacteria | 3646 |
| 756 | Ga0207652_10065015 | 3300025921 | Bacteria | 3157 |
| 757 | Ga0207652_10101081 | 3300025921 | Bacteria | 2546 |
| 758 | Ga0207652_10123939 | 3300025921 | Bacteria | 2301 |
| 759 | Ga0207652_10127047 | 3300025921 | Bacteria | 2271 |
| 760 | Ga0207652_10289647 | 3300025921 | Bacteria | 1477 |
| 761 | Ga0207646_10050403 | 3300025922 | Bacteria | 3726 |
| 762 | Ga0207646_10128543 | 3300025922 | Bacteria | 2279 |
| 763 | Ga0207646_10269889 | 3300025922 | Bacteria | 1538 |
| 764 | Ga0207681_10000271 | 3300025923 | Bacteria | 38955 |
| 765 | Ga0207681_10072398 | 3300025923 | Bacteria | 2407 |
| 766 | Ga0207681_10097997 | 3300025923 | Bacteria | 2108 |
| 767 | Ga0207694_10013167 | 3300025924 | Bacteria | 6227 |
| 768 | Ga0207694_10153669 | 3300025924 | Bacteria | 1855 |
| 769 | Ga0207694_10504424 | 3300025924 | Bacteria | 1013 |
| 770 | Ga0207650_10006320 | 3300025925 | Bacteria | 8074 |
| 771 | Ga0207650_10014750 | 3300025925 | Bacteria | 5432 |
| 772 | Ga0207650_10023350 | 3300025925 | Bacteria | 4384 |
| 773 | Ga0207650_10026553 | 3300025925 | Bacteria | 4133 |
| 774 | Ga0207650_10045459 | 3300025925 | Bacteria | 3230 |
| 775 | Ga0207650_10151005 | 3300025925 | Bacteria | 1833 |
| 776 | Ga0207659_10000258 | 3300025926 | Bacteria | 32465 |
| 777 | Ga0207659_10040244 | 3300025926 | Bacteria | 3267 |
| 778 | Ga0207659_10057381 | 3300025926 | Bacteria | 2791 |
| 779 | Ga0207659_10113354 | 3300025926 | Bacteria | 2065 |
| 780 | Ga0207659_10191778 | 3300025926 | Bacteria | 1627 |
| 781 | Ga0207659_10237474 | 3300025926 | Bacteria | 1473 |
| 782 | Ga0207659_10313108 | 3300025926 | Bacteria | 1293 |
| 783 | Ga0207687_10000063 | 3300025927 | Bacteria | 83105 |
| 784 | Ga0207687_10013043 | 3300025927 | Bacteria | 5430 |
| 785 | Ga0207687_10086242 | 3300025927 | Bacteria | 2279 |
| 786 | Ga0207687_10421539 | 3300025927 | Bacteria | 1102 |
| 787 | Ga0207687_10640576 | 3300025927 | Bacteria | 898 |
| 788 | Ga0207700_10022871 | 3300025928 | Bacteria | 4296 |
| 789 | Ga0207700_10046001 | 3300025928 | Bacteria | 3224 |
| 790 | Ga0207700_10062363 | 3300025928 | Bacteria | 2831 |
| 791 | Ga0207700_10128057 | 3300025928 | Bacteria | 2068 |
| 792 | Ga0207700_10172519 | 3300025928 | Bacteria | 1805 |
| 793 | Ga0207700_10347125 | 3300025928 | Bacteria | 1291 |
| 794 | Ga0207700_10822302 | 3300025928 | Bacteria | 831 |
| 795 | Ga0207664_10038216 | 3300025929 | Bacteria | 3720 |
| 796 | Ga0207664_10054501 | 3300025929 | Bacteria | 3169 |
| 797 | Ga0207664_10128655 | 3300025929 | Bacteria | 2129 |
| 798 | Ga0207664_10254745 | 3300025929 | Bacteria | 1533 |
| 799 | Ga0207664_10524073 | 3300025929 | Bacteria | 1062 |
| 800 | Ga0207644_10000524 | 3300025931 | Bacteria | 24831 |
| 801 | Ga0207644_10006692 | 3300025931 | Bacteria | 7508 |
| 802 | Ga0207644_10045806 | 3300025931 | Bacteria | 3112 |
| 803 | Ga0207644_10074067 | 3300025931 | Bacteria | 2498 |
| 804 | Ga0207644_10129632 | 3300025931 | Bacteria | 1929 |
| 805 | Ga0207644_10207058 | 3300025931 | Bacteria | 1549 |
| 806 | Ga0207690_10001251 | 3300025932 | Bacteria | 16066 |
| 807 | Ga0207690_10230639 | 3300025932 | Bacteria | 1421 |
| 808 | Ga0207690_10388623 | 3300025932 | Bacteria | 1110 |
| 809 | Ga0207706_10001197 | 3300025933 | Bacteria | 26204 |
| 810 | Ga0207706_10002752 | 3300025933 | Bacteria | 17102 |
| 811 | Ga0207706_10009072 | 3300025933 | Bacteria | 9149 |
| 812 | Ga0207706_10032010 | 3300025933 | Bacteria | 4685 |
| 813 | Ga0207706_10099317 | 3300025933 | Bacteria | 2561 |
| 814 | Ga0207706_10182028 | 3300025933 | Bacteria | 1845 |
| 815 | Ga0207706_10412473 | 3300025933 | Bacteria | 1170 |
| 816 | Ga0207686_10000456 | 3300025934 | Bacteria | 27184 |
| 817 | Ga0207686_10108312 | 3300025934 | Bacteria | 1869 |
| 818 | Ga0207686_10158898 | 3300025934 | Bacteria | 1582 |
| 819 | Ga0207686_10257159 | 3300025934 | Bacteria | 1278 |
| 820 | Ga0207709_10000372 | 3300025935 | Bacteria | 45219 |
| 821 | Ga0207709_10068200 | 3300025935 | Bacteria | 2247 |
| 822 | Ga0207670_10000345 | 3300025936 | Bacteria | 27608 |
| 823 | Ga0207670_10003254 | 3300025936 | Bacteria | 8607 |
| 824 | Ga0207670_10006141 | 3300025936 | Bacteria | 6645 |
| 825 | Ga0207670_10007621 | 3300025936 | Bacteria | 6055 |
| 826 | Ga0207670_10058416 | 3300025936 | Bacteria | 2620 |
| 827 | Ga0207670_10072520 | 3300025936 | Bacteria | 2384 |
| 828 | Ga0207669_10000019 | 3300025937 | Bacteria | 111630 |
| 829 | Ga0207704_10007530 | 3300025938 | Bacteria | 5150 |
| 830 | Ga0207704_10160016 | 3300025938 | Bacteria | 1601 |
| 831 | Ga0207665_10008520 | 3300025939 | Bacteria | 6751 |
| 832 | Ga0207665_10043429 | 3300025939 | Bacteria | 3005 |
| 833 | Ga0207665_10142024 | 3300025939 | Bacteria | 1713 |
| 834 | Ga0207665_10226485 | 3300025939 | Bacteria | 1372 |
| 835 | Ga0207665_10312167 | 3300025939 | Bacteria | 1178 |
| 836 | Ga0207665_10414586 | 3300025939 | Bacteria | 1028 |
| 837 | Ga0207691_10000987 | 3300025940 | Bacteria | 28275 |
| 838 | Ga0207691_10003130 | 3300025940 | Bacteria | 16166 |
| 839 | Ga0207691_10035947 | 3300025940 | Bacteria | 4592 |
| 840 | Ga0207691_10087771 | 3300025940 | Bacteria | 2790 |
| 841 | Ga0207691_10138784 | 3300025940 | Bacteria | 2143 |
| 842 | Ga0207691_10183730 | 3300025940 | Bacteria | 1826 |
| 843 | Ga0207691_10680101 | 3300025940 | Bacteria | 868 |
| 844 | Ga0207711_10001673 | 3300025941 | Bacteria | 20423 |
| 845 | Ga0207711_10011969 | 3300025941 | Bacteria | 7211 |
| 846 | Ga0207711_10057086 | 3300025941 | Bacteria | 3356 |
| 847 | Ga0207711_10263308 | 3300025941 | Bacteria | 1585 |
| 848 | Ga0207711_10300267 | 3300025941 | Bacteria | 1481 |
| 849 | Ga0207711_10404704 | 3300025941 | Bacteria | 1268 |
| 850 | Ga0207689_10000916 | 3300025942 | Bacteria | 28296 |
| 851 | Ga0207689_10043776 | 3300025942 | Bacteria | 3700 |
| 852 | Ga0207661_10000107 | 3300025944 | Bacteria | 52429 |
| 853 | Ga0207661_10008359 | 3300025944 | Bacteria | 7393 |
| 854 | Ga0207661_10355257 | 3300025944 | Bacteria | 1323 |
| 855 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 856 | Ga0207679_10010198 | 3300025945 | Bacteria | 6045 |
| 857 | Ga0207679_10180970 | 3300025945 | Bacteria | 1744 |
| 858 | Ga0207679_10531988 | 3300025945 | Bacteria | 1052 |
| 859 | Ga0207679_10683305 | 3300025945 | Bacteria | 930 |
| 860 | Ga0207667_10003336 | 3300025949 | Bacteria | 19809 |
| 861 | Ga0207667_10016894 | 3300025949 | Bacteria | 8232 |
| 862 | Ga0207667_10026958 | 3300025949 | Bacteria | 6268 |
| 863 | Ga0207667_10240610 | 3300025949 | Bacteria | 1852 |
| 864 | Ga0207667_10352694 | 3300025949 | Bacteria | 1500 |
| 865 | Ga0207667_10671609 | 3300025949 | Bacteria | 1040 |
| 866 | Ga0207651_10000855 | 3300025960 | Bacteria | 13295 |
| 867 | Ga0207651_10007700 | 3300025960 | Bacteria | 5756 |
| 868 | Ga0207651_10048298 | 3300025960 | Bacteria | 2876 |
| 869 | Ga0207651_10417901 | 3300025960 | Bacteria | 1144 |
| 870 | Ga0207712_10000242 | 3300025961 | Bacteria | 53794 |
| 871 | Ga0207712_10005698 | 3300025961 | Bacteria | 7852 |
| 872 | Ga0207712_10109207 | 3300025961 | Bacteria | 2072 |
| 873 | Ga0207712_10178669 | 3300025961 | Bacteria | 1665 |
| 874 | Ga0207668_10000049 | 3300025972 | Bacteria | 99391 |
| 875 | Ga0207668_10035376 | 3300025972 | Bacteria | 3324 |
| 876 | Ga0207668_10183307 | 3300025972 | Bacteria | 1653 |
| 877 | Ga0207668_10664834 | 3300025972 | Bacteria | 913 |
| 878 | Ga0207640_10000234 | 3300025981 | Bacteria | 38057 |
| 879 | Ga0207640_10054433 | 3300025981 | Bacteria | 2616 |
| 880 | Ga0207640_10418870 | 3300025981 | Bacteria | 1095 |
| 881 | Ga0207658_10000804 | 3300025986 | Bacteria | 26394 |
| 882 | Ga0207658_10081866 | 3300025986 | Bacteria | 2477 |
| 883 | Ga0207658_10530498 | 3300025986 | Bacteria | 1051 |
| 884 | Ga0207658_10593474 | 3300025986 | Bacteria | 994 |
| 885 | Ga0207677_10010292 | 3300026023 | Bacteria | 5290 |
| 886 | Ga0207677_10014242 | 3300026023 | Bacteria | 4637 |
| 887 | Ga0207677_10399653 | 3300026023 | Bacteria | 1165 |
| 888 | Ga0207703_10001356 | 3300026035 | Bacteria | 22405 |
| 889 | Ga0207703_10013541 | 3300026035 | Bacteria | 6353 |
| 890 | Ga0207703_10052590 | 3300026035 | Bacteria | 3308 |
| 891 | Ga0207639_10063261 | 3300026041 | Bacteria | 2864 |
| 892 | Ga0207678_10000831 | 3300026067 | Bacteria | 28276 |
| 893 | Ga0207678_10020178 | 3300026067 | Bacteria | 5852 |
| 894 | Ga0207678_10047638 | 3300026067 | Bacteria | 3706 |
| 895 | Ga0207678_10217103 | 3300026067 | Bacteria | 1637 |
| 896 | Ga0207678_10233442 | 3300026067 | Bacteria | 1575 |
| 897 | Ga0207708_10001403 | 3300026075 | Bacteria | 18072 |
| 898 | Ga0207708_10003197 | 3300026075 | Bacteria | 12074 |
| 899 | Ga0207708_10008657 | 3300026075 | Bacteria | 7533 |
| 900 | Ga0207708_10048004 | 3300026075 | Bacteria | 3249 |
| 901 | Ga0207708_10093743 | 3300026075 | Bacteria | 2317 |
| 902 | Ga0207708_10111840 | 3300026075 | Bacteria | 2121 |
| 903 | Ga0207708_10134596 | 3300026075 | Bacteria | 1935 |
| 904 | Ga0207702_10001965 | 3300026078 | Bacteria | 19983 |
| 905 | Ga0207702_10021193 | 3300026078 | Bacteria | 5379 |
| 906 | Ga0207702_10037163 | 3300026078 | Bacteria | 4075 |
| 907 | Ga0207702_10430239 | 3300026078 | Bacteria | 1278 |
| 908 | Ga0207702_10769345 | 3300026078 | Bacteria | 951 |
| 909 | Ga0207641_10000669 | 3300026088 | Bacteria | 37271 |
| 910 | Ga0207641_10020291 | 3300026088 | Bacteria | 5458 |
| 911 | Ga0207641_10116676 | 3300026088 | Bacteria | 2376 |
| 912 | Ga0207641_10203724 | 3300026088 | Bacteria | 1826 |
| 913 | Ga0207641_10244333 | 3300026088 | Bacteria | 1674 |
| 914 | Ga0207641_10617020 | 3300026088 | Bacteria | 1063 |
| 915 | Ga0207648_10001440 | 3300026089 | Bacteria | 26204 |
| 916 | Ga0207648_10007865 | 3300026089 | Bacteria | 10401 |
| 917 | Ga0207648_10135059 | 3300026089 | Bacteria | 2173 |
| 918 | Ga0207648_10145029 | 3300026089 | Bacteria | 2094 |
| 919 | Ga0207648_10150751 | 3300026089 | Bacteria | 2052 |
| 920 | Ga0207676_10002834 | 3300026095 | Bacteria | 12336 |
| 921 | Ga0207676_10038734 | 3300026095 | Bacteria | 3641 |
| 922 | Ga0207676_10317214 | 3300026095 | Bacteria | 1429 |
| 923 | Ga0207674_10001207 | 3300026116 | Bacteria | 33673 |
| 924 | Ga0207674_10048795 | 3300026116 | Bacteria | 4332 |
| 925 | Ga0207674_10079903 | 3300026116 | Bacteria | 3273 |
| 926 | Ga0207675_100000983 | 3300026118 | Bacteria | 28277 |
| 927 | Ga0207675_100008958 | 3300026118 | Bacteria | 9389 |
| 928 | Ga0207675_100060262 | 3300026118 | Bacteria | 3543 |
| 929 | Ga0207683_10000324 | 3300026121 | Bacteria | 43461 |
| 930 | Ga0207683_10003263 | 3300026121 | Bacteria | 14146 |
| 931 | Ga0207683_10009172 | 3300026121 | Bacteria | 8427 |
| 932 | Ga0207683_10032197 | 3300026121 | Bacteria | 4554 |
| 933 | Ga0207683_10034197 | 3300026121 | Bacteria | 4417 |
| 934 | Ga0207683_10082323 | 3300026121 | Bacteria | 2859 |
| 935 | Ga0207683_10231898 | 3300026121 | Bacteria | 1684 |
| 936 | Ga0207683_10273012 | 3300026121 | Bacteria | 1545 |
| 937 | Ga0207698_10037934 | 3300026142 | Bacteria | 3554 |
| 938 | Ga0207698_10055015 | 3300026142 | Bacteria | 3064 |
| 939 | Ga0207698_10083712 | 3300026142 | Bacteria | 2583 |
| 940 | Ga0207698_10317619 | 3300026142 | Bacteria | 1457 |
| 941 | Ga0207698_10867889 | 3300026142 | Bacteria | 908 |
| 942 | Ga0209281_1000028 | 3300027111 | Bacteria | 440027 |
| 943 | Ga0209973_1012614 | 3300027252 | Bacteria | 1030 |
| 944 | Ga0209967_1033312 | 3300027364 | Bacteria | 774 |
| 945 | Ga0209999_1030856 | 3300027543 | Bacteria | 995 |
| 946 | Ga0209982_1014071 | 3300027552 | Bacteria | 1208 |
| 947 | Ga0210002_1000535 | 3300027617 | Bacteria | 5125 |
| 948 | Ga0209588_1008486 | 3300027671 | Bacteria | 3047 |
| 949 | Ga0209971_1009254 | 3300027682 | Bacteria | 2333 |
| 950 | Ga0209966_1001462 | 3300027695 | Bacteria | 4096 |
| 951 | Ga0209966_1001844 | 3300027695 | Bacteria | 3589 |
| 952 | Ga0209998_10003317 | 3300027717 | Bacteria | 3534 |
| 953 | Ga0209998_10003343 | 3300027717 | Bacteria | 3521 |
| 954 | Ga0209998_10021479 | 3300027717 | Bacteria | 1386 |
| 955 | Ga0209974_10000294 | 3300027876 | Bacteria | 16284 |
| 956 | Ga0207428_10000130 | 3300027907 | Bacteria | 104457 |
| 957 | Ga0207428_10000180 | 3300027907 | Bacteria | 88557 |
| 958 | Ga0207428_10000286 | 3300027907 | Bacteria | 68250 |
| 959 | Ga0207428_10021017 | 3300027907 | Bacteria | 5533 |
| 960 | Ga0207428_10108503 | 3300027907 | Bacteria | 2138 |
| 961 | Ga0268266_10018041 | 3300028379 | Bacteria | 6014 |
| 962 | Ga0268266_10082954 | 3300028379 | Bacteria | 2797 |
| 963 | Ga0268266_10096310 | 3300028379 | Bacteria | 2601 |
| 964 | Ga0268266_10228212 | 3300028379 | Bacteria | 1714 |
| 965 | Ga0268265_10001031 | 3300028380 | Bacteria | 25141 |
| 966 | Ga0268264_10001139 | 3300028381 | Bacteria | 26034 |
| 967 | Ga0268264_10052458 | 3300028381 | Bacteria | 3400 |
| 968 | Ga0268264_10053079 | 3300028381 | Bacteria | 3381 |
| 969 | Ga0268264_10158196 | 3300028381 | Bacteria | 2038 |
| 970 | Ga0268264_10208891 | 3300028381 | Bacteria | 1791 |
| 971 | Ga0268264_10406525 | 3300028381 | Bacteria | 1309 |
| 972 | Ga0268264_10475908 | 3300028381 | Bacteria | 1214 |
| 973 | Ga0265337_1005487 | 3300028556 | Bacteria | 5032 |
| 974 | Ga0265318_10020071 | 3300028577 | Bacteria | 2701 |
| 975 | Ga0265338_10027443 | 3300028800 | Bacteria | 5712 |
| 976 | Ga0265338_10041953 | 3300028800 | Bacteria | 4270 |
| 977 | Ga0265338_10279590 | 3300028800 | Bacteria | 1220 |
| 978 | Ga0307511_10162010 | 3300030521 | Bacteria | 1253 |
| 979 | Ga0265762_1009325 | 3300030760 | Bacteria | 1749 |
| 980 | Ga0265763_1000858 | 3300030763 | Bacteria | 2025 |
| 981 | Ga0265760_10015831 | 3300031090 | Bacteria | 2163 |
| 982 | Ga0265330_10012081 | 3300031235 | Bacteria | 4038 |
| 983 | Ga0265330_10040936 | 3300031235 | Bacteria | 2056 |
| 984 | Ga0265330_10086514 | 3300031235 | Bacteria | 1347 |
| 985 | Ga0265320_10020669 | 3300031240 | Bacteria | 3561 |
| 986 | Ga0265325_10000011 | 3300031241 | Bacteria | 150631 |
| 987 | Ga0265325_10003712 | 3300031241 | Bacteria | 9877 |
| 988 | Ga0265325_10014736 | 3300031241 | Bacteria | 4411 |
| 989 | Ga0265325_10022034 | 3300031241 | Bacteria | 3493 |
| 990 | Ga0265325_10057438 | 3300031241 | Bacteria | 1984 |
| 991 | Ga0265325_10062114 | 3300031241 | Bacteria | 1893 |
| 992 | Ga0265329_10029376 | 3300031242 | Bacteria | 1796 |
| 993 | Ga0265329_10032779 | 3300031242 | Bacteria | 1682 |
| 994 | Ga0265340_10013469 | 3300031247 | Bacteria | 4294 |
| 995 | Ga0265340_10021550 | 3300031247 | Bacteria | 3306 |
| 996 | Ga0265340_10064325 | 3300031247 | Bacteria | 1748 |
| 997 | Ga0265340_10120326 | 3300031247 | Bacteria | 1208 |
| 998 | Ga0265339_10000323 | 3300031249 | Bacteria | 38406 |
| 999 | Ga0265339_10001920 | 3300031249 | Bacteria | 15256 |
| 1000 | Ga0265339_10054498 | 3300031249 | Bacteria | 2172 |
| 1001 | Ga0265339_10072814 | 3300031249 | Bacteria | 1828 |
| 1002 | Ga0265339_10123366 | 3300031249 | Bacteria | 1329 |
| 1003 | Ga0265339_10168861 | 3300031249 | Bacteria | 1096 |
| 1004 | Ga0265331_10003347 | 3300031250 | Bacteria | 10404 |
| 1005 | Ga0265331_10021350 | 3300031250 | Bacteria | 3314 |
| 1006 | Ga0265331_10091038 | 3300031250 | Bacteria | 1409 |
| 1007 | Ga0265331_10121371 | 3300031250 | Bacteria | 1195 |
| 1008 | Ga0265327_10001225 | 3300031251 | Bacteria | 34433 |
| 1009 | Ga0265316_10034538 | 3300031344 | Bacteria | 4106 |
| 1010 | Ga0307513_10104188 | 3300031456 | Bacteria | 2851 |
| 1011 | Ga0307408_100107474 | 3300031548 | Bacteria | 2137 |
| 1012 | Ga0265313_10001449 | 3300031595 | Bacteria | 22152 |
| 1013 | Ga0265313_10001589 | 3300031595 | Bacteria | 21087 |
| 1014 | Ga0265313_10003565 | 3300031595 | Bacteria | 12516 |
| 1015 | Ga0265313_10009692 | 3300031595 | Bacteria | 6214 |
| 1016 | Ga0265313_10020730 | 3300031595 | Bacteria | 3618 |
| 1017 | Ga0265313_10029784 | 3300031595 | Bacteria | 2818 |
| 1018 | Ga0265313_10040888 | 3300031595 | Bacteria | 2288 |
| 1019 | Ga0316575_10070445 | 3300031665 | Bacteria | 1404 |
| 1020 | Ga0316579_10055021 | 3300031691 | Bacteria | 1866 |
| 1021 | Ga0265314_10013869 | 3300031711 | Bacteria | 6486 |
| 1022 | Ga0265314_10015442 | 3300031711 | Bacteria | 6059 |
| 1023 | Ga0265314_10045240 | 3300031711 | Bacteria | 3114 |
| 1024 | Ga0265314_10076897 | 3300031711 | Bacteria | 2216 |
| 1025 | Ga0265342_10000149 | 3300031712 | Bacteria | 79177 |
| 1026 | Ga0265342_10007848 | 3300031712 | Bacteria | 7749 |
| 1027 | Ga0265342_10019096 | 3300031712 | Bacteria | 4423 |
| 1028 | Ga0265342_10039757 | 3300031712 | Bacteria | 2855 |
| 1029 | Ga0265342_10045575 | 3300031712 | Bacteria | 2639 |
| 1030 | Ga0265342_10119218 | 3300031712 | Bacteria | 1487 |
| 1031 | Ga0316576_10107181 | 3300031727 | Bacteria | 2093 |
| 1032 | Ga0316578_10048911 | 3300031728 | Bacteria | 2470 |
| 1033 | Ga0307413_10112006 | 3300031824 | Bacteria | 1829 |
| 1034 | Ga0307410_10760394 | 3300031852 | Bacteria | 821 |
| 1035 | Ga0307406_10181064 | 3300031901 | Bacteria | 1534 |
| 1036 | Ga0307406_10288537 | 3300031901 | Bacteria | 1255 |
| 1037 | Ga0307412_10153401 | 3300031911 | Bacteria | 1703 |
| 1038 | Ga0307412_10535256 | 3300031911 | Bacteria | 981 |
| 1039 | Ga0307409_100646148 | 3300031995 | Bacteria | 1051 |
| 1040 | Ga0307416_100451831 | 3300032002 | Bacteria | 1338 |
| 1041 | Ga0316583_10000030 | 3300032133 | Bacteria | 26612 |
| 1042 | Ga0373930_0000095 | 3300034816 | Bacteria | 9182 |
| 1043 | Ga0373948_0000228 | 3300034817 | Bacteria | 6653 |
| 1044 | Ga0373958_0000068 | 3300034819 | Bacteria | 10448 |
| 1045 | Ga0373958_0007995 | 3300034819 | Bacteria | 1702 |
| 1046 | Ga0373959_0000647 | 3300034820 | Bacteria | 6016 |
| 1047 | Ga0373938_0000024 | 3300034957 | Bacteria | 19333 |
| 1048 | Ga0373938_0000123 | 3300034957 | Bacteria | 10839 |
| 1049 | Ga0373926_0018881 | 3300035083 | Bacteria | 2375 |
| 1050 | Ga0373926_0020863 | 3300035083 | Bacteria | 2265 |
| 1051 | Ga0373926_0034034 | 3300035083 | Bacteria | 1802 |
| 1052 | Ga0373926_0147383 | 3300035083 | Bacteria | 895 |
| 1053 | Ga0373928_0000414 | 3300035084 | Bacteria | 8521 |
| 1054 | Ga0373928_0005868 | 3300035084 | Bacteria | 2349 |
| 1055 | Ga0373928_0043229 | 3300035084 | Bacteria | 1042 |
| 1056 | Ga0373928_0062581 | 3300035084 | Bacteria | 903 |
| 1057 | Ga0373929_0000244 | 3300035085 | Bacteria | 9965 |
| 1058 | Ga0373929_0000851 | 3300035085 | Bacteria | 5946 |
| 1059 | Ga0373929_0011780 | 3300035085 | Bacteria | 1653 |
| 1060 | Ga0373934_0020094 | 3300035086 | Bacteria | 2567 |
| 1061 | Ga0373934_0039777 | 3300035086 | Bacteria | 1854 |
| 1062 | Ga0373940_0000883 | 3300035088 | Bacteria | 5043 |
| 1063 | Ga0373940_0042643 | 3300035088 | Bacteria | 1251 |
| 1064 | Ga0373944_0004335 | 3300035089 | Bacteria | 3692 |
| 1065 | Ga0373944_0022951 | 3300035089 | Bacteria | 1816 |
| 1066 | Ga0373944_0055312 | 3300035089 | Bacteria | 1260 |
| 1067 | Ga0373944_0110928 | 3300035089 | Bacteria | 936 |
| 1068 | Ga0373944_0124588 | 3300035089 | Bacteria | 891 |
| 1069 | Ga0373944_0135960 | 3300035089 | Bacteria | 858 |
| 1070 | Ga0373951_0000589 | 3300035091 | Bacteria | 10027 |
| 1071 | Ga0373951_0065173 | 3300035091 | Bacteria | 919 |
| 1072 | Ga0373952_0001678 | 3300035092 | Bacteria | 4025 |
| 1073 | Ga0373952_0019323 | 3300035092 | Bacteria | 1417 |
| 1074 | Ga0373923_0001460 | 3300035111 | Bacteria | 6789 |
| 1075 | Ga0373923_0090664 | 3300035111 | Bacteria | 1337 |
| 1076 | Ga0373923_0211333 | 3300035111 | Bacteria | 899 |
| 1077 | Ga0373932_0004049 | 3300035112 | Bacteria | 3485 |
| 1078 | Ga0373932_0028908 | 3300035112 | Bacteria | 1527 |
| 1079 | Ga0373936_0000207 | 3300035113 | Bacteria | 19389 |
| 1080 | Ga0373936_0011857 | 3300035113 | Bacteria | 3307 |
| 1081 | Ga0373936_0026559 | 3300035113 | Bacteria | 2267 |
| 1082 | Ga0373936_0055171 | 3300035113 | Bacteria | 1613 |
| 1083 | Ga0373936_0125171 | 3300035113 | Bacteria | 1101 |
| 1084 | Ga0373939_0000144 | 3300035114 | Bacteria | 19991 |
| 1085 | Ga0373939_0000494 | 3300035114 | Bacteria | 9973 |
| 1086 | Ga0373941_0000087 | 3300035115 | Bacteria | 15105 |
| 1087 | Ga0373941_0006414 | 3300035115 | Bacteria | 2834 |
| 1088 | Ga0373941_0021021 | 3300035115 | Bacteria | 1837 |
