F496509

General Info

Members Datasets Scaffolds Average Seq Length
2174 591 4344 229

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0091635|Ga0530510_0091635_455_1261
Length 268
Sequence MLYFARRAGPGSAESLPDRAGMGKSGVIGLCKAVPVQDREMTNTRKILIVDXXXELRAALVEQLALHEEFESVAVENGTKGVQAARAGQIDLVIMDVGLPDVDGREAVRILRKNGFKAPIIMLTGHDTDSDTILGLESGANDYVTKPFRFAVLLARIRAQLRQHEASEDAVFSIGPYTFRPSSKILLNPKGNKVRLTEKETAILRYLYRAGQRPVTRETLLQEVWGYNSGVTTHTLETHIYRLRQKVEKDAASPSILVTEAGGYKLVP

Samples

Sample ID Description Type Environment
1 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
10 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
11 3300001224 Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_1 Metagenome Rhizosphere
12 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
15 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
19 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
20 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
21 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
22 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
23 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
24 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
25 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
26 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
27 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
28 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
29 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
30 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
39 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
71 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
75 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
76 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
77 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
78 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
79 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
80 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
84 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
87 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
88 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
89 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
90 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
91 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
92 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
93 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
94 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
97 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
98 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
99 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
100 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
101 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
102 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
111 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
112 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
113 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
114 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
115 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
116 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
117 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
118 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
119 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
120 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
121 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
122 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
123 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
124 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
125 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
126 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
127 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
128 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
129 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
130 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
131 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
132 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
133 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
134 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
135 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
136 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
137 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
139 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
140 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
141 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
142 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
143 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
144 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
145 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
146 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
147 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
148 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
149 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
150 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
151 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
152 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
153 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
154 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
155 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
156 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
157 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
158 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
159 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
160 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
161 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
162 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
163 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
164 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
165 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
166 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
167 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
168 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
169 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
170 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
171 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
172 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
173 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
174 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
175 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
176 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
177 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
178 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
179 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
180 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
181 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
182 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
183 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
184 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
185 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
186 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
187 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
188 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
189 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
191 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
192 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
193 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
194 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
195 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
197 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
199 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
271 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
282 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
286 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
287 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
288 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
289 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
293 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
294 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
295 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
296 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
297 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
298 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
299 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
300 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
301 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
302 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
303 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
304 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
305 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
306 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
307 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
308 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
309 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
310 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
311 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
312 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
313 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
314 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
315 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
316 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
317 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
318 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
319 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
320 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
321 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
322 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
323 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
324 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
325 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
326 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
327 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
328 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
329 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
330 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
331 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
332 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
333 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
334 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
335 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
336 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
337 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
338 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
339 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
340 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
341 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
342 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
343 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
344 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
345 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
346 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
347 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
348 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
349 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
350 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
351 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
352 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
353 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
354 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
355 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
356 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
357 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
358 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
359 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
360 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
361 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
362 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
363 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
364 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
365 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
366 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
367 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
368 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
369 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
370 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
371 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
372 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
373 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
374 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
375 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
376 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
377 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
378 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