| 1089 | Ga0373941_0042002 | 3300035115 | Bacteria | 1418 |
| 1090 | Ga0373945_0000777 | 3300035116 | Bacteria | 9315 |
| 1091 | Ga0373945_0001428 | 3300035116 | Bacteria | 7268 |
| 1092 | Ga0373945_0021379 | 3300035116 | Bacteria | 2223 |
| 1093 | Ga0373945_0077652 | 3300035116 | Bacteria | 1267 |
| 1094 | Ga0373953_0001671 | 3300035117 | Bacteria | 6524 |
| 1095 | Ga0373953_0005830 | 3300035117 | Bacteria | 4027 |
| 1096 | Ga0373953_0039509 | 3300035117 | Bacteria | 1870 |
| 1097 | Ga0373953_0059627 | 3300035117 | Bacteria | 1558 |
| 1098 | Ga0373954_0001529 | 3300035118 | Bacteria | 9408 |
| 1099 | Ga0373954_0003918 | 3300035118 | Bacteria | 6369 |
| 1100 | Ga0373954_0102689 | 3300035118 | Bacteria | 1380 |
| 1101 | Ga0373954_0133876 | 3300035118 | Bacteria | 1207 |
| 1102 | Ga0373956_0003195 | 3300035119 | Bacteria | 6622 |
| 1103 | Ga0373956_0007244 | 3300035119 | Bacteria | 4467 |
| 1104 | Ga0373956_0009272 | 3300035119 | Bacteria | 3998 |
| 1105 | Ga0373957_0015185 | 3300035120 | Bacteria | 2647 |
| 1106 | Ga0373957_0027588 | 3300035120 | Bacteria | 2063 |
| 1107 | Ga0373957_0029065 | 3300035120 | Bacteria | 2017 |
| 1108 | Ga0373957_0036106 | 3300035120 | Bacteria | 1840 |
| 1109 | Ga0373957_0041093 | 3300035120 | Bacteria | 1740 |
| 1110 | Ga0373957_0045754 | 3300035120 | Bacteria | 1659 |
| 1111 | Ga0373957_0054452 | 3300035120 | Bacteria | 1537 |
| 1112 | Ga0373960_0000084 | 3300035121 | Bacteria | 13972 |
| 1113 | Ga0373960_0090397 | 3300035121 | Bacteria | 978 |
| 1114 | Ga0373960_0102997 | 3300035121 | Bacteria | 927 |
| 1115 | Ga0373943_0000284 | 3300035170 | Bacteria | 21002 |
| 1116 | Ga0373943_0002532 | 3300035170 | Bacteria | 8309 |
| 1117 | Ga0373943_0014380 | 3300035170 | Bacteria | 3582 |
| 1118 | Ga0373943_0019966 | 3300035170 | Bacteria | 3086 |
| 1119 | Ga0373943_0038607 | 3300035170 | Bacteria | 2297 |
| 1120 | Ga0373943_0120226 | 3300035170 | Bacteria | 1395 |
| 1121 | Ga0373943_0141050 | 3300035170 | Bacteria | 1298 |
| 1122 | Ga0373946_0000695 | 3300035171 | Bacteria | 11350 |
| 1123 | Ga0373946_0002959 | 3300035171 | Bacteria | 6027 |
| 1124 | Ga0373946_0009548 | 3300035171 | Bacteria | 3576 |
| 1125 | Ga0373946_0096209 | 3300035171 | Bacteria | 1320 |
| 1126 | Ga0373955_0000939 | 3300035172 | Bacteria | 12465 |
| 1127 | Ga0373955_0020961 | 3300035172 | Bacteria | 3292 |
| 1128 | Ga0373955_0022592 | 3300035172 | Bacteria | 3192 |
| 1129 | Ga0373955_0025875 | 3300035172 | Bacteria | 3017 |
| 1130 | Ga0373955_0069900 | 3300035172 | Bacteria | 1960 |
| 1131 | Ga0373955_0115527 | 3300035172 | Bacteria | 1555 |
| 1132 | Ga0373955_0195555 | 3300035172 | Bacteria | 1203 |
| 1133 | Ga0373942_0000345 | 3300035207 | Bacteria | 12686 |
| 1134 | Ga0373942_0024473 | 3300035207 | Bacteria | 1548 |
| 1135 | Ga0373961_0000298 | 3300035241 | Bacteria | 22185 |
| 1136 | Ga0373961_0119758 | 3300035241 | Bacteria | 871 |
| 1137 | Ga0373962_0000490 | 3300035242 | Bacteria | 8786 |
| 1138 | Ga0373962_0026721 | 3300035242 | Bacteria | 1558 |
| 1139 | Ga0373962_0038087 | 3300035242 | Bacteria | 1345 |
| 1140 | Ga0373962_0071855 | 3300035242 | Bacteria | 1036 |
| 1141 | Ga0316574_0000211 | 3300035398 | Bacteria | 20517 |
| 1142 | Ga0373924_0000420 | 3300035410 | Bacteria | 12971 |
| 1143 | Ga0373924_0010729 | 3300035410 | Bacteria | 3389 |
| 1144 | Ga0373924_0018992 | 3300035410 | Bacteria | 2658 |
| 1145 | Ga0373924_0019629 | 3300035410 | Bacteria | 2620 |
| 1146 | Ga0373924_0022643 | 3300035410 | Bacteria | 2457 |
| 1147 | Ga0373924_0050885 | 3300035410 | Bacteria | 1717 |
| 1148 | Ga0373924_0075188 | 3300035410 | Bacteria | 1429 |
| 1149 | Ga0373931_0002660 | 3300035691 | Bacteria | 7947 |
| 1150 | Ga0373931_0006309 | 3300035691 | Bacteria | 5532 |
| 1151 | Ga0373931_0009404 | 3300035691 | Bacteria | 4673 |
| 1152 | Ga0373931_0009501 | 3300035691 | Bacteria | 4651 |
| 1153 | Ga0373931_0019643 | 3300035691 | Bacteria | 3375 |
| 1154 | Ga0373931_0077504 | 3300035691 | Bacteria | 1827 |
| 1155 | Ga0373931_0095815 | 3300035691 | Bacteria | 1661 |
| 1156 | Ga0373931_0416183 | 3300035691 | Bacteria | 854 |
| 1157 | Ga0373935_0000068 | 3300035692 | Bacteria | 43997 |
| 1158 | Ga0373935_0001340 | 3300035692 | Bacteria | 13632 |
| 1159 | Ga0373935_0004603 | 3300035692 | Bacteria | 8107 |
| 1160 | Ga0373935_0033167 | 3300035692 | Bacteria | 3212 |
| 1161 | Ga0373935_0035234 | 3300035692 | Bacteria | 3124 |
| 1162 | Ga0373935_0047368 | 3300035692 | Bacteria | 2718 |
| 1163 | Ga0373935_0124991 | 3300035692 | Bacteria | 1722 |
| 1164 | Ga0373935_0291884 | 3300035692 | Bacteria | 1150 |
| 1165 | Ga0373927_0000892 | 3300035695 | Bacteria | 22721 |
| 1166 | Ga0373927_0007778 | 3300035695 | Bacteria | 7249 |
| 1167 | Ga0373927_0013606 | 3300035695 | Bacteria | 5403 |
| 1168 | Ga0373927_0017506 | 3300035695 | Bacteria | 4714 |
| 1169 | Ga0373927_0028055 | 3300035695 | Bacteria | 3673 |
| 1170 | Ga0373927_0040077 | 3300035695 | Bacteria | 3039 |
| 1171 | Ga0373927_0044599 | 3300035695 | Bacteria | 2869 |
| 1172 | Ga0373927_0068542 | 3300035695 | Bacteria | 2295 |
| 1173 | Ga0373927_0089508 | 3300035695 | Bacteria | 1998 |
| 1174 | Ga0373927_0107455 | 3300035695 | Bacteria | 1817 |
| 1175 | Ga0373927_0122064 | 3300035695 | Bacteria | 1700 |
| 1176 | Ga0373927_0165875 | 3300035695 | Bacteria | 1447 |
| 1177 | Ga0373927_0237513 | 3300035695 | Bacteria | 1197 |
| 1178 | Ga0373927_0407104 | 3300035695 | Bacteria | 898 |
| 1179 | Ga0373933_0002505 | 3300035724 | Bacteria | 10327 |
| 1180 | Ga0373933_0006990 | 3300035724 | Bacteria | 6153 |
| 1181 | Ga0373933_0019730 | 3300035724 | Bacteria | 3813 |
| 1182 | Ga0373933_0035338 | 3300035724 | Bacteria | 2918 |
| 1183 | Ga0373933_0169074 | 3300035724 | Bacteria | 1391 |
| 1184 | Ga0373933_0216853 | 3300035724 | Bacteria | 1227 |
| 1185 | Ga0373933_0438419 | 3300035724 | Bacteria | 854 |
| 1186 | Ga0373947_0001171 | 3300035725 | Bacteria | 16128 |
| 1187 | Ga0373947_0001272 | 3300035725 | Bacteria | 15537 |
| 1188 | Ga0373947_0023230 | 3300035725 | Bacteria | 3605 |
| 1189 | Ga0373947_0024918 | 3300035725 | Bacteria | 3488 |
| 1190 | Ga0373947_0040448 | 3300035725 | Bacteria | 2777 |
| 1191 | Ga0373947_0057180 | 3300035725 | Bacteria | 2359 |
| 1192 | Ga0373947_0071540 | 3300035725 | Bacteria | 2127 |
| 1193 | Ga0373947_0144980 | 3300035725 | Bacteria | 1526 |
| 1194 | Ga0373947_0159507 | 3300035725 | Bacteria | 1458 |
| 1195 | Ga0373947_0180941 | 3300035725 | Bacteria | 1372 |
| 1196 | Ga0373947_0201741 | 3300035725 | Bacteria | 1301 |
| 1197 | Ga0373947_0265333 | 3300035725 | Bacteria | 1138 |
| 1198 | Ga0373947_0420068 | 3300035725 | Bacteria | 904 |
| 1199 | Ga0373937_0000347 | 3300036401 | Bacteria | 43749 |
| 1200 | Ga0373937_0008050 | 3300036401 | Bacteria | 9140 |
| 1201 | Ga0373937_0011304 | 3300036401 | Bacteria | 7830 |
| 1202 | Ga0373937_0026143 | 3300036401 | Bacteria | 5274 |
| 1203 | Ga0373937_0027513 | 3300036401 | Bacteria | 5141 |
| 1204 | Ga0373937_0057623 | 3300036401 | Bacteria | 3569 |
| 1205 | Ga0373937_0098779 | 3300036401 | Bacteria | 2708 |
| 1206 | Ga0373937_0188576 | 3300036401 | Bacteria | 1937 |
| 1207 | Ga0373937_0229258 | 3300036401 | Bacteria | 1749 |
| 1208 | Ga0373937_0232213 | 3300036401 | Bacteria | 1737 |
| 1209 | Ga0373937_0469428 | 3300036401 | Bacteria | 1195 |
| 1210 | Ga0373937_0495646 | 3300036401 | Bacteria | 1160 |
| 1211 | Ga0316582_0353427 | 3300036647 | Bacteria | 1011 |
| 1212 | Ga0316584_0008194 | 3300036712 | Bacteria | 7188 |
| 1213 | Ga0373925_0000081 | 3300037068 | Bacteria | 102407 |
| 1214 | Ga0373925_0000653 | 3300037068 | Bacteria | 32591 |
| 1215 | Ga0373925_0001023 | 3300037068 | Bacteria | 25318 |
| 1216 | Ga0373925_0008272 | 3300037068 | Bacteria | 7570 |
| 1217 | Ga0373925_0025054 | 3300037068 | Bacteria | 4357 |
| 1218 | Ga0373925_0030678 | 3300037068 | Bacteria | 3947 |
| 1219 | Ga0373925_0046325 | 3300037068 | Bacteria | 3233 |
| 1220 | Ga0373925_0049791 | 3300037068 | Bacteria | 3123 |
| 1221 | Ga0373925_0050717 | 3300037068 | Bacteria | 3096 |
| 1222 | Ga0373925_0058583 | 3300037068 | Bacteria | 2888 |
| 1223 | Ga0373925_0095524 | 3300037068 | Bacteria | 2277 |
| 1224 | Ga0373925_0155767 | 3300037068 | Bacteria | 1797 |
| 1225 | Ga0373925_0164207 | 3300037068 | Bacteria | 1751 |
| 1226 | Ga0373925_0191875 | 3300037068 | Bacteria | 1621 |
| 1227 | Ga0373925_0229783 | 3300037068 | Bacteria | 1483 |
| 1228 | Ga0373925_0294800 | 3300037068 | Bacteria | 1308 |
| 1229 | Ga0373925_0507200 | 3300037068 | Bacteria | 990 |
| 1230 | Ga0373925_0758593 | 3300037068 | Bacteria | 800 |
| 1231 | Ga0395899_0032551 | 3300037312 | Bacteria | 3916 |
| 1232 | Ga0395899_0213489 | 3300037312 | Bacteria | 1340 |
| 1233 | Ga0395900_0006665 | 3300037418 | Bacteria | 12001 |
| 1234 | Ga0395900_0028654 | 3300037418 | Bacteria | 5707 |
| 1235 | Ga0395900_0098941 | 3300037418 | Bacteria | 2996 |
| 1236 | Ga0395900_0172509 | 3300037418 | Bacteria | 2201 |
| 1237 | Ga0395900_0200420 | 3300037418 | Bacteria | 2020 |
| 1238 | Ga0395898_0035860 | 3300037466 | Bacteria | 4929 |
| 1239 | Ga0395898_0038265 | 3300037466 | Bacteria | 4755 |
| 1240 | Ga0395898_0085008 | 3300037466 | Bacteria | 3050 |
| 1241 | Ga0395898_0092455 | 3300037466 | Bacteria | 2909 |
| 1242 | Ga0395898_0283432 | 3300037466 | Bacteria | 1580 |
| 1243 | Ga0395905_0302093 | 3300037471 | Bacteria | 1488 |
| 1244 | Ga0436364_0121626 | 3300037853 | Bacteria | 20150 |
| 1245 | Ga0436364_0338040 | 3300037853 | Bacteria | 2394 |
| 1246 | Ga0436364_0627969 | 3300037853 | Bacteria | 1385 |
| 1247 | Ga0436364_0660984 | 3300037853 | Bacteria | 4632 |
| 1248 | Ga0436364_0901640 | 3300037853 | Bacteria | 1900 |
| 1249 | Ga0436364_0916700 | 3300037853 | Bacteria | 2244 |
| 1250 | Ga0436364_1474445 | 3300037853 | Bacteria | 1793 |
| 1251 | Ga0436364_1519170 | 3300037853 | Bacteria | 1089 |
| 1252 | Ga0395901_0025427 | 3300038443 | Bacteria | 6077 |
| 1253 | Ga0395901_0026822 | 3300038443 | Bacteria | 5916 |
| 1254 | Ga0395901_0040513 | 3300038443 | Bacteria | 4825 |
| 1255 | Ga0395901_0902692 | 3300038443 | Bacteria | 865 |
| 1256 | Ga0242420_002911 | 3300038996 | Bacteria | 2488 |
| 1257 | Ga0436365_0059281 | 3300039437 | Bacteria | 3207 |
| 1258 | Ga0436365_0122255 | 3300039437 | Bacteria | 6640 |
| 1259 | Ga0436365_0248540 | 3300039437 | Bacteria | 1905 |
| 1260 | Ga0436365_1138132 | 3300039437 | Bacteria | 1348 |
| 1261 | Ga0436365_1168875 | 3300039437 | Bacteria | 1571 |
| 1262 | Ga0436365_1227273 | 3300039437 | Bacteria | 1978 |
| 1263 | Ga0436365_1288986 | 3300039437 | Bacteria | 1856 |
| 1264 | Ga0436365_1489999 | 3300039437 | Bacteria | 6004 |
| 1265 | Ga0436365_1546564 | 3300039437 | Bacteria | 2826 |
| 1266 | Ga0436365_1586594 | 3300039437 | Bacteria | 1333 |
| 1267 | Ga0436365_1636132 | 3300039437 | Bacteria | 1151 |
| 1268 | Ga0436365_1743112 | 3300039437 | Bacteria | 1354 |
| 1269 | Ga0436365_1808718 | 3300039437 | Bacteria | 864 |
| 1270 | Ga0436360_0104217 | 3300039438 | Bacteria | 745 |
| 1271 | Ga0436360_0526234 | 3300039438 | Bacteria | 1540 |
| 1272 | Ga0436361_0396460 | 3300039447 | Bacteria | 1735 |
| 1273 | Ga0436361_0537381 | 3300039447 | Bacteria | 3047 |
| 1274 | Ga0436363_1053196 | 3300039450 | Bacteria | 1617 |
| 1275 | Ga0436362_0029375 | 3300039453 | Bacteria | 786 |
| 1276 | Ga0436362_0103934 | 3300039453 | Bacteria | 1410 |
| 1277 | Ga0436362_0842372 | 3300039453 | Bacteria | 1346 |
| 1278 | Ga0451793_1602144 | 3300041452 | Bacteria | 1202 |
| 1279 | Ga0451798_0255151 | 3300041458 | Bacteria | 935 |
| 1280 | Ga0451800_0275571 | 3300041459 | Bacteria | 889 |
| 1281 | Ga0439441_046807 | 3300042001 | Bacteria | 881 |
| 1282 | Ga0439443_001105 | 3300042003 | Bacteria | 2835 |
| 1283 | Ga0439448_0009804 | 3300042005 | Bacteria | 2829 |
| 1284 | Ga0439450_003605 | 3300042008 | Bacteria | 2577 |
| 1285 | Ga0439452_038943 | 3300042010 | Bacteria | 1127 |
| 1286 | Ga0439455_0077232 | 3300042012 | Bacteria | 901 |
| 1287 | Ga0439456_012957 | 3300042013 | Bacteria | 1732 |
| 1288 | Ga0439458_0072824 | 3300042157 | Bacteria | 869 |
| 1289 | Ga0439434_0095338 | 3300042435 | Bacteria | 955 |
| 1290 | Ga0439435_0013920 | 3300042436 | Bacteria | 1979 |
| 1291 | Ga0439435_0033029 | 3300042436 | Bacteria | 1414 |
| 1292 | Ga0439459_0010364 | 3300042438 | Bacteria | 1625 |
| 1293 | Ga0439460_0024666 | 3300042461 | Bacteria | 1668 |
| 1294 | Ga0439460_0030144 | 3300042461 | Bacteria | 1540 |
| 1295 | Ga0450916_015667 | 3300042530 | Bacteria | 998 |
| 1296 | Ga0450893_0026988 | 3300042532 | Bacteria | 1011 |
| 1297 | Ga0466961_0213607 | 3300044693 | Bacteria | 1190 |
| 1298 | Ga0466963_0015054 | 3300044694 | Bacteria | 4781 |
| 1299 | Ga0466963_0050712 | 3300044694 | Bacteria | 2747 |
| 1300 | Ga0466964_0199296 | 3300044706 | Bacteria | 960 |
| 1301 | Ga0453684_0016107 | 3300044712 | Bacteria | 11730 |
| 1302 | Ga0466971_0011557 | 3300044719 | Bacteria | 3866 |
| 1303 | Ga0466968_0043860 | 3300044735 | Bacteria | 1895 |
| 1304 | Ga0466957_0007649 | 3300044842 | Bacteria | 6110 |
| 1305 | Ga0466957_0030543 | 3300044842 | Bacteria | 3217 |
| 1306 | Ga0466959_0053759 | 3300045049 | Bacteria | 2943 |
| 1307 | Ga0466959_0128956 | 3300045049 | Bacteria | 1793 |
| 1308 | Ga0451576_0092818 | 3300045051 | Bacteria | 3139 |
| 1309 | Ga0451576_0288386 | 3300045051 | Bacteria | 1716 |
| 1310 | Ga0466958_0016565 | 3300045836 | Bacteria | 4246 |
| 1311 | Ga0466958_0162419 | 3300045836 | Bacteria | 1412 |
| 1312 | Ga0466958_0245248 | 3300045836 | Bacteria | 1145 |
| 1313 | Ga0466967_0018949 | 3300045976 | Bacteria | 5520 |
| 1314 | Ga0466967_0217467 | 3300045976 | Bacteria | 1814 |
| 1315 | Ga0466967_0469013 | 3300045976 | Bacteria | 1232 |
| 1316 | Ga0495617_050620 | 3300046452 | Bacteria | 1382 |
| 1317 | Ga0495617_078054 | 3300046452 | Bacteria | 1086 |
| 1318 | Ga0495627_036133 | 3300046453 | Bacteria | 1537 |
| 1319 | Ga0495592_0000196 | 3300046454 | Bacteria | 51625 |
| 1320 | Ga0495592_0008970 | 3300046454 | Bacteria | 7513 |
| 1321 | Ga0495592_0025624 | 3300046454 | Bacteria | 4475 |
| 1322 | Ga0495592_0037087 | 3300046454 | Bacteria | 3670 |
| 1323 | Ga0495592_0053905 | 3300046454 | Bacteria | 2981 |
| 1324 | Ga0495603_0000093 | 3300046455 | Bacteria | 40890 |
| 1325 | Ga0495603_0054690 | 3300046455 | Bacteria | 2365 |
| 1326 | Ga0495603_0128064 | 3300046455 | Bacteria | 1479 |
| 1327 | Ga0495603_0214608 | 3300046455 | Bacteria | 1111 |
| 1328 | Ga0495603_0360902 | 3300046455 | Bacteria | 833 |
| 1329 | Ga0495591_057995 | 3300046458 | Bacteria | 1036 |
| 1330 | Ga0495629_0001201 | 3300046459 | Bacteria | 20401 |
| 1331 | Ga0495629_0010557 | 3300046459 | Bacteria | 6721 |
| 1332 | Ga0495629_0012746 | 3300046459 | Bacteria | 6086 |
| 1333 | Ga0495629_0027735 | 3300046459 | Bacteria | 4021 |
| 1334 | Ga0495629_0059328 | 3300046459 | Bacteria | 2674 |
| 1335 | Ga0495629_0064371 | 3300046459 | Bacteria | 2560 |
| 1336 | Ga0495629_0086242 | 3300046459 | Bacteria | 2190 |
| 1337 | Ga0495629_0225442 | 3300046459 | Bacteria | 1292 |
| 1338 | Ga0495638_0012740 | 3300046460 | Bacteria | 5748 |
| 1339 | Ga0495638_0021453 | 3300046460 | Bacteria | 4257 |
| 1340 | Ga0495641_0020177 | 3300046461 | Bacteria | 3389 |
| 1341 | Ga0495641_0021631 | 3300046461 | Bacteria | 3232 |
| 1342 | Ga0495641_0114948 | 3300046461 | Bacteria | 1200 |
| 1343 | Ga0495641_0223227 | 3300046461 | Bacteria | 845 |
| 1344 | Ga0495651_0002348 | 3300046462 | Bacteria | 14609 |
| 1345 | Ga0495651_0002948 | 3300046462 | Bacteria | 13159 |
| 1346 | Ga0495651_0005382 | 3300046462 | Bacteria | 9767 |
| 1347 | Ga0495651_0021551 | 3300046462 | Bacteria | 5008 |
| 1348 | Ga0495651_0042323 | 3300046462 | Bacteria | 3537 |
| 1349 | Ga0495651_0083231 | 3300046462 | Bacteria | 2413 |
| 1350 | Ga0495651_0094627 | 3300046462 | Bacteria | 2235 |
| 1351 | Ga0495651_0171422 | 3300046462 | Bacteria | 1545 |
| 1352 | Ga0495653_0000193 | 3300046463 | Bacteria | 49516 |
| 1353 | Ga0495653_0009994 | 3300046463 | Bacteria | 7762 |
| 1354 | Ga0495653_0019439 | 3300046463 | Bacteria | 5510 |
| 1355 | Ga0495653_0035077 | 3300046463 | Bacteria | 3961 |
| 1356 | Ga0495653_0057712 | 3300046463 | Bacteria | 2953 |
| 1357 | Ga0495653_0097052 | 3300046463 | Bacteria | 2142 |
| 1358 | Ga0495653_0227148 | 3300046463 | Bacteria | 1251 |
| 1359 | Ga0495653_0400753 | 3300046463 | Bacteria | 872 |
| 1360 | Ga0495580_0007841 | 3300046472 | Bacteria | 8549 |
| 1361 | Ga0495580_0010786 | 3300046472 | Bacteria | 7096 |
| 1362 | Ga0495580_0096357 | 3300046472 | Bacteria | 2057 |
| 1363 | Ga0495582_0005327 | 3300046473 | Bacteria | 7183 |
| 1364 | Ga0495582_0152078 | 3300046473 | Bacteria | 1314 |
| 1365 | Ga0495582_0190635 | 3300046473 | Bacteria | 1169 |
| 1366 | Ga0495582_0282348 | 3300046473 | Bacteria | 953 |
| 1367 | Ga0495582_0415554 | 3300046473 | Bacteria | 776 |
| 1368 | Ga0495605_0156893 | 3300046474 | Bacteria | 1012 |
| 1369 | Ga0495639_0005974 | 3300046475 | Bacteria | 5235 |
| 1370 | Ga0495639_0011892 | 3300046475 | Bacteria | 3754 |
| 1371 | Ga0495639_0044738 | 3300046475 | Bacteria | 2001 |
| 1372 | Ga0495639_0059835 | 3300046475 | Bacteria | 1744 |
| 1373 | Ga0495639_0074989 | 3300046475 | Bacteria | 1568 |
| 1374 | Ga0495639_0131573 | 3300046475 | Bacteria | 1198 |
| 1375 | Ga0495662_0002058 | 3300046476 | Bacteria | 10084 |
| 1376 | Ga0495662_0015755 | 3300046476 | Bacteria | 3668 |
| 1377 | Ga0495662_0018838 | 3300046476 | Bacteria | 3340 |
| 1378 | Ga0495662_0038790 | 3300046476 | Bacteria | 2302 |
| 1379 | Ga0495662_0220777 | 3300046476 | Bacteria | 934 |
| 1380 | Ga0495664_0000016 | 3300046477 | Bacteria | 175933 |
| 1381 | Ga0495664_0008894 | 3300046477 | Bacteria | 5612 |
| 1382 | Ga0495664_0027162 | 3300046477 | Bacteria | 3336 |
| 1383 | Ga0495664_0031450 | 3300046477 | Bacteria | 3111 |
| 1384 | Ga0495664_0109799 | 3300046477 | Bacteria | 1664 |
| 1385 | Ga0495664_0121094 | 3300046477 | Bacteria | 1583 |
| 1386 | Ga0495584_0015525 | 3300046491 | Bacteria | 3881 |
| 1387 | Ga0495584_0028278 | 3300046491 | Bacteria | 2840 |
| 1388 | Ga0495584_0200121 | 3300046491 | Bacteria | 1015 |
| 1389 | Ga0495585_0000744 | 3300046492 | Bacteria | 28955 |
| 1390 | Ga0495594_0000721 | 3300046499 | Bacteria | 16981 |
| 1391 | Ga0495594_0087294 | 3300046499 | Bacteria | 1745 |
| 1392 | Ga0495607_0004149 | 3300046501 | Bacteria | 10786 |
| 1393 | Ga0495607_0136966 | 3300046501 | Bacteria | 1267 |
| 1394 | Ga0495607_0210563 | 3300046501 | Bacteria | 957 |
| 1395 | Ga0495608_0000121 | 3300046511 | Bacteria | 56189 |
| 1396 | Ga0495608_0000771 | 3300046511 | Bacteria | 22430 |
| 1397 | Ga0495608_0014487 | 3300046511 | Bacteria | 5469 |
| 1398 | Ga0495608_0040568 | 3300046511 | Bacteria | 3118 |
| 1399 | Ga0495608_0112226 | 3300046511 | Bacteria | 1752 |
| 1400 | Ga0495608_0113543 | 3300046511 | Bacteria | 1740 |
| 1401 | Ga0495616_0016978 | 3300046513 | Bacteria | 4020 |
| 1402 | Ga0495618_0000124 | 3300046514 | Bacteria | 56215 |
| 1403 | Ga0495618_0005183 | 3300046514 | Bacteria | 7964 |
| 1404 | Ga0495618_0017457 | 3300046514 | Bacteria | 4401 |
| 1405 | Ga0495618_0018922 | 3300046514 | Bacteria | 4231 |
| 1406 | Ga0495618_0042509 | 3300046514 | Bacteria | 2865 |
| 1407 | Ga0495618_0055657 | 3300046514 | Bacteria | 2504 |
| 1408 | Ga0495620_0172302 | 3300046515 | Bacteria | 839 |
| 1409 | Ga0495628_0000018 | 3300046516 | Bacteria | 169916 |
| 1410 | Ga0495628_0000983 | 3300046516 | Bacteria | 26069 |
| 1411 | Ga0495628_0009078 | 3300046516 | Bacteria | 8504 |
| 1412 | Ga0495628_0027680 | 3300046516 | Bacteria | 4609 |
| 1413 | Ga0495628_0036129 | 3300046516 | Bacteria | 3967 |
| 1414 | Ga0495628_0130602 | 3300046516 | Bacteria | 1921 |
| 1415 | Ga0495628_0258302 | 3300046516 | Bacteria | 1299 |
| 1416 | Ga0495628_0514395 | 3300046516 | Bacteria | 863 |
| 1417 | Ga0495630_0003520 | 3300046517 | Bacteria | 10898 |
| 1418 | Ga0495630_0017798 | 3300046517 | Bacteria | 5210 |
| 1419 | Ga0495630_0024763 | 3300046517 | Bacteria | 4436 |
| 1420 | Ga0495630_0077425 | 3300046517 | Bacteria | 2507 |
| 1421 | Ga0495630_0085278 | 3300046517 | Bacteria | 2384 |
| 1422 | Ga0495630_0160731 | 3300046517 | Bacteria | 1710 |
| 1423 | Ga0495630_0276089 | 3300046517 | Bacteria | 1284 |