379 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
380 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
381 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
382 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
383 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
384 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
385 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
386 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
387 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
388 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
389 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
390 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
391 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
392 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
393 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
394 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
395 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
396 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
397 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
398 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
399 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
400 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
401 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
402 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
403 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
404 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
405 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
406 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
407 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
408 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
409 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
410 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
411 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
412 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
413 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
414 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
415 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
416 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
417 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
418 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
419 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
420 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
421 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
422 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
423 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
424 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
425 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
426 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
427 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
428 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
429 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
430 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
431 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
432 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
433 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
434 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
435 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
436 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
437 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
438 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
439 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
440 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
441 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
442 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
443 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
444 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
445 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
446 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
447 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
448 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
449 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
450 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
451 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
452 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
453 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
454 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
455 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
456 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
457 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
458 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
459 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
460 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
461 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
462 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
463 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
464 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
465 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
466 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
467 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
468 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
469 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
470 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
471 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
472 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
473 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
474 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
475 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
476 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
477 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
478 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
479 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
480 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
481 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
482 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
483 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
484 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
485 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
486 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
487 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
488 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
489 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
490 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
491 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
492 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
493 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
494 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
495 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
496 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
497 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
499 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
501 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
502 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
503 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
505 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
509 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
510 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
511 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
512 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
513 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
514 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
515 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
516 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
517 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
518 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
519 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
520 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
521 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
522 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
523 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
524 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
526 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
527 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
528 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
529 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
530 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
531 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
532 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
533 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
534 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
535 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
536 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
537 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
538 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
539 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
540 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
541 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
542 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
543 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
544 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
545 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
546 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
547 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
548 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
549 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
550 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
551 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
552 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
553 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
554 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
555 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
556 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
557 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
558 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
559 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
560 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
561 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
562 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
563 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
564 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
565 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
566 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
567 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
568 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
569 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
570 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
571 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
572 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
573 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
574 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
575 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
576 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
577 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
578 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
579 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
580 2643221733 Bosea sp. Root381 Isolate Unclassified
581 2818991467 Bosea vestrisii 3192 Isolate Unclassified
582 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
583 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
584 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
585 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
586 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
587 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
588 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
589 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
590 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
591 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.23
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.29
Nodule 0.37
Rhizoplane 7.5
Rhizosphere 84.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0530510_0091635 3300061734 Bacteria 2218
2 SwRhRL2b_contig_103294 2162886007 Bacteria 4113
3 2214828525 2209111006 Bacteria 9988
4 ARcpr5oldR_c000051 3300000041 Bacteria 21598
5 ARSoilYngRDRAFT_c00005 3300000042 Bacteria 35497
6 ARcpr5yngRDRAFT_c000005 3300000043 Bacteria 45740
7 ARSoilOldRDRAFT_c000003 3300000044 Bacteria 63923
8 ARCol0oldRDRAFT_c00049 3300000045 Bacteria 9332
9 CNBas_1002440 3300000531 Bacteria 1025
10 ARCol0yngRDRAFT_1000007 3300000652 Bacteria 46089
11 SwM_106758 3300001224 Bacteria 828
12 JGI24032J14994_100411 3300001430 Bacteria 2245
13 JGI24741J21665_1003075 3300001915 Bacteria 4102
14 JGI24752J21851_1002865 3300001976 Bacteria 2288
15 JGI24752J21851_1003059 3300001976 Bacteria 2213
16 JGI24746J21847_1000487 3300001977 Bacteria 5944
17 JGI24746J21847_1005435 3300001977 Bacteria 1987
18 JGI24739J22299_10000027 3300001989 Bacteria 42306
19 JGI24739J22299_10047696 3300001989 Bacteria 1396
20 JGI24739J22299_10081951 3300001989 Bacteria 990
21 JGI24737J22298_10006724 3300001990 Bacteria 3912
22 JGI24737J22298_10008091 3300001990 Bacteria 3533
23 JGI24743J22301_10001138 3300001991 Bacteria 3570
24 JGI24743J22301_10008358 3300001991 Bacteria 1815
25 JGI24750J21931_1000003 3300002070 Bacteria 26303
26 JGI24745J21846_1000027 3300002073 Bacteria 9524
27 JGI24745J21846_1006416 3300002073 Bacteria 1305
28 JGI24748J21848_1000421 3300002074 Bacteria 4723
29 JGI24738J21930_10000032 3300002075 Bacteria 26331
30 JGI24749J21850_1000320 3300002076 Bacteria 7353
31 JGI24749J21850_1004740 3300002076 Bacteria 1905
32 JGI24749J21850_1008927 3300002076 Bacteria 1400
33 JGI24744J21845_10001709 3300002077 Bacteria 4402
34 JGI24035J26624_1000017 3300002126 Bacteria 12601
35 JGI24033J26618_1000528 3300002155 Bacteria 3715
36 JGI24033J26618_1006673 3300002155 Bacteria 1300
37 JGI24034J26672_10002708 3300002239 Bacteria 2441
38 JGI24034J26672_10004055 3300002239 Bacteria 2064
39 JGI24034J26672_10004686 3300002239 Bacteria 1945
40 JGI24742J22300_10000479 3300002244 Bacteria 5952
41 JGI24742J22300_10006180 3300002244 Bacteria 1975
42 JGI24742J22300_10014308 3300002244 Bacteria 1333
43 JGI24751J29686_10002694 3300002459 Bacteria 3578
44 JGI24751J29686_10007181 3300002459 Bacteria 2276
45 JGI25406J46586_10044912 3300003203 Bacteria 1526
46 JGI25153J46596_10026532 3300003215 Bacteria 2048
47 JGI25404J52841_10020892 3300003659 Bacteria 1417
48 Ga0055524_1026287 3300003775 Bacteria 1803
49 Ga0055536_1001690 3300003781 Bacteria 13057
50 Ga0055540_1009128 3300003792 Bacteria 3471
51 Ga0055531_10006983 3300003794 Bacteria 6271
52 JGI25405J52794_10002320 3300003911 Bacteria 3268
53 JGI25405J52794_10008886 3300003911 Bacteria 1886
54 Ga0065717_1001936 3300005276 Bacteria 9530
55 Ga0065716_1001733 3300005277 Bacteria 3727
56 Ga0065704_10071648 3300005289 Bacteria 10386
57 Ga0065712_10069491 3300005290 Bacteria 7192
58 Ga0065712_10069860 3300005290 Bacteria 6603
59 Ga0065712_10071460 3300005290 Bacteria 5250
60 Ga0065715_10002372 3300005293 Bacteria 8813
61 Ga0065715_10089909 3300005293 Bacteria 8156
62 Ga0065707_10089899 3300005295 Bacteria 4256
63 Ga0065707_10237060 3300005295 Bacteria 1169
64 Ga0070658_10060574 3300005327 Bacteria 3083
65 Ga0070658_10112610 3300005327 Bacteria 2255
66 Ga0070676_10001346 3300005328 Bacteria 12342
67 Ga0070676_10064265 3300005328 Bacteria 2188
68 Ga0070676_10172931 3300005328 Bacteria 1399
69 Ga0070676_10188218 3300005328 Bacteria 1346
70 Ga0070676_10215012 3300005328 Bacteria 1267
71 Ga0070683_100002452 3300005329 Bacteria 14754
72 Ga0070683_100396768 3300005329 Bacteria 1315
73 Ga0070690_100006735 3300005330 Bacteria 6528
74 Ga0070690_100038138 3300005330 Bacteria 3030
75 Ga0070690_100038458 3300005330 Bacteria 3020
76 Ga0070690_100056679 3300005330 Bacteria 2513
77 Ga0070690_100082686 3300005330 Bacteria 2102
78 Ga0070690_100325641 3300005330 Bacteria 1109
79 Ga0070690_100427276 3300005330 Bacteria 978
80 Ga0070690_100550881 3300005330 Bacteria 869
81 Ga0070670_100019209 3300005331 Bacteria 5860
82 Ga0070670_100020107 3300005331 Bacteria 5735
83 Ga0070670_100035824 3300005331 Bacteria 4272
84 Ga0070670_100037375 3300005331 Bacteria 4178
85 Ga0070677_10000240 3300005333 Bacteria 19034
86 Ga0068869_100000013 3300005334 Bacteria 73970
87 Ga0070666_10014037 3300005335 Bacteria 5094
88 Ga0070666_10146036 3300005335 Bacteria 1648
89 Ga0070680_100001807 3300005336 Bacteria 15715
90 Ga0070680_100015245 3300005336 Bacteria 6022
91 Ga0070680_100022501 3300005336 Bacteria 5021
92 Ga0070680_100091598 3300005336 Bacteria 2516
93 Ga0070680_100267422 3300005336 Bacteria 1447
94 Ga0070680_100484131 3300005336 Bacteria 1058
95 Ga0070682_100000611 3300005337 Bacteria 21716
96 Ga0070682_100066793 3300005337 Bacteria 2289
97 Ga0070682_100121945 3300005337 Bacteria 1752
98 Ga0070682_100191438 3300005337 Bacteria 1436
99 Ga0070682_100192842 3300005337 Bacteria 1432
100 Ga0068868_100010701 3300005338 Bacteria 6650
101 Ga0068868_100018781 3300005338 Bacteria 5171
102 Ga0068868_100050631 3300005338 Bacteria 3263
103 Ga0068868_100428396 3300005338 Bacteria 1147
104 Ga0070660_100000554 3300005339 Bacteria 25071
105 Ga0070660_100013100 3300005339 Bacteria 5938
106 Ga0070660_100023479 3300005339 Bacteria 4568
107 Ga0070660_100137260 3300005339 Bacteria 1960
108 Ga0070660_100355120 3300005339 Bacteria 1208
109 Ga0070660_100441865 3300005339 Bacteria 1078
110 Ga0070689_100005543 3300005340 Bacteria 8632
111 Ga0070689_100007858 3300005340 Bacteria 7478
112 Ga0070689_100014756 3300005340 Bacteria 5684
113 Ga0070689_100037914 3300005340 Bacteria 3686
114 Ga0070689_100059973 3300005340 Bacteria 2957
115 Ga0070691_10000093 3300005341 Bacteria 25708
116 Ga0070691_10012176 3300005341 Bacteria 3939
117 Ga0070691_10025049 3300005341 Bacteria 2776
118 Ga0070691_10026914 3300005341 Bacteria 2682
119 Ga0070687_100000097 3300005343 Bacteria 28900
120 Ga0070687_100014202 3300005343 Bacteria 3572
121 Ga0070687_100064527 3300005343 Bacteria 1946
122 Ga0070687_100071834 3300005343 Bacteria 1861
123 Ga0070687_100267592 3300005343 Bacteria 1070
124 Ga0070661_100000228 3300005344 Bacteria 46622
125 Ga0070661_100056368 3300005344 Bacteria 2879
126 Ga0070661_100443636 3300005344 Bacteria 1032
127 Ga0070692_10052614 3300005345 Bacteria 2121
128 Ga0070668_100004073 3300005347 Bacteria 10828
129 Ga0070668_100047757 3300005347 Bacteria 3291
130 Ga0070668_100072567 3300005347 Bacteria 2682
131 Ga0070668_100155362 3300005347 Bacteria 1853
132 Ga0070669_100000368 3300005353 Bacteria 34899
133 Ga0070669_100079252 3300005353 Bacteria 2442
134 Ga0070675_100000752 3300005354 Bacteria 22581
135 Ga0070675_100008586 3300005354 Bacteria 7931
136 Ga0070675_100149971 3300005354 Bacteria 1999
137 Ga0070675_100272096 3300005354 Bacteria 1487
138 Ga0070675_100342940 3300005354 Bacteria 1323
139 Ga0070671_100000142 3300005355 Bacteria 46386
140 Ga0070671_100010354 3300005355 Bacteria 7480
141 Ga0070671_100011531 3300005355 Bacteria 7107
142 Ga0070671_100071428 3300005355 Bacteria 2897
143 Ga0070671_100095786 3300005355 Bacteria 2488
144 Ga0070671_100099630 3300005355 Bacteria 2437
145 Ga0070674_100090668 3300005356 Bacteria 2205
146 Ga0070673_100007057 3300005364 Bacteria 7369
147 Ga0070673_100142110 3300005364 Bacteria 2026
148 Ga0070673_100151560 3300005364 Bacteria 1964
149 Ga0070673_100269417 3300005364 Bacteria 1490
150 Ga0070673_100435297 3300005364 Bacteria 1178
151 Ga0070688_100020344 3300005365 Bacteria 3857
152 Ga0070688_100056806 3300005365 Bacteria 2459
153 Ga0070688_100107996 3300005365 Bacteria 1846
154 Ga0070659_100000183 3300005366 Bacteria 47789
155 Ga0070659_100025219 3300005366 Bacteria 4563
156 Ga0070659_100054734 3300005366 Bacteria 3143
157 Ga0070659_100094213 3300005366 Bacteria 2404
158 Ga0070659_100390899 3300005366 Bacteria 1173
159 Ga0070667_100005458 3300005367 Bacteria 10620
160 Ga0070667_100074773 3300005367 Bacteria 2891
161 Ga0070703_10014438 3300005406 Bacteria 2250
162 Ga0070709_10014058 3300005434 Bacteria 4518
163 Ga0070709_10053514 3300005434 Bacteria 2542
164 Ga0070709_10088689 3300005434 Bacteria 2035
165 Ga0070714_100108241 3300005435 Bacteria 2457
166 Ga0070714_100356557 3300005435 Bacteria 1374
167 Ga0070714_100567442 3300005435 Bacteria 1088
168 Ga0070713_100026299 3300005436 Bacteria 4566
169 Ga0070713_100051151 3300005436 Bacteria 3416
170 Ga0070713_100103256 3300005436 Bacteria 2473
171 Ga0070713_100117558 3300005436 Bacteria 2327
172 Ga0070713_100126719 3300005436 Bacteria 2247
173 Ga0070713_100128660 3300005436 Bacteria 2231
174 Ga0070713_100153972 3300005436 Bacteria 2047
175 Ga0070713_100250349 3300005436 Bacteria 1616
176 Ga0070710_10021492 3300005437 Bacteria 3364
177 Ga0070710_10035682 3300005437 Bacteria 2713
178 Ga0070710_10096932 3300005437 Bacteria 1749
179 Ga0070710_10218412 3300005437 Bacteria 1212
180 Ga0070710_10259224 3300005437 Bacteria 1120
181 Ga0070701_10000008 3300005438 Bacteria 53317
182 Ga0070701_10049861 3300005438 Bacteria 2166
183 Ga0070701_10061601 3300005438 Bacteria 1979
184 Ga0070711_100003097 3300005439 Bacteria 9618
185 Ga0070711_100026562 3300005439 Bacteria 3794
186 Ga0070711_100029559 3300005439 Bacteria 3617
187 Ga0070711_100033924 3300005439 Bacteria 3401
188 Ga0070711_100062238 3300005439 Bacteria 2601
189 Ga0070711_100069294 3300005439 Bacteria 2481
190 Ga0070711_100124194 3300005439 Bacteria 1914
191 Ga0070711_100187201 3300005439 Bacteria 1588
192 Ga0070705_100074101 3300005440 Bacteria 2068
193 Ga0070700_100001950 3300005441 Bacteria 10465
194 Ga0070700_100005827 3300005441 Bacteria 6539
195 Ga0070700_100008830 3300005441 Bacteria 5507
196 Ga0070700_100045582 3300005441 Bacteria 2705
197 Ga0070700_100276060 3300005441 Bacteria 1216
198 Ga0070700_100667213 3300005441 Bacteria 823
199 Ga0070694_100001186 3300005444 Bacteria 14984
200 Ga0070694_100080518 3300005444 Bacteria 2263
201 Ga0070694_100089169 3300005444 Bacteria 2161
202 Ga0070708_100099590 3300005445 Bacteria 2659
203 Ga0070708_100100031 3300005445 Bacteria 2653
204 Ga0070708_100239063 3300005445 Bacteria 1705
205 Ga0070708_100251856 3300005445 Bacteria 1659
206 Ga0070708_100283793 3300005445 Bacteria 1558
207 Ga0070708_100353560 3300005445 Bacteria 1385
208 Ga0070708_100645067 3300005445 Bacteria 998
209 Ga0070663_100000385 3300005455 Bacteria 23230
210 Ga0070663_100036093 3300005455 Bacteria 3433
211 Ga0070678_100001994 3300005456 Bacteria 11025
212 Ga0070678_100012171 3300005456 Bacteria 5337
213 Ga0070678_100215214 3300005456 Bacteria 1594
214 Ga0070678_100271298 3300005456 Bacteria 1431
215 Ga0070662_100003682 3300005457 Bacteria 9580
216 Ga0070662_100009811 3300005457 Bacteria 6272
217 Ga0070662_100010178 3300005457 Bacteria 6165
218 Ga0070662_100059826 3300005457 Bacteria 2776
219 Ga0070662_100129850 3300005457 Bacteria 1941
220 Ga0070681_10008332 3300005458 Bacteria 10153
221 Ga0070681_10047059 3300005458 Bacteria 4311
222 Ga0070681_10145682 3300005458 Bacteria 2297
223 Ga0070681_10217724 3300005458 Bacteria 1825
224 Ga0070681_10252174 3300005458 Bacteria 1677
225 Ga0068867_100000160 3300005459 Bacteria 43656
226 Ga0070685_10128882 3300005466 Bacteria 1580
227 Ga0070685_10321057 3300005466 Bacteria 1049
228 Ga0070706_100040915 3300005467 Bacteria 4279
229 Ga0070706_100526234 3300005467 Bacteria 1100
230 Ga0070706_100556637 3300005467 Bacteria 1067
231 Ga0070707_100219196 3300005468 Bacteria 1853
232 Ga0070707_100522148 3300005468 Bacteria 1149
233 Ga0070698_100722378 3300005471 Bacteria 939
234 Ga0074259_10011108 3300005507 Bacteria 1266
235 Ga0070699_100065122 3300005518 Bacteria 3162
236 Ga0070699_100552794 3300005518 Bacteria 1048
237 Ga0070679_100017517 3300005530 Bacteria 6935
238 Ga0070679_100048351 3300005530 Bacteria 4238
239 Ga0070679_100077883 3300005530 Bacteria 3304
240 Ga0070679_100104854 3300005530 Bacteria 2813
241 Ga0070679_100115052 3300005530 Bacteria 2675
242 Ga0070679_100156421 3300005530 Bacteria 2254
243 Ga0070679_100276899 3300005530 Bacteria 1631
244 Ga0070679_100407853 3300005530 Bacteria 1304
245 Ga0070679_100523416 3300005530 Bacteria 1130
246 Ga0070684_100004278 3300005535 Bacteria 10824
247 Ga0070684_100256293 3300005535 Bacteria 1600
248 Ga0070697_100210394 3300005536 Bacteria 1655
249 Ga0070697_100401129 3300005536 Bacteria 1190
250 Ga0070697_100403873 3300005536 Bacteria 1186
251 Ga0068853_100017859 3300005539 Bacteria 5860
252 Ga0068853_100065138 3300005539 Bacteria 3162
253 Ga0068853_100258612 3300005539 Bacteria 1600
254 Ga0068853_100614488 3300005539 Bacteria 1033
255 Ga0070672_100000348 3300005543 Bacteria 26680
256 Ga0070672_100009899 3300005543 Bacteria 6591
257 Ga0070672_100127133 3300005543 Bacteria 2091
258 Ga0070686_100000688 3300005544 Bacteria 19665
259 Ga0070686_100056657 3300005544 Bacteria 2514
260 Ga0070686_100066046 3300005544 Bacteria 2351
261 Ga0070695_100008662 3300005545 Bacteria 6045
262 Ga0070695_100018808 3300005545 Bacteria 4199
263 Ga0070695_100196585 3300005545 Bacteria 1438
264 Ga0070696_100007141 3300005546 Bacteria 7460
265 Ga0070696_100047322 3300005546 Bacteria 2984
266 Ga0070696_100134936 3300005546 Bacteria 1799
267 Ga0070696_100373843 3300005546 Bacteria 1109
268 Ga0070693_100001722 3300005547 Bacteria 9947
269 Ga0070693_100043419 3300005547 Bacteria 2539
270 Ga0070693_100049011 3300005547 Bacteria 2408
271 Ga0070693_100167687 3300005547 Bacteria 1404
272 Ga0070665_100023397 3300005548 Bacteria 6219
273 Ga0070665_100025642 3300005548 Bacteria 5939
274 Ga0070665_100042480 3300005548 Bacteria 4570
275 Ga0070665_100084962 3300005548 Bacteria 3170
276 Ga0070665_100154853 3300005548 Bacteria 2294
277 Ga0070665_100618980 3300005548 Bacteria 1096
278 Ga0070704_100008342 3300005549 Bacteria 6207
279 Ga0070704_100077073 3300005549 Bacteria 2441
280 Ga0070704_100147222 3300005549 Bacteria 1847
281 Ga0070704_100345255 3300005549 Bacteria 1255
282 Ga0070704_100374657 3300005549 Bacteria 1208
283 Ga0068855_100005199 3300005563 Bacteria 15872
284 Ga0068855_100014630 3300005563 Bacteria 9450
285 Ga0068855_100028763 3300005563 Bacteria 6649
286 Ga0068855_100167649 3300005563 Bacteria 2488
287 Ga0068855_100261036 3300005563 Bacteria 1929
288 Ga0070664_100021119 3300005564 Bacteria 5364