| 1424 | Ga0495630_0278009 | 3300046517 | Bacteria | 1279 |
| 1425 | Ga0495630_0289424 | 3300046517 | Bacteria | 1252 |
| 1426 | Ga0495630_0341734 | 3300046517 | Bacteria | 1145 |
| 1427 | Ga0495637_0037120 | 3300046520 | Bacteria | 2118 |
| 1428 | Ga0495643_0196220 | 3300046522 | Bacteria | 972 |
| 1429 | Ga0495644_0001408 | 3300046523 | Bacteria | 9823 |
| 1430 | Ga0495644_0167041 | 3300046523 | Bacteria | 844 |
| 1431 | Ga0495663_0117490 | 3300046525 | Bacteria | 888 |
| 1432 | Ga0495666_0042442 | 3300046526 | Bacteria | 2199 |
| 1433 | Ga0495666_0043799 | 3300046526 | Bacteria | 2161 |
| 1434 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 1435 | Ga0495652_0002733 | 3300046529 | Bacteria | 17857 |
| 1436 | Ga0495652_0051626 | 3300046529 | Bacteria | 3511 |
| 1437 | Ga0495652_0058542 | 3300046529 | Bacteria | 3261 |
| 1438 | Ga0495652_0066677 | 3300046529 | Bacteria | 3019 |
| 1439 | Ga0495652_0089511 | 3300046529 | Bacteria | 2520 |
| 1440 | Ga0495652_0106119 | 3300046529 | Bacteria | 2269 |
| 1441 | Ga0495652_0125251 | 3300046529 | Bacteria | 2042 |
| 1442 | Ga0495652_0141866 | 3300046529 | Bacteria | 1888 |
| 1443 | Ga0495652_0190519 | 3300046529 | Bacteria | 1565 |
| 1444 | Ga0495652_0286467 | 3300046529 | Bacteria | 1204 |
| 1445 | Ga0495652_0342268 | 3300046529 | Bacteria | 1074 |
| 1446 | Ga0495665_0009999 | 3300046531 | Bacteria | 5138 |
| 1447 | Ga0495665_0058209 | 3300046531 | Bacteria | 2040 |
| 1448 | Ga0495665_0118793 | 3300046531 | Bacteria | 1385 |
| 1449 | Ga0495665_0134352 | 3300046531 | Bacteria | 1294 |
| 1450 | Ga0495665_0146541 | 3300046531 | Bacteria | 1233 |
| 1451 | Ga0495665_0309354 | 3300046531 | Bacteria | 808 |
| 1452 | Ga0495640_0000063 | 3300046533 | Bacteria | 60255 |
| 1453 | Ga0495640_0006976 | 3300046533 | Bacteria | 8896 |
| 1454 | Ga0495640_0008162 | 3300046533 | Bacteria | 8220 |
| 1455 | Ga0495640_0020151 | 3300046533 | Bacteria | 4913 |
| 1456 | Ga0495640_0026278 | 3300046533 | Bacteria | 4209 |
| 1457 | Ga0495640_0028991 | 3300046533 | Bacteria | 3979 |
| 1458 | Ga0495640_0073498 | 3300046533 | Bacteria | 2289 |
| 1459 | Ga0495640_0084335 | 3300046533 | Bacteria | 2107 |
| 1460 | Ga0495640_0111190 | 3300046533 | Bacteria | 1790 |
| 1461 | Ga0495640_0225160 | 3300046533 | Bacteria | 1181 |
| 1462 | Ga0495640_0282941 | 3300046533 | Bacteria | 1032 |
| 1463 | Ga0495586_0013527 | 3300046535 | Bacteria | 4328 |
| 1464 | Ga0495586_0193971 | 3300046535 | Bacteria | 1150 |
| 1465 | Ga0495587_0000134 | 3300046536 | Bacteria | 56076 |
| 1466 | Ga0495587_0001646 | 3300046536 | Bacteria | 14900 |
| 1467 | Ga0495587_0002875 | 3300046536 | Bacteria | 11533 |
| 1468 | Ga0495587_0029159 | 3300046536 | Bacteria | 3352 |
| 1469 | Ga0495587_0039375 | 3300046536 | Bacteria | 2829 |
| 1470 | Ga0495587_0039844 | 3300046536 | Bacteria | 2810 |
| 1471 | Ga0495587_0078567 | 3300046536 | Bacteria | 1914 |
| 1472 | Ga0495598_0003261 | 3300046537 | Bacteria | 3428 |
| 1473 | Ga0495598_0051766 | 3300046537 | Bacteria | 1238 |
| 1474 | Ga0495598_0095176 | 3300046537 | Bacteria | 977 |
| 1475 | Ga0495609_0093773 | 3300046538 | Bacteria | 1304 |
| 1476 | Ga0495609_0198642 | 3300046538 | Bacteria | 839 |
| 1477 | Ga0495645_0000070 | 3300046543 | Bacteria | 71823 |
| 1478 | Ga0495645_0000964 | 3300046543 | Bacteria | 19618 |
| 1479 | Ga0495645_0010945 | 3300046543 | Bacteria | 6369 |
| 1480 | Ga0495645_0032016 | 3300046543 | Bacteria | 3835 |
| 1481 | Ga0495645_0101869 | 3300046543 | Bacteria | 2041 |
| 1482 | Ga0495645_0169314 | 3300046543 | Bacteria | 1504 |
| 1483 | Ga0495622_0000860 | 3300046557 | Bacteria | 16649 |
| 1484 | Ga0495622_0046427 | 3300046557 | Bacteria | 2018 |
| 1485 | Ga0495633_0001138 | 3300046558 | Bacteria | 21358 |
| 1486 | Ga0495667_0000023 | 3300046559 | Bacteria | 169343 |
| 1487 | Ga0495667_0001135 | 3300046559 | Bacteria | 17343 |
| 1488 | Ga0495667_0001703 | 3300046559 | Bacteria | 14601 |
| 1489 | Ga0495667_0012592 | 3300046559 | Bacteria | 5735 |
| 1490 | Ga0495667_0013045 | 3300046559 | Bacteria | 5628 |
| 1491 | Ga0495667_0033063 | 3300046559 | Bacteria | 3461 |
| 1492 | Ga0495667_0045998 | 3300046559 | Bacteria | 2887 |
| 1493 | Ga0495667_0077552 | 3300046559 | Bacteria | 2161 |
| 1494 | Ga0495667_0353605 | 3300046559 | Bacteria | 928 |
| 1495 | Ga0495656_0000294 | 3300046615 | Bacteria | 17355 |
| 1496 | Ga0495656_0031553 | 3300046615 | Bacteria | 2150 |
| 1497 | Ga0495668_0109391 | 3300046616 | Bacteria | 1512 |
| 1498 | Ga0495634_0001421 | 3300046642 | Bacteria | 21381 |
| 1499 | Ga0495634_0010247 | 3300046642 | Bacteria | 6866 |
| 1500 | Ga0495634_0010782 | 3300046642 | Bacteria | 6686 |
| 1501 | Ga0495634_0021067 | 3300046642 | Bacteria | 4616 |
| 1502 | Ga0495634_0081754 | 3300046642 | Bacteria | 2112 |
| 1503 | Ga0495634_0098959 | 3300046642 | Bacteria | 1886 |
| 1504 | Ga0495634_0253731 | 3300046642 | Bacteria | 1075 |
| 1505 | Ga0495611_0023332 | 3300046648 | Bacteria | 2683 |
| 1506 | Ga0495611_0075383 | 3300046648 | Bacteria | 1546 |
| 1507 | Ga0495635_0000045 | 3300046663 | Bacteria | 82266 |
| 1508 | Ga0495635_0012375 | 3300046663 | Bacteria | 5979 |
| 1509 | Ga0495635_0013259 | 3300046663 | Bacteria | 5768 |
| 1510 | Ga0495635_0015541 | 3300046663 | Bacteria | 5320 |
| 1511 | Ga0495635_0025544 | 3300046663 | Bacteria | 4115 |
| 1512 | Ga0495635_0086485 | 3300046663 | Bacteria | 2145 |
| 1513 | Ga0495635_0153273 | 3300046663 | Bacteria | 1569 |
| 1514 | Ga0495659_0000910 | 3300046664 | Bacteria | 10516 |
| 1515 | Ga0495659_0007996 | 3300046664 | Bacteria | 3357 |
| 1516 | Ga0495659_0028993 | 3300046664 | Bacteria | 1919 |
| 1517 | Ga0495659_0051172 | 3300046664 | Bacteria | 1504 |
| 1518 | Ga0495661_0142490 | 3300046665 | Bacteria | 1302 |
| 1519 | Ga0495661_0268576 | 3300046665 | Bacteria | 864 |
| 1520 | Ga0495588_0015102 | 3300046674 | Bacteria | 3710 |
| 1521 | Ga0495588_0035827 | 3300046674 | Bacteria | 2516 |
| 1522 | Ga0495657_0001484 | 3300046675 | Bacteria | 20216 |
| 1523 | Ga0495657_0009705 | 3300046675 | Bacteria | 7278 |
| 1524 | Ga0495657_0020415 | 3300046675 | Bacteria | 4761 |
| 1525 | Ga0495657_0061911 | 3300046675 | Bacteria | 2474 |
| 1526 | Ga0495657_0357786 | 3300046675 | Bacteria | 863 |
| 1527 | Ga0495599_0000107 | 3300046678 | Bacteria | 56178 |
| 1528 | Ga0495599_0004271 | 3300046678 | Bacteria | 8443 |
| 1529 | Ga0495599_0012935 | 3300046678 | Bacteria | 5151 |
| 1530 | Ga0495599_0140992 | 3300046678 | Bacteria | 1495 |
| 1531 | Ga0495599_0172179 | 3300046678 | Bacteria | 1335 |
| 1532 | Ga0495599_0249395 | 3300046678 | Bacteria | 1081 |
| 1533 | Ga0495599_0253644 | 3300046678 | Bacteria | 1070 |
| 1534 | Ga0495623_0001191 | 3300046679 | Bacteria | 17644 |
| 1535 | Ga0495623_0007416 | 3300046679 | Bacteria | 7122 |
| 1536 | Ga0495623_0008866 | 3300046679 | Bacteria | 6528 |
| 1537 | Ga0495623_0014856 | 3300046679 | Bacteria | 5035 |
| 1538 | Ga0495623_0055588 | 3300046679 | Bacteria | 2495 |
| 1539 | Ga0495646_0000027 | 3300046680 | Bacteria | 97629 |
| 1540 | Ga0495646_0032793 | 3300046680 | Bacteria | 3230 |
| 1541 | Ga0495646_0037398 | 3300046680 | Bacteria | 3002 |
| 1542 | Ga0495646_0047543 | 3300046680 | Bacteria | 2611 |
| 1543 | Ga0495647_0011106 | 3300046681 | Bacteria | 3079 |
| 1544 | Ga0495647_0120031 | 3300046681 | Bacteria | 1105 |
| 1545 | Ga0495647_0221901 | 3300046681 | Bacteria | 835 |
| 1546 | Ga0495658_0011800 | 3300046683 | Bacteria | 4405 |
| 1547 | Ga0495658_0041663 | 3300046683 | Bacteria | 2559 |
| 1548 | Ga0495658_0051957 | 3300046683 | Bacteria | 2322 |
| 1549 | Ga0495658_0069244 | 3300046683 | Bacteria | 2045 |
| 1550 | Ga0495658_0166566 | 3300046683 | Bacteria | 1362 |
| 1551 | Ga0495669_0029452 | 3300046684 | Bacteria | 2408 |
| 1552 | Ga0495669_0050152 | 3300046684 | Bacteria | 1871 |
| 1553 | Ga0495613_0001829 | 3300046689 | Bacteria | 16164 |
| 1554 | Ga0495613_0001924 | 3300046689 | Bacteria | 15748 |
| 1555 | Ga0495613_0006830 | 3300046689 | Bacteria | 8523 |
| 1556 | Ga0495613_0090999 | 3300046689 | Bacteria | 2209 |
| 1557 | Ga0495613_0138925 | 3300046689 | Bacteria | 1737 |
| 1558 | Ga0495613_0146571 | 3300046689 | Bacteria | 1684 |
| 1559 | Ga0495613_0163629 | 3300046689 | Bacteria | 1581 |
| 1560 | Ga0495624_0003159 | 3300046690 | Bacteria | 12283 |
| 1561 | Ga0495624_0039069 | 3300046690 | Bacteria | 3044 |
| 1562 | Ga0495624_0115043 | 3300046690 | Bacteria | 1653 |
| 1563 | Ga0495624_0188625 | 3300046690 | Bacteria | 1254 |
| 1564 | Ga0495624_0394134 | 3300046690 | Bacteria | 831 |
| 1565 | Ga0495670_0002475 | 3300046691 | Bacteria | 9116 |
| 1566 | Ga0495670_0134647 | 3300046691 | Bacteria | 1289 |
| 1567 | Ga0495671_0055359 | 3300046692 | Bacteria | 1965 |
| 1568 | Ga0495671_0300586 | 3300046692 | Bacteria | 772 |
| 1569 | Ga0495600_0000062 | 3300046809 | Bacteria | 61420 |
| 1570 | Ga0495600_0007173 | 3300046809 | Bacteria | 6806 |
| 1571 | Ga0495600_0011446 | 3300046809 | Bacteria | 5528 |
| 1572 | Ga0495600_0022696 | 3300046809 | Bacteria | 4032 |
| 1573 | Ga0495600_0063032 | 3300046809 | Bacteria | 2422 |
| 1574 | Ga0495600_0170741 | 3300046809 | Bacteria | 1404 |
| 1575 | Ga0495600_0337010 | 3300046809 | Bacteria | 946 |
| 1576 | Ga0495581_0001040 | 3300047315 | Bacteria | 15017 |
| 1577 | Ga0495581_0024139 | 3300047315 | Bacteria | 3523 |
| 1578 | Ga0495581_0038630 | 3300047315 | Bacteria | 2762 |
| 1579 | Ga0495581_0046212 | 3300047315 | Bacteria | 2515 |
| 1580 | Ga0495581_0079606 | 3300047315 | Bacteria | 1896 |
| 1581 | Ga0495581_0138786 | 3300047315 | Bacteria | 1417 |
| 1582 | Ga0495604_0000014 | 3300047317 | Bacteria | 205481 |
| 1583 | Ga0495604_0002499 | 3300047317 | Bacteria | 14688 |
| 1584 | Ga0495604_0053444 | 3300047317 | Bacteria | 3121 |
| 1585 | Ga0495604_0055049 | 3300047317 | Bacteria | 3067 |
| 1586 | Ga0495604_0078633 | 3300047317 | Bacteria | 2475 |
| 1587 | Ga0495604_0080164 | 3300047317 | Bacteria | 2447 |
| 1588 | Ga0495604_0099497 | 3300047317 | Bacteria | 2140 |
| 1589 | Ga0495674_0000014 | 3300047319 | Bacteria | 241211 |
| 1590 | Ga0495674_0016669 | 3300047319 | Bacteria | 6855 |
| 1591 | Ga0495674_0023132 | 3300047319 | Bacteria | 5727 |
| 1592 | Ga0495674_0049831 | 3300047319 | Bacteria | 3697 |
| 1593 | Ga0495674_0049897 | 3300047319 | Bacteria | 3695 |
| 1594 | Ga0495674_0057712 | 3300047319 | Bacteria | 3397 |
| 1595 | Ga0495674_0059508 | 3300047319 | Bacteria | 3336 |
| 1596 | Ga0495674_0216636 | 3300047319 | Bacteria | 1584 |
| 1597 | Ga0495674_0356436 | 3300047319 | Bacteria | 1187 |
| 1598 | Ga0495674_0357015 | 3300047319 | Bacteria | 1185 |
| 1599 | Ga0495674_0361912 | 3300047319 | Bacteria | 1176 |
| 1600 | Ga0495672_0065395 | 3300047320 | Bacteria | 2079 |
| 1601 | Ga0495672_0164150 | 3300047320 | Bacteria | 1139 |
| 1602 | Ga0495676_0046149 | 3300047321 | Bacteria | 3539 |
| 1603 | Ga0495676_0080907 | 3300047321 | Bacteria | 2464 |
| 1604 | Ga0495676_0084335 | 3300047321 | Bacteria | 2397 |
| 1605 | Ga0495676_0153985 | 3300047321 | Bacteria | 1633 |
| 1606 | Ga0495676_0190838 | 3300047321 | Bacteria | 1429 |
| 1607 | Ga0495680_0002314 | 3300047322 | Bacteria | 19559 |
| 1608 | Ga0495680_0005915 | 3300047322 | Bacteria | 11432 |
| 1609 | Ga0495680_0009630 | 3300047322 | Bacteria | 8674 |
| 1610 | Ga0495680_0014720 | 3300047322 | Bacteria | 6763 |
| 1611 | Ga0495680_0035972 | 3300047322 | Bacteria | 3981 |
| 1612 | Ga0495680_0054521 | 3300047322 | Bacteria | 3104 |
| 1613 | Ga0495680_0059006 | 3300047322 | Bacteria | 2964 |
| 1614 | Ga0495680_0181817 | 3300047322 | Bacteria | 1517 |
| 1615 | Ga0495680_0247426 | 3300047322 | Bacteria | 1265 |
| 1616 | Ga0495675_0000058 | 3300047444 | Bacteria | 77587 |
| 1617 | Ga0495675_0002587 | 3300047444 | Bacteria | 10845 |
| 1618 | Ga0495675_0017488 | 3300047444 | Bacteria | 4544 |
| 1619 | Ga0495675_0049171 | 3300047444 | Bacteria | 2681 |
| 1620 | Ga0495675_0081769 | 3300047444 | Bacteria | 2034 |
| 1621 | Ga0495675_0237466 | 3300047444 | Bacteria | 1098 |
| 1622 | Ga0495677_0108541 | 3300047445 | Bacteria | 1054 |
| 1623 | Ga0495685_010080 | 3300047447 | Bacteria | 3166 |
| 1624 | Ga0495684_0000059 | 3300047471 | Bacteria | 77947 |
| 1625 | Ga0495684_0002058 | 3300047471 | Bacteria | 16177 |
| 1626 | Ga0495684_0060169 | 3300047471 | Bacteria | 2892 |
| 1627 | Ga0495684_0124863 | 3300047471 | Bacteria | 1936 |
| 1628 | Ga0495684_0129220 | 3300047471 | Bacteria | 1899 |
| 1629 | Ga0495684_0244855 | 3300047471 | Bacteria | 1306 |
| 1630 | Ga0495593_0000892 | 3300047673 | Bacteria | 17349 |
| 1631 | Ga0495593_0002389 | 3300047673 | Bacteria | 11288 |
| 1632 | Ga0495593_0006746 | 3300047673 | Bacteria | 6718 |
| 1633 | Ga0495593_0012827 | 3300047673 | Bacteria | 4787 |
| 1634 | Ga0495593_0041503 | 3300047673 | Bacteria | 2473 |
| 1635 | Ga0495593_0084739 | 3300047673 | Bacteria | 1636 |
| 1636 | Ga0495602_0000017 | 3300048088 | Bacteria | 184180 |
| 1637 | Ga0495602_0003589 | 3300048088 | Bacteria | 16070 |
| 1638 | Ga0495602_0009345 | 3300048088 | Bacteria | 10198 |
| 1639 | Ga0495602_0021745 | 3300048088 | Bacteria | 6303 |
| 1640 | Ga0495602_0075453 | 3300048088 | Bacteria | 2861 |
| 1641 | Ga0495602_0111881 | 3300048088 | Bacteria | 2217 |
| 1642 | Ga0495602_0367535 | 3300048088 | Bacteria | 1034 |
| 1643 | Ga0495614_0009570 | 3300048089 | Bacteria | 4283 |
| 1644 | Ga0495614_0013572 | 3300048089 | Bacteria | 3572 |
| 1645 | Ga0495614_0083069 | 3300048089 | Bacteria | 1389 |
| 1646 | Ga0495614_0191860 | 3300048089 | Bacteria | 922 |
| 1647 | Ga0496100_0000919 | 3300048903 | Bacteria | 14036 |
| 1648 | Ga0496100_0006499 | 3300048903 | Bacteria | 6377 |
| 1649 | Ga0496100_0019742 | 3300048903 | Bacteria | 4027 |
| 1650 | Ga0496100_0027242 | 3300048903 | Bacteria | 3513 |
| 1651 | Ga0496100_0038257 | 3300048903 | Bacteria | 3039 |
| 1652 | Ga0496100_0066987 | 3300048903 | Bacteria | 2383 |
| 1653 | Ga0496100_0139605 | 3300048903 | Bacteria | 1716 |
| 1654 | Ga0496100_0174481 | 3300048903 | Bacteria | 1551 |
| 1655 | Ga0496100_0264740 | 3300048903 | Bacteria | 1276 |
| 1656 | Ga0496100_0365725 | 3300048903 | Bacteria | 1092 |
| 1657 | Ga0496101_0000569 | 3300048904 | Bacteria | 22604 |
| 1658 | Ga0496101_0012497 | 3300048904 | Bacteria | 5666 |
| 1659 | Ga0496101_0024358 | 3300048904 | Bacteria | 4188 |
| 1660 | Ga0496101_0088947 | 3300048904 | Bacteria | 2294 |
| 1661 | Ga0496101_0161752 | 3300048904 | Bacteria | 1717 |
| 1662 | Ga0496101_0270579 | 3300048904 | Bacteria | 1326 |
| 1663 | Ga0496101_0273467 | 3300048904 | Bacteria | 1319 |
| 1664 | Ga0496101_0306739 | 3300048904 | Bacteria | 1244 |
| 1665 | Ga0496101_0597260 | 3300048904 | Bacteria | 873 |
| 1666 | Ga0496102_0008204 | 3300048905 | Bacteria | 8939 |
| 1667 | Ga0496102_0017532 | 3300048905 | Bacteria | 6272 |
| 1668 | Ga0496102_0032540 | 3300048905 | Bacteria | 4684 |
| 1669 | Ga0496102_0033436 | 3300048905 | Bacteria | 4621 |
| 1670 | Ga0496102_0044888 | 3300048905 | Bacteria | 4011 |
| 1671 | Ga0496102_0141274 | 3300048905 | Bacteria | 2258 |
| 1672 | Ga0496102_0158894 | 3300048905 | Bacteria | 2126 |
| 1673 | Ga0496102_0232147 | 3300048905 | Bacteria | 1739 |
| 1674 | Ga0496102_0427547 | 3300048905 | Bacteria | 1244 |
| 1675 | Ga0496102_0673704 | 3300048905 | Bacteria | 957 |
| 1676 | Ga0496102_0760608 | 3300048905 | Bacteria | 891 |
| 1677 | Ga0496103_0001432 | 3300048906 | Bacteria | 16005 |
| 1678 | Ga0496103_0004579 | 3300048906 | Bacteria | 8373 |
| 1679 | Ga0496103_0012887 | 3300048906 | Bacteria | 4959 |
| 1680 | Ga0496103_0056458 | 3300048906 | Bacteria | 2437 |
| 1681 | Ga0496103_0089717 | 3300048906 | Bacteria | 1939 |
| 1682 | Ga0496103_0129074 | 3300048906 | Bacteria | 1614 |
| 1683 | Ga0496104_0000239 | 3300048907 | Bacteria | 48386 |
| 1684 | Ga0496104_0002113 | 3300048907 | Bacteria | 17249 |
| 1685 | Ga0496104_0002280 | 3300048907 | Bacteria | 16544 |
| 1686 | Ga0496104_0003037 | 3300048907 | Bacteria | 14457 |
| 1687 | Ga0496104_0006583 | 3300048907 | Bacteria | 10216 |
| 1688 | Ga0496104_0009456 | 3300048907 | Bacteria | 8672 |
| 1689 | Ga0496104_0021769 | 3300048907 | Bacteria | 5888 |
| 1690 | Ga0496104_0059203 | 3300048907 | Bacteria | 3626 |
| 1691 | Ga0496104_0079916 | 3300048907 | Bacteria | 3117 |
| 1692 | Ga0496104_0093981 | 3300048907 | Bacteria | 2868 |
| 1693 | Ga0496104_0115058 | 3300048907 | Bacteria | 2581 |
| 1694 | Ga0496104_0138130 | 3300048907 | Bacteria | 2342 |
| 1695 | Ga0496104_0141028 | 3300048907 | Bacteria | 2315 |
| 1696 | Ga0496104_0683279 | 3300048907 | Bacteria | 934 |
| 1697 | Ga0496105_0002071 | 3300048908 | Bacteria | 14509 |
| 1698 | Ga0496105_0006702 | 3300048908 | Bacteria | 8864 |
| 1699 | Ga0496105_0006961 | 3300048908 | Bacteria | 8711 |
| 1700 | Ga0496105_0021912 | 3300048908 | Bacteria | 5172 |
| 1701 | Ga0496105_0032767 | 3300048908 | Bacteria | 4265 |
| 1702 | Ga0496105_0041467 | 3300048908 | Bacteria | 3794 |
| 1703 | Ga0496105_0083517 | 3300048908 | Bacteria | 2638 |
| 1704 | Ga0496105_0089019 | 3300048908 | Bacteria | 2550 |
| 1705 | Ga0496105_0089523 | 3300048908 | Bacteria | 2542 |
| 1706 | Ga0496105_0110435 | 3300048908 | Bacteria | 2270 |
| 1707 | Ga0496105_0235798 | 3300048908 | Bacteria | 1486 |
| 1708 | Ga0496106_0000491 | 3300048909 | Bacteria | 28020 |
| 1709 | Ga0496106_0005632 | 3300048909 | Bacteria | 9268 |
| 1710 | Ga0496106_0007949 | 3300048909 | Bacteria | 7837 |
| 1711 | Ga0496106_0033580 | 3300048909 | Bacteria | 3828 |
| 1712 | Ga0496106_0068253 | 3300048909 | Bacteria | 2712 |
| 1713 | Ga0496106_0110672 | 3300048909 | Bacteria | 2138 |
| 1714 | Ga0496106_0114853 | 3300048909 | Bacteria | 2099 |
| 1715 | Ga0496106_0127117 | 3300048909 | Bacteria | 1996 |
| 1716 | Ga0496106_0404935 | 3300048909 | Bacteria | 1096 |
| 1717 | Ga0496106_0407312 | 3300048909 | Bacteria | 1093 |
| 1718 | Ga0496107_0000327 | 3300048910 | Bacteria | 25714 |
| 1719 | Ga0496107_0001121 | 3300048910 | Bacteria | 16149 |
| 1720 | Ga0496107_0008877 | 3300048910 | Bacteria | 6964 |
| 1721 | Ga0496107_0012293 | 3300048910 | Bacteria | 5975 |
| 1722 | Ga0496107_0015183 | 3300048910 | Bacteria | 5395 |
| 1723 | Ga0496107_0031442 | 3300048910 | Bacteria | 3788 |
| 1724 | Ga0496107_0071203 | 3300048910 | Bacteria | 2526 |
| 1725 | Ga0496107_0103484 | 3300048910 | Bacteria | 2089 |
| 1726 | Ga0496107_0138410 | 3300048910 | Bacteria | 1799 |
| 1727 | Ga0496107_0145816 | 3300048910 | Bacteria | 1750 |
| 1728 | Ga0496107_0281241 | 3300048910 | Bacteria | 1238 |
| 1729 | Ga0496108_0004390 | 3300048911 | Bacteria | 11350 |
| 1730 | Ga0496108_0006898 | 3300048911 | Bacteria | 9191 |
| 1731 | Ga0496108_0011233 | 3300048911 | Bacteria | 7274 |
| 1732 | Ga0496108_0016572 | 3300048911 | Bacteria | 6016 |
| 1733 | Ga0496108_0097238 | 3300048911 | Bacteria | 2508 |
| 1734 | Ga0496108_0278723 | 3300048911 | Bacteria | 1455 |
| 1735 | Ga0496108_0325528 | 3300048911 | Bacteria | 1340 |
| 1736 | Ga0496108_0434532 | 3300048911 | Bacteria | 1146 |
| 1737 | Ga0496108_0539560 | 3300048911 | Bacteria | 1018 |
| 1738 | Ga0496109_0000925 | 3300048912 | Bacteria | 24421 |
| 1739 | Ga0496109_0007037 | 3300048912 | Bacteria | 9492 |
| 1740 | Ga0496109_0021125 | 3300048912 | Bacteria | 5755 |
| 1741 | Ga0496109_0029032 | 3300048912 | Bacteria | 4951 |
| 1742 | Ga0496109_0045546 | 3300048912 | Bacteria | 3981 |
| 1743 | Ga0496109_0065028 | 3300048912 | Bacteria | 3339 |
| 1744 | Ga0496109_0084279 | 3300048912 | Bacteria | 2932 |
| 1745 | Ga0496109_0165837 | 3300048912 | Bacteria | 2070 |
| 1746 | Ga0496109_0277551 | 3300048912 | Bacteria | 1579 |
| 1747 | Ga0496109_0425101 | 3300048912 | Bacteria | 1255 |
| 1748 | Ga0496109_0673353 | 3300048912 | Bacteria | 972 |
| 1749 | Ga0496110_0001215 | 3300048913 | Bacteria | 18339 |
| 1750 | Ga0496110_0001775 | 3300048913 | Bacteria | 15895 |
| 1751 | Ga0496110_0002587 | 3300048913 | Bacteria | 13609 |
| 1752 | Ga0496110_0017600 | 3300048913 | Bacteria | 5975 |
| 1753 | Ga0496110_0039582 | 3300048913 | Bacteria | 4105 |
| 1754 | Ga0496110_0118444 | 3300048913 | Bacteria | 2384 |
| 1755 | Ga0496110_0332263 | 3300048913 | Bacteria | 1385 |
| 1756 | Ga0496110_0470355 | 3300048913 | Bacteria | 1145 |
| 1757 | Ga0496110_0579877 | 3300048913 | Bacteria | 1018 |
| 1758 | Ga0496110_0678163 | 3300048913 | Bacteria | 931 |
| 1759 | Ga0496110_0696273 | 3300048913 | Bacteria | 917 |
| 1760 | Ga0496111_0004183 | 3300048914 | Bacteria | 9080 |
| 1761 | Ga0496111_0012152 | 3300048914 | Bacteria | 5823 |
| 1762 | Ga0496111_0021771 | 3300048914 | Bacteria | 4479 |
| 1763 | Ga0496111_0126663 | 3300048914 | Bacteria | 1888 |
| 1764 | Ga0496111_0165119 | 3300048914 | Bacteria | 1644 |
| 1765 | Ga0496111_0475177 | 3300048914 | Bacteria | 921 |
| 1766 | Ga0496111_0524209 | 3300048914 | Bacteria | 871 |
| 1767 | Ga0496112_0005890 | 3300048915 | Bacteria | 10681 |
| 1768 | Ga0496112_0013125 | 3300048915 | Bacteria | 7645 |
| 1769 | Ga0496112_0014646 | 3300048915 | Bacteria | 7286 |
| 1770 | Ga0496112_0060529 | 3300048915 | Bacteria | 3732 |
| 1771 | Ga0496112_0146319 | 3300048915 | Bacteria | 2331 |
| 1772 | Ga0496112_0218273 | 3300048915 | Bacteria | 1863 |
| 1773 | Ga0496112_0230093 | 3300048915 | Bacteria | 1808 |
| 1774 | Ga0496112_0280006 | 3300048915 | Bacteria | 1615 |
| 1775 | Ga0496112_0332097 | 3300048915 | Bacteria | 1464 |
| 1776 | Ga0496112_0698260 | 3300048915 | Bacteria | 942 |
| 1777 | Ga0496113_0000285 | 3300048916 | Bacteria | 23890 |
| 1778 | Ga0496113_0000465 | 3300048916 | Bacteria | 19801 |
| 1779 | Ga0496113_0006001 | 3300048916 | Bacteria | 7646 |
| 1780 | Ga0496113_0017270 | 3300048916 | Bacteria | 5004 |
| 1781 | Ga0496113_0032574 | 3300048916 | Bacteria | 3788 |
| 1782 | Ga0496113_0065939 | 3300048916 | Bacteria | 2741 |
| 1783 | Ga0496113_0082796 | 3300048916 | Bacteria | 2461 |
| 1784 | Ga0496113_0289967 | 3300048916 | Bacteria | 1309 |
| 1785 | Ga0496113_0457702 | 3300048916 | Bacteria | 1025 |
| 1786 | Ga0496113_0567031 | 3300048916 | Bacteria | 910 |
| 1787 | Ga0496113_0787461 | 3300048916 | Bacteria | 756 |
| 1788 | Ga0496114_0014271 | 3300048917 | Bacteria | 6374 |
| 1789 | Ga0496114_0017597 | 3300048917 | Bacteria | 5771 |
| 1790 | Ga0496114_0019622 | 3300048917 | Bacteria | 5478 |
| 1791 | Ga0496114_0112527 | 3300048917 | Bacteria | 2333 |
| 1792 | Ga0496114_0183954 | 3300048917 | Bacteria | 1825 |
| 1793 | Ga0496114_0323705 | 3300048917 | Bacteria | 1362 |
| 1794 | Ga0496114_0473044 | 3300048917 | Bacteria | 1109 |
| 1795 | Ga0496114_0520262 | 3300048917 | Bacteria | 1052 |
| 1796 | Ga0496115_0000673 | 3300048918 | Bacteria | 25278 |
| 1797 | Ga0496115_0028117 | 3300048918 | Bacteria | 4405 |
| 1798 | Ga0496115_0038417 | 3300048918 | Bacteria | 3799 |
| 1799 | Ga0496115_0054936 | 3300048918 | Bacteria | 3198 |
| 1800 | Ga0496115_0060964 | 3300048918 | Bacteria | 3041 |
| 1801 | Ga0496115_0071316 | 3300048918 | Bacteria | 2817 |
| 1802 | Ga0496115_0193911 | 3300048918 | Bacteria | 1678 |
| 1803 | Ga0496115_0286675 | 3300048918 | Bacteria | 1351 |
| 1804 | Ga0496115_0298007 | 3300048918 | Bacteria | 1321 |
| 1805 | Ga0496115_0330680 | 3300048918 | Bacteria | 1245 |
| 1806 | Ga0496117_0037784 | 3300048920 | Bacteria | 3591 |
| 1807 | Ga0496121_0260581 | 3300048924 | Bacteria | 1197 |
| 1808 | Ga0496122_0000074 | 3300048925 | Bacteria | 219900 |
| 1809 | Ga0496123_0000062 | 3300048926 | Bacteria | 219882 |
| 1810 | Ga0496123_0028666 | 3300048926 | Bacteria | 4115 |
| 1811 | Ga0496123_0067278 | 3300048926 | Bacteria | 2263 |
| 1812 | Ga0496124_0017561 | 3300048927 | Bacteria | 6739 |
| 1813 | Ga0496124_0103122 | 3300048927 | Bacteria | 2308 |
| 1814 | Ga0496126_0131026 | 3300048929 | Bacteria | 2167 |
| 1815 | Ga0495678_103576 | 3300049459 | Bacteria | 983 |
| 1816 | Ga0501031_0003691 | 3300049568 | Bacteria | 9849 |
| 1817 | Ga0501031_0234738 | 3300049568 | Bacteria | 1193 |
| 1818 | Ga0501031_0251105 | 3300049568 | Bacteria | 1149 |
| 1819 | Ga0501032_0009043 | 3300049569 | Bacteria | 7238 |
| 1820 | Ga0501032_0029180 | 3300049569 | Bacteria | 3788 |
| 1821 | Ga0501032_0317789 | 3300049569 | Bacteria | 1005 |
| 1822 | Ga0501033_0031141 | 3300049570 | Bacteria | 4010 |
| 1823 | Ga0501033_0044079 | 3300049570 | Bacteria | 3320 |
| 1824 | Ga0501033_0247833 | 3300049570 | Bacteria | 1263 |
| 1825 | Ga0501033_0345718 | 3300049570 | Bacteria | 1042 |
| 1826 | Ga0501034_0000286 | 3300049571 | Bacteria | 90126 |
| 1827 | Ga0501034_0005591 | 3300049571 | Bacteria | 13694 |
| 1828 | Ga0501034_0024972 | 3300049571 | Bacteria | 6080 |
| 1829 | Ga0501034_0064368 | 3300049571 | Bacteria | 3681 |
| 1830 | Ga0501034_0073247 | 3300049571 | Bacteria | 3434 |
| 1831 | Ga0501034_0113968 | 3300049571 | Bacteria | 2692 |
| 1832 | Ga0501034_0163594 | 3300049571 | Bacteria | 2194 |
| 1833 | Ga0501034_0271490 | 3300049571 | Bacteria | 1637 |
| 1834 | Ga0501034_0286262 | 3300049571 | Bacteria | 1587 |
| 1835 | Ga0501034_0300972 | 3300049571 | Bacteria | 1540 |
| 1836 | Ga0501034_0369466 | 3300049571 | Bacteria | 1361 |
| 1837 | Ga0501036_0003843 | 3300049572 | Bacteria | 12047 |
| 1838 | Ga0501036_0024488 | 3300049572 | Bacteria | 5089 |
| 1839 | Ga0501036_0174295 | 3300049572 | Bacteria | 1811 |
| 1840 | Ga0501036_0441382 | 3300049572 | Bacteria | 1085 |
| 1841 | Ga0501037_0148919 | 3300049573 | Bacteria | 1673 |
| 1842 | Ga0501038_0015789 | 3300049574 | Bacteria | 6862 |
| 1843 | Ga0501038_0019883 | 3300049574 | Bacteria | 6043 |
| 1844 | Ga0501038_0051587 | 3300049574 | Bacteria | 3549 |
| 1845 | Ga0501038_0229555 | 3300049574 | Bacteria | 1478 |
| 1846 | Ga0501039_0002615 | 3300049575 | Bacteria | 13445 |
| 1847 | Ga0501039_0280799 | 3300049575 | Bacteria | 1309 |
| 1848 | Ga0501039_0335357 | 3300049575 | Bacteria | 1188 |
| 1849 | Ga0501039_0365640 | 3300049575 | Bacteria | 1133 |
| 1850 | Ga0501042_0062147 | 3300049578 | Bacteria | 2668 |
| 1851 | Ga0501042_0122911 | 3300049578 | Bacteria | 1869 |
| 1852 | Ga0501042_0146303 | 3300049578 | Bacteria | 1704 |
| 1853 | Ga0501042_0193467 | 3300049578 | Bacteria | 1467 |
| 1854 | Ga0501042_0560354 | 3300049578 | Bacteria | 831 |
| 1855 | Ga0501042_0577164 | 3300049578 | Bacteria | 817 |
| 1856 | Ga0501043_0047574 | 3300049579 | Bacteria | 3372 |
| 1857 | Ga0501043_0050425 | 3300049579 | Bacteria | 3271 |
| 1858 | Ga0501043_0076572 | 3300049579 | Bacteria | 2628 |
| 1859 | Ga0501043_0172612 | 3300049579 | Bacteria | 1686 |
| 1860 | Ga0501043_0361478 | 3300049579 | Bacteria | 1102 |
| 1861 | Ga0501043_0414734 | 3300049579 | Bacteria | 1016 |
| 1862 | Ga0501046_0008490 | 3300049580 | Bacteria | 8945 |
| 1863 | Ga0501046_0015232 | 3300049580 | Bacteria | 6466 |
| 1864 | Ga0501046_0094483 | 3300049580 | Bacteria | 2298 |
| 1865 | Ga0501046_0143560 | 3300049580 | Bacteria | 1805 |
| 1866 | Ga0501046_0169306 | 3300049580 | Bacteria | 1640 |
| 1867 | Ga0501046_0341264 | 3300049580 | Bacteria | 1089 |
| 1868 | Ga0501047_0077981 | 3300049581 | Bacteria | 3186 |
| 1869 | Ga0501047_0085143 | 3300049581 | Bacteria | 3037 |
| 1870 | Ga0501047_0156909 | 3300049581 | Bacteria | 2149 |
| 1871 | Ga0501047_0166283 | 3300049581 | Bacteria | 2076 |
| 1872 | Ga0501047_0345118 | 3300049581 | Bacteria | 1326 |
| 1873 | Ga0501048_0009248 | 3300049582 | Bacteria | 7404 |
| 1874 | Ga0501048_0117010 | 3300049582 | Bacteria | 1883 |
| 1875 | Ga0501048_0175869 | 3300049582 | Bacteria | 1517 |
| 1876 | Ga0501048_0325907 | 3300049582 | Bacteria | 1094 |
| 1877 | Ga0501067_0001333 | 3300049583 | Bacteria | 13379 |
| 1878 | Ga0501067_0058225 | 3300049583 | Bacteria | 2140 |
| 1879 | Ga0501068_0003078 | 3300049584 | Bacteria | 8907 |
| 1880 | Ga0501068_0222915 | 3300049584 | Bacteria | 1199 |
| 1881 | Ga0501069_0005694 | 3300049585 | Bacteria | 6489 |
| 1882 | Ga0501069_0014035 | 3300049585 | Bacteria | 4279 |
| 1883 | Ga0501069_0052326 | 3300049585 | Bacteria | 2273 |
| 1884 | Ga0501069_0053979 | 3300049585 | Bacteria | 2238 |
| 1885 | Ga0501069_0067407 | 3300049585 | Bacteria | 2002 |
| 1886 | Ga0501070_0013017 | 3300049586 | Bacteria | 7010 |
| 1887 | Ga0501070_0067345 | 3300049586 | Bacteria | 2965 |
| 1888 | Ga0501070_0098289 | 3300049586 | Bacteria | 2421 |
| 1889 | Ga0501070_0121215 | 3300049586 | Bacteria | 2161 |
| 1890 | Ga0501070_0130170 | 3300049586 | Bacteria | 2079 |
| 1891 | Ga0501070_0344369 | 3300049586 | Bacteria | 1210 |
| 1892 | Ga0501071_0157377 | 3300049587 | Bacteria | 1697 |
| 1893 | Ga0501071_0261633 | 3300049587 | Bacteria | 1307 |
| 1894 | Ga0501071_0495796 | 3300049587 | Bacteria | 937 |
| 1895 | Ga0501072_0000394 | 3300049588 | Bacteria | 31235 |
| 1896 | Ga0501072_0115857 | 3300049588 | Bacteria | 2134 |
| 1897 | Ga0501072_0256826 | 3300049588 | Bacteria | 1391 |
| 1898 | Ga0501072_0373709 | 3300049588 | Bacteria | 1131 |
| 1899 | Ga0501073_0002088 | 3300049589 | Bacteria | 14957 |
| 1900 | Ga0501073_0004584 | 3300049589 | Bacteria | 10387 |
| 1901 | Ga0501073_0024120 | 3300049589 | Bacteria | 4368 |
| 1902 | Ga0501073_0205035 | 3300049589 | Bacteria | 1363 |
| 1903 | Ga0501073_0229779 | 3300049589 | Bacteria | 1282 |
| 1904 | Ga0501073_0251337 | 3300049589 | Bacteria | 1220 |
| 1905 | Ga0501074_0136864 | 3300049590 | Bacteria | 1752 |
| 1906 | Ga0501074_0148802 | 3300049590 | Bacteria | 1674 |
| 1907 | Ga0501074_0167895 | 3300049590 | Bacteria | 1567 |
| 1908 | Ga0501074_0214655 | 3300049590 | Bacteria | 1370 |
| 1909 | Ga0501075_0017438 | 3300049591 | Bacteria | 5188 |
| 1910 | Ga0501075_0045437 | 3300049591 | Bacteria | 3297 |
| 1911 | Ga0501075_0258978 | 3300049591 | Bacteria | 1326 |
| 1912 | Ga0501076_0082339 | 3300049592 | Bacteria | 2583 |
| 1913 | Ga0501076_0109082 | 3300049592 | Bacteria | 2237 |
| 1914 | Ga0501076_0251287 | 3300049592 | Bacteria | 1447 |
| 1915 | Ga0501077_0118869 | 3300049593 | Bacteria | 1675 |
| 1916 | Ga0501077_0170845 | 3300049593 | Bacteria | 1381 |
| 1917 | Ga0501077_0295147 | 3300049593 | Bacteria | 1032 |
| 1918 | Ga0501079_0019376 | 3300049741 | Bacteria | 5196 |
| 1919 | Ga0501079_0153520 | 3300049741 | Bacteria | 1795 |
| 1920 | Ga0501079_0178301 | 3300049741 | Bacteria | 1658 |
| 1921 | Ga0501079_0212618 | 3300049741 | Bacteria | 1511 |
| 1922 | Ga0501079_0414344 | 3300049741 | Bacteria | 1057 |
| 1923 | Ga0501080_0008622 | 3300049742 | Bacteria | 9252 |
| 1924 | Ga0501080_0038365 | 3300049742 | Bacteria | 4472 |
| 1925 | Ga0501080_0102537 | 3300049742 | Bacteria | 2654 |
| 1926 | Ga0501080_0157781 | 3300049742 | Bacteria | 2096 |
| 1927 | Ga0501080_0399092 | 3300049742 | Bacteria | 1237 |
| 1928 | Ga0501080_0903976 | 3300049742 | Bacteria | 769 |
| 1929 | Ga0501081_0127738 | 3300049743 | Bacteria | 1815 |
| 1930 | Ga0501081_0342327 | 3300049743 | Bacteria | 1101 |
| 1931 | Ga0501081_0431453 | 3300049743 | Bacteria | 978 |
| 1932 | Ga0501081_0526093 | 3300049743 | Bacteria | 882 |
| 1933 | Ga0501081_0616156 | 3300049743 | Bacteria | 813 |
| 1934 | Ga0501081_0691805 | 3300049743 | Bacteria | 765 |
| 1935 | Ga0501083_0054982 | 3300049744 | Bacteria | 2670 |
| 1936 | Ga0501083_0180003 | 3300049744 | Bacteria | 1380 |
| 1937 | Ga0501083_0223960 | 3300049744 | Bacteria | 1225 |
| 1938 | Ga0501083_0388169 | 3300049744 | Bacteria | 908 |
| 1939 | Ga0501035_0000366 | 3300049822 | Bacteria | 52132 |
| 1940 | Ga0501035_0004315 | 3300049822 | Bacteria | 13512 |
| 1941 | Ga0501035_0287424 | 3300049822 | Bacteria | 1388 |
| 1942 | Ga0501035_0322480 | 3300049822 | Bacteria | 1298 |
| 1943 | Ga0501035_0396206 | 3300049822 | Bacteria | 1149 |
| 1944 | Ga0501035_0412764 | 3300049822 | Bacteria | 1122 |
| 1945 | Ga0501035_0506405 | 3300049822 | Bacteria | 993 |
| 1946 | Ga0501035_0825876 | 3300049822 | Bacteria | 739 |
| 1947 | Ga0501044_0000411 | 3300049823 | Bacteria | 52862 |
| 1948 | Ga0501044_0010794 | 3300049823 | Bacteria | 9909 |
| 1949 | Ga0501044_0168342 | 3300049823 | Bacteria | 2164 |
| 1950 | Ga0501044_0235588 | 3300049823 | Bacteria | 1776 |
| 1951 | Ga0501044_0364766 | 3300049823 | Bacteria | 1362 |
| 1952 | Ga0501044_0548348 | 3300049823 | Bacteria | 1053 |
| 1953 | Ga0501044_0698945 | 3300049823 | Bacteria | 900 |
| 1954 | Ga0501045_0236103 | 3300049824 | Bacteria | 1361 |
| 1955 | nmdc:mga03683_50658_c1 | 3300050489 | Bacteria | 1731 |
| 1956 | nmdc:mga03n38_27804_c1 | 3300050490 | Bacteria | 2350 |
| 1957 | nmdc:mga00v17_180081_c1 | 3300050491 | Bacteria | 1364 |
| 1958 | nmdc:mga00v17_20140_c1 | 3300050491 | Bacteria | 3818 |
| 1959 | nmdc:mga00v17_28756_c1 | 3300050491 | Bacteria | 3258 |
| 1960 | nmdc:mga00v17_407945_c1 | 3300050491 | Bacteria | 883 |
| 1961 | nmdc:mga00v17_90210_c1 | 3300050491 | Bacteria | 1924 |
| 1962 | nmdc:mga0yw44_1214_c1 | 3300050492 | Bacteria | 10094 |
| 1963 | nmdc:mga0yw44_145695_c1 | 3300050492 | Bacteria | 1542 |
| 1964 | nmdc:mga0yw44_18317_c1 | 3300050492 | Bacteria | 3831 |
| 1965 | nmdc:mga0yw44_3468_c1 | 3300050492 | Bacteria | 7006 |
| 1966 | nmdc:mga0yw44_393180_c1 | 3300050492 | Bacteria | 937 |
| 1967 | nmdc:mga0yw44_417972_c1 | 3300050492 | Bacteria | 908 |
| 1968 | nmdc:mga0k408_20068_c1 | 3300050493 | Bacteria | 3739 |
| 1969 | nmdc:mga0k408_237741_c1 | 3300050493 | Bacteria | 1088 |
| 1970 | nmdc:mga0k408_33374_c1 | 3300050493 | Bacteria | 2944 |
| 1971 | nmdc:mga0k408_3509_c1 | 3300050493 | Bacteria | 8286 |
| 1972 | nmdc:mga06z11_109408_c1 | 3300050494 | Bacteria | 1528 |
| 1973 | nmdc:mga06z11_25471_c2 | 3300050494 | Bacteria | 1358 |
| 1974 | nmdc:mga06z11_44907_c1 | 3300050494 | Bacteria | 2231 |
| 1975 | nmdc:mga06z11_6960_c1 | 3300050494 | Bacteria | 4634 |
| 1976 | nmdc:mga07m45_129250_c1 | 3300050496 | Bacteria | 1461 |
| 1977 | nmdc:mga07m45_14938_c1 | 3300050496 | Bacteria | 4146 |
| 1978 | nmdc:mga07m45_35923_c1 | 3300050496 | Bacteria | 2757 |
| 1979 | nmdc:mga07m45_42676_c1 | 3300050496 | Bacteria | 2543 |
| 1980 | nmdc:mga05p37_105379_c1 | 3300050507 | Bacteria | 3469 |
| 1981 | nmdc:mga05p37_285_c1 | 3300050507 | Bacteria | 52916 |
| 1982 | nmdc:mga05p37_290_c1 | 3300050507 | Bacteria | 52425 |
| 1983 | nmdc:mga05p37_38352_c1 | 3300050507 | Bacteria | 5877 |
| 1984 | nmdc:mga05p37_430768_c1 | 3300050507 | Bacteria | 1532 |
| 1985 | nmdc:mga05p37_488186_c1 | 3300050507 | Bacteria | 1417 |
| 1986 | nmdc:mga05p37_585068_c1 | 3300050507 | Bacteria | 1263 |
| 1987 | nmdc:mga09592_168998_c1 | 3300050508 | Bacteria | 1890 |
| 1988 | nmdc:mga09592_8025_c1 | 3300050508 | Bacteria | 8584 |
| 1989 | nmdc:mga0qj67_139644_c1 | 3300050509 | Bacteria | 1964 |
| 1990 | nmdc:mga0qj67_215932_c1 | 3300050509 | Bacteria | 1557 |
| 1991 | nmdc:mga0qj67_290975_c1 | 3300050509 | Bacteria | 1324 |
| 1992 | nmdc:mga0qj67_347_c1 | 3300050509 | Bacteria | 31880 |
| 1993 | nmdc:mga0qj67_527193_c1 | 3300050509 | Bacteria | 948 |
| 1994 | nmdc:mga0qj67_606000_c1 | 3300050509 | Bacteria | 876 |
| 1995 | nmdc:mga0qj67_880_c1 | 3300050509 | Bacteria | 20589 |
| 1996 | nmdc:mga06r32_118_c1 | 3300050510 | Bacteria | 56778 |
| 1997 | nmdc:mga06r32_267466_c1 | 3300050510 | Bacteria | 1697 |
| 1998 | nmdc:mga06r32_352166_c1 | 3300050510 | Bacteria | 1457 |
| 1999 | nmdc:mga06r32_374633_c1 | 3300050510 | Bacteria | 1406 |
| 2000 | nmdc:mga06r32_649_c1 | 3300050510 | Bacteria | 30358 |
| 2001 | nmdc:mga08y16_103693_c1 | 3300050511 | Bacteria | 2961 |
| 2002 | nmdc:mga08y16_119854_c1 | 3300050511 | Bacteria | 2738 |
| 2003 | nmdc:mga08y16_153738_c1 | 3300050511 | Bacteria | 2391 |
| 2004 | nmdc:mga08y16_16589_c1 | 3300050511 | Bacteria | 7747 |
| 2005 | nmdc:mga08y16_211704_c1 | 3300050511 | Bacteria | 2008 |
| 2006 | nmdc:mga08y16_452689_c1 | 3300050511 | Bacteria | 1309 |
| 2007 | nmdc:mga08y16_66189_c1 | 3300050511 | Bacteria | 3771 |
| 2008 | nmdc:mga08y16_7099_c1 | 3300050511 | Bacteria | 11758 |
| 2009 | nmdc:mga08y16_851_c1 | 3300050511 | Bacteria | 29277 |
| 2010 | nmdc:mga08y16_89_c1 | 3300050511 | Bacteria | 76793 |
| 2011 | nmdc:mga08y16_98412_c1 | 3300050511 | Bacteria | 3046 |
| 2012 | nmdc:mga0n895_104899_c1 | 3300050512 | Bacteria | 2839 |
| 2013 | nmdc:mga0n895_157640_c1 | 3300050512 | Bacteria | 2301 |
| 2014 | nmdc:mga0n895_173292_c1 | 3300050512 | Bacteria | 2189 |
| 2015 | nmdc:mga0n895_196757_c1 | 3300050512 | Bacteria | 2047 |
| 2016 | nmdc:mga0n895_309610_c1 | 3300050512 | Bacteria | 1601 |
| 2017 | nmdc:mga0n895_369_c1 | 3300050512 | Bacteria | 30447 |
| 2018 | nmdc:mga0n895_376459_c1 | 3300050512 | Bacteria | 1437 |
| 2019 | nmdc:mga0n895_46361_c1 | 3300050512 | Bacteria | 4246 |
| 2020 | nmdc:mga0n895_552_c1 | 3300050512 | Bacteria | 25634 |
| 2021 | nmdc:mga0rr50_11023_c1 | 3300050513 | Bacteria | 5764 |
| 2022 | nmdc:mga0rr50_137806_c1 | 3300050513 | Bacteria | 1960 |
| 2023 | nmdc:mga0rr50_236400_c1 | 3300050513 | Bacteria | 1513 |
| 2024 | nmdc:mga0rr50_245951_c1 | 3300050513 | Bacteria | 1484 |
| 2025 | nmdc:mga0rr50_469070_c1 | 3300050513 | Bacteria | 1068 |
| 2026 | nmdc:mga0rr50_52321_c1 | 3300050513 | Bacteria | 3034 |
| 2027 | nmdc:mga0rr50_574_c1 | 3300050513 | Bacteria | 19721 |
| 2028 | nmdc:mga0rr50_6149_c1 | 3300050513 | Bacteria | 7268 |
| 2029 | nmdc:mga0rr50_798081_c1 | 3300050513 | Bacteria | 805 |
| 2030 | nmdc:mga08x19_154993_c1 | 3300050514 | Bacteria | 1553 |
| 2031 | nmdc:mga08x19_307807_c1 | 3300050514 | Bacteria | 1101 |
| 2032 | nmdc:mga08x19_9501_c1 | 3300050514 | Bacteria | 5824 |
| 2033 | nmdc:mga0a205_1059_c1 | 3300050515 | Bacteria | 22915 |
| 2034 | nmdc:mga0a205_124111_c1 | 3300050515 | Bacteria | 2482 |
| 2035 | nmdc:mga0a205_148593_c1 | 3300050515 | Bacteria | 2243 |
| 2036 | nmdc:mga0a205_21310_c1 | 3300050515 | Bacteria | 6131 |
| 2037 | nmdc:mga0a205_251366_c1 | 3300050515 | Bacteria | 1647 |
| 2038 | nmdc:mga0a205_2568_c1 | 3300050515 | Bacteria | 16009 |
| 2039 | nmdc:mga0a205_26046_c1 | 3300050515 | Bacteria | 5572 |
| 2040 | nmdc:mga0a205_298175_c1 | 3300050515 | Bacteria | 1485 |
| 2041 | nmdc:mga0a205_353181_c1 | 3300050515 | Bacteria | 1337 |
| 2042 | nmdc:mga0sz30_144168_c1 | 3300050516 | Bacteria | 1052 |
| 2043 | Ga0495601_0000016 | 3300053077 | Bacteria | 207486 |
| 2044 | Ga0495601_0000205 | 3300053077 | Bacteria | 31542 |
| 2045 | Ga0495601_0001742 | 3300053077 | Bacteria | 12023 |
| 2046 | Ga0495601_0001966 | 3300053077 | Bacteria | 11489 |
| 2047 | Ga0495601_0003031 | 3300053077 | Bacteria | 9577 |
| 2048 | Ga0495601_0004702 | 3300053077 | Bacteria | 7911 |
| 2049 | Ga0495601_0005657 | 3300053077 | Bacteria | 7289 |
| 2050 | Ga0495601_0006040 | 3300053077 | Bacteria | 7064 |
| 2051 | Ga0495601_0036612 | 3300053077 | Bacteria | 3065 |
| 2052 | Ga0495601_0050863 | 3300053077 | Bacteria | 2614 |
| 2053 | Ga0495601_0052938 | 3300053077 | Bacteria | 2564 |
| 2054 | Ga0495601_0057737 | 3300053077 | Bacteria | 2458 |
| 2055 | Ga0495601_0064935 | 3300053077 | Bacteria | 2322 |
| 2056 | Ga0495601_0071850 | 3300053077 | Bacteria | 2210 |
| 2057 | Ga0495612_0000041 | 3300053078 | Bacteria | 62752 |
| 2058 | Ga0495612_0000896 | 3300053078 | Bacteria | 12191 |
| 2059 | Ga0495612_0003681 | 3300053078 | Bacteria | 6360 |
| 2060 | Ga0495612_0004543 | 3300053078 | Bacteria | 5762 |
| 2061 | Ga0495612_0012951 | 3300053078 | Bacteria | 3360 |
| 2062 | Ga0495612_0014629 | 3300053078 | Bacteria | 3153 |
| 2063 | Ga0495612_0026997 | 3300053078 | Bacteria | 2308 |
| 2064 | Ga0495612_0027352 | 3300053078 | Bacteria | 2293 |
| 2065 | Ga0495612_0050413 | 3300053078 | Bacteria | 1709 |
| 2066 | Ga0495612_0062696 | 3300053078 | Bacteria | 1541 |
| 2067 | Ga0495612_0110598 | 3300053078 | Bacteria | 1175 |
| 2068 | Ga0500610_0115490 | 3300053079 | Bacteria | 1376 |
| 2069 | Ga0495655_0000378 | 3300053083 | Bacteria | 7658 |
| 2070 | Ga0495655_0019851 | 3300053083 | Bacteria | 1499 |
| 2071 | Ga0495595_0000161 | 3300053084 | Bacteria | 26762 |
| 2072 | Ga0495595_0001105 | 3300053084 | Bacteria | 10462 |
| 2073 | Ga0495595_0001119 | 3300053084 | Bacteria | 10385 |
| 2074 | Ga0495595_0004084 | 3300053084 | Bacteria | 5849 |
| 2075 | Ga0495595_0006277 | 3300053084 | Bacteria | 4840 |
| 2076 | Ga0495595_0011917 | 3300053084 | Bacteria | 3645 |
| 2077 | Ga0495595_0014655 | 3300053084 | Bacteria | 3329 |
| 2078 | Ga0495595_0185538 | 3300053084 | Bacteria | 1032 |
| 2079 | Ga0495595_0189050 | 3300053084 | Bacteria | 1023 |
| 2080 | Ga0495619_0000050 | 3300053085 | Bacteria | 101361 |
| 2081 | Ga0495619_0000139 | 3300053085 | Bacteria | 54165 |
| 2082 | Ga0495619_0000957 | 3300053085 | Bacteria | 18932 |
| 2083 | Ga0495619_0003087 | 3300053085 | Bacteria | 10812 |