289 Ga0070664_100033837 3300005564 Bacteria 4284
290 Ga0070664_100255936 3300005564 Bacteria 1575
291 Ga0068857_100000307 3300005577 Bacteria 33926
292 Ga0068854_100000131 3300005578 Bacteria 51521
293 Ga0068854_100032775 3300005578 Bacteria 3617
294 Ga0068856_100001866 3300005614 Bacteria 21986
295 Ga0068856_100355506 3300005614 Bacteria 1484
296 Ga0068856_100658686 3300005614 Bacteria 1067
297 Ga0070702_100000197 3300005615 Bacteria 19661
298 Ga0070702_100093165 3300005615 Bacteria 1831
299 Ga0068852_100000151 3300005616 Bacteria 46414
300 Ga0068852_100036565 3300005616 Bacteria 4110
301 Ga0068852_100219594 3300005616 Bacteria 1807
302 Ga0068852_100255172 3300005616 Bacteria 1681
303 Ga0068859_100018300 3300005617 Bacteria 7043
304 Ga0068859_100100457 3300005617 Bacteria 2948
305 Ga0068859_100227137 3300005617 Bacteria 1955
306 Ga0068859_100445267 3300005617 Bacteria 1391
307 Ga0068859_100479110 3300005617 Bacteria 1340
308 Ga0068859_101154642 3300005617 Bacteria 852
309 Ga0068864_100001095 3300005618 Bacteria 22704
310 Ga0068864_100024767 3300005618 Bacteria 5048
311 Ga0068866_10001144 3300005718 Bacteria 11653
312 Ga0068866_10188871 3300005718 Bacteria 1223
313 Ga0068861_100000436 3300005719 Bacteria 24224
314 Ga0068861_100101811 3300005719 Bacteria 2286
315 Ga0068861_100151746 3300005719 Bacteria 1902
316 Ga0068861_100237244 3300005719 Bacteria 1549
317 Ga0068861_100295240 3300005719 Bacteria 1401
318 Ga0068851_10043282 3300005834 Bacteria 2269
319 Ga0068851_10092720 3300005834 Bacteria 1592
320 Ga0068870_10000120 3300005840 Bacteria 26776
321 Ga0068870_10000985 3300005840 Bacteria 11236
322 Ga0068870_10075164 3300005840 Bacteria 1853
323 Ga0068863_100000418 3300005841 Bacteria 43162
324 Ga0068863_100119754 3300005841 Bacteria 2509
325 Ga0068863_100290787 3300005841 Bacteria 1584
326 Ga0068858_100015337 3300005842 Bacteria 7208
327 Ga0068858_100086580 3300005842 Bacteria 2914
328 Ga0068858_100126013 3300005842 Bacteria 2398
329 Ga0068858_100145088 3300005842 Bacteria 2229
330 Ga0068858_100306920 3300005842 Bacteria 1515
331 Ga0068860_100004963 3300005843 Bacteria 13563
332 Ga0068860_100103776 3300005843 Bacteria 2714
333 Ga0068860_100106624 3300005843 Bacteria 2676
334 Ga0068860_100148273 3300005843 Bacteria 2258
335 Ga0068862_100029273 3300005844 Bacteria 4639
336 Ga0068862_100483181 3300005844 Bacteria 1173
337 Ga0081455_10000002 3300005937 Bacteria 460472
338 Ga0081455_10001354 3300005937 Bacteria 30285
339 Ga0081455_10006240 3300005937 Bacteria 12834
340 Ga0081455_10012128 3300005937 Bacteria 8612
341 Ga0081455_10027662 3300005937 Bacteria 5194
342 Ga0081455_10053652 3300005937 Bacteria 3443
343 Ga0081455_10343110 3300005937 Bacteria 1056
344 Ga0081538_10011656 3300005981 Bacteria 7108
345 Ga0081538_10053528 3300005981 Bacteria 2398
346 Ga0081540_1000166 3300005983 Bacteria 68242
347 Ga0081540_1002025 3300005983 Bacteria 16912
348 Ga0081540_1015548 3300005983 Bacteria 4813
349 Ga0081540_1016475 3300005983 Bacteria 4622
350 Ga0081540_1061250 3300005983 Bacteria 1795
351 Ga0081540_1113203 3300005983 Bacteria 1142
352 Ga0081540_1156102 3300005983 Bacteria 892
353 Ga0081539_10010724 3300005985 Bacteria 7384
354 Ga0081539_10044788 3300005985 Bacteria 2551
355 Ga0081539_10140099 3300005985 Bacteria 1176
356 Ga0070717_10013275 3300006028 Bacteria 6306
357 Ga0070717_10036603 3300006028 Bacteria 3981
358 Ga0070717_10040398 3300006028 Bacteria 3799
359 Ga0070717_10043212 3300006028 Bacteria 3677
360 Ga0070717_10185683 3300006028 Bacteria 1814
361 Ga0070717_10267089 3300006028 Bacteria 1515
362 Ga0070717_10390143 3300006028 Bacteria 1249
363 Ga0070717_10896061 3300006028 Bacteria 807
364 Ga0075365_10002199 3300006038 Bacteria 9406
365 Ga0075365_10007282 3300006038 Bacteria 6186
366 Ga0075365_10015116 3300006038 Bacteria 4661
367 Ga0075365_10079674 3300006038 Bacteria 2216
368 Ga0075365_10293793 3300006038 Bacteria 1143
369 Ga0075368_10050125 3300006042 Bacteria 1657
370 Ga0075363_100003290 3300006048 Bacteria 6844
371 Ga0075363_100046416 3300006048 Bacteria 2304
372 Ga0075363_100117367 3300006048 Bacteria 1483
373 Ga0075364_10003576 3300006051 Bacteria 8850
374 Ga0075364_10048755 3300006051 Bacteria 2760
375 Ga0075364_10048826 3300006051 Bacteria 2759
376 Ga0075364_10156148 3300006051 Bacteria 1539
377 Ga0075364_10160278 3300006051 Bacteria 1518
378 Ga0070715_10004035 3300006163 Bacteria 4763
379 Ga0070715_10071020 3300006163 Bacteria 1555
380 Ga0070715_10082331 3300006163 Bacteria 1464
381 Ga0070715_10134237 3300006163 Bacteria 1195
382 Ga0070716_100032365 3300006173 Bacteria 2851
383 Ga0070716_100167105 3300006173 Bacteria 1432
384 Ga0070716_100303562 3300006173 Bacteria 1111
385 Ga0070712_100021809 3300006175 Bacteria 4213
386 Ga0070712_100022609 3300006175 Bacteria 4144
387 Ga0070712_100037456 3300006175 Bacteria 3306
388 Ga0070712_100054250 3300006175 Bacteria 2802
389 Ga0070712_100065597 3300006175 Bacteria 2577
390 Ga0070712_100069678 3300006175 Bacteria 2510
391 Ga0070712_100104739 3300006175 Bacteria 2100
392 Ga0070712_100111932 3300006175 Bacteria 2039
393 Ga0070712_100150909 3300006175 Bacteria 1784
394 Ga0070712_100234045 3300006175 Bacteria 1460
395 Ga0070712_100257634 3300006175 Bacteria 1397
396 Ga0070712_100323361 3300006175 Bacteria 1255
397 Ga0070712_100435213 3300006175 Bacteria 1089
398 Ga0070712_100616661 3300006175 Bacteria 919
399 Ga0070712_100657811 3300006175 Bacteria 891
400 Ga0075362_10011461 3300006177 Bacteria 3492
401 Ga0075362_10037226 3300006177 Bacteria 2132
402 Ga0075362_10103811 3300006177 Bacteria 1332
403 Ga0075362_10128187 3300006177 Bacteria 1205
404 Ga0075367_10011511 3300006178 Bacteria 4685
405 Ga0075367_10017973 3300006178 Bacteria 3893
406 Ga0075367_10032143 3300006178 Bacteria 3017
407 Ga0075367_10045294 3300006178 Bacteria 2581
408 Ga0075367_10124301 3300006178 Bacteria 1591
409 Ga0075367_10243531 3300006178 Bacteria 1127
410 Ga0075367_10335353 3300006178 Bacteria 954
411 Ga0075369_10076405 3300006186 Bacteria 1480
412 Ga0075369_10080932 3300006186 Bacteria 1440
413 Ga0075427_10000036 3300006194 Bacteria 9339
414 Ga0075366_10001260 3300006195 Bacteria 12585
415 Ga0075366_10018230 3300006195 Bacteria 4050
416 Ga0075366_10266495 3300006195 Bacteria 1046
417 Ga0075366_10338888 3300006195 Bacteria 922
418 Ga0097621_100000887 3300006237 Bacteria 20959
419 Ga0097621_100113804 3300006237 Bacteria 2288
420 Ga0097621_100208933 3300006237 Bacteria 1697
421 Ga0097621_100224616 3300006237 Bacteria 1637
422 Ga0075370_10077581 3300006353 Bacteria 1906
423 Ga0075370_10335825 3300006353 Bacteria 901
424 Ga0068871_100000484 3300006358 Bacteria 27198
425 Ga0068871_100001991 3300006358 Bacteria 13829
426 Ga0068871_100020759 3300006358 Bacteria 5037
427 Ga0068871_100023143 3300006358 Bacteria 4800
428 Ga0068871_100308560 3300006358 Bacteria 1390
429 Ga0075428_100001081 3300006844 Bacteria 28974
430 Ga0075428_100002972 3300006844 Bacteria 18477
431 Ga0075428_100023291 3300006844 Bacteria 6852
432 Ga0075428_100103169 3300006844 Bacteria 3110
433 Ga0075428_100302813 3300006844 Bacteria 1718
434 Ga0075428_100365093 3300006844 Bacteria 1548
435 Ga0075428_100423317 3300006844 Bacteria 1427
436 Ga0075428_100555795 3300006844 Bacteria 1227
437 Ga0075430_100000045 3300006846 Bacteria 64983
438 Ga0075430_100000274 3300006846 Bacteria 36446
439 Ga0075430_100144888 3300006846 Bacteria 1979
440 Ga0075431_100000059 3300006847 Bacteria 61740
441 Ga0075431_100000219 3300006847 Bacteria 42587
442 Ga0075431_100258813 3300006847 Bacteria 1766
443 Ga0075431_100310825 3300006847 Bacteria 1591
444 Ga0075431_100331438 3300006847 Bacteria 1533
445 Ga0075433_10001892 3300006852 Bacteria 15744
446 Ga0075433_10034114 3300006852 Bacteria 4369
447 Ga0075433_10043556 3300006852 Bacteria 3896
448 Ga0075433_10186304 3300006852 Bacteria 1847
449 Ga0075433_10221632 3300006852 Bacteria 1680
450 Ga0075433_10232214 3300006852 Bacteria 1638
451 Ga0075434_100003622 3300006871 Bacteria 13791
452 Ga0075434_100006246 3300006871 Bacteria 10914
453 Ga0075434_100078022 3300006871 Bacteria 3307
454 Ga0075434_100243412 3300006871 Bacteria 1818
455 Ga0075434_100363060 3300006871 Bacteria 1469
456 Ga0075434_100372665 3300006871 Bacteria 1448
457 Ga0075429_100003392 3300006880 Bacteria 13582
458 Ga0075429_100014917 3300006880 Bacteria 6740
459 Ga0075429_100133092 3300006880 Bacteria 2175
460 Ga0075429_100446866 3300006880 Bacteria 1133
461 Ga0068865_100000613 3300006881 Bacteria 20015
462 Ga0075436_100005027 3300006914 Bacteria 9091
463 Ga0075436_100060170 3300006914 Bacteria 2623
464 Ga0075436_100125224 3300006914 Bacteria 1800
465 Ga0075436_100216483 3300006914 Bacteria 1358
466 Ga0075436_100408373 3300006914 Bacteria 985
467 Ga0097620_100018301 3300006931 Bacteria 7043
468 Ga0097620_100100460 3300006931 Bacteria 2948
469 Ga0097620_100227140 3300006931 Bacteria 1955
470 Ga0097620_100445249 3300006931 Bacteria 1391
471 Ga0097620_100479046 3300006931 Bacteria 1340
472 Ga0097620_101154661 3300006931 Bacteria 852
473 Ga0079104_1000195 3300006946 Bacteria 85244
474 Ga0075435_100044561 3300007076 Bacteria 3553
475 Ga0075435_100052359 3300007076 Bacteria 3291
476 Ga0075435_100072187 3300007076 Bacteria 2820
477 Ga0075435_100090548 3300007076 Bacteria 2523
478 Ga0075435_100114913 3300007076 Bacteria 2241
479 Ga0075435_100174407 3300007076 Bacteria 1815
480 Ga0075435_100322592 3300007076 Bacteria 1322
481 Ga0075435_100426336 3300007076 Bacteria 1143
482 Ga0075435_100591792 3300007076 Bacteria 962
483 Ga0099794_10007909 3300007265 Bacteria 4395
484 Ga0099794_10031163 3300007265 Bacteria 2495
485 Ga0099795_10110463 3300007788 Bacteria 1089
486 Ga0099795_10154416 3300007788 Bacteria 942
487 Ga0099795_10175236 3300007788 Bacteria 893
488 Ga0105251_10031791 3300009011 Bacteria 2637
489 Ga0105251_10048048 3300009011 Bacteria 2048
490 Ga0105244_10017634 3300009036 Bacteria 4030
491 Ga0105250_10012131 3300009092 Bacteria 3565
492 Ga0105240_10023181 3300009093 Bacteria 8219
493 Ga0105240_10189033 3300009093 Bacteria 2423
494 Ga0105240_10609018 3300009093 Bacteria 1202
495 Ga0105240_10915440 3300009093 Bacteria 942
496 Ga0105240_11245333 3300009093 Bacteria 786
497 Ga0111539_10000679 3300009094 Bacteria 44034
498 Ga0111539_10000693 3300009094 Bacteria 43665
499 Ga0111539_10000925 3300009094 Bacteria 38387
500 Ga0111539_10001296 3300009094 Bacteria 33381
501 Ga0111539_10048622 3300009094 Bacteria 5063
502 Ga0111539_10123739 3300009094 Bacteria 3031
503 Ga0111539_10132601 3300009094 Bacteria 2918
504 Ga0111539_10165942 3300009094 Bacteria 2582
505 Ga0111539_10220232 3300009094 Bacteria 2210
506 Ga0111539_10274557 3300009094 Bacteria 1962
507 Ga0111539_10863039 3300009094 Bacteria 1053
508 Ga0111539_11275377 3300009094 Bacteria 853
509 Ga0111539_11339110 3300009094 Bacteria 831
510 Ga0111539_11411435 3300009094 Bacteria 808
511 Ga0105245_10000090 3300009098 Bacteria 90378
512 Ga0105245_10010517 3300009098 Bacteria 8050
513 Ga0105245_10036531 3300009098 Bacteria 4365
514 Ga0105245_10071370 3300009098 Bacteria 3154
515 Ga0105245_10409644 3300009098 Bacteria 1357
516 Ga0105245_10512313 3300009098 Bacteria 1217
517 Ga0105245_10945090 3300009098 Bacteria 905
518 Ga0105245_11005301 3300009098 Bacteria 878
519 Ga0105247_10003560 3300009101 Bacteria 10122
520 Ga0105247_10007854 3300009101 Bacteria 6528
521 Ga0105247_10019461 3300009101 Bacteria 4076
522 Ga0105247_10115510 3300009101 Bacteria 1732
523 Ga0114129_10006313 3300009147 Bacteria 16810
524 Ga0114129_10008707 3300009147 Bacteria 14466
525 Ga0114129_10024738 3300009147 Bacteria 8512
526 Ga0114129_10037360 3300009147 Bacteria 6857
527 Ga0114129_10381844 3300009147 Bacteria 1860
528 Ga0114129_10544573 3300009147 Bacteria 1510
529 Ga0114129_10664413 3300009147 Bacteria 1343
530 Ga0114129_10783267 3300009147 Bacteria 1218
531 Ga0114129_10908682 3300009147 Bacteria 1115
532 Ga0105243_10001004 3300009148 Bacteria 26090
533 Ga0105243_10027743 3300009148 Bacteria 4341
534 Ga0105243_10037418 3300009148 Bacteria 3772
535 Ga0105243_10077516 3300009148 Bacteria 2703
536 Ga0105243_11178051 3300009148 Bacteria 778
537 Ga0105241_10000053 3300009174 Bacteria 94578
538 Ga0105241_10309814 3300009174 Bacteria 1358
539 Ga0105241_10555788 3300009174 Bacteria 1031
540 Ga0105242_10004018 3300009176 Bacteria 11437
541 Ga0105242_10171984 3300009176 Bacteria 1904
542 Ga0105242_10187774 3300009176 Bacteria 1828
543 Ga0105242_10381302 3300009176 Bacteria 1311
544 Ga0105242_11219152 3300009176 Bacteria 772
545 Ga0105248_10000964 3300009177 Bacteria 32048
546 Ga0105248_10020015 3300009177 Bacteria 7409
547 Ga0105248_10020708 3300009177 Bacteria 7288
548 Ga0105248_10022530 3300009177 Bacteria 6987
549 Ga0105248_10027546 3300009177 Bacteria 6328
550 Ga0105248_10149687 3300009177 Bacteria 2633
551 Ga0105248_10216999 3300009177 Bacteria 2154
552 Ga0105237_10005610 3300009545 Bacteria 14144
553 Ga0105237_10045785 3300009545 Bacteria 4401
554 Ga0105237_10116760 3300009545 Bacteria 2662
555 Ga0105237_10126352 3300009545 Bacteria 2551
556 Ga0105237_10296065 3300009545 Bacteria 1621
557 Ga0105238_10068323 3300009551 Bacteria 3555