| 2084 | Ga0495619_0003733 | 3300053085 | Bacteria | 9812 |
| 2085 | Ga0495619_0007273 | 3300053085 | Bacteria | 7011 |
| 2086 | Ga0495619_0008115 | 3300053085 | Bacteria | 6647 |
| 2087 | Ga0495619_0009272 | 3300053085 | Bacteria | 6216 |
| 2088 | Ga0495619_0021121 | 3300053085 | Bacteria | 4154 |
| 2089 | Ga0495619_0034965 | 3300053085 | Bacteria | 3267 |
| 2090 | Ga0495619_0053482 | 3300053085 | Bacteria | 2671 |
| 2091 | Ga0495619_0074099 | 3300053085 | Bacteria | 2282 |
| 2092 | Ga0495619_0075261 | 3300053085 | Bacteria | 2265 |
| 2093 | Ga0495619_0078936 | 3300053085 | Bacteria | 2213 |
| 2094 | Ga0495619_0093382 | 3300053085 | Bacteria | 2039 |
| 2095 | Ga0495619_0105009 | 3300053085 | Bacteria | 1926 |
| 2096 | Ga0495619_0143877 | 3300053085 | Bacteria | 1643 |
| 2097 | Ga0495619_0175462 | 3300053085 | Bacteria | 1482 |
| 2098 | Ga0495619_0296555 | 3300053085 | Bacteria | 1120 |
| 2099 | Ga0495619_0355856 | 3300053085 | Bacteria | 1013 |
| 2100 | Ga0500643_025908 | 3300053087 | Bacteria | 1843 |
| 2101 | Ga0500644_0000839 | 3300053088 | Bacteria | 10266 |
| 2102 | Ga0500646_0021421 | 3300053090 | Bacteria | 1722 |
| 2103 | Ga0500651_0036353 | 3300053093 | Bacteria | 3103 |
| 2104 | Ga0500651_0256398 | 3300053093 | Bacteria | 1015 |
| 2105 | Ga0500566_0170404 | 3300053094 | Bacteria | 1126 |
| 2106 | Ga0500641_0000457 | 3300053096 | Bacteria | 14851 |
| 2107 | Ga0500641_0013326 | 3300053096 | Bacteria | 3019 |
| 2108 | Ga0500641_0013957 | 3300053096 | Bacteria | 2958 |
| 2109 | Ga0500641_0016990 | 3300053096 | Bacteria | 2714 |
| 2110 | Ga0500641_0078607 | 3300053096 | Bacteria | 1397 |
| 2111 | Ga0500654_042304 | 3300053099 | Bacteria | 2568 |
| 2112 | Ga0500557_072589 | 3300053105 | Bacteria | 1130 |
| 2113 | Ga0500562_033612 | 3300053108 | Bacteria | 1356 |
| 2114 | Ga0500562_035649 | 3300053108 | Bacteria | 1318 |
| 2115 | Ga0500593_016699 | 3300053117 | Bacteria | 3182 |
| 2116 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 2117 | Ga0500595_021247 | 3300053119 | Bacteria | 2320 |
| 2118 | Ga0500595_035998 | 3300053119 | Bacteria | 1625 |
| 2119 | Ga0500608_143136 | 3300053122 | Bacteria | 1057 |
| 2120 | Ga0500618_017858 | 3300053125 | Bacteria | 1761 |
| 2121 | Ga0500618_029346 | 3300053125 | Bacteria | 1298 |
| 2122 | Ga0500642_0002438 | 3300053130 | Bacteria | 5459 |
| 2123 | Ga0500642_0259228 | 3300053130 | Bacteria | 796 |
| 2124 | Ga0500652_000069 | 3300053131 | Bacteria | 45026 |
| 2125 | Ga0500652_003823 | 3300053131 | Bacteria | 4598 |
| 2126 | Ga0500652_075254 | 3300053131 | Bacteria | 1403 |
| 2127 | Ga0500658_0035326 | 3300053134 | Bacteria | 1978 |
| 2128 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 2129 | Ga0500616_0012716 | 3300053153 | Bacteria | 4918 |
| 2130 | Ga0500616_0016192 | 3300053153 | Bacteria | 4249 |
| 2131 | Ga0500616_0037804 | 3300053153 | Bacteria | 2611 |
| 2132 | Ga0500616_0068585 | 3300053153 | Bacteria | 1816 |
| 2133 | Ga0500622_0001259 | 3300053156 | Bacteria | 20680 |
| 2134 | Ga0500627_0154463 | 3300053158 | Bacteria | 1036 |
| 2135 | Ga0500636_0014182 | 3300053177 | Bacteria | 4685 |
| 2136 | Ga0500636_0020014 | 3300053177 | Bacteria | 3958 |
| 2137 | Ga0500611_016270 | 3300053727 | Bacteria | 1333 |
| 2138 | Ga0500657_126448 | 3300053728 | Bacteria | 1001 |
| 2139 | Ga0500645_000418 | 3300053730 | Bacteria | 29391 |
| 2140 | Ga0500552_027558 | 3300053733 | Bacteria | 855 |
| 2141 | Ga0501084_0023301 | 3300054114 | Bacteria | 5169 |
| 2142 | Ga0501084_0044229 | 3300054114 | Bacteria | 3728 |
| 2143 | Ga0501084_0077505 | 3300054114 | Bacteria | 2787 |
| 2144 | Ga0501084_0325438 | 3300054114 | Bacteria | 1298 |
| 2145 | Ga0501084_0398433 | 3300054114 | Bacteria | 1163 |
| 2146 | Ga0501084_0619231 | 3300054114 | Bacteria | 914 |
| 2147 | Ga0501082_0013821 | 3300060353 | Bacteria | 6943 |
| 2148 | Ga0501082_0085747 | 3300060353 | Bacteria | 2716 |
| 2149 | Ga0501082_0112796 | 3300060353 | Bacteria | 2354 |
| 2150 | Ga0501082_0219481 | 3300060353 | Bacteria | 1654 |
| 2151 | Ga0501082_0286855 | 3300060353 | Bacteria | 1433 |
| 2152 | Ga0501082_0782765 | 3300060353 | Bacteria | 835 |
| 2153 | Ga0466962_0049979 | 3300061719 | Bacteria | 1999 |
| 2154 | Ga0530510_0022504 | 3300061734 | Bacteria | 4490 |
| 2155 | Ga0530510_0053232 | 3300061734 | Bacteria | 2925 |
| 2156 | Ga0530510_0399907 | 3300061734 | Bacteria | 1035 |
| 2157 | Ga0530510_0444126 | 3300061734 | Bacteria | 980 |
| 2158 | 2585997793 | 2585427633 | Bacteria | 6413184 |
| 2159 | 2586002379 | 2585427634 | Bacteria | 6455027 |
| 2160 | 2599720347 | 2599185236 | Bacteria | 6875203 |
| 2161 | 2644730983 | 2643221733 | Bacteria | 5690728 |
| 2162 | 2819722241 | 2818991467 | Bacteria | 5893227 |
| 2163 | 2821128736 | 2821123053 | Bacteria | 7836056 |
| 2164 | 2838741752 | 2838736955 | Bacteria | 5760694 |
| 2165 | 2841845414 | 2841840854 | Bacteria | 5761912 |
| 2166 | 2842145117 | 2842140634 | Bacteria | 5759631 |
| 2167 | 2854919494 | 2854916844 | Bacteria | 5725939 |
| 2168 | 2857534111 | 2857531043 | Bacteria | 6754041 |
| 2169 | 2919175773 | 2919171160 | Bacteria | 6499771 |
| 2170 | 641335761 | 641228493 | Bacteria | 3999591 |
| 2171 | 8054564098 | 8054563764 | Bacteria | 5592885 |
| 2172 | 8056878208 | 8056875544 | Bacteria | 4355797 |
| 2173 | Ga0530510_0091635 | |||
| 2174 | SwRhRL2b_contig_103294 | |||
| 2175 | 2214828525 | |||
| 2176 | ARcpr5oldR_c000051 | |||
| 2177 | ARSoilYngRDRAFT_c00005 | |||
| 2178 | ARcpr5yngRDRAFT_c000005 | |||
| 2179 | ARSoilOldRDRAFT_c000003 | |||
| 2180 | ARCol0oldRDRAFT_c00049 | |||
| 2181 | CNBas_1002440 | |||
| 2182 | ARCol0yngRDRAFT_1000007 | |||
| 2183 | SwM_106758 | |||
| 2184 | JGI24032J14994_100411 | |||
| 2185 | JGI24741J21665_1003075 | |||
| 2186 | JGI24752J21851_1002865 | |||
| 2187 | JGI24752J21851_1003059 | |||
| 2188 | JGI24746J21847_1000487 | |||
| 2189 | JGI24746J21847_1005435 | |||
| 2190 | JGI24739J22299_10000027 | |||
| 2191 | JGI24739J22299_10047696 | |||
| 2192 | JGI24739J22299_10081951 | |||
| 2193 | JGI24737J22298_10006724 | |||
| 2194 | JGI24737J22298_10008091 | |||
| 2195 | JGI24743J22301_10001138 | |||
| 2196 | JGI24743J22301_10008358 | |||
| 2197 | JGI24750J21931_1000003 | |||
| 2198 | JGI24745J21846_1000027 | |||
| 2199 | JGI24745J21846_1006416 | |||
| 2200 | JGI24748J21848_1000421 | |||
| 2201 | JGI24738J21930_10000032 | |||
| 2202 | JGI24749J21850_1000320 | |||
| 2203 | JGI24749J21850_1004740 | |||
| 2204 | JGI24749J21850_1008927 | |||
| 2205 | JGI24744J21845_10001709 | |||
| 2206 | JGI24035J26624_1000017 | |||
| 2207 | JGI24033J26618_1000528 | |||
| 2208 | JGI24033J26618_1006673 | |||
| 2209 | JGI24034J26672_10002708 | |||
| 2210 | JGI24034J26672_10004055 | |||
| 2211 | JGI24034J26672_10004686 | |||
| 2212 | JGI24742J22300_10000479 | |||
| 2213 | JGI24742J22300_10006180 | |||
| 2214 | JGI24742J22300_10014308 | |||
| 2215 | JGI24751J29686_10002694 | |||
| 2216 | JGI24751J29686_10007181 | |||
| 2217 | JGI25406J46586_10044912 | |||
| 2218 | JGI25153J46596_10026532 | |||
| 2219 | JGI25404J52841_10020892 | |||
| 2220 | Ga0055524_1026287 | |||
| 2221 | Ga0055536_1001690 | |||
| 2222 | Ga0055540_1009128 | |||
| 2223 | Ga0055531_10006983 | |||
| 2224 | JGI25405J52794_10002320 | |||
| 2225 | JGI25405J52794_10008886 | |||
| 2226 | Ga0065717_1001936 | |||
| 2227 | Ga0065716_1001733 | |||
| 2228 | Ga0065704_10071648 | |||
| 2229 | Ga0065712_10069491 | |||
| 2230 | Ga0065712_10069860 | |||
| 2231 | Ga0065712_10071460 | |||
| 2232 | Ga0065715_10002372 | |||
| 2233 | Ga0065715_10089909 | |||
| 2234 | Ga0065707_10089899 | |||
| 2235 | Ga0065707_10237060 | |||
| 2236 | Ga0070658_10060574 | |||
| 2237 | Ga0070658_10112610 | |||
| 2238 | Ga0070676_10001346 | |||
| 2239 | Ga0070676_10064265 | |||
| 2240 | Ga0070676_10172931 | |||
| 2241 | Ga0070676_10188218 | |||
| 2242 | Ga0070676_10215012 | |||
| 2243 | Ga0070683_100002452 | |||
| 2244 | Ga0070683_100396768 | |||
| 2245 | Ga0070690_100006735 | |||
| 2246 | Ga0070690_100038138 | |||
| 2247 | Ga0070690_100038458 | |||
| 2248 | Ga0070690_100056679 | |||
| 2249 | Ga0070690_100082686 | |||
| 2250 | Ga0070690_100325641 | |||
| 2251 | Ga0070690_100427276 | |||
| 2252 | Ga0070690_100550881 | |||
| 2253 | Ga0070670_100019209 | |||
| 2254 | Ga0070670_100020107 | |||
| 2255 | Ga0070670_100035824 | |||
| 2256 | Ga0070670_100037375 | |||
| 2257 | Ga0070677_10000240 | |||
| 2258 | Ga0068869_100000013 | |||
| 2259 | Ga0070666_10014037 | |||
| 2260 | Ga0070666_10146036 | |||
| 2261 | Ga0070680_100001807 | |||
| 2262 | Ga0070680_100015245 | |||
| 2263 | Ga0070680_100022501 | |||
| 2264 | Ga0070680_100091598 | |||
| 2265 | Ga0070680_100267422 | |||
| 2266 | Ga0070680_100484131 | |||
| 2267 | Ga0070682_100000611 | |||
| 2268 | Ga0070682_100066793 | |||
| 2269 | Ga0070682_100121945 | |||
| 2270 | Ga0070682_100191438 | |||
| 2271 | Ga0070682_100192842 | |||
| 2272 | Ga0068868_100010701 | |||
| 2273 | Ga0068868_100018781 | |||
| 2274 | Ga0068868_100050631 | |||
| 2275 | Ga0068868_100428396 | |||
| 2276 | Ga0070660_100000554 | |||
| 2277 | Ga0070660_100013100 | |||
| 2278 | Ga0070660_100023479 | |||
| 2279 | Ga0070660_100137260 | |||
| 2280 | Ga0070660_100355120 | |||
| 2281 | Ga0070660_100441865 | |||
| 2282 | Ga0070689_100005543 | |||
| 2283 | Ga0070689_100007858 | |||
| 2284 | Ga0070689_100014756 | |||
| 2285 | Ga0070689_100037914 | |||
| 2286 | Ga0070689_100059973 | |||
| 2287 | Ga0070691_10000093 | |||
| 2288 | Ga0070691_10012176 | |||
| 2289 | Ga0070691_10025049 | |||
| 2290 | Ga0070691_10026914 | |||
| 2291 | Ga0070687_100000097 | |||
| 2292 | Ga0070687_100014202 | |||
| 2293 | Ga0070687_100064527 | |||
| 2294 | Ga0070687_100071834 | |||
| 2295 | Ga0070687_100267592 | |||
| 2296 | Ga0070661_100000228 | |||
| 2297 | Ga0070661_100056368 | |||
| 2298 | Ga0070661_100443636 | |||
| 2299 | Ga0070692_10052614 | |||
| 2300 | Ga0070668_100004073 | |||
| 2301 | Ga0070668_100047757 | |||
| 2302 | Ga0070668_100072567 | |||
| 2303 | Ga0070668_100155362 | |||
| 2304 | Ga0070669_100000368 | |||
| 2305 | Ga0070669_100079252 | |||
| 2306 | Ga0070675_100000752 | |||
| 2307 | Ga0070675_100008586 | |||
| 2308 | Ga0070675_100149971 | |||
| 2309 | Ga0070675_100272096 | |||
| 2310 | Ga0070675_100342940 | |||
| 2311 | Ga0070671_100000142 | |||
| 2312 | Ga0070671_100010354 | |||
| 2313 | Ga0070671_100011531 | |||
| 2314 | Ga0070671_100071428 | |||
| 2315 | Ga0070671_100095786 | |||
| 2316 | Ga0070671_100099630 | |||
| 2317 | Ga0070674_100090668 | |||
| 2318 | Ga0070673_100007057 | |||
| 2319 | Ga0070673_100142110 | |||
| 2320 | Ga0070673_100151560 | |||
| 2321 | Ga0070673_100269417 | |||
| 2322 | Ga0070673_100435297 | |||
| 2323 | Ga0070688_100020344 | |||
| 2324 | Ga0070688_100056806 | |||
| 2325 | Ga0070688_100107996 | |||
| 2326 | Ga0070659_100000183 | |||
| 2327 | Ga0070659_100025219 | |||
| 2328 | Ga0070659_100054734 | |||
| 2329 | Ga0070659_100094213 | |||
| 2330 | Ga0070659_100390899 | |||
| 2331 | Ga0070667_100005458 | |||
| 2332 | Ga0070667_100074773 | |||
| 2333 | Ga0070703_10014438 | |||
| 2334 | Ga0070709_10014058 | |||
| 2335 | Ga0070709_10053514 | |||
| 2336 | Ga0070709_10088689 | |||
| 2337 | Ga0070714_100108241 | |||
| 2338 | Ga0070714_100356557 | |||
| 2339 | Ga0070714_100567442 | |||
| 2340 | Ga0070713_100026299 | |||
| 2341 | Ga0070713_100051151 | |||
| 2342 | Ga0070713_100103256 | |||
| 2343 | Ga0070713_100117558 | |||
| 2344 | Ga0070713_100126719 | |||
| 2345 | Ga0070713_100128660 | |||
| 2346 | Ga0070713_100153972 | |||
| 2347 | Ga0070713_100250349 | |||
| 2348 | Ga0070710_10021492 | |||
| 2349 | Ga0070710_10035682 | |||
| 2350 | Ga0070710_10096932 | |||
| 2351 | Ga0070710_10218412 | |||
| 2352 | Ga0070710_10259224 | |||
| 2353 | Ga0070701_10000008 | |||
| 2354 | Ga0070701_10049861 | |||
| 2355 | Ga0070701_10061601 | |||
| 2356 | Ga0070711_100003097 | |||
| 2357 | Ga0070711_100026562 | |||
| 2358 | Ga0070711_100029559 | |||
| 2359 | Ga0070711_100033924 | |||
| 2360 | Ga0070711_100062238 | |||
| 2361 | Ga0070711_100069294 | |||
| 2362 | Ga0070711_100124194 | |||
| 2363 | Ga0070711_100187201 | |||
| 2364 | Ga0070705_100074101 | |||
| 2365 | Ga0070700_100001950 | |||
| 2366 | Ga0070700_100005827 | |||
| 2367 | Ga0070700_100008830 | |||
| 2368 | Ga0070700_100045582 | |||
| 2369 | Ga0070700_100276060 | |||
| 2370 | Ga0070700_100667213 | |||
| 2371 | Ga0070694_100001186 | |||
| 2372 | Ga0070694_100080518 | |||
| 2373 | Ga0070694_100089169 | |||
| 2374 | Ga0070708_100099590 | |||
| 2375 | Ga0070708_100100031 | |||
| 2376 | Ga0070708_100239063 | |||
| 2377 | Ga0070708_100251856 | |||
| 2378 | Ga0070708_100283793 | |||
| 2379 | Ga0070708_100353560 | |||
| 2380 | Ga0070708_100645067 | |||
| 2381 | Ga0070663_100000385 | |||
| 2382 | Ga0070663_100036093 | |||
| 2383 | Ga0070678_100001994 | |||
| 2384 | Ga0070678_100012171 | |||
| 2385 | Ga0070678_100215214 | |||
| 2386 | Ga0070678_100271298 | |||
| 2387 | Ga0070662_100003682 | |||
| 2388 | Ga0070662_100009811 | |||
| 2389 | Ga0070662_100010178 | |||
| 2390 | Ga0070662_100059826 | |||
| 2391 | Ga0070662_100129850 | |||
| 2392 | Ga0070681_10008332 | |||
| 2393 | Ga0070681_10047059 | |||
| 2394 | Ga0070681_10145682 | |||
| 2395 | Ga0070681_10217724 | |||
| 2396 | Ga0070681_10252174 | |||
| 2397 | Ga0068867_100000160 | |||
| 2398 | Ga0070685_10128882 | |||
| 2399 | Ga0070685_10321057 | |||
| 2400 | Ga0070706_100040915 | |||
| 2401 | Ga0070706_100526234 | |||
| 2402 | Ga0070706_100556637 | |||
| 2403 | Ga0070707_100219196 | |||
| 2404 | Ga0070707_100522148 | |||
| 2405 | Ga0070698_100722378 | |||
| 2406 | Ga0074259_10011108 | |||
| 2407 | Ga0070699_100065122 | |||
| 2408 | Ga0070699_100552794 | |||
| 2409 | Ga0070679_100017517 | |||
| 2410 | Ga0070679_100048351 | |||
| 2411 | Ga0070679_100077883 | |||
| 2412 | Ga0070679_100104854 | |||
| 2413 | Ga0070679_100115052 | |||
| 2414 | Ga0070679_100156421 | |||
| 2415 | Ga0070679_100276899 | |||
| 2416 | Ga0070679_100407853 | |||
| 2417 | Ga0070679_100523416 | |||
| 2418 | Ga0070684_100004278 | |||
| 2419 | Ga0070684_100256293 | |||
| 2420 | Ga0070697_100210394 | |||
| 2421 | Ga0070697_100401129 | |||
| 2422 | Ga0070697_100403873 | |||
| 2423 | Ga0068853_100017859 | |||
| 2424 | Ga0068853_100065138 | |||
| 2425 | Ga0068853_100258612 | |||
| 2426 | Ga0068853_100614488 | |||
| 2427 | Ga0070672_100000348 | |||
| 2428 | Ga0070672_100009899 | |||
| 2429 | Ga0070672_100127133 | |||
| 2430 | Ga0070686_100000688 | |||
| 2431 | Ga0070686_100056657 | |||
| 2432 | Ga0070686_100066046 | |||
| 2433 | Ga0070695_100008662 | |||
| 2434 | Ga0070695_100018808 | |||
| 2435 | Ga0070695_100196585 | |||
| 2436 | Ga0070696_100007141 | |||
| 2437 | Ga0070696_100047322 | |||
| 2438 | Ga0070696_100134936 | |||
| 2439 | Ga0070696_100373843 | |||
| 2440 | Ga0070693_100001722 | |||
| 2441 | Ga0070693_100043419 | |||
| 2442 | Ga0070693_100049011 | |||
| 2443 | Ga0070693_100167687 | |||
| 2444 | Ga0070665_100023397 | |||
| 2445 | Ga0070665_100025642 | |||
| 2446 | Ga0070665_100042480 | |||
| 2447 | Ga0070665_100084962 | |||
| 2448 | Ga0070665_100154853 | |||
| 2449 | Ga0070665_100618980 | |||
| 2450 | Ga0070704_100008342 | |||
| 2451 | Ga0070704_100077073 | |||
| 2452 | Ga0070704_100147222 | |||
| 2453 | Ga0070704_100345255 | |||
| 2454 | Ga0070704_100374657 | |||
| 2455 | Ga0068855_100005199 | |||
| 2456 | Ga0068855_100014630 | |||
| 2457 | Ga0068855_100028763 | |||
| 2458 | Ga0068855_100167649 | |||
| 2459 | Ga0068855_100261036 | |||
| 2460 | Ga0070664_100021119 | |||
| 2461 | Ga0070664_100033837 | |||
| 2462 | Ga0070664_100255936 | |||
| 2463 | Ga0068857_100000307 | |||
| 2464 | Ga0068854_100000131 | |||
| 2465 | Ga0068854_100032775 | |||
| 2466 | Ga0068856_100001866 | |||
| 2467 | Ga0068856_100355506 | |||
| 2468 | Ga0068856_100658686 | |||
| 2469 | Ga0070702_100000197 | |||
| 2470 | Ga0070702_100093165 | |||
| 2471 | Ga0068852_100000151 | |||
| 2472 | Ga0068852_100036565 | |||
| 2473 | Ga0068852_100219594 | |||
| 2474 | Ga0068852_100255172 | |||
| 2475 | Ga0068859_100018300 | |||
| 2476 | Ga0068859_100100457 | |||
| 2477 | Ga0068859_100227137 | |||
| 2478 | Ga0068859_100445267 | |||
| 2479 | Ga0068859_100479110 | |||
| 2480 | Ga0068859_101154642 | |||
| 2481 | Ga0068864_100001095 | |||
| 2482 | Ga0068864_100024767 | |||
| 2483 | Ga0068866_10001144 | |||
| 2484 | Ga0068866_10188871 | |||
| 2485 | Ga0068861_100000436 | |||
| 2486 | Ga0068861_100101811 | |||
| 2487 | Ga0068861_100151746 | |||
| 2488 | Ga0068861_100237244 | |||
| 2489 | Ga0068861_100295240 | |||
| 2490 | Ga0068851_10043282 | |||
| 2491 | Ga0068851_10092720 | |||
| 2492 | Ga0068870_10000120 | |||
| 2493 | Ga0068870_10000985 | |||
| 2494 | Ga0068870_10075164 | |||
| 2495 | Ga0068863_100000418 | |||
| 2496 | Ga0068863_100119754 | |||
| 2497 | Ga0068863_100290787 | |||
| 2498 | Ga0068858_100015337 | |||
| 2499 | Ga0068858_100086580 | |||
| 2500 | Ga0068858_100126013 | |||
| 2501 | Ga0068858_100145088 | |||
| 2502 | Ga0068858_100306920 | |||
| 2503 | Ga0068860_100004963 | |||
| 2504 | Ga0068860_100103776 | |||
| 2505 | Ga0068860_100106624 | |||
| 2506 | Ga0068860_100148273 | |||
| 2507 | Ga0068862_100029273 | |||
| 2508 | Ga0068862_100483181 | |||
| 2509 | Ga0081455_10000002 | |||
| 2510 | Ga0081455_10001354 | |||
| 2511 | Ga0081455_10006240 | |||
| 2512 | Ga0081455_10012128 | |||
| 2513 | Ga0081455_10027662 | |||
| 2514 | Ga0081455_10053652 | |||
| 2515 | Ga0081455_10343110 | |||
| 2516 | Ga0081538_10011656 | |||
| 2517 | Ga0081538_10053528 | |||
| 2518 | Ga0081540_1000166 | |||
| 2519 | Ga0081540_1002025 | |||
| 2520 | Ga0081540_1015548 | |||
| 2521 | Ga0081540_1016475 | |||
| 2522 | Ga0081540_1061250 | |||
| 2523 | Ga0081540_1113203 | |||
| 2524 | Ga0081540_1156102 | |||
| 2525 | Ga0081539_10010724 | |||
| 2526 | Ga0081539_10044788 | |||
| 2527 | Ga0081539_10140099 | |||
| 2528 | Ga0070717_10013275 | |||
| 2529 | Ga0070717_10036603 | |||
| 2530 | Ga0070717_10040398 | |||
| 2531 | Ga0070717_10043212 | |||
| 2532 | Ga0070717_10185683 | |||
| 2533 | Ga0070717_10267089 | |||
| 2534 | Ga0070717_10390143 | |||
| 2535 | Ga0070717_10896061 | |||
| 2536 | Ga0075365_10002199 | |||
| 2537 | Ga0075365_10007282 | |||
| 2538 | Ga0075365_10015116 | |||
| 2539 | Ga0075365_10079674 | |||
| 2540 | Ga0075365_10293793 | |||
| 2541 | Ga0075368_10050125 | |||
| 2542 | Ga0075363_100003290 | |||
| 2543 | Ga0075363_100046416 | |||
| 2544 | Ga0075363_100117367 | |||
| 2545 | Ga0075364_10003576 | |||
| 2546 | Ga0075364_10048755 | |||
| 2547 | Ga0075364_10048826 | |||
| 2548 | Ga0075364_10156148 | |||
| 2549 | Ga0075364_10160278 | |||
| 2550 | Ga0070715_10004035 | |||
| 2551 | Ga0070715_10071020 | |||
| 2552 | Ga0070715_10082331 | |||
| 2553 | Ga0070715_10134237 | |||
| 2554 | Ga0070716_100032365 | |||
| 2555 | Ga0070716_100167105 | |||
| 2556 | Ga0070716_100303562 | |||
| 2557 | Ga0070712_100021809 | |||
| 2558 | Ga0070712_100022609 | |||
| 2559 | Ga0070712_100037456 | |||
| 2560 | Ga0070712_100054250 | |||
| 2561 | Ga0070712_100065597 | |||
| 2562 | Ga0070712_100069678 | |||
| 2563 | Ga0070712_100104739 | |||
| 2564 | Ga0070712_100111932 | |||
| 2565 | Ga0070712_100150909 | |||
| 2566 | Ga0070712_100234045 | |||
| 2567 | Ga0070712_100257634 | |||
| 2568 | Ga0070712_100323361 | |||
| 2569 | Ga0070712_100435213 | |||
| 2570 | Ga0070712_100616661 | |||
| 2571 | Ga0070712_100657811 | |||
| 2572 | Ga0075362_10011461 | |||
| 2573 | Ga0075362_10037226 | |||
| 2574 | Ga0075362_10103811 | |||
| 2575 | Ga0075362_10128187 | |||
| 2576 | Ga0075367_10011511 | |||
| 2577 | Ga0075367_10017973 | |||
| 2578 | Ga0075367_10032143 | |||
| 2579 | Ga0075367_10045294 | |||
| 2580 | Ga0075367_10124301 | |||
| 2581 | Ga0075367_10243531 | |||
| 2582 | Ga0075367_10335353 | |||
| 2583 | Ga0075369_10076405 | |||
| 2584 | Ga0075369_10080932 | |||
| 2585 | Ga0075427_10000036 | |||
| 2586 | Ga0075366_10001260 | |||
| 2587 | Ga0075366_10018230 | |||
| 2588 | Ga0075366_10266495 | |||
| 2589 | Ga0075366_10338888 | |||
| 2590 | Ga0097621_100000887 | |||
| 2591 | Ga0097621_100113804 | |||
| 2592 | Ga0097621_100208933 | |||
| 2593 | Ga0097621_100224616 | |||
| 2594 | Ga0075370_10077581 | |||
| 2595 | Ga0075370_10335825 | |||
| 2596 | Ga0068871_100000484 | |||