558 Ga0105238_10079941 3300009551 Bacteria 3259
559 Ga0105238_10454156 3300009551 Bacteria 1278
560 Ga0105249_10009773 3300009553 Bacteria 8402
561 Ga0099796_10009779 3300010159 Bacteria 2610
562 Ga0099796_10042857 3300010159 Bacteria 1539
563 Ga0099796_10113552 3300010159 Bacteria 1034
564 Ga0099796_10146835 3300010159 Bacteria 926
565 Ga0105239_10007674 3300010375 Bacteria 12357
566 Ga0105239_10092138 3300010375 Bacteria 3345
567 Ga0105239_10097118 3300010375 Bacteria 3256
568 Ga0105239_10462312 3300010375 Bacteria 1440
569 Ga0105239_10644202 3300010375 Bacteria 1210
570 Ga0105246_10000052 3300011119 Bacteria 46290
571 Ga0105246_10075238 3300011119 Bacteria 2390
572 Ga0105246_10095324 3300011119 Bacteria 2154
573 Ga0105246_10379958 3300011119 Bacteria 1167
574 Ga0157339_1001686 3300012505 Bacteria 1394
575 Ga0157342_1000555 3300012507 Bacteria 2343
576 Ga0157338_1000120 3300012515 Bacteria 3636
577 Ga0157373_10039051 3300013100 Bacteria 3399
578 Ga0157371_10006781 3300013102 Bacteria 9363
579 Ga0157371_10177791 3300013102 Bacteria 1521
580 Ga0157370_10237622 3300013104 Bacteria 1686
581 Ga0157370_10282380 3300013104 Bacteria 1534
582 Ga0157370_10582633 3300013104 Bacteria 1025
583 Ga0157369_10508677 3300013105 Bacteria 1246
584 Ga0157369_10541970 3300013105 Bacteria 1203
585 Ga0157374_10000476 3300013296 Bacteria 36354
586 Ga0157374_10055453 3300013296 Bacteria 3699
587 Ga0157374_10105147 3300013296 Bacteria 2711
588 Ga0157374_10567490 3300013296 Bacteria 1143
589 Ga0157374_10951380 3300013296 Bacteria 877
590 Ga0157378_10002229 3300013297 Bacteria 17200
591 Ga0157378_10294896 3300013297 Bacteria 1567
592 Ga0157378_10348777 3300013297 Bacteria 1445
593 Ga0157378_10397742 3300013297 Bacteria 1357
594 Ga0163162_10000308 3300013306 Bacteria 45253
595 Ga0163162_10050166 3300013306 Bacteria 4185
596 Ga0163162_10146941 3300013306 Bacteria 2474
597 Ga0163162_10193333 3300013306 Bacteria 2162
598 Ga0163162_10242765 3300013306 Bacteria 1932
599 Ga0163162_10268386 3300013306 Bacteria 1838
600 Ga0163162_10570554 3300013306 Bacteria 1259
601 Ga0157372_10572295 3300013307 Bacteria 1317
602 Ga0157375_10000414 3300013308 Bacteria 38778
603 Ga0157375_10056632 3300013308 Bacteria 3872
604 Ga0157375_10090677 3300013308 Bacteria 3116
605 Ga0157375_10257419 3300013308 Bacteria 1907
606 Ga0157375_10796255 3300013308 Bacteria 1094
607 Ga0163163_10002595 3300014325 Bacteria 15315
608 Ga0163163_10003463 3300014325 Bacteria 13415
609 Ga0163163_10010358 3300014325 Bacteria 8376
610 Ga0163163_10029326 3300014325 Bacteria 5292
611 Ga0157380_10000122 3300014326 Bacteria 43303
612 Ga0157380_10208227 3300014326 Bacteria 1741
613 Ga0157380_10225848 3300014326 Bacteria 1678
614 Ga0157377_10001747 3300014745 Bacteria 9469
615 Ga0157377_10037359 3300014745 Bacteria 2675
616 Ga0157377_10058897 3300014745 Bacteria 2187
617 Ga0157377_10069104 3300014745 Bacteria 2037
618 Ga0157379_10000261 3300014968 Bacteria 41455
619 Ga0157379_10028513 3300014968 Bacteria 4965
620 Ga0157379_10047295 3300014968 Bacteria 3838
621 Ga0157379_10049326 3300014968 Bacteria 3759
622 Ga0157379_10059283 3300014968 Bacteria 3422
623 Ga0157379_10832212 3300014968 Bacteria 873
624 Ga0157376_10000283 3300014969 Bacteria 34227
625 Ga0157376_10147361 3300014969 Bacteria 2119
626 Ga0157376_10249144 3300014969 Bacteria 1658
627 Ga0157376_10972670 3300014969 Bacteria 870
628 Ga0163161_10000199 3300017792 Bacteria 55004
629 Ga0206356_11625837 3300020070 Bacteria 2442
630 Ga0206356_11859219 3300020070 Bacteria 2029
631 Ga0213872_10041990 3300021361 Bacteria 2086
632 Ga0213876_10052325 3300021384 Bacteria 2158
633 Ga0213876_10086180 3300021384 Bacteria 1662
634 Ga0213876_10241168 3300021384 Bacteria 961
635 Ga0213875_10000053 3300021388 Bacteria 141791
636 Ga0213875_10078217 3300021388 Bacteria 1543
637 Ga0213875_10158350 3300021388 Bacteria 1062
638 Ga0224572_1003469 3300024225 Bacteria 2661
639 Ga0209233_1007144 3300025261 Bacteria 3556
640 Ga0207666_1000861 3300025271 Bacteria 3639
641 Ga0207666_1002383 3300025271 Bacteria 2263
642 Ga0207673_1000489 3300025290 Bacteria 4157
643 Ga0209676_1032510 3300025292 Bacteria 1568
644 Ga0209758_1001119 3300025297 Bacteria 34539
645 Ga0209758_1004320 3300025297 Bacteria 11948
646 Ga0209050_1025171 3300025298 Bacteria 2032
647 Ga0209256_1009023 3300025299 Bacteria 4467
648 Ga0209051_1009812 3300025303 Bacteria 4902
649 Ga0209257_1010796 3300025304 Bacteria 4535
650 Ga0207697_10000335 3300025315 Bacteria 26204
651 Ga0207697_10004744 3300025315 Bacteria 6439
652 Ga0207653_10001210 3300025885 Bacteria 8432
653 Ga0207682_10000042 3300025893 Bacteria 52333
654 Ga0207692_10007314 3300025898 Bacteria 4520
655 Ga0207692_10010700 3300025898 Bacteria 3878
656 Ga0207692_10038756 3300025898 Bacteria 2339
657 Ga0207692_10141611 3300025898 Bacteria 1368
658 Ga0207642_10000725 3300025899 Bacteria 10195
659 Ga0207642_10080842 3300025899 Bacteria 1577
660 Ga0207710_10002054 3300025900 Bacteria 9549
661 Ga0207710_10038983 3300025900 Bacteria 2102
662 Ga0207710_10062509 3300025900 Bacteria 1692
663 Ga0207710_10098804 3300025900 Bacteria 1374
664 Ga0207688_10000053 3300025901 Bacteria 41441
665 Ga0207688_10000303 3300025901 Bacteria 22604
666 Ga0207688_10021480 3300025901 Bacteria 3527
667 Ga0207688_10046434 3300025901 Bacteria 2425
668 Ga0207688_10089188 3300025901 Bacteria 1769
669 Ga0207680_10001204 3300025903 Bacteria 12248
670 Ga0207680_10022210 3300025903 Bacteria 3447
671 Ga0207680_10045668 3300025903 Bacteria 2584
672 Ga0207647_10003927 3300025904 Bacteria 11107
673 Ga0207647_10004389 3300025904 Bacteria 10462
674 Ga0207647_10053679 3300025904 Bacteria 2482
675 Ga0207685_10062000 3300025905 Bacteria 1484
676 Ga0207685_10063480 3300025905 Bacteria 1471
677 Ga0207685_10064913 3300025905 Bacteria 1460
678 Ga0207699_10055238 3300025906 Bacteria 2362
679 Ga0207699_10177379 3300025906 Bacteria 1430
680 Ga0207699_10192061 3300025906 Bacteria 1378
681 Ga0207699_10661932 3300025906 Bacteria 763
682 Ga0207645_10000090 3300025907 Bacteria 65569
683 Ga0207645_10027127 3300025907 Bacteria 3701
684 Ga0207645_10044860 3300025907 Bacteria 2828
685 Ga0207645_10079551 3300025907 Bacteria 2101
686 Ga0207645_10151056 3300025907 Bacteria 1516
687 Ga0207645_10428663 3300025907 Bacteria 891
688 Ga0207645_10429959 3300025907 Bacteria 890
689 Ga0207643_10000044 3300025908 Bacteria 82217
690 Ga0207643_10001489 3300025908 Bacteria 13420
691 Ga0207643_10143305 3300025908 Bacteria 1428
692 Ga0207705_10059249 3300025909 Bacteria 2763
693 Ga0207705_10168933 3300025909 Bacteria 1646
694 Ga0207684_10006762 3300025910 Bacteria 10405
695 Ga0207684_10035923 3300025910 Bacteria 4206
696 Ga0207684_10099712 3300025910 Bacteria 2481
697 Ga0207684_10187027 3300025910 Bacteria 1786
698 Ga0207684_10288055 3300025910 Bacteria 1416
699 Ga0207684_10613266 3300025910 Bacteria 929
700 Ga0207654_10000397 3300025911 Bacteria 25317
701 Ga0207654_10029294 3300025911 Bacteria 3012
702 Ga0207654_10057163 3300025911 Bacteria 2266
703 Ga0207707_10001536 3300025912 Bacteria 21265
704 Ga0207707_10187436 3300025912 Bacteria 1805
705 Ga0207707_10301162 3300025912 Bacteria 1386
706 Ga0207707_10436914 3300025912 Bacteria 1121
707 Ga0207695_10156553 3300025913 Bacteria 2213
708 Ga0207695_10183913 3300025913 Bacteria 2010
709 Ga0207671_10007530 3300025914 Bacteria 9435
710 Ga0207671_10136584 3300025914 Bacteria 1886
711 Ga0207671_10341351 3300025914 Bacteria 1187
712 Ga0207671_10429836 3300025914 Bacteria 1051
713 Ga0207693_10002841 3300025915 Bacteria 15002
714 Ga0207693_10023723 3300025915 Bacteria 4867
715 Ga0207693_10024688 3300025915 Bacteria 4767
716 Ga0207693_10033027 3300025915 Bacteria 4084
717 Ga0207693_10065540 3300025915 Bacteria 2844
718 Ga0207693_10088650 3300025915 Bacteria 2425
719 Ga0207693_10097277 3300025915 Bacteria 2308
720 Ga0207693_10127778 3300025915 Bacteria 1998
721 Ga0207693_10161041 3300025915 Bacteria 1765
722 Ga0207693_10175786 3300025915 Bacteria 1685
723 Ga0207693_10221353 3300025915 Bacteria 1487
724 Ga0207693_10496113 3300025915 Bacteria 953
725 Ga0207693_10529246 3300025915 Bacteria 920
726 Ga0207693_10547110 3300025915 Bacteria 903
727 Ga0207693_10614071 3300025915 Bacteria 846
728 Ga0207693_10676278 3300025915 Bacteria 801
729 Ga0207663_10012583 3300025916 Bacteria 4580
730 Ga0207663_10078915 3300025916 Bacteria 2148
731 Ga0207663_10093246 3300025916 Bacteria 2004
732 Ga0207663_10120068 3300025916 Bacteria 1798
733 Ga0207663_10315585 3300025916 Bacteria 1173
734 Ga0207663_10508650 3300025916 Bacteria 936
735 Ga0207660_10000083 3300025917 Bacteria 50279
736 Ga0207660_10014742 3300025917 Bacteria 5151
737 Ga0207660_10038833 3300025917 Bacteria 3325
738 Ga0207660_10085535 3300025917 Bacteria 2326
739 Ga0207660_10355796 3300025917 Bacteria 1174
740 Ga0207662_10000230 3300025918 Bacteria 25941
741 Ga0207662_10025780 3300025918 Bacteria 3387
742 Ga0207662_10029808 3300025918 Bacteria 3164
743 Ga0207662_10076174 3300025918 Bacteria 2038
744 Ga0207657_10001336 3300025919 Bacteria 26204
745 Ga0207657_10043359 3300025919 Bacteria 3963
746 Ga0207657_10051527 3300025919 Bacteria 3578
747 Ga0207657_10057189 3300025919 Bacteria 3362
748 Ga0207657_10118613 3300025919 Bacteria 2178
749 Ga0207657_10238867 3300025919 Bacteria 1451
750 Ga0207657_10379870 3300025919 Bacteria 1113
751 Ga0207649_10000260 3300025920 Bacteria 41709
752 Ga0207649_10062643 3300025920 Bacteria 2345
753 Ga0207652_10002829 3300025921 Bacteria 14558
754 Ga0207652_10041895 3300025921 Bacteria 3895
755 Ga0207652_10048055 3300025921 Bacteria 3646
756 Ga0207652_10065015 3300025921 Bacteria 3157
757 Ga0207652_10101081 3300025921 Bacteria 2546
758 Ga0207652_10123939 3300025921 Bacteria 2301
759 Ga0207652_10127047 3300025921 Bacteria 2271
760 Ga0207652_10289647 3300025921 Bacteria 1477
761 Ga0207646_10050403 3300025922 Bacteria 3726
762 Ga0207646_10128543 3300025922 Bacteria 2279
763 Ga0207646_10269889 3300025922 Bacteria 1538
764 Ga0207681_10000271 3300025923 Bacteria 38955
765 Ga0207681_10072398 3300025923 Bacteria 2407
766 Ga0207681_10097997 3300025923 Bacteria 2108
767 Ga0207694_10013167 3300025924 Bacteria 6227
768 Ga0207694_10153669 3300025924 Bacteria 1855
769 Ga0207694_10504424 3300025924 Bacteria 1013
770 Ga0207650_10006320 3300025925 Bacteria 8074
771 Ga0207650_10014750 3300025925 Bacteria 5432
772 Ga0207650_10023350 3300025925 Bacteria 4384
773 Ga0207650_10026553 3300025925 Bacteria 4133
774 Ga0207650_10045459 3300025925 Bacteria 3230
775 Ga0207650_10151005 3300025925 Bacteria 1833
776 Ga0207659_10000258 3300025926 Bacteria 32465
777 Ga0207659_10040244 3300025926 Bacteria 3267
778 Ga0207659_10057381 3300025926 Bacteria 2791
779 Ga0207659_10113354 3300025926 Bacteria 2065
780 Ga0207659_10191778 3300025926 Bacteria 1627
781 Ga0207659_10237474 3300025926 Bacteria 1473
782 Ga0207659_10313108 3300025926 Bacteria 1293
783 Ga0207687_10000063 3300025927 Bacteria 83105
784 Ga0207687_10013043 3300025927 Bacteria 5430
785 Ga0207687_10086242 3300025927 Bacteria 2279
786 Ga0207687_10421539 3300025927 Bacteria 1102
787 Ga0207687_10640576 3300025927 Bacteria 898
788 Ga0207700_10022871 3300025928 Bacteria 4296
789 Ga0207700_10046001 3300025928 Bacteria 3224
790 Ga0207700_10062363 3300025928 Bacteria 2831
791 Ga0207700_10128057 3300025928 Bacteria 2068
792 Ga0207700_10172519 3300025928 Bacteria 1805
793 Ga0207700_10347125 3300025928 Bacteria 1291
794 Ga0207700_10822302 3300025928 Bacteria 831
795 Ga0207664_10038216 3300025929 Bacteria 3720
796 Ga0207664_10054501 3300025929 Bacteria 3169
797 Ga0207664_10128655 3300025929 Bacteria 2129
798 Ga0207664_10254745 3300025929 Bacteria 1533
799 Ga0207664_10524073 3300025929 Bacteria 1062
800 Ga0207644_10000524 3300025931 Bacteria 24831
801 Ga0207644_10006692 3300025931 Bacteria 7508
802 Ga0207644_10045806 3300025931 Bacteria 3112
803 Ga0207644_10074067 3300025931 Bacteria 2498
804 Ga0207644_10129632 3300025931 Bacteria 1929
805 Ga0207644_10207058 3300025931 Bacteria 1549
806 Ga0207690_10001251 3300025932 Bacteria 16066
807 Ga0207690_10230639 3300025932 Bacteria 1421
808 Ga0207690_10388623 3300025932 Bacteria 1110
809 Ga0207706_10001197 3300025933 Bacteria 26204
810 Ga0207706_10002752 3300025933 Bacteria 17102
811 Ga0207706_10009072 3300025933 Bacteria 9149
812 Ga0207706_10032010 3300025933 Bacteria 4685
813 Ga0207706_10099317 3300025933 Bacteria 2561
814 Ga0207706_10182028 3300025933 Bacteria 1845
815 Ga0207706_10412473 3300025933 Bacteria 1170
816 Ga0207686_10000456 3300025934 Bacteria 27184
817 Ga0207686_10108312 3300025934 Bacteria 1869
818 Ga0207686_10158898 3300025934 Bacteria 1582
819 Ga0207686_10257159 3300025934 Bacteria 1278
820 Ga0207709_10000372 3300025935 Bacteria 45219
821 Ga0207709_10068200 3300025935 Bacteria 2247
822 Ga0207670_10000345 3300025936 Bacteria 27608
823 Ga0207670_10003254 3300025936 Bacteria 8607
824 Ga0207670_10006141 3300025936 Bacteria 6645
825 Ga0207670_10007621 3300025936 Bacteria 6055
826 Ga0207670_10058416 3300025936 Bacteria 2620
827 Ga0207670_10072520 3300025936 Bacteria 2384
828 Ga0207669_10000019 3300025937 Bacteria 111630
829 Ga0207704_10007530 3300025938 Bacteria 5150
830 Ga0207704_10160016 3300025938 Bacteria 1601
831 Ga0207665_10008520 3300025939 Bacteria 6751
832 Ga0207665_10043429 3300025939 Bacteria 3005
833 Ga0207665_10142024 3300025939 Bacteria 1713
834 Ga0207665_10226485 3300025939 Bacteria 1372
835 Ga0207665_10312167 3300025939 Bacteria 1178
836 Ga0207665_10414586 3300025939 Bacteria 1028
837 Ga0207691_10000987 3300025940 Bacteria 28275
838 Ga0207691_10003130 3300025940 Bacteria 16166
839 Ga0207691_10035947 3300025940 Bacteria 4592
840 Ga0207691_10087771 3300025940 Bacteria 2790
841 Ga0207691_10138784 3300025940 Bacteria 2143
842 Ga0207691_10183730 3300025940 Bacteria 1826
843 Ga0207691_10680101 3300025940 Bacteria 868
844 Ga0207711_10001673 3300025941 Bacteria 20423
845 Ga0207711_10011969 3300025941 Bacteria 7211
846 Ga0207711_10057086 3300025941 Bacteria 3356
847 Ga0207711_10263308 3300025941 Bacteria 1585
848 Ga0207711_10300267 3300025941 Bacteria 1481
849 Ga0207711_10404704 3300025941 Bacteria 1268
850 Ga0207689_10000916 3300025942 Bacteria 28296
851 Ga0207689_10043776 3300025942 Bacteria 3700
852 Ga0207661_10000107 3300025944 Bacteria 52429
853 Ga0207661_10008359 3300025944 Bacteria 7393
854 Ga0207661_10355257 3300025944 Bacteria 1323
855 Ga0207679_10000026 3300025945 Bacteria 200073
856 Ga0207679_10010198 3300025945 Bacteria 6045
857 Ga0207679_10180970 3300025945 Bacteria 1744
858 Ga0207679_10531988 3300025945 Bacteria 1052
859 Ga0207679_10683305 3300025945 Bacteria 930
860 Ga0207667_10003336 3300025949 Bacteria 19809
861 Ga0207667_10016894 3300025949 Bacteria 8232
862 Ga0207667_10026958 3300025949 Bacteria 6268
863 Ga0207667_10240610 3300025949 Bacteria 1852
864 Ga0207667_10352694 3300025949 Bacteria 1500
865 Ga0207667_10671609 3300025949 Bacteria 1040
866 Ga0207651_10000855 3300025960 Bacteria 13295
867 Ga0207651_10007700 3300025960 Bacteria 5756
868 Ga0207651_10048298 3300025960 Bacteria 2876
869 Ga0207651_10417901 3300025960 Bacteria 1144
870 Ga0207712_10000242 3300025961 Bacteria 53794
871 Ga0207712_10005698 3300025961 Bacteria 7852
872 Ga0207712_10109207 3300025961 Bacteria 2072
873 Ga0207712_10178669 3300025961 Bacteria 1665
874 Ga0207668_10000049 3300025972 Bacteria 99391
875 Ga0207668_10035376 3300025972 Bacteria 3324
876 Ga0207668_10183307 3300025972 Bacteria 1653
877 Ga0207668_10664834 3300025972 Bacteria 913
878 Ga0207640_10000234 3300025981 Bacteria 38057
879 Ga0207640_10054433 3300025981 Bacteria 2616
880 Ga0207640_10418870 3300025981 Bacteria 1095
881 Ga0207658_10000804 3300025986 Bacteria 26394
882 Ga0207658_10081866 3300025986 Bacteria 2477
883 Ga0207658_10530498 3300025986 Bacteria 1051
884 Ga0207658_10593474 3300025986 Bacteria 994
885 Ga0207677_10010292 3300026023 Bacteria 5290
886 Ga0207677_10014242 3300026023 Bacteria 4637
887 Ga0207677_10399653 3300026023 Bacteria 1165
888 Ga0207703_10001356 3300026035 Bacteria 22405
889 Ga0207703_10013541 3300026035 Bacteria 6353
890 Ga0207703_10052590 3300026035 Bacteria 3308
891 Ga0207639_10063261 3300026041 Bacteria 2864
892 Ga0207678_10000831 3300026067 Bacteria 28276
893 Ga0207678_10020178 3300026067 Bacteria 5852
894 Ga0207678_10047638 3300026067 Bacteria 3706
895 Ga0207678_10217103 3300026067 Bacteria 1637
896 Ga0207678_10233442 3300026067 Bacteria 1575
897 Ga0207708_10001403 3300026075 Bacteria 18072
898 Ga0207708_10003197 3300026075 Bacteria 12074
899 Ga0207708_10008657 3300026075 Bacteria 7533
900 Ga0207708_10048004 3300026075 Bacteria 3249
901 Ga0207708_10093743 3300026075 Bacteria 2317
902 Ga0207708_10111840 3300026075 Bacteria 2121
903 Ga0207708_10134596 3300026075 Bacteria 1935
904 Ga0207702_10001965 3300026078 Bacteria 19983
905 Ga0207702_10021193 3300026078 Bacteria 5379
906 Ga0207702_10037163 3300026078 Bacteria 4075
907 Ga0207702_10430239 3300026078 Bacteria 1278
908 Ga0207702_10769345 3300026078 Bacteria 951
909 Ga0207641_10000669 3300026088 Bacteria 37271
910 Ga0207641_10020291 3300026088 Bacteria 5458
911 Ga0207641_10116676 3300026088 Bacteria 2376
912 Ga0207641_10203724 3300026088 Bacteria 1826
913 Ga0207641_10244333 3300026088 Bacteria 1674
914 Ga0207641_10617020 3300026088 Bacteria 1063
915 Ga0207648_10001440 3300026089 Bacteria 26204
916 Ga0207648_10007865 3300026089 Bacteria 10401
917 Ga0207648_10135059 3300026089 Bacteria 2173
918 Ga0207648_10145029 3300026089 Bacteria 2094
919 Ga0207648_10150751 3300026089 Bacteria 2052
920 Ga0207676_10002834 3300026095 Bacteria 12336
921 Ga0207676_10038734 3300026095 Bacteria 3641
922 Ga0207676_10317214 3300026095 Bacteria 1429
923 Ga0207674_10001207 3300026116 Bacteria 33673
924 Ga0207674_10048795 3300026116 Bacteria 4332
925 Ga0207674_10079903 3300026116 Bacteria 3273
926 Ga0207675_100000983 3300026118 Bacteria 28277
927 Ga0207675_100008958 3300026118 Bacteria 9389
928 Ga0207675_100060262 3300026118 Bacteria 3543
929 Ga0207683_10000324 3300026121 Bacteria 43461
930 Ga0207683_10003263 3300026121 Bacteria 14146
931 Ga0207683_10009172 3300026121 Bacteria 8427
932 Ga0207683_10032197 3300026121 Bacteria 4554
933 Ga0207683_10034197 3300026121 Bacteria 4417
934 Ga0207683_10082323 3300026121 Bacteria 2859
935 Ga0207683_10231898 3300026121 Bacteria 1684
936 Ga0207683_10273012 3300026121 Bacteria 1545
937 Ga0207698_10037934 3300026142 Bacteria 3554
938 Ga0207698_10055015 3300026142 Bacteria 3064
939 Ga0207698_10083712 3300026142 Bacteria 2583
940 Ga0207698_10317619 3300026142 Bacteria 1457
941 Ga0207698_10867889 3300026142 Bacteria 908
942 Ga0209281_1000028 3300027111 Bacteria 440027
943 Ga0209973_1012614 3300027252 Bacteria 1030
944 Ga0209967_1033312 3300027364 Bacteria 774
945 Ga0209999_1030856 3300027543 Bacteria 995
946 Ga0209982_1014071 3300027552 Bacteria 1208
947 Ga0210002_1000535 3300027617 Bacteria 5125
948 Ga0209588_1008486 3300027671 Bacteria 3047
949 Ga0209971_1009254 3300027682 Bacteria 2333
950 Ga0209966_1001462 3300027695 Bacteria 4096
951 Ga0209966_1001844 3300027695 Bacteria 3589
952 Ga0209998_10003317 3300027717 Bacteria 3534
953 Ga0209998_10003343 3300027717 Bacteria 3521
954 Ga0209998_10021479 3300027717 Bacteria 1386
955 Ga0209974_10000294 3300027876 Bacteria 16284
956 Ga0207428_10000130 3300027907 Bacteria 104457
957 Ga0207428_10000180 3300027907 Bacteria 88557
958 Ga0207428_10000286 3300027907 Bacteria 68250
959 Ga0207428_10021017 3300027907 Bacteria 5533
960 Ga0207428_10108503 3300027907 Bacteria 2138
961 Ga0268266_10018041 3300028379 Bacteria 6014
962 Ga0268266_10082954 3300028379 Bacteria 2797
963 Ga0268266_10096310 3300028379 Bacteria 2601
964 Ga0268266_10228212 3300028379 Bacteria 1714
965 Ga0268265_10001031 3300028380 Bacteria 25141
966 Ga0268264_10001139 3300028381 Bacteria 26034
967 Ga0268264_10052458 3300028381 Bacteria 3400
968 Ga0268264_10053079 3300028381 Bacteria 3381
969 Ga0268264_10158196 3300028381 Bacteria 2038
970 Ga0268264_10208891 3300028381 Bacteria 1791
971 Ga0268264_10406525 3300028381 Bacteria 1309
972 Ga0268264_10475908 3300028381 Bacteria 1214
973 Ga0265337_1005487 3300028556 Bacteria 5032
974 Ga0265318_10020071 3300028577 Bacteria 2701
975 Ga0265338_10027443 3300028800 Bacteria 5712
976 Ga0265338_10041953 3300028800 Bacteria 4270
977 Ga0265338_10279590 3300028800 Bacteria 1220
978 Ga0307511_10162010 3300030521 Bacteria 1253
979 Ga0265762_1009325 3300030760 Bacteria 1749
980 Ga0265763_1000858 3300030763 Bacteria 2025
981 Ga0265760_10015831 3300031090 Bacteria 2163
982 Ga0265330_10012081 3300031235 Bacteria 4038
983 Ga0265330_10040936 3300031235 Bacteria 2056
984 Ga0265330_10086514 3300031235 Bacteria 1347
985 Ga0265320_10020669 3300031240 Bacteria 3561
986 Ga0265325_10000011 3300031241 Bacteria 150631
987 Ga0265325_10003712 3300031241 Bacteria 9877
988 Ga0265325_10014736 3300031241 Bacteria 4411
989 Ga0265325_10022034 3300031241 Bacteria 3493
990 Ga0265325_10057438 3300031241 Bacteria 1984
991 Ga0265325_10062114 3300031241 Bacteria 1893
992 Ga0265329_10029376 3300031242 Bacteria 1796
993 Ga0265329_10032779 3300031242 Bacteria 1682
994 Ga0265340_10013469 3300031247 Bacteria 4294
995 Ga0265340_10021550 3300031247 Bacteria 3306
996 Ga0265340_10064325 3300031247 Bacteria 1748
997 Ga0265340_10120326 3300031247 Bacteria 1208
998 Ga0265339_10000323 3300031249 Bacteria 38406
999 Ga0265339_10001920 3300031249 Bacteria 15256
1000 Ga0265339_10054498 3300031249 Bacteria 2172
1001 Ga0265339_10072814 3300031249 Bacteria 1828
1002 Ga0265339_10123366 3300031249 Bacteria 1329
1003 Ga0265339_10168861 3300031249 Bacteria 1096
1004 Ga0265331_10003347 3300031250 Bacteria 10404
1005 Ga0265331_10021350 3300031250 Bacteria 3314
1006 Ga0265331_10091038 3300031250 Bacteria 1409
1007 Ga0265331_10121371 3300031250 Bacteria 1195
1008 Ga0265327_10001225 3300031251 Bacteria 34433
1009 Ga0265316_10034538 3300031344 Bacteria 4106
1010 Ga0307513_10104188 3300031456 Bacteria 2851
1011 Ga0307408_100107474 3300031548 Bacteria 2137
1012 Ga0265313_10001449 3300031595 Bacteria 22152
1013 Ga0265313_10001589 3300031595 Bacteria 21087
1014 Ga0265313_10003565 3300031595 Bacteria 12516
1015 Ga0265313_10009692 3300031595 Bacteria 6214
1016 Ga0265313_10020730 3300031595 Bacteria 3618
1017 Ga0265313_10029784 3300031595 Bacteria 2818
1018 Ga0265313_10040888 3300031595 Bacteria 2288
1019 Ga0316575_10070445 3300031665 Bacteria 1404
1020 Ga0316579_10055021 3300031691 Bacteria 1866
1021 Ga0265314_10013869 3300031711 Bacteria 6486
1022 Ga0265314_10015442 3300031711 Bacteria 6059
1023 Ga0265314_10045240 3300031711 Bacteria 3114
1024 Ga0265314_10076897 3300031711 Bacteria 2216
1025 Ga0265342_10000149 3300031712 Bacteria 79177
1026 Ga0265342_10007848 3300031712 Bacteria 7749
1027 Ga0265342_10019096 3300031712 Bacteria 4423
1028 Ga0265342_10039757 3300031712 Bacteria 2855
1029 Ga0265342_10045575 3300031712 Bacteria 2639
1030 Ga0265342_10119218 3300031712 Bacteria 1487
1031 Ga0316576_10107181 3300031727 Bacteria 2093
1032 Ga0316578_10048911 3300031728 Bacteria 2470
1033 Ga0307413_10112006 3300031824 Bacteria 1829
1034 Ga0307410_10760394 3300031852 Bacteria 821
1035 Ga0307406_10181064 3300031901 Bacteria 1534
1036 Ga0307406_10288537 3300031901 Bacteria 1255
1037 Ga0307412_10153401 3300031911 Bacteria 1703
1038 Ga0307412_10535256 3300031911 Bacteria 981
1039 Ga0307409_100646148 3300031995 Bacteria 1051
1040 Ga0307416_100451831 3300032002 Bacteria 1338
1041 Ga0316583_10000030 3300032133 Bacteria 26612
1042 Ga0373930_0000095 3300034816 Bacteria 9182
1043 Ga0373948_0000228 3300034817 Bacteria 6653
1044 Ga0373958_0000068 3300034819 Bacteria 10448
1045 Ga0373958_0007995 3300034819 Bacteria 1702
1046 Ga0373959_0000647 3300034820 Bacteria 6016
1047 Ga0373938_0000024 3300034957 Bacteria 19333
1048 Ga0373938_0000123 3300034957 Bacteria 10839
1049 Ga0373926_0018881 3300035083 Bacteria 2375
1050 Ga0373926_0020863 3300035083 Bacteria 2265
1051 Ga0373926_0034034 3300035083 Bacteria 1802
1052 Ga0373926_0147383 3300035083 Bacteria 895
1053 Ga0373928_0000414 3300035084 Bacteria 8521
1054 Ga0373928_0005868 3300035084 Bacteria 2349
1055 Ga0373928_0043229 3300035084 Bacteria 1042
1056 Ga0373928_0062581 3300035084 Bacteria 903
1057 Ga0373929_0000244 3300035085 Bacteria 9965
1058 Ga0373929_0000851 3300035085 Bacteria 5946
1059 Ga0373929_0011780 3300035085 Bacteria 1653
1060 Ga0373934_0020094 3300035086 Bacteria 2567
1061 Ga0373934_0039777 3300035086 Bacteria 1854
1062 Ga0373940_0000883 3300035088 Bacteria 5043
1063 Ga0373940_0042643 3300035088 Bacteria 1251
1064 Ga0373944_0004335 3300035089 Bacteria 3692
1065 Ga0373944_0022951 3300035089 Bacteria 1816
1066 Ga0373944_0055312 3300035089 Bacteria 1260
1067 Ga0373944_0110928 3300035089 Bacteria 936
1068 Ga0373944_0124588 3300035089 Bacteria 891
1069 Ga0373944_0135960 3300035089 Bacteria 858
1070 Ga0373951_0000589 3300035091 Bacteria 10027
1071 Ga0373951_0065173 3300035091 Bacteria 919
1072 Ga0373952_0001678 3300035092 Bacteria 4025
1073 Ga0373952_0019323 3300035092 Bacteria 1417
1074 Ga0373923_0001460 3300035111 Bacteria 6789
1075 Ga0373923_0090664 3300035111 Bacteria 1337
1076 Ga0373923_0211333 3300035111 Bacteria 899
1077 Ga0373932_0004049 3300035112 Bacteria 3485
1078 Ga0373932_0028908 3300035112 Bacteria 1527
1079 Ga0373936_0000207 3300035113 Bacteria 19389
1080 Ga0373936_0011857 3300035113 Bacteria 3307
1081 Ga0373936_0026559 3300035113 Bacteria 2267
1082 Ga0373936_0055171 3300035113 Bacteria 1613
1083 Ga0373936_0125171 3300035113 Bacteria 1101
1084 Ga0373939_0000144 3300035114 Bacteria 19991
1085 Ga0373939_0000494 3300035114 Bacteria 9973
1086 Ga0373941_0000087 3300035115 Bacteria 15105
1087 Ga0373941_0006414 3300035115 Bacteria 2834
1088 Ga0373941_0021021 3300035115 Bacteria 1837
1089 Ga0373941_0042002 3300035115 Bacteria 1418
1090 Ga0373945_0000777 3300035116 Bacteria 9315
1091 Ga0373945_0001428 3300035116 Bacteria 7268
1092 Ga0373945_0021379 3300035116 Bacteria 2223
1093 Ga0373945_0077652 3300035116 Bacteria 1267
1094 Ga0373953_0001671 3300035117 Bacteria 6524
1095 Ga0373953_0005830 3300035117 Bacteria 4027
1096 Ga0373953_0039509 3300035117 Bacteria 1870
1097 Ga0373953_0059627 3300035117 Bacteria 1558
1098 Ga0373954_0001529 3300035118 Bacteria 9408
1099 Ga0373954_0003918 3300035118 Bacteria 6369
1100 Ga0373954_0102689 3300035118 Bacteria 1380
1101 Ga0373954_0133876 3300035118 Bacteria 1207