| 2597 | Ga0068871_100001991 | |||
| 2598 | Ga0068871_100020759 | |||
| 2599 | Ga0068871_100023143 | |||
| 2600 | Ga0068871_100308560 | |||
| 2601 | Ga0075428_100001081 | |||
| 2602 | Ga0075428_100002972 | |||
| 2603 | Ga0075428_100023291 | |||
| 2604 | Ga0075428_100103169 | |||
| 2605 | Ga0075428_100302813 | |||
| 2606 | Ga0075428_100365093 | |||
| 2607 | Ga0075428_100423317 | |||
| 2608 | Ga0075428_100555795 | |||
| 2609 | Ga0075430_100000045 | |||
| 2610 | Ga0075430_100000274 | |||
| 2611 | Ga0075430_100144888 | |||
| 2612 | Ga0075431_100000059 | |||
| 2613 | Ga0075431_100000219 | |||
| 2614 | Ga0075431_100258813 | |||
| 2615 | Ga0075431_100310825 | |||
| 2616 | Ga0075431_100331438 | |||
| 2617 | Ga0075433_10001892 | |||
| 2618 | Ga0075433_10034114 | |||
| 2619 | Ga0075433_10043556 | |||
| 2620 | Ga0075433_10186304 | |||
| 2621 | Ga0075433_10221632 | |||
| 2622 | Ga0075433_10232214 | |||
| 2623 | Ga0075434_100003622 | |||
| 2624 | Ga0075434_100006246 | |||
| 2625 | Ga0075434_100078022 | |||
| 2626 | Ga0075434_100243412 | |||
| 2627 | Ga0075434_100363060 | |||
| 2628 | Ga0075434_100372665 | |||
| 2629 | Ga0075429_100003392 | |||
| 2630 | Ga0075429_100014917 | |||
| 2631 | Ga0075429_100133092 | |||
| 2632 | Ga0075429_100446866 | |||
| 2633 | Ga0068865_100000613 | |||
| 2634 | Ga0075436_100005027 | |||
| 2635 | Ga0075436_100060170 | |||
| 2636 | Ga0075436_100125224 | |||
| 2637 | Ga0075436_100216483 | |||
| 2638 | Ga0075436_100408373 | |||
| 2639 | Ga0097620_100018301 | |||
| 2640 | Ga0097620_100100460 | |||
| 2641 | Ga0097620_100227140 | |||
| 2642 | Ga0097620_100445249 | |||
| 2643 | Ga0097620_100479046 | |||
| 2644 | Ga0097620_101154661 | |||
| 2645 | Ga0079104_1000195 | |||
| 2646 | Ga0075435_100044561 | |||
| 2647 | Ga0075435_100052359 | |||
| 2648 | Ga0075435_100072187 | |||
| 2649 | Ga0075435_100090548 | |||
| 2650 | Ga0075435_100114913 | |||
| 2651 | Ga0075435_100174407 | |||
| 2652 | Ga0075435_100322592 | |||
| 2653 | Ga0075435_100426336 | |||
| 2654 | Ga0075435_100591792 | |||
| 2655 | Ga0099794_10007909 | |||
| 2656 | Ga0099794_10031163 | |||
| 2657 | Ga0099795_10110463 | |||
| 2658 | Ga0099795_10154416 | |||
| 2659 | Ga0099795_10175236 | |||
| 2660 | Ga0105251_10031791 | |||
| 2661 | Ga0105251_10048048 | |||
| 2662 | Ga0105244_10017634 | |||
| 2663 | Ga0105250_10012131 | |||
| 2664 | Ga0105240_10023181 | |||
| 2665 | Ga0105240_10189033 | |||
| 2666 | Ga0105240_10609018 | |||
| 2667 | Ga0105240_10915440 | |||
| 2668 | Ga0105240_11245333 | |||
| 2669 | Ga0111539_10000679 | |||
| 2670 | Ga0111539_10000693 | |||
| 2671 | Ga0111539_10000925 | |||
| 2672 | Ga0111539_10001296 | |||
| 2673 | Ga0111539_10048622 | |||
| 2674 | Ga0111539_10123739 | |||
| 2675 | Ga0111539_10132601 | |||
| 2676 | Ga0111539_10165942 | |||
| 2677 | Ga0111539_10220232 | |||
| 2678 | Ga0111539_10274557 | |||
| 2679 | Ga0111539_10863039 | |||
| 2680 | Ga0111539_11275377 | |||
| 2681 | Ga0111539_11339110 | |||
| 2682 | Ga0111539_11411435 | |||
| 2683 | Ga0105245_10000090 | |||
| 2684 | Ga0105245_10010517 | |||
| 2685 | Ga0105245_10036531 | |||
| 2686 | Ga0105245_10071370 | |||
| 2687 | Ga0105245_10409644 | |||
| 2688 | Ga0105245_10512313 | |||
| 2689 | Ga0105245_10945090 | |||
| 2690 | Ga0105245_11005301 | |||
| 2691 | Ga0105247_10003560 | |||
| 2692 | Ga0105247_10007854 | |||
| 2693 | Ga0105247_10019461 | |||
| 2694 | Ga0105247_10115510 | |||
| 2695 | Ga0114129_10006313 | |||
| 2696 | Ga0114129_10008707 | |||
| 2697 | Ga0114129_10024738 | |||
| 2698 | Ga0114129_10037360 | |||
| 2699 | Ga0114129_10381844 | |||
| 2700 | Ga0114129_10544573 | |||
| 2701 | Ga0114129_10664413 | |||
| 2702 | Ga0114129_10783267 | |||
| 2703 | Ga0114129_10908682 | |||
| 2704 | Ga0105243_10001004 | |||
| 2705 | Ga0105243_10027743 | |||
| 2706 | Ga0105243_10037418 | |||
| 2707 | Ga0105243_10077516 | |||
| 2708 | Ga0105243_11178051 | |||
| 2709 | Ga0105241_10000053 | |||
| 2710 | Ga0105241_10309814 | |||
| 2711 | Ga0105241_10555788 | |||
| 2712 | Ga0105242_10004018 | |||
| 2713 | Ga0105242_10171984 | |||
| 2714 | Ga0105242_10187774 | |||
| 2715 | Ga0105242_10381302 | |||
| 2716 | Ga0105242_11219152 | |||
| 2717 | Ga0105248_10000964 | |||
| 2718 | Ga0105248_10020015 | |||
| 2719 | Ga0105248_10020708 | |||
| 2720 | Ga0105248_10022530 | |||
| 2721 | Ga0105248_10027546 | |||
| 2722 | Ga0105248_10149687 | |||
| 2723 | Ga0105248_10216999 | |||
| 2724 | Ga0105237_10005610 | |||
| 2725 | Ga0105237_10045785 | |||
| 2726 | Ga0105237_10116760 | |||
| 2727 | Ga0105237_10126352 | |||
| 2728 | Ga0105237_10296065 | |||
| 2729 | Ga0105238_10068323 | |||
| 2730 | Ga0105238_10079941 | |||
| 2731 | Ga0105238_10454156 | |||
| 2732 | Ga0105249_10009773 | |||
| 2733 | Ga0099796_10009779 | |||
| 2734 | Ga0099796_10042857 | |||
| 2735 | Ga0099796_10113552 | |||
| 2736 | Ga0099796_10146835 | |||
| 2737 | Ga0105239_10007674 | |||
| 2738 | Ga0105239_10092138 | |||
| 2739 | Ga0105239_10097118 | |||
| 2740 | Ga0105239_10462312 | |||
| 2741 | Ga0105239_10644202 | |||
| 2742 | Ga0105246_10000052 | |||
| 2743 | Ga0105246_10075238 | |||
| 2744 | Ga0105246_10095324 | |||
| 2745 | Ga0105246_10379958 | |||
| 2746 | Ga0157339_1001686 | |||
| 2747 | Ga0157342_1000555 | |||
| 2748 | Ga0157338_1000120 | |||
| 2749 | Ga0157373_10039051 | |||
| 2750 | Ga0157371_10006781 | |||
| 2751 | Ga0157371_10177791 | |||
| 2752 | Ga0157370_10237622 | |||
| 2753 | Ga0157370_10282380 | |||
| 2754 | Ga0157370_10582633 | |||
| 2755 | Ga0157369_10508677 | |||
| 2756 | Ga0157369_10541970 | |||
| 2757 | Ga0157374_10000476 | |||
| 2758 | Ga0157374_10055453 | |||
| 2759 | Ga0157374_10105147 | |||
| 2760 | Ga0157374_10567490 | |||
| 2761 | Ga0157374_10951380 | |||
| 2762 | Ga0157378_10002229 | |||
| 2763 | Ga0157378_10294896 | |||
| 2764 | Ga0157378_10348777 | |||
| 2765 | Ga0157378_10397742 | |||
| 2766 | Ga0163162_10000308 | |||
| 2767 | Ga0163162_10050166 | |||
| 2768 | Ga0163162_10146941 | |||
| 2769 | Ga0163162_10193333 | |||
| 2770 | Ga0163162_10242765 | |||
| 2771 | Ga0163162_10268386 | |||
| 2772 | Ga0163162_10570554 | |||
| 2773 | Ga0157372_10572295 | |||
| 2774 | Ga0157375_10000414 | |||
| 2775 | Ga0157375_10056632 | |||
| 2776 | Ga0157375_10090677 | |||
| 2777 | Ga0157375_10257419 | |||
| 2778 | Ga0157375_10796255 | |||
| 2779 | Ga0163163_10002595 | |||
| 2780 | Ga0163163_10003463 | |||
| 2781 | Ga0163163_10010358 | |||
| 2782 | Ga0163163_10029326 | |||
| 2783 | Ga0157380_10000122 | |||
| 2784 | Ga0157380_10208227 | |||
| 2785 | Ga0157380_10225848 | |||
| 2786 | Ga0157377_10001747 | |||
| 2787 | Ga0157377_10037359 | |||
| 2788 | Ga0157377_10058897 | |||
| 2789 | Ga0157377_10069104 | |||
| 2790 | Ga0157379_10000261 | |||
| 2791 | Ga0157379_10028513 | |||
| 2792 | Ga0157379_10047295 | |||
| 2793 | Ga0157379_10049326 | |||
| 2794 | Ga0157379_10059283 | |||
| 2795 | Ga0157379_10832212 | |||
| 2796 | Ga0157376_10000283 | |||
| 2797 | Ga0157376_10147361 | |||
| 2798 | Ga0157376_10249144 | |||
| 2799 | Ga0157376_10972670 | |||
| 2800 | Ga0163161_10000199 | |||
| 2801 | Ga0206356_11625837 | |||
| 2802 | Ga0206356_11859219 | |||
| 2803 | Ga0213872_10041990 | |||
| 2804 | Ga0213876_10052325 | |||
| 2805 | Ga0213876_10086180 | |||
| 2806 | Ga0213876_10241168 | |||
| 2807 | Ga0213875_10000053 | |||
| 2808 | Ga0213875_10078217 | |||
| 2809 | Ga0213875_10158350 | |||
| 2810 | Ga0224572_1003469 | |||
| 2811 | Ga0209233_1007144 | |||
| 2812 | Ga0207666_1000861 | |||
| 2813 | Ga0207666_1002383 | |||
| 2814 | Ga0207673_1000489 | |||
| 2815 | Ga0209676_1032510 | |||
| 2816 | Ga0209758_1001119 | |||
| 2817 | Ga0209758_1004320 | |||
| 2818 | Ga0209050_1025171 | |||
| 2819 | Ga0209256_1009023 | |||
| 2820 | Ga0209051_1009812 | |||
| 2821 | Ga0209257_1010796 | |||
| 2822 | Ga0207697_10000335 | |||
| 2823 | Ga0207697_10004744 | |||
| 2824 | Ga0207653_10001210 | |||
| 2825 | Ga0207682_10000042 | |||
| 2826 | Ga0207692_10007314 | |||
| 2827 | Ga0207692_10010700 | |||
| 2828 | Ga0207692_10038756 | |||
| 2829 | Ga0207692_10141611 | |||
| 2830 | Ga0207642_10000725 | |||
| 2831 | Ga0207642_10080842 | |||
| 2832 | Ga0207710_10002054 | |||
| 2833 | Ga0207710_10038983 | |||
| 2834 | Ga0207710_10062509 | |||
| 2835 | Ga0207710_10098804 | |||
| 2836 | Ga0207688_10000053 | |||
| 2837 | Ga0207688_10000303 | |||
| 2838 | Ga0207688_10021480 | |||
| 2839 | Ga0207688_10046434 | |||
| 2840 | Ga0207688_10089188 | |||
| 2841 | Ga0207680_10001204 | |||
| 2842 | Ga0207680_10022210 | |||
| 2843 | Ga0207680_10045668 | |||
| 2844 | Ga0207647_10003927 | |||
| 2845 | Ga0207647_10004389 | |||
| 2846 | Ga0207647_10053679 | |||
| 2847 | Ga0207685_10062000 | |||
| 2848 | Ga0207685_10063480 | |||
| 2849 | Ga0207685_10064913 | |||
| 2850 | Ga0207699_10055238 | |||
| 2851 | Ga0207699_10177379 | |||
| 2852 | Ga0207699_10192061 | |||
| 2853 | Ga0207699_10661932 | |||
| 2854 | Ga0207645_10000090 | |||
| 2855 | Ga0207645_10027127 | |||
| 2856 | Ga0207645_10044860 | |||
| 2857 | Ga0207645_10079551 | |||
| 2858 | Ga0207645_10151056 | |||
| 2859 | Ga0207645_10428663 | |||
| 2860 | Ga0207645_10429959 | |||
| 2861 | Ga0207643_10000044 | |||
| 2862 | Ga0207643_10001489 | |||
| 2863 | Ga0207643_10143305 | |||
| 2864 | Ga0207705_10059249 | |||
| 2865 | Ga0207705_10168933 | |||
| 2866 | Ga0207684_10006762 | |||
| 2867 | Ga0207684_10035923 | |||
| 2868 | Ga0207684_10099712 | |||
| 2869 | Ga0207684_10187027 | |||
| 2870 | Ga0207684_10288055 | |||
| 2871 | Ga0207684_10613266 | |||
| 2872 | Ga0207654_10000397 | |||
| 2873 | Ga0207654_10029294 | |||
| 2874 | Ga0207654_10057163 | |||
| 2875 | Ga0207707_10001536 | |||
| 2876 | Ga0207707_10187436 | |||
| 2877 | Ga0207707_10301162 | |||
| 2878 | Ga0207707_10436914 | |||
| 2879 | Ga0207695_10156553 | |||
| 2880 | Ga0207695_10183913 | |||
| 2881 | Ga0207671_10007530 | |||
| 2882 | Ga0207671_10136584 | |||
| 2883 | Ga0207671_10341351 | |||
| 2884 | Ga0207671_10429836 | |||
| 2885 | Ga0207693_10002841 | |||
| 2886 | Ga0207693_10023723 | |||
| 2887 | Ga0207693_10024688 | |||
| 2888 | Ga0207693_10033027 | |||
| 2889 | Ga0207693_10065540 | |||
| 2890 | Ga0207693_10088650 | |||
| 2891 | Ga0207693_10097277 | |||
| 2892 | Ga0207693_10127778 | |||
| 2893 | Ga0207693_10161041 | |||
| 2894 | Ga0207693_10175786 | |||
| 2895 | Ga0207693_10221353 | |||
| 2896 | Ga0207693_10496113 | |||
| 2897 | Ga0207693_10529246 | |||
| 2898 | Ga0207693_10547110 | |||
| 2899 | Ga0207693_10614071 | |||
| 2900 | Ga0207693_10676278 | |||
| 2901 | Ga0207663_10012583 | |||
| 2902 | Ga0207663_10078915 | |||
| 2903 | Ga0207663_10093246 | |||
| 2904 | Ga0207663_10120068 | |||
| 2905 | Ga0207663_10315585 | |||
| 2906 | Ga0207663_10508650 | |||
| 2907 | Ga0207660_10000083 | |||
| 2908 | Ga0207660_10014742 | |||
| 2909 | Ga0207660_10038833 | |||
| 2910 | Ga0207660_10085535 | |||
| 2911 | Ga0207660_10355796 | |||
| 2912 | Ga0207662_10000230 | |||
| 2913 | Ga0207662_10025780 | |||
| 2914 | Ga0207662_10029808 | |||
| 2915 | Ga0207662_10076174 | |||
| 2916 | Ga0207657_10001336 | |||
| 2917 | Ga0207657_10043359 | |||
| 2918 | Ga0207657_10051527 | |||
| 2919 | Ga0207657_10057189 | |||
| 2920 | Ga0207657_10118613 | |||
| 2921 | Ga0207657_10238867 | |||
| 2922 | Ga0207657_10379870 | |||
| 2923 | Ga0207649_10000260 | |||
| 2924 | Ga0207649_10062643 | |||
| 2925 | Ga0207652_10002829 | |||
| 2926 | Ga0207652_10041895 | |||
| 2927 | Ga0207652_10048055 | |||
| 2928 | Ga0207652_10065015 | |||
| 2929 | Ga0207652_10101081 | |||
| 2930 | Ga0207652_10123939 | |||
| 2931 | Ga0207652_10127047 | |||
| 2932 | Ga0207652_10289647 | |||
| 2933 | Ga0207646_10050403 | |||
| 2934 | Ga0207646_10128543 | |||
| 2935 | Ga0207646_10269889 | |||
| 2936 | Ga0207681_10000271 | |||
| 2937 | Ga0207681_10072398 | |||
| 2938 | Ga0207681_10097997 | |||
| 2939 | Ga0207694_10013167 | |||
| 2940 | Ga0207694_10153669 | |||
| 2941 | Ga0207694_10504424 | |||
| 2942 | Ga0207650_10006320 | |||
| 2943 | Ga0207650_10014750 | |||
| 2944 | Ga0207650_10023350 | |||
| 2945 | Ga0207650_10026553 | |||
| 2946 | Ga0207650_10045459 | |||
| 2947 | Ga0207650_10151005 | |||
| 2948 | Ga0207659_10000258 | |||
| 2949 | Ga0207659_10040244 | |||
| 2950 | Ga0207659_10057381 | |||
| 2951 | Ga0207659_10113354 | |||
| 2952 | Ga0207659_10191778 | |||
| 2953 | Ga0207659_10237474 | |||
| 2954 | Ga0207659_10313108 | |||
| 2955 | Ga0207687_10000063 | |||
| 2956 | Ga0207687_10013043 | |||
| 2957 | Ga0207687_10086242 | |||
| 2958 | Ga0207687_10421539 | |||
| 2959 | Ga0207687_10640576 | |||
| 2960 | Ga0207700_10022871 | |||
| 2961 | Ga0207700_10046001 | |||
| 2962 | Ga0207700_10062363 | |||
| 2963 | Ga0207700_10128057 | |||
| 2964 | Ga0207700_10172519 | |||
| 2965 | Ga0207700_10347125 | |||
| 2966 | Ga0207700_10822302 | |||
| 2967 | Ga0207664_10038216 | |||
| 2968 | Ga0207664_10054501 | |||
| 2969 | Ga0207664_10128655 | |||
| 2970 | Ga0207664_10254745 | |||
| 2971 | Ga0207664_10524073 | |||
| 2972 | Ga0207644_10000524 | |||
| 2973 | Ga0207644_10006692 | |||
| 2974 | Ga0207644_10045806 | |||
| 2975 | Ga0207644_10074067 | |||
| 2976 | Ga0207644_10129632 | |||
| 2977 | Ga0207644_10207058 | |||
| 2978 | Ga0207690_10001251 | |||
| 2979 | Ga0207690_10230639 | |||
| 2980 | Ga0207690_10388623 | |||
| 2981 | Ga0207706_10001197 | |||
| 2982 | Ga0207706_10002752 | |||
| 2983 | Ga0207706_10009072 | |||
| 2984 | Ga0207706_10032010 | |||
| 2985 | Ga0207706_10099317 | |||
| 2986 | Ga0207706_10182028 | |||
| 2987 | Ga0207706_10412473 | |||
| 2988 | Ga0207686_10000456 | |||
| 2989 | Ga0207686_10108312 | |||
| 2990 | Ga0207686_10158898 | |||
| 2991 | Ga0207686_10257159 | |||
| 2992 | Ga0207709_10000372 | |||
| 2993 | Ga0207709_10068200 | |||
| 2994 | Ga0207670_10000345 | |||
| 2995 | Ga0207670_10003254 | |||
| 2996 | Ga0207670_10006141 | |||
| 2997 | Ga0207670_10007621 | |||
| 2998 | Ga0207670_10058416 | |||
| 2999 | Ga0207670_10072520 | |||
| 3000 | Ga0207669_10000019 | |||
| 3001 | Ga0207704_10007530 | |||
| 3002 | Ga0207704_10160016 | |||
| 3003 | Ga0207665_10008520 | |||
| 3004 | Ga0207665_10043429 | |||
| 3005 | Ga0207665_10142024 | |||
| 3006 | Ga0207665_10226485 | |||
| 3007 | Ga0207665_10312167 | |||
| 3008 | Ga0207665_10414586 | |||
| 3009 | Ga0207691_10000987 | |||
| 3010 | Ga0207691_10003130 | |||
| 3011 | Ga0207691_10035947 | |||
| 3012 | Ga0207691_10087771 | |||
| 3013 | Ga0207691_10138784 | |||
| 3014 | Ga0207691_10183730 | |||
| 3015 | Ga0207691_10680101 | |||
| 3016 | Ga0207711_10001673 | |||
| 3017 | Ga0207711_10011969 | |||
| 3018 | Ga0207711_10057086 | |||
| 3019 | Ga0207711_10263308 | |||
| 3020 | Ga0207711_10300267 | |||
| 3021 | Ga0207711_10404704 | |||
| 3022 | Ga0207689_10000916 | |||
| 3023 | Ga0207689_10043776 | |||
| 3024 | Ga0207661_10000107 | |||
| 3025 | Ga0207661_10008359 | |||
| 3026 | Ga0207661_10355257 | |||
| 3027 | Ga0207679_10000026 | |||
| 3028 | Ga0207679_10010198 | |||
| 3029 | Ga0207679_10180970 | |||
| 3030 | Ga0207679_10531988 | |||
| 3031 | Ga0207679_10683305 | |||
| 3032 | Ga0207667_10003336 | |||
| 3033 | Ga0207667_10016894 | |||
| 3034 | Ga0207667_10026958 | |||
| 3035 | Ga0207667_10240610 | |||
| 3036 | Ga0207667_10352694 | |||
| 3037 | Ga0207667_10671609 | |||
| 3038 | Ga0207651_10000855 | |||
| 3039 | Ga0207651_10007700 | |||
| 3040 | Ga0207651_10048298 | |||
| 3041 | Ga0207651_10417901 | |||
| 3042 | Ga0207712_10000242 | |||
| 3043 | Ga0207712_10005698 | |||
| 3044 | Ga0207712_10109207 | |||
| 3045 | Ga0207712_10178669 | |||
| 3046 | Ga0207668_10000049 | |||
| 3047 | Ga0207668_10035376 | |||
| 3048 | Ga0207668_10183307 | |||
| 3049 | Ga0207668_10664834 | |||
| 3050 | Ga0207640_10000234 | |||
| 3051 | Ga0207640_10054433 | |||
| 3052 | Ga0207640_10418870 | |||
| 3053 | Ga0207658_10000804 | |||
| 3054 | Ga0207658_10081866 | |||
| 3055 | Ga0207658_10530498 | |||
| 3056 | Ga0207658_10593474 | |||
| 3057 | Ga0207677_10010292 | |||
| 3058 | Ga0207677_10014242 | |||
| 3059 | Ga0207677_10399653 | |||
| 3060 | Ga0207703_10001356 | |||
| 3061 | Ga0207703_10013541 | |||
| 3062 | Ga0207703_10052590 | |||
| 3063 | Ga0207639_10063261 | |||
| 3064 | Ga0207678_10000831 | |||
| 3065 | Ga0207678_10020178 | |||
| 3066 | Ga0207678_10047638 | |||
| 3067 | Ga0207678_10217103 | |||
| 3068 | Ga0207678_10233442 | |||
| 3069 | Ga0207708_10001403 | |||
| 3070 | Ga0207708_10003197 | |||
| 3071 | Ga0207708_10008657 | |||
| 3072 | Ga0207708_10048004 | |||
| 3073 | Ga0207708_10093743 | |||
| 3074 | Ga0207708_10111840 | |||
| 3075 | Ga0207708_10134596 | |||
| 3076 | Ga0207702_10001965 | |||
| 3077 | Ga0207702_10021193 | |||
| 3078 | Ga0207702_10037163 | |||
| 3079 | Ga0207702_10430239 | |||
| 3080 | Ga0207702_10769345 | |||
| 3081 | Ga0207641_10000669 | |||
| 3082 | Ga0207641_10020291 | |||
| 3083 | Ga0207641_10116676 | |||
| 3084 | Ga0207641_10203724 | |||
| 3085 | Ga0207641_10244333 | |||
| 3086 | Ga0207641_10617020 | |||
| 3087 | Ga0207648_10001440 | |||
| 3088 | Ga0207648_10007865 | |||
| 3089 | Ga0207648_10135059 | |||
| 3090 | Ga0207648_10145029 | |||
| 3091 | Ga0207648_10150751 | |||
| 3092 | Ga0207676_10002834 | |||
| 3093 | Ga0207676_10038734 | |||
| 3094 | Ga0207676_10317214 | |||
| 3095 | Ga0207674_10001207 | |||
| 3096 | Ga0207674_10048795 | |||
| 3097 | Ga0207674_10079903 | |||
| 3098 | Ga0207675_100000983 | |||
| 3099 | Ga0207675_100008958 | |||
| 3100 | Ga0207675_100060262 | |||
| 3101 | Ga0207683_10000324 | |||
| 3102 | Ga0207683_10003263 | |||
| 3103 | Ga0207683_10009172 | |||
| 3104 | Ga0207683_10032197 | |||
| 3105 | Ga0207683_10034197 | |||
| 3106 | Ga0207683_10082323 | |||
| 3107 | Ga0207683_10231898 | |||
| 3108 | Ga0207683_10273012 | |||
| 3109 | Ga0207698_10037934 | |||
| 3110 | Ga0207698_10055015 | |||
| 3111 | Ga0207698_10083712 | |||
| 3112 | Ga0207698_10317619 | |||
| 3113 | Ga0207698_10867889 | |||
| 3114 | Ga0209281_1000028 | |||
| 3115 | Ga0209973_1012614 | |||
| 3116 | Ga0209967_1033312 | |||
| 3117 | Ga0209999_1030856 | |||
| 3118 | Ga0209982_1014071 | |||
| 3119 | Ga0210002_1000535 | |||
| 3120 | Ga0209588_1008486 | |||
| 3121 | Ga0209971_1009254 | |||
| 3122 | Ga0209966_1001462 | |||
| 3123 | Ga0209966_1001844 | |||
| 3124 | Ga0209998_10003317 | |||
| 3125 | Ga0209998_10003343 | |||
| 3126 | Ga0209998_10021479 | |||
| 3127 | Ga0209974_10000294 | |||
| 3128 | Ga0207428_10000130 | |||
| 3129 | Ga0207428_10000180 | |||
| 3130 | Ga0207428_10000286 | |||
| 3131 | Ga0207428_10021017 | |||
| 3132 | Ga0207428_10108503 | |||
| 3133 | Ga0268266_10018041 | |||
| 3134 | Ga0268266_10082954 | |||
| 3135 | Ga0268266_10096310 | |||
| 3136 | Ga0268266_10228212 | |||
| 3137 | Ga0268265_10001031 | |||
| 3138 | Ga0268264_10001139 | |||
| 3139 | Ga0268264_10052458 | |||
| 3140 | Ga0268264_10053079 | |||
| 3141 | Ga0268264_10158196 | |||
| 3142 | Ga0268264_10208891 | |||
| 3143 | Ga0268264_10406525 | |||
| 3144 | Ga0268264_10475908 | |||
| 3145 | Ga0265337_1005487 | |||
| 3146 | Ga0265318_10020071 | |||
| 3147 | Ga0265338_10027443 | |||
| 3148 | Ga0265338_10041953 | |||
| 3149 | Ga0265338_10279590 | |||
| 3150 | Ga0307511_10162010 | |||
| 3151 | Ga0265762_1009325 | |||
| 3152 | Ga0265763_1000858 | |||
| 3153 | Ga0265760_10015831 | |||
| 3154 | Ga0265330_10012081 | |||
| 3155 | Ga0265330_10040936 | |||
| 3156 | Ga0265330_10086514 | |||
| 3157 | Ga0265320_10020669 | |||
| 3158 | Ga0265325_10000011 | |||
| 3159 | Ga0265325_10003712 | |||
| 3160 | Ga0265325_10014736 | |||
| 3161 | Ga0265325_10022034 | |||
| 3162 | Ga0265325_10057438 | |||
| 3163 | Ga0265325_10062114 | |||
| 3164 | Ga0265329_10029376 | |||
| 3165 | Ga0265329_10032779 | |||
| 3166 | Ga0265340_10013469 | |||
| 3167 | Ga0265340_10021550 | |||
| 3168 | Ga0265340_10064325 | |||
| 3169 | Ga0265340_10120326 | |||
| 3170 | Ga0265339_10000323 | |||
| 3171 | Ga0265339_10001920 | |||
| 3172 | Ga0265339_10054498 | |||
| 3173 | Ga0265339_10072814 | |||
| 3174 | Ga0265339_10123366 | |||
| 3175 | Ga0265339_10168861 | |||
| 3176 | Ga0265331_10003347 | |||
| 3177 | Ga0265331_10021350 | |||
| 3178 | Ga0265331_10091038 | |||
| 3179 | Ga0265331_10121371 | |||
| 3180 | Ga0265327_10001225 | |||
| 3181 | Ga0265316_10034538 | |||
| 3182 | Ga0307513_10104188 | |||
| 3183 | Ga0307408_100107474 | |||
| 3184 | Ga0265313_10001449 | |||
| 3185 | Ga0265313_10001589 | |||