1102 Ga0373956_0003195 3300035119 Bacteria 6622
1103 Ga0373956_0007244 3300035119 Bacteria 4467
1104 Ga0373956_0009272 3300035119 Bacteria 3998
1105 Ga0373957_0015185 3300035120 Bacteria 2647
1106 Ga0373957_0027588 3300035120 Bacteria 2063
1107 Ga0373957_0029065 3300035120 Bacteria 2017
1108 Ga0373957_0036106 3300035120 Bacteria 1840
1109 Ga0373957_0041093 3300035120 Bacteria 1740
1110 Ga0373957_0045754 3300035120 Bacteria 1659
1111 Ga0373957_0054452 3300035120 Bacteria 1537
1112 Ga0373960_0000084 3300035121 Bacteria 13972
1113 Ga0373960_0090397 3300035121 Bacteria 978
1114 Ga0373960_0102997 3300035121 Bacteria 927
1115 Ga0373943_0000284 3300035170 Bacteria 21002
1116 Ga0373943_0002532 3300035170 Bacteria 8309
1117 Ga0373943_0014380 3300035170 Bacteria 3582
1118 Ga0373943_0019966 3300035170 Bacteria 3086
1119 Ga0373943_0038607 3300035170 Bacteria 2297
1120 Ga0373943_0120226 3300035170 Bacteria 1395
1121 Ga0373943_0141050 3300035170 Bacteria 1298
1122 Ga0373946_0000695 3300035171 Bacteria 11350
1123 Ga0373946_0002959 3300035171 Bacteria 6027
1124 Ga0373946_0009548 3300035171 Bacteria 3576
1125 Ga0373946_0096209 3300035171 Bacteria 1320
1126 Ga0373955_0000939 3300035172 Bacteria 12465
1127 Ga0373955_0020961 3300035172 Bacteria 3292
1128 Ga0373955_0022592 3300035172 Bacteria 3192
1129 Ga0373955_0025875 3300035172 Bacteria 3017
1130 Ga0373955_0069900 3300035172 Bacteria 1960
1131 Ga0373955_0115527 3300035172 Bacteria 1555
1132 Ga0373955_0195555 3300035172 Bacteria 1203
1133 Ga0373942_0000345 3300035207 Bacteria 12686
1134 Ga0373942_0024473 3300035207 Bacteria 1548
1135 Ga0373961_0000298 3300035241 Bacteria 22185
1136 Ga0373961_0119758 3300035241 Bacteria 871
1137 Ga0373962_0000490 3300035242 Bacteria 8786
1138 Ga0373962_0026721 3300035242 Bacteria 1558
1139 Ga0373962_0038087 3300035242 Bacteria 1345
1140 Ga0373962_0071855 3300035242 Bacteria 1036
1141 Ga0316574_0000211 3300035398 Bacteria 20517
1142 Ga0373924_0000420 3300035410 Bacteria 12971
1143 Ga0373924_0010729 3300035410 Bacteria 3389
1144 Ga0373924_0018992 3300035410 Bacteria 2658
1145 Ga0373924_0019629 3300035410 Bacteria 2620
1146 Ga0373924_0022643 3300035410 Bacteria 2457
1147 Ga0373924_0050885 3300035410 Bacteria 1717
1148 Ga0373924_0075188 3300035410 Bacteria 1429
1149 Ga0373931_0002660 3300035691 Bacteria 7947
1150 Ga0373931_0006309 3300035691 Bacteria 5532
1151 Ga0373931_0009404 3300035691 Bacteria 4673
1152 Ga0373931_0009501 3300035691 Bacteria 4651
1153 Ga0373931_0019643 3300035691 Bacteria 3375
1154 Ga0373931_0077504 3300035691 Bacteria 1827
1155 Ga0373931_0095815 3300035691 Bacteria 1661
1156 Ga0373931_0416183 3300035691 Bacteria 854
1157 Ga0373935_0000068 3300035692 Bacteria 43997
1158 Ga0373935_0001340 3300035692 Bacteria 13632
1159 Ga0373935_0004603 3300035692 Bacteria 8107
1160 Ga0373935_0033167 3300035692 Bacteria 3212
1161 Ga0373935_0035234 3300035692 Bacteria 3124
1162 Ga0373935_0047368 3300035692 Bacteria 2718
1163 Ga0373935_0124991 3300035692 Bacteria 1722
1164 Ga0373935_0291884 3300035692 Bacteria 1150
1165 Ga0373927_0000892 3300035695 Bacteria 22721
1166 Ga0373927_0007778 3300035695 Bacteria 7249
1167 Ga0373927_0013606 3300035695 Bacteria 5403
1168 Ga0373927_0017506 3300035695 Bacteria 4714
1169 Ga0373927_0028055 3300035695 Bacteria 3673
1170 Ga0373927_0040077 3300035695 Bacteria 3039
1171 Ga0373927_0044599 3300035695 Bacteria 2869
1172 Ga0373927_0068542 3300035695 Bacteria 2295
1173 Ga0373927_0089508 3300035695 Bacteria 1998
1174 Ga0373927_0107455 3300035695 Bacteria 1817
1175 Ga0373927_0122064 3300035695 Bacteria 1700
1176 Ga0373927_0165875 3300035695 Bacteria 1447
1177 Ga0373927_0237513 3300035695 Bacteria 1197
1178 Ga0373927_0407104 3300035695 Bacteria 898
1179 Ga0373933_0002505 3300035724 Bacteria 10327
1180 Ga0373933_0006990 3300035724 Bacteria 6153
1181 Ga0373933_0019730 3300035724 Bacteria 3813
1182 Ga0373933_0035338 3300035724 Bacteria 2918
1183 Ga0373933_0169074 3300035724 Bacteria 1391
1184 Ga0373933_0216853 3300035724 Bacteria 1227
1185 Ga0373933_0438419 3300035724 Bacteria 854
1186 Ga0373947_0001171 3300035725 Bacteria 16128
1187 Ga0373947_0001272 3300035725 Bacteria 15537
1188 Ga0373947_0023230 3300035725 Bacteria 3605
1189 Ga0373947_0024918 3300035725 Bacteria 3488
1190 Ga0373947_0040448 3300035725 Bacteria 2777
1191 Ga0373947_0057180 3300035725 Bacteria 2359
1192 Ga0373947_0071540 3300035725 Bacteria 2127
1193 Ga0373947_0144980 3300035725 Bacteria 1526
1194 Ga0373947_0159507 3300035725 Bacteria 1458
1195 Ga0373947_0180941 3300035725 Bacteria 1372
1196 Ga0373947_0201741 3300035725 Bacteria 1301
1197 Ga0373947_0265333 3300035725 Bacteria 1138
1198 Ga0373947_0420068 3300035725 Bacteria 904
1199 Ga0373937_0000347 3300036401 Bacteria 43749
1200 Ga0373937_0008050 3300036401 Bacteria 9140
1201 Ga0373937_0011304 3300036401 Bacteria 7830
1202 Ga0373937_0026143 3300036401 Bacteria 5274
1203 Ga0373937_0027513 3300036401 Bacteria 5141
1204 Ga0373937_0057623 3300036401 Bacteria 3569
1205 Ga0373937_0098779 3300036401 Bacteria 2708
1206 Ga0373937_0188576 3300036401 Bacteria 1937
1207 Ga0373937_0229258 3300036401 Bacteria 1749
1208 Ga0373937_0232213 3300036401 Bacteria 1737
1209 Ga0373937_0469428 3300036401 Bacteria 1195
1210 Ga0373937_0495646 3300036401 Bacteria 1160
1211 Ga0316582_0353427 3300036647 Bacteria 1011
1212 Ga0316584_0008194 3300036712 Bacteria 7188
1213 Ga0373925_0000081 3300037068 Bacteria 102407
1214 Ga0373925_0000653 3300037068 Bacteria 32591
1215 Ga0373925_0001023 3300037068 Bacteria 25318
1216 Ga0373925_0008272 3300037068 Bacteria 7570
1217 Ga0373925_0025054 3300037068 Bacteria 4357
1218 Ga0373925_0030678 3300037068 Bacteria 3947
1219 Ga0373925_0046325 3300037068 Bacteria 3233
1220 Ga0373925_0049791 3300037068 Bacteria 3123
1221 Ga0373925_0050717 3300037068 Bacteria 3096
1222 Ga0373925_0058583 3300037068 Bacteria 2888
1223 Ga0373925_0095524 3300037068 Bacteria 2277
1224 Ga0373925_0155767 3300037068 Bacteria 1797
1225 Ga0373925_0164207 3300037068 Bacteria 1751
1226 Ga0373925_0191875 3300037068 Bacteria 1621
1227 Ga0373925_0229783 3300037068 Bacteria 1483
1228 Ga0373925_0294800 3300037068 Bacteria 1308
1229 Ga0373925_0507200 3300037068 Bacteria 990
1230 Ga0373925_0758593 3300037068 Bacteria 800
1231 Ga0395899_0032551 3300037312 Bacteria 3916
1232 Ga0395899_0213489 3300037312 Bacteria 1340
1233 Ga0395900_0006665 3300037418 Bacteria 12001
1234 Ga0395900_0028654 3300037418 Bacteria 5707
1235 Ga0395900_0098941 3300037418 Bacteria 2996
1236 Ga0395900_0172509 3300037418 Bacteria 2201
1237 Ga0395900_0200420 3300037418 Bacteria 2020
1238 Ga0395898_0035860 3300037466 Bacteria 4929
1239 Ga0395898_0038265 3300037466 Bacteria 4755
1240 Ga0395898_0085008 3300037466 Bacteria 3050
1241 Ga0395898_0092455 3300037466 Bacteria 2909
1242 Ga0395898_0283432 3300037466 Bacteria 1580
1243 Ga0395905_0302093 3300037471 Bacteria 1488
1244 Ga0436364_0121626 3300037853 Bacteria 20150
1245 Ga0436364_0338040 3300037853 Bacteria 2394
1246 Ga0436364_0627969 3300037853 Bacteria 1385
1247 Ga0436364_0660984 3300037853 Bacteria 4632
1248 Ga0436364_0901640 3300037853 Bacteria 1900
1249 Ga0436364_0916700 3300037853 Bacteria 2244
1250 Ga0436364_1474445 3300037853 Bacteria 1793
1251 Ga0436364_1519170 3300037853 Bacteria 1089
1252 Ga0395901_0025427 3300038443 Bacteria 6077
1253 Ga0395901_0026822 3300038443 Bacteria 5916
1254 Ga0395901_0040513 3300038443 Bacteria 4825
1255 Ga0395901_0902692 3300038443 Bacteria 865
1256 Ga0242420_002911 3300038996 Bacteria 2488
1257 Ga0436365_0059281 3300039437 Bacteria 3207
1258 Ga0436365_0122255 3300039437 Bacteria 6640
1259 Ga0436365_0248540 3300039437 Bacteria 1905
1260 Ga0436365_1138132 3300039437 Bacteria 1348
1261 Ga0436365_1168875 3300039437 Bacteria 1571
1262 Ga0436365_1227273 3300039437 Bacteria 1978
1263 Ga0436365_1288986 3300039437 Bacteria 1856
1264 Ga0436365_1489999 3300039437 Bacteria 6004
1265 Ga0436365_1546564 3300039437 Bacteria 2826
1266 Ga0436365_1586594 3300039437 Bacteria 1333
1267 Ga0436365_1636132 3300039437 Bacteria 1151
1268 Ga0436365_1743112 3300039437 Bacteria 1354
1269 Ga0436365_1808718 3300039437 Bacteria 864
1270 Ga0436360_0104217 3300039438 Bacteria 745
1271 Ga0436360_0526234 3300039438 Bacteria 1540
1272 Ga0436361_0396460 3300039447 Bacteria 1735
1273 Ga0436361_0537381 3300039447 Bacteria 3047
1274 Ga0436363_1053196 3300039450 Bacteria 1617
1275 Ga0436362_0029375 3300039453 Bacteria 786
1276 Ga0436362_0103934 3300039453 Bacteria 1410
1277 Ga0436362_0842372 3300039453 Bacteria 1346
1278 Ga0451793_1602144 3300041452 Bacteria 1202
1279 Ga0451798_0255151 3300041458 Bacteria 935
1280 Ga0451800_0275571 3300041459 Bacteria 889
1281 Ga0439441_046807 3300042001 Bacteria 881
1282 Ga0439443_001105 3300042003 Bacteria 2835
1283 Ga0439448_0009804 3300042005 Bacteria 2829
1284 Ga0439450_003605 3300042008 Bacteria 2577
1285 Ga0439452_038943 3300042010 Bacteria 1127
1286 Ga0439455_0077232 3300042012 Bacteria 901
1287 Ga0439456_012957 3300042013 Bacteria 1732
1288 Ga0439458_0072824 3300042157 Bacteria 869
1289 Ga0439434_0095338 3300042435 Bacteria 955
1290 Ga0439435_0013920 3300042436 Bacteria 1979
1291 Ga0439435_0033029 3300042436 Bacteria 1414
1292 Ga0439459_0010364 3300042438 Bacteria 1625
1293 Ga0439460_0024666 3300042461 Bacteria 1668
1294 Ga0439460_0030144 3300042461 Bacteria 1540
1295 Ga0450916_015667 3300042530 Bacteria 998
1296 Ga0450893_0026988 3300042532 Bacteria 1011
1297 Ga0466961_0213607 3300044693 Bacteria 1190
1298 Ga0466963_0015054 3300044694 Bacteria 4781
1299 Ga0466963_0050712 3300044694 Bacteria 2747
1300 Ga0466964_0199296 3300044706 Bacteria 960
1301 Ga0453684_0016107 3300044712 Bacteria 11730
1302 Ga0466971_0011557 3300044719 Bacteria 3866
1303 Ga0466968_0043860 3300044735 Bacteria 1895
1304 Ga0466957_0007649 3300044842 Bacteria 6110
1305 Ga0466957_0030543 3300044842 Bacteria 3217
1306 Ga0466959_0053759 3300045049 Bacteria 2943
1307 Ga0466959_0128956 3300045049 Bacteria 1793
1308 Ga0451576_0092818 3300045051 Bacteria 3139
1309 Ga0451576_0288386 3300045051 Bacteria 1716
1310 Ga0466958_0016565 3300045836 Bacteria 4246
1311 Ga0466958_0162419 3300045836 Bacteria 1412
1312 Ga0466958_0245248 3300045836 Bacteria 1145
1313 Ga0466967_0018949 3300045976 Bacteria 5520
1314 Ga0466967_0217467 3300045976 Bacteria 1814
1315 Ga0466967_0469013 3300045976 Bacteria 1232
1316 Ga0495617_050620 3300046452 Bacteria 1382
1317 Ga0495617_078054 3300046452 Bacteria 1086
1318 Ga0495627_036133 3300046453 Bacteria 1537
1319 Ga0495592_0000196 3300046454 Bacteria 51625
1320 Ga0495592_0008970 3300046454 Bacteria 7513
1321 Ga0495592_0025624 3300046454 Bacteria 4475
1322 Ga0495592_0037087 3300046454 Bacteria 3670
1323 Ga0495592_0053905 3300046454 Bacteria 2981
1324 Ga0495603_0000093 3300046455 Bacteria 40890
1325 Ga0495603_0054690 3300046455 Bacteria 2365
1326 Ga0495603_0128064 3300046455 Bacteria 1479
1327 Ga0495603_0214608 3300046455 Bacteria 1111
1328 Ga0495603_0360902 3300046455 Bacteria 833
1329 Ga0495591_057995 3300046458 Bacteria 1036
1330 Ga0495629_0001201 3300046459 Bacteria 20401
1331 Ga0495629_0010557 3300046459 Bacteria 6721
1332 Ga0495629_0012746 3300046459 Bacteria 6086
1333 Ga0495629_0027735 3300046459 Bacteria 4021
1334 Ga0495629_0059328 3300046459 Bacteria 2674
1335 Ga0495629_0064371 3300046459 Bacteria 2560
1336 Ga0495629_0086242 3300046459 Bacteria 2190
1337 Ga0495629_0225442 3300046459 Bacteria 1292
1338 Ga0495638_0012740 3300046460 Bacteria 5748
1339 Ga0495638_0021453 3300046460 Bacteria 4257
1340 Ga0495641_0020177 3300046461 Bacteria 3389
1341 Ga0495641_0021631 3300046461 Bacteria 3232
1342 Ga0495641_0114948 3300046461 Bacteria 1200
1343 Ga0495641_0223227 3300046461 Bacteria 845
1344 Ga0495651_0002348 3300046462 Bacteria 14609
1345 Ga0495651_0002948 3300046462 Bacteria 13159
1346 Ga0495651_0005382 3300046462 Bacteria 9767
1347 Ga0495651_0021551 3300046462 Bacteria 5008
1348 Ga0495651_0042323 3300046462 Bacteria 3537
1349 Ga0495651_0083231 3300046462 Bacteria 2413
1350 Ga0495651_0094627 3300046462 Bacteria 2235
1351 Ga0495651_0171422 3300046462 Bacteria 1545
1352 Ga0495653_0000193 3300046463 Bacteria 49516
1353 Ga0495653_0009994 3300046463 Bacteria 7762
1354 Ga0495653_0019439 3300046463 Bacteria 5510
1355 Ga0495653_0035077 3300046463 Bacteria 3961
1356 Ga0495653_0057712 3300046463 Bacteria 2953
1357 Ga0495653_0097052 3300046463 Bacteria 2142
1358 Ga0495653_0227148 3300046463 Bacteria 1251
1359 Ga0495653_0400753 3300046463 Bacteria 872
1360 Ga0495580_0007841 3300046472 Bacteria 8549
1361 Ga0495580_0010786 3300046472 Bacteria 7096
1362 Ga0495580_0096357 3300046472 Bacteria 2057
1363 Ga0495582_0005327 3300046473 Bacteria 7183
1364 Ga0495582_0152078 3300046473 Bacteria 1314
1365 Ga0495582_0190635 3300046473 Bacteria 1169
1366 Ga0495582_0282348 3300046473 Bacteria 953
1367 Ga0495582_0415554 3300046473 Bacteria 776
1368 Ga0495605_0156893 3300046474 Bacteria 1012
1369 Ga0495639_0005974 3300046475 Bacteria 5235
1370 Ga0495639_0011892 3300046475 Bacteria 3754
1371 Ga0495639_0044738 3300046475 Bacteria 2001
1372 Ga0495639_0059835 3300046475 Bacteria 1744
1373 Ga0495639_0074989 3300046475 Bacteria 1568
1374 Ga0495639_0131573 3300046475 Bacteria 1198