| 3186 | Ga0265313_10003565 | |||
| 3187 | Ga0265313_10009692 | |||
| 3188 | Ga0265313_10020730 | |||
| 3189 | Ga0265313_10029784 | |||
| 3190 | Ga0265313_10040888 | |||
| 3191 | Ga0316575_10070445 | |||
| 3192 | Ga0316579_10055021 | |||
| 3193 | Ga0265314_10013869 | |||
| 3194 | Ga0265314_10015442 | |||
| 3195 | Ga0265314_10045240 | |||
| 3196 | Ga0265314_10076897 | |||
| 3197 | Ga0265342_10000149 | |||
| 3198 | Ga0265342_10007848 | |||
| 3199 | Ga0265342_10019096 | |||
| 3200 | Ga0265342_10039757 | |||
| 3201 | Ga0265342_10045575 | |||
| 3202 | Ga0265342_10119218 | |||
| 3203 | Ga0316576_10107181 | |||
| 3204 | Ga0316578_10048911 | |||
| 3205 | Ga0307413_10112006 | |||
| 3206 | Ga0307410_10760394 | |||
| 3207 | Ga0307406_10181064 | |||
| 3208 | Ga0307406_10288537 | |||
| 3209 | Ga0307412_10153401 | |||
| 3210 | Ga0307412_10535256 | |||
| 3211 | Ga0307409_100646148 | |||
| 3212 | Ga0307416_100451831 | |||
| 3213 | Ga0316583_10000030 | |||
| 3214 | Ga0373930_0000095 | |||
| 3215 | Ga0373948_0000228 | |||
| 3216 | Ga0373958_0000068 | |||
| 3217 | Ga0373958_0007995 | |||
| 3218 | Ga0373959_0000647 | |||
| 3219 | Ga0373938_0000024 | |||
| 3220 | Ga0373938_0000123 | |||
| 3221 | Ga0373926_0018881 | |||
| 3222 | Ga0373926_0020863 | |||
| 3223 | Ga0373926_0034034 | |||
| 3224 | Ga0373926_0147383 | |||
| 3225 | Ga0373928_0000414 | |||
| 3226 | Ga0373928_0005868 | |||
| 3227 | Ga0373928_0043229 | |||
| 3228 | Ga0373928_0062581 | |||
| 3229 | Ga0373929_0000244 | |||
| 3230 | Ga0373929_0000851 | |||
| 3231 | Ga0373929_0011780 | |||
| 3232 | Ga0373934_0020094 | |||
| 3233 | Ga0373934_0039777 | |||
| 3234 | Ga0373940_0000883 | |||
| 3235 | Ga0373940_0042643 | |||
| 3236 | Ga0373944_0004335 | |||
| 3237 | Ga0373944_0022951 | |||
| 3238 | Ga0373944_0055312 | |||
| 3239 | Ga0373944_0110928 | |||
| 3240 | Ga0373944_0124588 | |||
| 3241 | Ga0373944_0135960 | |||
| 3242 | Ga0373951_0000589 | |||
| 3243 | Ga0373951_0065173 | |||
| 3244 | Ga0373952_0001678 | |||
| 3245 | Ga0373952_0019323 | |||
| 3246 | Ga0373923_0001460 | |||
| 3247 | Ga0373923_0090664 | |||
| 3248 | Ga0373923_0211333 | |||
| 3249 | Ga0373932_0004049 | |||
| 3250 | Ga0373932_0028908 | |||
| 3251 | Ga0373936_0000207 | |||
| 3252 | Ga0373936_0011857 | |||
| 3253 | Ga0373936_0026559 | |||
| 3254 | Ga0373936_0055171 | |||
| 3255 | Ga0373936_0125171 | |||
| 3256 | Ga0373939_0000144 | |||
| 3257 | Ga0373939_0000494 | |||
| 3258 | Ga0373941_0000087 | |||
| 3259 | Ga0373941_0006414 | |||
| 3260 | Ga0373941_0021021 | |||
| 3261 | Ga0373941_0042002 | |||
| 3262 | Ga0373945_0000777 | |||
| 3263 | Ga0373945_0001428 | |||
| 3264 | Ga0373945_0021379 | |||
| 3265 | Ga0373945_0077652 | |||
| 3266 | Ga0373953_0001671 | |||
| 3267 | Ga0373953_0005830 | |||
| 3268 | Ga0373953_0039509 | |||
| 3269 | Ga0373953_0059627 | |||
| 3270 | Ga0373954_0001529 | |||
| 3271 | Ga0373954_0003918 | |||
| 3272 | Ga0373954_0102689 | |||
| 3273 | Ga0373954_0133876 | |||
| 3274 | Ga0373956_0003195 | |||
| 3275 | Ga0373956_0007244 | |||
| 3276 | Ga0373956_0009272 | |||
| 3277 | Ga0373957_0015185 | |||
| 3278 | Ga0373957_0027588 | |||
| 3279 | Ga0373957_0029065 | |||
| 3280 | Ga0373957_0036106 | |||
| 3281 | Ga0373957_0041093 | |||
| 3282 | Ga0373957_0045754 | |||
| 3283 | Ga0373957_0054452 | |||
| 3284 | Ga0373960_0000084 | |||
| 3285 | Ga0373960_0090397 | |||
| 3286 | Ga0373960_0102997 | |||
| 3287 | Ga0373943_0000284 | |||
| 3288 | Ga0373943_0002532 | |||
| 3289 | Ga0373943_0014380 | |||
| 3290 | Ga0373943_0019966 | |||
| 3291 | Ga0373943_0038607 | |||
| 3292 | Ga0373943_0120226 | |||
| 3293 | Ga0373943_0141050 | |||
| 3294 | Ga0373946_0000695 | |||
| 3295 | Ga0373946_0002959 | |||
| 3296 | Ga0373946_0009548 | |||
| 3297 | Ga0373946_0096209 | |||
| 3298 | Ga0373955_0000939 | |||
| 3299 | Ga0373955_0020961 | |||
| 3300 | Ga0373955_0022592 | |||
| 3301 | Ga0373955_0025875 | |||
| 3302 | Ga0373955_0069900 | |||
| 3303 | Ga0373955_0115527 | |||
| 3304 | Ga0373955_0195555 | |||
| 3305 | Ga0373942_0000345 | |||
| 3306 | Ga0373942_0024473 | |||
| 3307 | Ga0373961_0000298 | |||
| 3308 | Ga0373961_0119758 | |||
| 3309 | Ga0373962_0000490 | |||
| 3310 | Ga0373962_0026721 | |||
| 3311 | Ga0373962_0038087 | |||
| 3312 | Ga0373962_0071855 | |||
| 3313 | Ga0316574_0000211 | |||
| 3314 | Ga0373924_0000420 | |||
| 3315 | Ga0373924_0010729 | |||
| 3316 | Ga0373924_0018992 | |||
| 3317 | Ga0373924_0019629 | |||
| 3318 | Ga0373924_0022643 | |||
| 3319 | Ga0373924_0050885 | |||
| 3320 | Ga0373924_0075188 | |||
| 3321 | Ga0373931_0002660 | |||
| 3322 | Ga0373931_0006309 | |||
| 3323 | Ga0373931_0009404 | |||
| 3324 | Ga0373931_0009501 | |||
| 3325 | Ga0373931_0019643 | |||
| 3326 | Ga0373931_0077504 | |||
| 3327 | Ga0373931_0095815 | |||
| 3328 | Ga0373931_0416183 | |||
| 3329 | Ga0373935_0000068 | |||
| 3330 | Ga0373935_0001340 | |||
| 3331 | Ga0373935_0004603 | |||
| 3332 | Ga0373935_0033167 | |||
| 3333 | Ga0373935_0035234 | |||
| 3334 | Ga0373935_0047368 | |||
| 3335 | Ga0373935_0124991 | |||
| 3336 | Ga0373935_0291884 | |||
| 3337 | Ga0373927_0000892 | |||
| 3338 | Ga0373927_0007778 | |||
| 3339 | Ga0373927_0013606 | |||
| 3340 | Ga0373927_0017506 | |||
| 3341 | Ga0373927_0028055 | |||
| 3342 | Ga0373927_0040077 | |||
| 3343 | Ga0373927_0044599 | |||
| 3344 | Ga0373927_0068542 | |||
| 3345 | Ga0373927_0089508 | |||
| 3346 | Ga0373927_0107455 | |||
| 3347 | Ga0373927_0122064 | |||
| 3348 | Ga0373927_0165875 | |||
| 3349 | Ga0373927_0237513 | |||
| 3350 | Ga0373927_0407104 | |||
| 3351 | Ga0373933_0002505 | |||
| 3352 | Ga0373933_0006990 | |||
| 3353 | Ga0373933_0019730 | |||
| 3354 | Ga0373933_0035338 | |||
| 3355 | Ga0373933_0169074 | |||
| 3356 | Ga0373933_0216853 | |||
| 3357 | Ga0373933_0438419 | |||
| 3358 | Ga0373947_0001171 | |||
| 3359 | Ga0373947_0001272 | |||
| 3360 | Ga0373947_0023230 | |||
| 3361 | Ga0373947_0024918 | |||
| 3362 | Ga0373947_0040448 | |||
| 3363 | Ga0373947_0057180 | |||
| 3364 | Ga0373947_0071540 | |||
| 3365 | Ga0373947_0144980 | |||
| 3366 | Ga0373947_0159507 | |||
| 3367 | Ga0373947_0180941 | |||
| 3368 | Ga0373947_0201741 | |||
| 3369 | Ga0373947_0265333 | |||
| 3370 | Ga0373947_0420068 | |||
| 3371 | Ga0373937_0000347 | |||
| 3372 | Ga0373937_0008050 | |||
| 3373 | Ga0373937_0011304 | |||
| 3374 | Ga0373937_0026143 | |||
| 3375 | Ga0373937_0027513 | |||
| 3376 | Ga0373937_0057623 | |||
| 3377 | Ga0373937_0098779 | |||
| 3378 | Ga0373937_0188576 | |||
| 3379 | Ga0373937_0229258 | |||
| 3380 | Ga0373937_0232213 | |||
| 3381 | Ga0373937_0469428 | |||
| 3382 | Ga0373937_0495646 | |||
| 3383 | Ga0316582_0353427 | |||
| 3384 | Ga0316584_0008194 | |||
| 3385 | Ga0373925_0000081 | |||
| 3386 | Ga0373925_0000653 | |||
| 3387 | Ga0373925_0001023 | |||
| 3388 | Ga0373925_0008272 | |||
| 3389 | Ga0373925_0025054 | |||
| 3390 | Ga0373925_0030678 | |||
| 3391 | Ga0373925_0046325 | |||
| 3392 | Ga0373925_0049791 | |||
| 3393 | Ga0373925_0050717 | |||
| 3394 | Ga0373925_0058583 | |||
| 3395 | Ga0373925_0095524 | |||
| 3396 | Ga0373925_0155767 | |||
| 3397 | Ga0373925_0164207 | |||
| 3398 | Ga0373925_0191875 | |||
| 3399 | Ga0373925_0229783 | |||
| 3400 | Ga0373925_0294800 | |||
| 3401 | Ga0373925_0507200 | |||
| 3402 | Ga0373925_0758593 | |||
| 3403 | Ga0395899_0032551 | |||
| 3404 | Ga0395899_0213489 | |||
| 3405 | Ga0395900_0006665 | |||
| 3406 | Ga0395900_0028654 | |||
| 3407 | Ga0395900_0098941 | |||
| 3408 | Ga0395900_0172509 | |||
| 3409 | Ga0395900_0200420 | |||
| 3410 | Ga0395898_0035860 | |||
| 3411 | Ga0395898_0038265 | |||
| 3412 | Ga0395898_0085008 | |||
| 3413 | Ga0395898_0092455 | |||
| 3414 | Ga0395898_0283432 | |||
| 3415 | Ga0395905_0302093 | |||
| 3416 | Ga0436364_0121626 | |||
| 3417 | Ga0436364_0338040 | |||
| 3418 | Ga0436364_0627969 | |||
| 3419 | Ga0436364_0660984 | |||
| 3420 | Ga0436364_0901640 | |||
| 3421 | Ga0436364_0916700 | |||
| 3422 | Ga0436364_1474445 | |||
| 3423 | Ga0436364_1519170 | |||
| 3424 | Ga0395901_0025427 | |||
| 3425 | Ga0395901_0026822 | |||
| 3426 | Ga0395901_0040513 | |||
| 3427 | Ga0395901_0902692 | |||
| 3428 | Ga0242420_002911 | |||
| 3429 | Ga0436365_0059281 | |||
| 3430 | Ga0436365_0122255 | |||
| 3431 | Ga0436365_0248540 | |||
| 3432 | Ga0436365_1138132 | |||
| 3433 | Ga0436365_1168875 | |||
| 3434 | Ga0436365_1227273 | |||
| 3435 | Ga0436365_1288986 | |||
| 3436 | Ga0436365_1489999 | |||
| 3437 | Ga0436365_1546564 | |||
| 3438 | Ga0436365_1586594 | |||
| 3439 | Ga0436365_1636132 | |||
| 3440 | Ga0436365_1743112 | |||
| 3441 | Ga0436365_1808718 | |||
| 3442 | Ga0436360_0104217 | |||
| 3443 | Ga0436360_0526234 | |||
| 3444 | Ga0436361_0396460 | |||
| 3445 | Ga0436361_0537381 | |||
| 3446 | Ga0436363_1053196 | |||
| 3447 | Ga0436362_0029375 | |||
| 3448 | Ga0436362_0103934 | |||
| 3449 | Ga0436362_0842372 | |||
| 3450 | Ga0451793_1602144 | |||
| 3451 | Ga0451798_0255151 | |||
| 3452 | Ga0451800_0275571 | |||
| 3453 | Ga0439441_046807 | |||
| 3454 | Ga0439443_001105 | |||
| 3455 | Ga0439448_0009804 | |||
| 3456 | Ga0439450_003605 | |||
| 3457 | Ga0439452_038943 | |||
| 3458 | Ga0439455_0077232 | |||
| 3459 | Ga0439456_012957 | |||
| 3460 | Ga0439458_0072824 | |||
| 3461 | Ga0439434_0095338 | |||
| 3462 | Ga0439435_0013920 | |||
| 3463 | Ga0439435_0033029 | |||
| 3464 | Ga0439459_0010364 | |||
| 3465 | Ga0439460_0024666 | |||
| 3466 | Ga0439460_0030144 | |||
| 3467 | Ga0450916_015667 | |||
| 3468 | Ga0450893_0026988 | |||
| 3469 | Ga0466961_0213607 | |||
| 3470 | Ga0466963_0015054 | |||
| 3471 | Ga0466963_0050712 | |||
| 3472 | Ga0466964_0199296 | |||
| 3473 | Ga0453684_0016107 | |||
| 3474 | Ga0466971_0011557 | |||
| 3475 | Ga0466968_0043860 | |||
| 3476 | Ga0466957_0007649 | |||
| 3477 | Ga0466957_0030543 | |||
| 3478 | Ga0466959_0053759 | |||
| 3479 | Ga0466959_0128956 | |||
| 3480 | Ga0451576_0092818 | |||
| 3481 | Ga0451576_0288386 | |||
| 3482 | Ga0466958_0016565 | |||
| 3483 | Ga0466958_0162419 | |||
| 3484 | Ga0466958_0245248 | |||
| 3485 | Ga0466967_0018949 | |||
| 3486 | Ga0466967_0217467 | |||
| 3487 | Ga0466967_0469013 | |||
| 3488 | Ga0495617_050620 | |||
| 3489 | Ga0495617_078054 | |||
| 3490 | Ga0495627_036133 | |||
| 3491 | Ga0495592_0000196 | |||
| 3492 | Ga0495592_0008970 | |||
| 3493 | Ga0495592_0025624 | |||
| 3494 | Ga0495592_0037087 | |||
| 3495 | Ga0495592_0053905 | |||
| 3496 | Ga0495603_0000093 | |||
| 3497 | Ga0495603_0054690 | |||
| 3498 | Ga0495603_0128064 | |||
| 3499 | Ga0495603_0214608 | |||
| 3500 | Ga0495603_0360902 | |||
| 3501 | Ga0495591_057995 | |||
| 3502 | Ga0495629_0001201 | |||
| 3503 | Ga0495629_0010557 | |||
| 3504 | Ga0495629_0012746 | |||
| 3505 | Ga0495629_0027735 | |||
| 3506 | Ga0495629_0059328 | |||
| 3507 | Ga0495629_0064371 | |||
| 3508 | Ga0495629_0086242 | |||
| 3509 | Ga0495629_0225442 | |||
| 3510 | Ga0495638_0012740 | |||
| 3511 | Ga0495638_0021453 | |||
| 3512 | Ga0495641_0020177 | |||
| 3513 | Ga0495641_0021631 | |||
| 3514 | Ga0495641_0114948 | |||
| 3515 | Ga0495641_0223227 | |||
| 3516 | Ga0495651_0002348 | |||
| 3517 | Ga0495651_0002948 | |||
| 3518 | Ga0495651_0005382 | |||
| 3519 | Ga0495651_0021551 | |||
| 3520 | Ga0495651_0042323 | |||
| 3521 | Ga0495651_0083231 | |||
| 3522 | Ga0495651_0094627 | |||
| 3523 | Ga0495651_0171422 | |||
| 3524 | Ga0495653_0000193 | |||
| 3525 | Ga0495653_0009994 | |||
| 3526 | Ga0495653_0019439 | |||
| 3527 | Ga0495653_0035077 | |||
| 3528 | Ga0495653_0057712 | |||
| 3529 | Ga0495653_0097052 | |||
| 3530 | Ga0495653_0227148 | |||
| 3531 | Ga0495653_0400753 | |||
| 3532 | Ga0495580_0007841 | |||
| 3533 | Ga0495580_0010786 | |||
| 3534 | Ga0495580_0096357 | |||
| 3535 | Ga0495582_0005327 | |||
| 3536 | Ga0495582_0152078 | |||
| 3537 | Ga0495582_0190635 | |||
| 3538 | Ga0495582_0282348 | |||
| 3539 | Ga0495582_0415554 | |||
| 3540 | Ga0495605_0156893 | |||
| 3541 | Ga0495639_0005974 | |||
| 3542 | Ga0495639_0011892 | |||
| 3543 | Ga0495639_0044738 | |||
| 3544 | Ga0495639_0059835 | |||
| 3545 | Ga0495639_0074989 | |||
| 3546 | Ga0495639_0131573 | |||
| 3547 | Ga0495662_0002058 | |||
| 3548 | Ga0495662_0015755 | |||
| 3549 | Ga0495662_0018838 | |||
| 3550 | Ga0495662_0038790 | |||
| 3551 | Ga0495662_0220777 | |||
| 3552 | Ga0495664_0000016 | |||
| 3553 | Ga0495664_0008894 | |||
| 3554 | Ga0495664_0027162 | |||
| 3555 | Ga0495664_0031450 | |||
| 3556 | Ga0495664_0109799 | |||
| 3557 | Ga0495664_0121094 | |||
| 3558 | Ga0495584_0015525 | |||
| 3559 | Ga0495584_0028278 | |||
| 3560 | Ga0495584_0200121 | |||
| 3561 | Ga0495585_0000744 | |||
| 3562 | Ga0495594_0000721 | |||
| 3563 | Ga0495594_0087294 | |||
| 3564 | Ga0495607_0004149 | |||
| 3565 | Ga0495607_0136966 | |||
| 3566 | Ga0495607_0210563 | |||
| 3567 | Ga0495608_0000121 | |||
| 3568 | Ga0495608_0000771 | |||
| 3569 | Ga0495608_0014487 | |||
| 3570 | Ga0495608_0040568 | |||
| 3571 | Ga0495608_0112226 | |||
| 3572 | Ga0495608_0113543 | |||
| 3573 | Ga0495616_0016978 | |||
| 3574 | Ga0495618_0000124 | |||
| 3575 | Ga0495618_0005183 | |||
| 3576 | Ga0495618_0017457 | |||
| 3577 | Ga0495618_0018922 | |||
| 3578 | Ga0495618_0042509 | |||
| 3579 | Ga0495618_0055657 | |||
| 3580 | Ga0495620_0172302 | |||
| 3581 | Ga0495628_0000018 | |||
| 3582 | Ga0495628_0000983 | |||
| 3583 | Ga0495628_0009078 | |||
| 3584 | Ga0495628_0027680 | |||
| 3585 | Ga0495628_0036129 | |||
| 3586 | Ga0495628_0130602 | |||
| 3587 | Ga0495628_0258302 | |||
| 3588 | Ga0495628_0514395 | |||
| 3589 | Ga0495630_0003520 | |||
| 3590 | Ga0495630_0017798 | |||
| 3591 | Ga0495630_0024763 | |||
| 3592 | Ga0495630_0077425 | |||
| 3593 | Ga0495630_0085278 | |||
| 3594 | Ga0495630_0160731 | |||
| 3595 | Ga0495630_0276089 | |||
| 3596 | Ga0495630_0278009 | |||
| 3597 | Ga0495630_0289424 | |||
| 3598 | Ga0495630_0341734 | |||
| 3599 | Ga0495637_0037120 | |||
| 3600 | Ga0495643_0196220 | |||
| 3601 | Ga0495644_0001408 | |||
| 3602 | Ga0495644_0167041 | |||
| 3603 | Ga0495663_0117490 | |||
| 3604 | Ga0495666_0042442 | |||
| 3605 | Ga0495666_0043799 | |||
| 3606 | Ga0495652_0000005 | |||
| 3607 | Ga0495652_0002733 | |||
| 3608 | Ga0495652_0051626 | |||
| 3609 | Ga0495652_0058542 | |||
| 3610 | Ga0495652_0066677 | |||
| 3611 | Ga0495652_0089511 | |||
| 3612 | Ga0495652_0106119 | |||
| 3613 | Ga0495652_0125251 | |||
| 3614 | Ga0495652_0141866 | |||
| 3615 | Ga0495652_0190519 | |||
| 3616 | Ga0495652_0286467 | |||
| 3617 | Ga0495652_0342268 | |||
| 3618 | Ga0495665_0009999 | |||
| 3619 | Ga0495665_0058209 | |||
| 3620 | Ga0495665_0118793 | |||
| 3621 | Ga0495665_0134352 | |||
| 3622 | Ga0495665_0146541 | |||
| 3623 | Ga0495665_0309354 | |||
| 3624 | Ga0495640_0000063 | |||
| 3625 | Ga0495640_0006976 | |||
| 3626 | Ga0495640_0008162 | |||
| 3627 | Ga0495640_0020151 | |||
| 3628 | Ga0495640_0026278 | |||
| 3629 | Ga0495640_0028991 | |||
| 3630 | Ga0495640_0073498 | |||
| 3631 | Ga0495640_0084335 | |||
| 3632 | Ga0495640_0111190 | |||
| 3633 | Ga0495640_0225160 | |||
| 3634 | Ga0495640_0282941 | |||
| 3635 | Ga0495586_0013527 | |||
| 3636 | Ga0495586_0193971 | |||
| 3637 | Ga0495587_0000134 | |||
| 3638 | Ga0495587_0001646 | |||
| 3639 | Ga0495587_0002875 | |||
| 3640 | Ga0495587_0029159 | |||
| 3641 | Ga0495587_0039375 | |||
| 3642 | Ga0495587_0039844 | |||
| 3643 | Ga0495587_0078567 | |||
| 3644 | Ga0495598_0003261 | |||
| 3645 | Ga0495598_0051766 | |||
| 3646 | Ga0495598_0095176 | |||
| 3647 | Ga0495609_0093773 | |||
| 3648 | Ga0495609_0198642 | |||
| 3649 | Ga0495645_0000070 | |||
| 3650 | Ga0495645_0000964 | |||
| 3651 | Ga0495645_0010945 | |||
| 3652 | Ga0495645_0032016 | |||
| 3653 | Ga0495645_0101869 | |||
| 3654 | Ga0495645_0169314 | |||
| 3655 | Ga0495622_0000860 | |||
| 3656 | Ga0495622_0046427 | |||
| 3657 | Ga0495633_0001138 | |||
| 3658 | Ga0495667_0000023 | |||
| 3659 | Ga0495667_0001135 | |||
| 3660 | Ga0495667_0001703 | |||
| 3661 | Ga0495667_0012592 | |||
| 3662 | Ga0495667_0013045 | |||
| 3663 | Ga0495667_0033063 | |||
| 3664 | Ga0495667_0045998 | |||
| 3665 | Ga0495667_0077552 | |||
| 3666 | Ga0495667_0353605 | |||
| 3667 | Ga0495656_0000294 | |||
| 3668 | Ga0495656_0031553 | |||
| 3669 | Ga0495668_0109391 | |||
| 3670 | Ga0495634_0001421 | |||
| 3671 | Ga0495634_0010247 | |||
| 3672 | Ga0495634_0010782 | |||
| 3673 | Ga0495634_0021067 | |||
| 3674 | Ga0495634_0081754 | |||
| 3675 | Ga0495634_0098959 | |||
| 3676 | Ga0495634_0253731 | |||
| 3677 | Ga0495611_0023332 | |||
| 3678 | Ga0495611_0075383 | |||
| 3679 | Ga0495635_0000045 | |||
| 3680 | Ga0495635_0012375 | |||
| 3681 | Ga0495635_0013259 | |||
| 3682 | Ga0495635_0015541 | |||
| 3683 | Ga0495635_0025544 | |||
| 3684 | Ga0495635_0086485 | |||
| 3685 | Ga0495635_0153273 | |||
| 3686 | Ga0495659_0000910 | |||
| 3687 | Ga0495659_0007996 | |||
| 3688 | Ga0495659_0028993 | |||
| 3689 | Ga0495659_0051172 | |||
| 3690 | Ga0495661_0142490 | |||
| 3691 | Ga0495661_0268576 | |||
| 3692 | Ga0495588_0015102 | |||
| 3693 | Ga0495588_0035827 | |||
| 3694 | Ga0495657_0001484 | |||
| 3695 | Ga0495657_0009705 | |||
| 3696 | Ga0495657_0020415 | |||
| 3697 | Ga0495657_0061911 | |||
| 3698 | Ga0495657_0357786 | |||
| 3699 | Ga0495599_0000107 | |||
| 3700 | Ga0495599_0004271 | |||
| 3701 | Ga0495599_0012935 | |||
| 3702 | Ga0495599_0140992 | |||
| 3703 | Ga0495599_0172179 | |||
| 3704 | Ga0495599_0249395 | |||
| 3705 | Ga0495599_0253644 | |||
| 3706 | Ga0495623_0001191 | |||
| 3707 | Ga0495623_0007416 | |||
| 3708 | Ga0495623_0008866 | |||
| 3709 | Ga0495623_0014856 | |||
| 3710 | Ga0495623_0055588 | |||
| 3711 | Ga0495646_0000027 | |||
| 3712 | Ga0495646_0032793 | |||
| 3713 | Ga0495646_0037398 | |||
| 3714 | Ga0495646_0047543 | |||
| 3715 | Ga0495647_0011106 | |||
| 3716 | Ga0495647_0120031 | |||
| 3717 | Ga0495647_0221901 | |||
| 3718 | Ga0495658_0011800 | |||
| 3719 | Ga0495658_0041663 | |||
| 3720 | Ga0495658_0051957 | |||
| 3721 | Ga0495658_0069244 | |||
| 3722 | Ga0495658_0166566 | |||
| 3723 | Ga0495669_0029452 | |||
| 3724 | Ga0495669_0050152 | |||
| 3725 | Ga0495613_0001829 | |||
| 3726 | Ga0495613_0001924 | |||
| 3727 | Ga0495613_0006830 | |||
| 3728 | Ga0495613_0090999 | |||
| 3729 | Ga0495613_0138925 | |||
| 3730 | Ga0495613_0146571 | |||
| 3731 | Ga0495613_0163629 | |||
| 3732 | Ga0495624_0003159 | |||
| 3733 | Ga0495624_0039069 | |||
| 3734 | Ga0495624_0115043 | |||
| 3735 | Ga0495624_0188625 | |||
| 3736 | Ga0495624_0394134 | |||
| 3737 | Ga0495670_0002475 | |||
| 3738 | Ga0495670_0134647 | |||
| 3739 | Ga0495671_0055359 | |||
| 3740 | Ga0495671_0300586 | |||
| 3741 | Ga0495600_0000062 | |||
| 3742 | Ga0495600_0007173 | |||
| 3743 | Ga0495600_0011446 | |||
| 3744 | Ga0495600_0022696 | |||
| 3745 | Ga0495600_0063032 | |||
| 3746 | Ga0495600_0170741 | |||
| 3747 | Ga0495600_0337010 | |||
| 3748 | Ga0495581_0001040 | |||
| 3749 | Ga0495581_0024139 | |||
| 3750 | Ga0495581_0038630 | |||
| 3751 | Ga0495581_0046212 | |||
| 3752 | Ga0495581_0079606 | |||
| 3753 | Ga0495581_0138786 | |||
| 3754 | Ga0495604_0000014 | |||
| 3755 | Ga0495604_0002499 | |||
| 3756 | Ga0495604_0053444 | |||
| 3757 | Ga0495604_0055049 | |||
| 3758 | Ga0495604_0078633 | |||
| 3759 | Ga0495604_0080164 | |||
| 3760 | Ga0495604_0099497 | |||
| 3761 | Ga0495674_0000014 | |||
| 3762 | Ga0495674_0016669 | |||
| 3763 | Ga0495674_0023132 | |||
| 3764 | Ga0495674_0049831 | |||
| 3765 | Ga0495674_0049897 | |||
| 3766 | Ga0495674_0057712 | |||
| 3767 | Ga0495674_0059508 | |||
| 3768 | Ga0495674_0216636 | |||
| 3769 | Ga0495674_0356436 | |||
| 3770 | Ga0495674_0357015 | |||
| 3771 | Ga0495674_0361912 | |||
| 3772 | Ga0495672_0065395 | |||
| 3773 | Ga0495672_0164150 | |||
| 3774 | Ga0495676_0046149 | |||
| 3775 | Ga0495676_0080907 | |||
| 3776 | Ga0495676_0084335 | |||
| 3777 | Ga0495676_0153985 | |||
| 3778 | Ga0495676_0190838 | |||
| 3779 | Ga0495680_0002314 | |||
| 3780 | Ga0495680_0005915 | |||
| 3781 | Ga0495680_0009630 | |||
| 3782 | Ga0495680_0014720 | |||
| 3783 | Ga0495680_0035972 | |||
| 3784 | Ga0495680_0054521 | |||
| 3785 | Ga0495680_0059006 | |||
| 3786 | Ga0495680_0181817 | |||
| 3787 | Ga0495680_0247426 | |||
| 3788 | Ga0495675_0000058 | |||
| 3789 | Ga0495675_0002587 | |||
| 3790 | Ga0495675_0017488 | |||
| 3791 | Ga0495675_0049171 | |||
| 3792 | Ga0495675_0081769 | |||
| 3793 | Ga0495675_0237466 | |||
| 3794 | Ga0495677_0108541 | |||
| 3795 | Ga0495685_010080 | |||
| 3796 | Ga0495684_0000059 | |||
| 3797 | Ga0495684_0002058 | |||
| 3798 | Ga0495684_0060169 | |||
| 3799 | Ga0495684_0124863 | |||
| 3800 | Ga0495684_0129220 | |||
| 3801 | Ga0495684_0244855 | |||
| 3802 | Ga0495593_0000892 | |||
| 3803 | Ga0495593_0002389 | |||
| 3804 | Ga0495593_0006746 | |||
| 3805 | Ga0495593_0012827 | |||
| 3806 | Ga0495593_0041503 | |||
| 3807 | Ga0495593_0084739 | |||
| 3808 | Ga0495602_0000017 | |||
| 3809 | Ga0495602_0003589 | |||
| 3810 | Ga0495602_0009345 | |||
| 3811 | Ga0495602_0021745 | |||
| 3812 | Ga0495602_0075453 | |||
| 3813 | Ga0495602_0111881 | |||
| 3814 | Ga0495602_0367535 | |||
| 3815 | Ga0495614_0009570 | |||
| 3816 | Ga0495614_0013572 | |||
| 3817 | Ga0495614_0083069 | |||
| 3818 | Ga0495614_0191860 | |||
| 3819 | Ga0496100_0000919 | |||
| 3820 | Ga0496100_0006499 | |||
| 3821 | Ga0496100_0019742 | |||
| 3822 | Ga0496100_0027242 | |||
| 3823 | Ga0496100_0038257 | |||
| 3824 | Ga0496100_0066987 | |||
| 3825 | Ga0496100_0139605 | |||
| 3826 | Ga0496100_0174481 | |||
| 3827 | Ga0496100_0264740 | |||
| 3828 | Ga0496100_0365725 | |||
| 3829 | Ga0496101_0000569 | |||
| 3830 | Ga0496101_0012497 | |||
| 3831 | Ga0496101_0024358 | |||
| 3832 | Ga0496101_0088947 | |||
| 3833 | Ga0496101_0161752 | |||
| 3834 | Ga0496101_0270579 | |||
| 3835 | Ga0496101_0273467 | |||
| 3836 | Ga0496101_0306739 | |||
| 3837 | Ga0496101_0597260 | |||
| 3838 | Ga0496102_0008204 | |||
| 3839 | Ga0496102_0017532 | |||
| 3840 | Ga0496102_0032540 | |||
| 3841 | Ga0496102_0033436 | |||
| 3842 | Ga0496102_0044888 | |||
| 3843 | Ga0496102_0141274 | |||
| 3844 | Ga0496102_0158894 | |||
| 3845 | Ga0496102_0232147 | |||
| 3846 | Ga0496102_0427547 | |||
| 3847 | Ga0496102_0673704 | |||
| 3848 | Ga0496102_0760608 | |||
| 3849 | Ga0496103_0001432 | |||
| 3850 | Ga0496103_0004579 | |||
| 3851 | Ga0496103_0012887 | |||
| 3852 | Ga0496103_0056458 | |||
| 3853 | Ga0496103_0089717 | |||
| 3854 | Ga0496103_0129074 | |||
| 3855 | Ga0496104_0000239 | |||
| 3856 | Ga0496104_0002113 | |||
| 3857 | Ga0496104_0002280 | |||
| 3858 | Ga0496104_0003037 | |||
| 3859 | Ga0496104_0006583 | |||
| 3860 | Ga0496104_0009456 | |||
| 3861 | Ga0496104_0021769 | |||
| 3862 | Ga0496104_0059203 | |||
| 3863 | Ga0496104_0079916 | |||
| 3864 | Ga0496104_0093981 | |||
| 3865 | Ga0496104_0115058 | |||
| 3866 | Ga0496104_0138130 | |||
| 3867 | Ga0496104_0141028 | |||
| 3868 | Ga0496104_0683279 | |||
| 3869 | Ga0496105_0002071 | |||
| 3870 | Ga0496105_0006702 | |||
| 3871 | Ga0496105_0006961 | |||
| 3872 | Ga0496105_0021912 | |||
| 3873 | Ga0496105_0032767 | |||
| 3874 | Ga0496105_0041467 | |||
| 3875 | Ga0496105_0083517 | |||
| 3876 | Ga0496105_0089019 | |||
| 3877 | Ga0496105_0089523 | |||
| 3878 | Ga0496105_0110435 | |||
| 3879 | Ga0496105_0235798 | |||
| 3880 | Ga0496106_0000491 | |||
| 3881 | Ga0496106_0005632 | |||
| 3882 | Ga0496106_0007949 | |||
| 3883 | Ga0496106_0033580 | |||
| 3884 | Ga0496106_0068253 | |||
| 3885 | Ga0496106_0110672 | |||
| 3886 | Ga0496106_0114853 | |||
| 3887 | Ga0496106_0127117 | |||
| 3888 | Ga0496106_0404935 | |||
| 3889 | Ga0496106_0407312 | |||
| 3890 | Ga0496107_0000327 | |||
| 3891 | Ga0496107_0001121 | |||
| 3892 | Ga0496107_0008877 | |||
| 3893 | Ga0496107_0012293 | |||
| 3894 | Ga0496107_0015183 | |||
| 3895 | Ga0496107_0031442 | |||
| 3896 | Ga0496107_0071203 | |||
| 3897 | Ga0496107_0103484 | |||
| 3898 | Ga0496107_0138410 | |||
| 3899 | Ga0496107_0145816 | |||
| 3900 | Ga0496107_0281241 | |||
| 3901 | Ga0496108_0004390 | |||
| 3902 | Ga0496108_0006898 | |||
| 3903 | Ga0496108_0011233 | |||
| 3904 | Ga0496108_0016572 | |||
| 3905 | Ga0496108_0097238 | |||
| 3906 | Ga0496108_0278723 | |||
| 3907 | Ga0496108_0325528 | |||
| 3908 | Ga0496108_0434532 | |||
| 3909 | Ga0496108_0539560 | |||
| 3910 | Ga0496109_0000925 | |||
| 3911 | Ga0496109_0007037 | |||
| 3912 | Ga0496109_0021125 | |||
| 3913 | Ga0496109_0029032 | |||
| 3914 | Ga0496109_0045546 | |||
| 3915 | Ga0496109_0065028 | |||
| 3916 | Ga0496109_0084279 | |||
| 3917 | Ga0496109_0165837 | |||
| 3918 | Ga0496109_0277551 | |||
| 3919 | Ga0496109_0425101 | |||
| 3920 | Ga0496109_0673353 | |||
| 3921 | Ga0496110_0001215 | |||
| 3922 | Ga0496110_0001775 | |||
| 3923 | Ga0496110_0002587 | |||
| 3924 | Ga0496110_0017600 | |||
| 3925 | Ga0496110_0039582 | |||
| 3926 | Ga0496110_0118444 | |||
| 3927 | Ga0496110_0332263 | |||
| 3928 | Ga0496110_0470355 | |||
| 3929 | Ga0496110_0579877 | |||
| 3930 | Ga0496110_0678163 | |||
| 3931 | Ga0496110_0696273 | |||
| 3932 | Ga0496111_0004183 | |||
| 3933 | Ga0496111_0012152 | |||
| 3934 | Ga0496111_0021771 | |||
| 3935 | Ga0496111_0126663 | |||
| 3936 | Ga0496111_0165119 | |||
| 3937 | Ga0496111_0475177 | |||
| 3938 | Ga0496111_0524209 | |||
| 3939 | Ga0496112_0005890 | |||
| 3940 | Ga0496112_0013125 | |||
| 3941 | Ga0496112_0014646 | |||
| 3942 | Ga0496112_0060529 | |||
| 3943 | Ga0496112_0146319 | |||
| 3944 | Ga0496112_0218273 | |||
| 3945 | Ga0496112_0230093 | |||
| 3946 | Ga0496112_0280006 | |||
| 3947 | Ga0496112_0332097 | |||
| 3948 | Ga0496112_0698260 | |||
| 3949 | Ga0496113_0000285 | |||
| 3950 | Ga0496113_0000465 | |||
| 3951 | Ga0496113_0006001 | |||
| 3952 | Ga0496113_0017270 | |||
| 3953 | Ga0496113_0032574 | |||
| 3954 | Ga0496113_0065939 | |||
| 3955 | Ga0496113_0082796 | |||
| 3956 | Ga0496113_0289967 | |||
| 3957 | Ga0496113_0457702 | |||
| 3958 | Ga0496113_0567031 | |||
| 3959 | Ga0496113_0787461 | |||
| 3960 | Ga0496114_0014271 | |||
| 3961 | Ga0496114_0017597 | |||
| 3962 | Ga0496114_0019622 | |||
| 3963 | Ga0496114_0112527 | |||
| 3964 | Ga0496114_0183954 | |||
| 3965 | Ga0496114_0323705 | |||
| 3966 | Ga0496114_0473044 | |||
| 3967 | Ga0496114_0520262 | |||
| 3968 | Ga0496115_0000673 | |||
| 3969 | Ga0496115_0028117 | |||
| 3970 | Ga0496115_0038417 | |||
| 3971 | Ga0496115_0054936 | |||
| 3972 | Ga0496115_0060964 | |||
| 3973 | Ga0496115_0071316 | |||
| 3974 | Ga0496115_0193911 | |||
| 3975 | Ga0496115_0286675 | |||
| 3976 | Ga0496115_0298007 | |||
| 3977 | Ga0496115_0330680 | |||
| 3978 | Ga0496117_0037784 | |||
| 3979 | Ga0496121_0260581 | |||
| 3980 | Ga0496122_0000074 | |||
| 3981 | Ga0496123_0000062 | |||
| 3982 | Ga0496123_0028666 | |||
| 3983 | Ga0496123_0067278 | |||
| 3984 | Ga0496124_0017561 | |||
| 3985 | Ga0496124_0103122 | |||
| 3986 | Ga0496126_0131026 | |||
| 3987 | Ga0495678_103576 | |||
| 3988 | Ga0501031_0003691 | |||
| 3989 | Ga0501031_0234738 | |||
| 3990 | Ga0501031_0251105 | |||
| 3991 | Ga0501032_0009043 | |||
| 3992 | Ga0501032_0029180 | |||
| 3993 | Ga0501032_0317789 | |||
| 3994 | Ga0501033_0031141 | |||
| 3995 | Ga0501033_0044079 | |||
| 3996 | Ga0501033_0247833 | |||
| 3997 | Ga0501033_0345718 | |||
| 3998 | Ga0501034_0000286 | |||
| 3999 | Ga0501034_0005591 | |||
| 4000 | Ga0501034_0024972 | |||
| 4001 | Ga0501034_0064368 | |||
| 4002 | Ga0501034_0073247 | |||
| 4003 | Ga0501034_0113968 | |||
| 4004 | Ga0501034_0163594 | |||
| 4005 | Ga0501034_0271490 | |||
| 4006 | Ga0501034_0286262 | |||
| 4007 | Ga0501034_0300972 | |||
| 4008 | Ga0501034_0369466 | |||
| 4009 | Ga0501036_0003843 | |||
| 4010 | Ga0501036_0024488 | |||
| 4011 | Ga0501036_0174295 | |||
| 4012 | Ga0501036_0441382 | |||
| 4013 | Ga0501037_0148919 | |||
| 4014 | Ga0501038_0015789 | |||
| 4015 | Ga0501038_0019883 | |||
| 4016 | Ga0501038_0051587 | |||
| 4017 | Ga0501038_0229555 | |||
| 4018 | Ga0501039_0002615 | |||
| 4019 | Ga0501039_0280799 | |||
| 4020 | Ga0501039_0335357 | |||
| 4021 | Ga0501039_0365640 | |||
| 4022 | Ga0501042_0062147 | |||
| 4023 | Ga0501042_0122911 | |||
| 4024 | Ga0501042_0146303 | |||
| 4025 | Ga0501042_0193467 | |||
| 4026 | Ga0501042_0560354 | |||
| 4027 | Ga0501042_0577164 | |||
| 4028 | Ga0501043_0047574 | |||
| 4029 | Ga0501043_0050425 | |||
| 4030 | Ga0501043_0076572 | |||
| 4031 | Ga0501043_0172612 | |||
| 4032 | Ga0501043_0361478 | |||
| 4033 | Ga0501043_0414734 | |||
| 4034 | Ga0501046_0008490 | |||
| 4035 | Ga0501046_0015232 | |||
| 4036 | Ga0501046_0094483 | |||
| 4037 | Ga0501046_0143560 | |||
| 4038 | Ga0501046_0169306 | |||
| 4039 | Ga0501046_0341264 | |||
| 4040 | Ga0501047_0077981 | |||
| 4041 | Ga0501047_0085143 | |||
| 4042 | Ga0501047_0156909 | |||
| 4043 | Ga0501047_0166283 | |||
| 4044 | Ga0501047_0345118 | |||
| 4045 | Ga0501048_0009248 | |||
| 4046 | Ga0501048_0117010 | |||
| 4047 | Ga0501048_0175869 | |||
| 4048 | Ga0501048_0325907 | |||
| 4049 | Ga0501067_0001333 | |||
| 4050 | Ga0501067_0058225 | |||
| 4051 | Ga0501068_0003078 | |||
| 4052 | Ga0501068_0222915 | |||
| 4053 | Ga0501069_0005694 | |||
| 4054 | Ga0501069_0014035 | |||
| 4055 | Ga0501069_0052326 | |||
| 4056 | Ga0501069_0053979 | |||
| 4057 | Ga0501069_0067407 | |||
| 4058 | Ga0501070_0013017 | |||
| 4059 | Ga0501070_0067345 | |||
| 4060 | Ga0501070_0098289 | |||
| 4061 | Ga0501070_0121215 | |||
| 4062 | Ga0501070_0130170 | |||
| 4063 | Ga0501070_0344369 | |||
| 4064 | Ga0501071_0157377 | |||
| 4065 | Ga0501071_0261633 | |||
| 4066 | Ga0501071_0495796 | |||
| 4067 | Ga0501072_0000394 | |||
| 4068 | Ga0501072_0115857 | |||
| 4069 | Ga0501072_0256826 | |||
| 4070 | Ga0501072_0373709 | |||
| 4071 | Ga0501073_0002088 | |||
| 4072 | Ga0501073_0004584 | |||
| 4073 | Ga0501073_0024120 | |||
| 4074 | Ga0501073_0205035 | |||
| 4075 | Ga0501073_0229779 | |||
| 4076 | Ga0501073_0251337 | |||
| 4077 | Ga0501074_0136864 | |||
| 4078 | Ga0501074_0148802 | |||
| 4079 | Ga0501074_0167895 | |||
| 4080 | Ga0501074_0214655 | |||
| 4081 | Ga0501075_0017438 | |||
| 4082 | Ga0501075_0045437 | |||
| 4083 | Ga0501075_0258978 | |||
| 4084 | Ga0501076_0082339 | |||
| 4085 | Ga0501076_0109082 | |||
| 4086 | Ga0501076_0251287 | |||
| 4087 | Ga0501077_0118869 | |||
| 4088 | Ga0501077_0170845 | |||
| 4089 | Ga0501077_0295147 | |||
| 4090 | Ga0501079_0019376 | |||
| 4091 | Ga0501079_0153520 | |||
| 4092 | Ga0501079_0178301 | |||
| 4093 | Ga0501079_0212618 | |||
| 4094 | Ga0501079_0414344 | |||
| 4095 | Ga0501080_0008622 | |||
| 4096 | Ga0501080_0038365 | |||
| 4097 | Ga0501080_0102537 | |||
| 4098 | Ga0501080_0157781 | |||
| 4099 | Ga0501080_0399092 | |||
| 4100 | Ga0501080_0903976 | |||
| 4101 | Ga0501081_0127738 | |||
| 4102 | Ga0501081_0342327 | |||
| 4103 | Ga0501081_0431453 | |||
| 4104 | Ga0501081_0526093 | |||
| 4105 | Ga0501081_0616156 | |||
| 4106 | Ga0501081_0691805 | |||
| 4107 | Ga0501083_0054982 | |||
| 4108 | Ga0501083_0180003 | |||
| 4109 | Ga0501083_0223960 | |||
| 4110 | Ga0501083_0388169 | |||
| 4111 | Ga0501035_0000366 | |||
| 4112 | Ga0501035_0004315 | |||
| 4113 | Ga0501035_0287424 | |||
| 4114 | Ga0501035_0322480 | |||
| 4115 | Ga0501035_0396206 | |||
| 4116 | Ga0501035_0412764 | |||
| 4117 | Ga0501035_0506405 | |||
| 4118 | Ga0501035_0825876 | |||
| 4119 | Ga0501044_0000411 | |||
| 4120 | Ga0501044_0010794 | |||
| 4121 | Ga0501044_0168342 | |||
| 4122 | Ga0501044_0235588 | |||
| 4123 | Ga0501044_0364766 | |||
| 4124 | Ga0501044_0548348 | |||
| 4125 | Ga0501044_0698945 | |||
| 4126 | Ga0501045_0236103 | |||
| 4127 | nmdc:mga03683_50658_c1 | |||
| 4128 | nmdc:mga03n38_27804_c1 | |||
| 4129 | nmdc:mga00v17_180081_c1 | |||
| 4130 | nmdc:mga00v17_20140_c1 | |||
| 4131 | nmdc:mga00v17_28756_c1 | |||
| 4132 | nmdc:mga00v17_407945_c1 | |||
| 4133 | nmdc:mga00v17_90210_c1 | |||
| 4134 | nmdc:mga0yw44_1214_c1 | |||
| 4135 | nmdc:mga0yw44_145695_c1 | |||
| 4136 | nmdc:mga0yw44_18317_c1 | |||
| 4137 | nmdc:mga0yw44_3468_c1 | |||
| 4138 | nmdc:mga0yw44_393180_c1 | |||
| 4139 | nmdc:mga0yw44_417972_c1 | |||
| 4140 | nmdc:mga0k408_20068_c1 | |||
| 4141 | nmdc:mga0k408_237741_c1 | |||
| 4142 | nmdc:mga0k408_33374_c1 | |||
| 4143 | nmdc:mga0k408_3509_c1 | |||
| 4144 | nmdc:mga06z11_109408_c1 | |||
| 4145 | nmdc:mga06z11_25471_c2 | |||
| 4146 | nmdc:mga06z11_44907_c1 | |||
| 4147 | nmdc:mga06z11_6960_c1 | |||
| 4148 | nmdc:mga07m45_129250_c1 | |||
| 4149 | nmdc:mga07m45_14938_c1 | |||
| 4150 | nmdc:mga07m45_35923_c1 | |||
| 4151 | nmdc:mga07m45_42676_c1 | |||
| 4152 | nmdc:mga05p37_105379_c1 | |||
| 4153 | nmdc:mga05p37_285_c1 | |||
| 4154 | nmdc:mga05p37_290_c1 | |||
| 4155 | nmdc:mga05p37_38352_c1 | |||
| 4156 | nmdc:mga05p37_430768_c1 | |||
| 4157 | nmdc:mga05p37_488186_c1 | |||
| 4158 | nmdc:mga05p37_585068_c1 | |||
| 4159 | nmdc:mga09592_168998_c1 | |||
| 4160 | nmdc:mga09592_8025_c1 | |||
| 4161 | nmdc:mga0qj67_139644_c1 | |||
| 4162 | nmdc:mga0qj67_215932_c1 | |||
| 4163 | nmdc:mga0qj67_290975_c1 | |||
| 4164 | nmdc:mga0qj67_347_c1 | |||
| 4165 | nmdc:mga0qj67_527193_c1 | |||
| 4166 | nmdc:mga0qj67_606000_c1 | |||
| 4167 | nmdc:mga0qj67_880_c1 | |||
| 4168 | nmdc:mga06r32_118_c1 | |||
| 4169 | nmdc:mga06r32_267466_c1 | |||
| 4170 | nmdc:mga06r32_352166_c1 | |||
| 4171 | nmdc:mga06r32_374633_c1 | |||
| 4172 | nmdc:mga06r32_649_c1 | |||
| 4173 | nmdc:mga08y16_103693_c1 | |||
| 4174 | nmdc:mga08y16_119854_c1 | |||
| 4175 | nmdc:mga08y16_153738_c1 | |||
| 4176 | nmdc:mga08y16_16589_c1 | |||
| 4177 | nmdc:mga08y16_211704_c1 | |||
| 4178 | nmdc:mga08y16_452689_c1 | |||
| 4179 | nmdc:mga08y16_66189_c1 | |||
| 4180 | nmdc:mga08y16_7099_c1 | |||
| 4181 | nmdc:mga08y16_851_c1 | |||
| 4182 | nmdc:mga08y16_89_c1 | |||
| 4183 | nmdc:mga08y16_98412_c1 | |||
| 4184 | nmdc:mga0n895_104899_c1 | |||
| 4185 | nmdc:mga0n895_157640_c1 | |||
| 4186 | nmdc:mga0n895_173292_c1 | |||
| 4187 | nmdc:mga0n895_196757_c1 | |||
| 4188 | nmdc:mga0n895_309610_c1 | |||
| 4189 | nmdc:mga0n895_369_c1 | |||
| 4190 | nmdc:mga0n895_376459_c1 | |||
| 4191 | nmdc:mga0n895_46361_c1 | |||
| 4192 | nmdc:mga0n895_552_c1 | |||
| 4193 | nmdc:mga0rr50_11023_c1 | |||
| 4194 | nmdc:mga0rr50_137806_c1 | |||
| 4195 | nmdc:mga0rr50_236400_c1 | |||
| 4196 | nmdc:mga0rr50_245951_c1 | |||
| 4197 | nmdc:mga0rr50_469070_c1 | |||
| 4198 | nmdc:mga0rr50_52321_c1 | |||
| 4199 | nmdc:mga0rr50_574_c1 | |||
| 4200 | nmdc:mga0rr50_6149_c1 | |||
| 4201 | nmdc:mga0rr50_798081_c1 | |||
| 4202 | nmdc:mga08x19_154993_c1 | |||
| 4203 | nmdc:mga08x19_307807_c1 | |||
| 4204 | nmdc:mga08x19_9501_c1 | |||
| 4205 | nmdc:mga0a205_1059_c1 | |||
| 4206 | nmdc:mga0a205_124111_c1 | |||
| 4207 | nmdc:mga0a205_148593_c1 | |||
| 4208 | nmdc:mga0a205_21310_c1 | |||
| 4209 | nmdc:mga0a205_251366_c1 | |||
| 4210 | nmdc:mga0a205_2568_c1 | |||
| 4211 | nmdc:mga0a205_26046_c1 | |||
| 4212 | nmdc:mga0a205_298175_c1 | |||
| 4213 | nmdc:mga0a205_353181_c1 | |||
| 4214 | nmdc:mga0sz30_144168_c1 | |||
| 4215 | Ga0495601_0000016 | |||
| 4216 | Ga0495601_0000205 | |||
| 4217 | Ga0495601_0001742 | |||
| 4218 | Ga0495601_0001966 | |||
| 4219 | Ga0495601_0003031 | |||
| 4220 | Ga0495601_0004702 | |||
| 4221 | Ga0495601_0005657 | |||
| 4222 | Ga0495601_0006040 | |||
| 4223 | Ga0495601_0036612 | |||
| 4224 | Ga0495601_0050863 | |||
| 4225 | Ga0495601_0052938 | |||
| 4226 | Ga0495601_0057737 | |||
| 4227 | Ga0495601_0064935 | |||
| 4228 | Ga0495601_0071850 | |||
| 4229 | Ga0495612_0000041 | |||
| 4230 | Ga0495612_0000896 | |||
| 4231 | Ga0495612_0003681 | |||
| 4232 | Ga0495612_0004543 | |||
| 4233 | Ga0495612_0012951 | |||
| 4234 | Ga0495612_0014629 | |||
| 4235 | Ga0495612_0026997 | |||
| 4236 | Ga0495612_0027352 | |||
| 4237 | Ga0495612_0050413 | |||
| 4238 | Ga0495612_0062696 | |||
| 4239 | Ga0495612_0110598 | |||
| 4240 | Ga0500610_0115490 | |||
| 4241 | Ga0495655_0000378 | |||
| 4242 | Ga0495655_0019851 | |||
| 4243 | Ga0495595_0000161 | |||
| 4244 | Ga0495595_0001105 | |||
| 4245 | Ga0495595_0001119 | |||
| 4246 | Ga0495595_0004084 | |||
| 4247 | Ga0495595_0006277 | |||
| 4248 | Ga0495595_0011917 | |||
| 4249 | Ga0495595_0014655 | |||
| 4250 | Ga0495595_0185538 | |||
| 4251 | Ga0495595_0189050 | |||
| 4252 | Ga0495619_0000050 | |||
| 4253 | Ga0495619_0000139 | |||
| 4254 | Ga0495619_0000957 | |||
| 4255 | Ga0495619_0003087 | |||
| 4256 | Ga0495619_0003733 | |||
| 4257 | Ga0495619_0007273 | |||
| 4258 | Ga0495619_0008115 | |||
| 4259 | Ga0495619_0009272 | |||
| 4260 | Ga0495619_0021121 | |||
| 4261 | Ga0495619_0034965 | |||
| 4262 | Ga0495619_0053482 | |||
| 4263 | Ga0495619_0074099 | |||
| 4264 | Ga0495619_0075261 | |||
| 4265 | Ga0495619_0078936 | |||
| 4266 | Ga0495619_0093382 | |||
| 4267 | Ga0495619_0105009 | |||
| 4268 | Ga0495619_0143877 | |||
| 4269 | Ga0495619_0175462 | |||
| 4270 | Ga0495619_0296555 | |||
| 4271 | Ga0495619_0355856 | |||
| 4272 | Ga0500643_025908 | |||
| 4273 | Ga0500644_0000839 | |||
| 4274 | Ga0500646_0021421 | |||
| 4275 | Ga0500651_0036353 | |||
| 4276 | Ga0500651_0256398 | |||
| 4277 | Ga0500566_0170404 | |||
| 4278 | Ga0500641_0000457 | |||
| 4279 | Ga0500641_0013326 | |||
| 4280 | Ga0500641_0013957 | |||
| 4281 | Ga0500641_0016990 | |||
| 4282 | Ga0500641_0078607 | |||
| 4283 | Ga0500654_042304 | |||
| 4284 | Ga0500557_072589 | |||
| 4285 | Ga0500562_033612 | |||
| 4286 | Ga0500562_035649 | |||
| 4287 | Ga0500593_016699 | |||
| 4288 | Ga0500595_000001 | |||
| 4289 | Ga0500595_021247 | |||
| 4290 | Ga0500595_035998 | |||
| 4291 | Ga0500608_143136 | |||
| 4292 | Ga0500618_017858 | |||
| 4293 | Ga0500618_029346 | |||
| 4294 | Ga0500642_0002438 | |||
| 4295 | Ga0500642_0259228 | |||
| 4296 | Ga0500652_000069 | |||
| 4297 | Ga0500652_003823 | |||
| 4298 | Ga0500652_075254 | |||
| 4299 | Ga0500658_0035326 | |||
| 4300 | Ga0500616_0000001 | |||
| 4301 | Ga0500616_0012716 | |||
| 4302 | Ga0500616_0016192 | |||
| 4303 | Ga0500616_0037804 | |||
| 4304 | Ga0500616_0068585 | |||
| 4305 | Ga0500622_0001259 | |||
| 4306 | Ga0500627_0154463 | |||
| 4307 | Ga0500636_0014182 | |||
| 4308 | Ga0500636_0020014 | |||
| 4309 | Ga0500611_016270 | |||
| 4310 | Ga0500657_126448 | |||
| 4311 | Ga0500645_000418 | |||
| 4312 | Ga0500552_027558 | |||
| 4313 | Ga0501084_0023301 | |||
| 4314 | Ga0501084_0044229 | |||
| 4315 | Ga0501084_0077505 | |||
| 4316 | Ga0501084_0325438 | |||
| 4317 | Ga0501084_0398433 | |||
| 4318 | Ga0501084_0619231 | |||
| 4319 | Ga0501082_0013821 | |||
| 4320 | Ga0501082_0085747 | |||
| 4321 | Ga0501082_0112796 | |||
| 4322 | Ga0501082_0219481 | |||
| 4323 | Ga0501082_0286855 | |||
| 4324 | Ga0501082_0782765 | |||
| 4325 | Ga0466962_0049979 | |||
| 4326 | Ga0530510_0022504 | |||
| 4327 | Ga0530510_0053232 | |||
| 4328 | Ga0530510_0399907 | |||
| 4329 | Ga0530510_0444126 | |||
| 4330 | 2585997793 | |||
| 4331 | 2586002379 | |||
| 4332 | 2599720347 | |||
| 4333 | 2644730983 | |||
| 4334 | 2819722241 | |||
| 4335 | 2821128736 | |||
| 4336 | 2838741752 | |||
| 4337 | 2841845414 | |||
| 4338 | 2842145117 | |||
| 4339 | 2854919494 | |||
| 4340 | 2857534111 | |||
| 4341 | 2919175773 | |||
| 4342 | 641335761 | |||
| 4343 | 8054564098 | |||
| 4344 | 8056878208 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m0s-assembly1.cif.gz_B | n-terminal domain of pmra from acinetobacter baumannii | 0.9748 | 5 | 123 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9746 | 5 | 123 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9744 | 5 | 123 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9724 | 5 | 123 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.969 | 5 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9768 | 6 | 82 | 3.40.50.2300 |
| af_Q06065_2_134_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9762 | 5 | 125 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9742 | 5 | 84 | 3.40.50.2300 |
| af_Q2FWH6_1_124_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9682 | 3 | 123 | 3.40.50.2300 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9678 | 5 | 84 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A448V449-F1-model_v4 | Transcriptional regulatory protein AfsQ1 | 0.9911 | 5 | 123 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A6L8GBT5-F1-model_v4 | Response regulator transcription factor | 0.9852 | 2 | 128 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A5P9JUZ0-F1-model_v4 | Response regulator | 0.9649 | 1 | 228 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A6L8GBT5-F1-model_v4 | Response regulator transcription factor | 0.9627 | 2 | 128 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A3A4NWN5-F1-model_v4 | Sigma-54-dependent Fis family transcriptional regulator | 0.949 | 1 | 125 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 GO:0043565 |