1375 Ga0495662_0002058 3300046476 Bacteria 10084
1376 Ga0495662_0015755 3300046476 Bacteria 3668
1377 Ga0495662_0018838 3300046476 Bacteria 3340
1378 Ga0495662_0038790 3300046476 Bacteria 2302
1379 Ga0495662_0220777 3300046476 Bacteria 934
1380 Ga0495664_0000016 3300046477 Bacteria 175933
1381 Ga0495664_0008894 3300046477 Bacteria 5612
1382 Ga0495664_0027162 3300046477 Bacteria 3336
1383 Ga0495664_0031450 3300046477 Bacteria 3111
1384 Ga0495664_0109799 3300046477 Bacteria 1664
1385 Ga0495664_0121094 3300046477 Bacteria 1583
1386 Ga0495584_0015525 3300046491 Bacteria 3881
1387 Ga0495584_0028278 3300046491 Bacteria 2840
1388 Ga0495584_0200121 3300046491 Bacteria 1015
1389 Ga0495585_0000744 3300046492 Bacteria 28955
1390 Ga0495594_0000721 3300046499 Bacteria 16981
1391 Ga0495594_0087294 3300046499 Bacteria 1745
1392 Ga0495607_0004149 3300046501 Bacteria 10786
1393 Ga0495607_0136966 3300046501 Bacteria 1267
1394 Ga0495607_0210563 3300046501 Bacteria 957
1395 Ga0495608_0000121 3300046511 Bacteria 56189
1396 Ga0495608_0000771 3300046511 Bacteria 22430
1397 Ga0495608_0014487 3300046511 Bacteria 5469
1398 Ga0495608_0040568 3300046511 Bacteria 3118
1399 Ga0495608_0112226 3300046511 Bacteria 1752
1400 Ga0495608_0113543 3300046511 Bacteria 1740
1401 Ga0495616_0016978 3300046513 Bacteria 4020
1402 Ga0495618_0000124 3300046514 Bacteria 56215
1403 Ga0495618_0005183 3300046514 Bacteria 7964
1404 Ga0495618_0017457 3300046514 Bacteria 4401
1405 Ga0495618_0018922 3300046514 Bacteria 4231
1406 Ga0495618_0042509 3300046514 Bacteria 2865
1407 Ga0495618_0055657 3300046514 Bacteria 2504
1408 Ga0495620_0172302 3300046515 Bacteria 839
1409 Ga0495628_0000018 3300046516 Bacteria 169916
1410 Ga0495628_0000983 3300046516 Bacteria 26069
1411 Ga0495628_0009078 3300046516 Bacteria 8504
1412 Ga0495628_0027680 3300046516 Bacteria 4609
1413 Ga0495628_0036129 3300046516 Bacteria 3967
1414 Ga0495628_0130602 3300046516 Bacteria 1921
1415 Ga0495628_0258302 3300046516 Bacteria 1299
1416 Ga0495628_0514395 3300046516 Bacteria 863
1417 Ga0495630_0003520 3300046517 Bacteria 10898
1418 Ga0495630_0017798 3300046517 Bacteria 5210
1419 Ga0495630_0024763 3300046517 Bacteria 4436
1420 Ga0495630_0077425 3300046517 Bacteria 2507
1421 Ga0495630_0085278 3300046517 Bacteria 2384
1422 Ga0495630_0160731 3300046517 Bacteria 1710
1423 Ga0495630_0276089 3300046517 Bacteria 1284
1424 Ga0495630_0278009 3300046517 Bacteria 1279
1425 Ga0495630_0289424 3300046517 Bacteria 1252
1426 Ga0495630_0341734 3300046517 Bacteria 1145
1427 Ga0495637_0037120 3300046520 Bacteria 2118
1428 Ga0495643_0196220 3300046522 Bacteria 972
1429 Ga0495644_0001408 3300046523 Bacteria 9823
1430 Ga0495644_0167041 3300046523 Bacteria 844
1431 Ga0495663_0117490 3300046525 Bacteria 888
1432 Ga0495666_0042442 3300046526 Bacteria 2199
1433 Ga0495666_0043799 3300046526 Bacteria 2161
1434 Ga0495652_0000005 3300046529 Bacteria 524368
1435 Ga0495652_0002733 3300046529 Bacteria 17857
1436 Ga0495652_0051626 3300046529 Bacteria 3511
1437 Ga0495652_0058542 3300046529 Bacteria 3261
1438 Ga0495652_0066677 3300046529 Bacteria 3019
1439 Ga0495652_0089511 3300046529 Bacteria 2520
1440 Ga0495652_0106119 3300046529 Bacteria 2269
1441 Ga0495652_0125251 3300046529 Bacteria 2042
1442 Ga0495652_0141866 3300046529 Bacteria 1888
1443 Ga0495652_0190519 3300046529 Bacteria 1565
1444 Ga0495652_0286467 3300046529 Bacteria 1204
1445 Ga0495652_0342268 3300046529 Bacteria 1074
1446 Ga0495665_0009999 3300046531 Bacteria 5138
1447 Ga0495665_0058209 3300046531 Bacteria 2040
1448 Ga0495665_0118793 3300046531 Bacteria 1385
1449 Ga0495665_0134352 3300046531 Bacteria 1294
1450 Ga0495665_0146541 3300046531 Bacteria 1233
1451 Ga0495665_0309354 3300046531 Bacteria 808
1452 Ga0495640_0000063 3300046533 Bacteria 60255
1453 Ga0495640_0006976 3300046533 Bacteria 8896
1454 Ga0495640_0008162 3300046533 Bacteria 8220
1455 Ga0495640_0020151 3300046533 Bacteria 4913
1456 Ga0495640_0026278 3300046533 Bacteria 4209
1457 Ga0495640_0028991 3300046533 Bacteria 3979
1458 Ga0495640_0073498 3300046533 Bacteria 2289
1459 Ga0495640_0084335 3300046533 Bacteria 2107
1460 Ga0495640_0111190 3300046533 Bacteria 1790
1461 Ga0495640_0225160 3300046533 Bacteria 1181
1462 Ga0495640_0282941 3300046533 Bacteria 1032
1463 Ga0495586_0013527 3300046535 Bacteria 4328
1464 Ga0495586_0193971 3300046535 Bacteria 1150
1465 Ga0495587_0000134 3300046536 Bacteria 56076
1466 Ga0495587_0001646 3300046536 Bacteria 14900
1467 Ga0495587_0002875 3300046536 Bacteria 11533
1468 Ga0495587_0029159 3300046536 Bacteria 3352
1469 Ga0495587_0039375 3300046536 Bacteria 2829
1470 Ga0495587_0039844 3300046536 Bacteria 2810
1471 Ga0495587_0078567 3300046536 Bacteria 1914
1472 Ga0495598_0003261 3300046537 Bacteria 3428
1473 Ga0495598_0051766 3300046537 Bacteria 1238
1474 Ga0495598_0095176 3300046537 Bacteria 977
1475 Ga0495609_0093773 3300046538 Bacteria 1304
1476 Ga0495609_0198642 3300046538 Bacteria 839
1477 Ga0495645_0000070 3300046543 Bacteria 71823
1478 Ga0495645_0000964 3300046543 Bacteria 19618
1479 Ga0495645_0010945 3300046543 Bacteria 6369
1480 Ga0495645_0032016 3300046543 Bacteria 3835
1481 Ga0495645_0101869 3300046543 Bacteria 2041
1482 Ga0495645_0169314 3300046543 Bacteria 1504
1483 Ga0495622_0000860 3300046557 Bacteria 16649
1484 Ga0495622_0046427 3300046557 Bacteria 2018
1485 Ga0495633_0001138 3300046558 Bacteria 21358
1486 Ga0495667_0000023 3300046559 Bacteria 169343
1487 Ga0495667_0001135 3300046559 Bacteria 17343
1488 Ga0495667_0001703 3300046559 Bacteria 14601
1489 Ga0495667_0012592 3300046559 Bacteria 5735
1490 Ga0495667_0013045 3300046559 Bacteria 5628
1491 Ga0495667_0033063 3300046559 Bacteria 3461
1492 Ga0495667_0045998 3300046559 Bacteria 2887
1493 Ga0495667_0077552 3300046559 Bacteria 2161
1494 Ga0495667_0353605 3300046559 Bacteria 928
1495 Ga0495656_0000294 3300046615 Bacteria 17355
1496 Ga0495656_0031553 3300046615 Bacteria 2150
1497 Ga0495668_0109391 3300046616 Bacteria 1512
1498 Ga0495634_0001421 3300046642 Bacteria 21381
1499 Ga0495634_0010247 3300046642 Bacteria 6866
1500 Ga0495634_0010782 3300046642 Bacteria 6686
1501 Ga0495634_0021067 3300046642 Bacteria 4616
1502 Ga0495634_0081754 3300046642 Bacteria 2112
1503 Ga0495634_0098959 3300046642 Bacteria 1886
1504 Ga0495634_0253731 3300046642 Bacteria 1075
1505 Ga0495611_0023332 3300046648 Bacteria 2683
1506 Ga0495611_0075383 3300046648 Bacteria 1546
1507 Ga0495635_0000045 3300046663 Bacteria 82266
1508 Ga0495635_0012375 3300046663 Bacteria 5979
1509 Ga0495635_0013259 3300046663 Bacteria 5768
1510 Ga0495635_0015541 3300046663 Bacteria 5320
1511 Ga0495635_0025544 3300046663 Bacteria 4115
1512 Ga0495635_0086485 3300046663 Bacteria 2145
1513 Ga0495635_0153273 3300046663 Bacteria 1569
1514 Ga0495659_0000910 3300046664 Bacteria 10516
1515 Ga0495659_0007996 3300046664 Bacteria 3357
1516 Ga0495659_0028993 3300046664 Bacteria 1919
1517 Ga0495659_0051172 3300046664 Bacteria 1504
1518 Ga0495661_0142490 3300046665 Bacteria 1302
1519 Ga0495661_0268576 3300046665 Bacteria 864
1520 Ga0495588_0015102 3300046674 Bacteria 3710
1521 Ga0495588_0035827 3300046674 Bacteria 2516
1522 Ga0495657_0001484 3300046675 Bacteria 20216
1523 Ga0495657_0009705 3300046675 Bacteria 7278
1524 Ga0495657_0020415 3300046675 Bacteria 4761
1525 Ga0495657_0061911 3300046675 Bacteria 2474
1526 Ga0495657_0357786 3300046675 Bacteria 863
1527 Ga0495599_0000107 3300046678 Bacteria 56178
1528 Ga0495599_0004271 3300046678 Bacteria 8443
1529 Ga0495599_0012935 3300046678 Bacteria 5151
1530 Ga0495599_0140992 3300046678 Bacteria 1495
1531 Ga0495599_0172179 3300046678 Bacteria 1335
1532 Ga0495599_0249395 3300046678 Bacteria 1081
1533 Ga0495599_0253644 3300046678 Bacteria 1070
1534 Ga0495623_0001191 3300046679 Bacteria 17644
1535 Ga0495623_0007416 3300046679 Bacteria 7122
1536 Ga0495623_0008866 3300046679 Bacteria 6528
1537 Ga0495623_0014856 3300046679 Bacteria 5035
1538 Ga0495623_0055588 3300046679 Bacteria 2495
1539 Ga0495646_0000027 3300046680 Bacteria 97629
1540 Ga0495646_0032793 3300046680 Bacteria 3230
1541 Ga0495646_0037398 3300046680 Bacteria 3002
1542 Ga0495646_0047543 3300046680 Bacteria 2611
1543 Ga0495647_0011106 3300046681 Bacteria 3079
1544 Ga0495647_0120031 3300046681 Bacteria 1105
1545 Ga0495647_0221901 3300046681 Bacteria 835
1546 Ga0495658_0011800 3300046683 Bacteria 4405
1547 Ga0495658_0041663 3300046683 Bacteria 2559
1548 Ga0495658_0051957 3300046683 Bacteria 2322
1549 Ga0495658_0069244 3300046683 Bacteria 2045
1550 Ga0495658_0166566 3300046683 Bacteria 1362
1551 Ga0495669_0029452 3300046684 Bacteria 2408
1552 Ga0495669_0050152 3300046684 Bacteria 1871
1553 Ga0495613_0001829 3300046689 Bacteria 16164
1554 Ga0495613_0001924 3300046689 Bacteria 15748
1555 Ga0495613_0006830 3300046689 Bacteria 8523
1556 Ga0495613_0090999 3300046689 Bacteria 2209
1557 Ga0495613_0138925 3300046689 Bacteria 1737
1558 Ga0495613_0146571 3300046689 Bacteria 1684
1559 Ga0495613_0163629 3300046689 Bacteria 1581
1560 Ga0495624_0003159 3300046690 Bacteria 12283
1561 Ga0495624_0039069 3300046690 Bacteria 3044
1562 Ga0495624_0115043 3300046690 Bacteria 1653
1563 Ga0495624_0188625 3300046690 Bacteria 1254
1564 Ga0495624_0394134 3300046690 Bacteria 831
1565 Ga0495670_0002475 3300046691 Bacteria 9116
1566 Ga0495670_0134647 3300046691 Bacteria 1289
1567 Ga0495671_0055359 3300046692 Bacteria 1965
1568 Ga0495671_0300586 3300046692 Bacteria 772
1569 Ga0495600_0000062 3300046809 Bacteria 61420
1570 Ga0495600_0007173 3300046809 Bacteria 6806
1571 Ga0495600_0011446 3300046809 Bacteria 5528
1572 Ga0495600_0022696 3300046809 Bacteria 4032
1573 Ga0495600_0063032 3300046809 Bacteria 2422
1574 Ga0495600_0170741 3300046809 Bacteria 1404
1575 Ga0495600_0337010 3300046809 Bacteria 946
1576 Ga0495581_0001040 3300047315 Bacteria 15017
1577 Ga0495581_0024139 3300047315 Bacteria 3523
1578 Ga0495581_0038630 3300047315 Bacteria 2762
1579 Ga0495581_0046212 3300047315 Bacteria 2515
1580 Ga0495581_0079606 3300047315 Bacteria 1896
1581 Ga0495581_0138786 3300047315 Bacteria 1417
1582 Ga0495604_0000014 3300047317 Bacteria 205481
1583 Ga0495604_0002499 3300047317 Bacteria 14688
1584 Ga0495604_0053444 3300047317 Bacteria 3121
1585 Ga0495604_0055049 3300047317 Bacteria 3067
1586 Ga0495604_0078633 3300047317 Bacteria 2475
1587 Ga0495604_0080164 3300047317 Bacteria 2447
1588 Ga0495604_0099497 3300047317 Bacteria 2140
1589 Ga0495674_0000014 3300047319 Bacteria 241211
1590 Ga0495674_0016669 3300047319 Bacteria 6855
1591 Ga0495674_0023132 3300047319 Bacteria 5727
1592 Ga0495674_0049831 3300047319 Bacteria 3697
1593 Ga0495674_0049897 3300047319 Bacteria 3695
1594 Ga0495674_0057712 3300047319 Bacteria 3397
1595 Ga0495674_0059508 3300047319 Bacteria 3336
1596 Ga0495674_0216636 3300047319 Bacteria 1584
1597 Ga0495674_0356436 3300047319 Bacteria 1187
1598 Ga0495674_0357015 3300047319 Bacteria 1185
1599 Ga0495674_0361912 3300047319 Bacteria 1176
1600 Ga0495672_0065395 3300047320 Bacteria 2079
1601 Ga0495672_0164150 3300047320 Bacteria 1139
1602 Ga0495676_0046149 3300047321 Bacteria 3539
1603 Ga0495676_0080907 3300047321 Bacteria 2464
1604 Ga0495676_0084335 3300047321 Bacteria 2397
1605 Ga0495676_0153985 3300047321 Bacteria 1633
1606 Ga0495676_0190838 3300047321 Bacteria 1429
1607 Ga0495680_0002314 3300047322 Bacteria 19559
1608 Ga0495680_0005915 3300047322 Bacteria 11432
1609 Ga0495680_0009630 3300047322 Bacteria 8674
1610 Ga0495680_0014720 3300047322 Bacteria 6763
1611 Ga0495680_0035972 3300047322 Bacteria 3981
1612 Ga0495680_0054521 3300047322 Bacteria 3104
1613 Ga0495680_0059006 3300047322 Bacteria 2964
1614 Ga0495680_0181817 3300047322 Bacteria 1517
1615 Ga0495680_0247426 3300047322 Bacteria 1265
1616 Ga0495675_0000058 3300047444 Bacteria 77587
1617 Ga0495675_0002587 3300047444 Bacteria 10845
1618 Ga0495675_0017488 3300047444 Bacteria 4544
1619 Ga0495675_0049171 3300047444 Bacteria 2681
1620 Ga0495675_0081769 3300047444 Bacteria 2034
1621 Ga0495675_0237466 3300047444 Bacteria 1098
1622 Ga0495677_0108541 3300047445 Bacteria 1054
1623 Ga0495685_010080 3300047447 Bacteria 3166
1624 Ga0495684_0000059 3300047471 Bacteria 77947
1625 Ga0495684_0002058 3300047471 Bacteria 16177
1626 Ga0495684_0060169 3300047471 Bacteria 2892
1627 Ga0495684_0124863 3300047471 Bacteria 1936
1628 Ga0495684_0129220 3300047471 Bacteria 1899
1629 Ga0495684_0244855 3300047471 Bacteria 1306
1630 Ga0495593_0000892 3300047673 Bacteria 17349
1631 Ga0495593_0002389 3300047673 Bacteria 11288
1632 Ga0495593_0006746 3300047673 Bacteria 6718
1633 Ga0495593_0012827 3300047673 Bacteria 4787
1634 Ga0495593_0041503 3300047673 Bacteria 2473
1635 Ga0495593_0084739 3300047673 Bacteria 1636
1636 Ga0495602_0000017 3300048088 Bacteria 184180
1637 Ga0495602_0003589 3300048088 Bacteria 16070
1638 Ga0495602_0009345 3300048088 Bacteria 10198
1639 Ga0495602_0021745 3300048088 Bacteria 6303
1640 Ga0495602_0075453 3300048088 Bacteria 2861
1641 Ga0495602_0111881 3300048088 Bacteria 2217
1642 Ga0495602_0367535 3300048088 Bacteria 1034
1643 Ga0495614_0009570 3300048089 Bacteria 4283
1644 Ga0495614_0013572 3300048089 Bacteria 3572
1645 Ga0495614_0083069 3300048089 Bacteria 1389
1646 Ga0495614_0191860 3300048089 Bacteria 922
1647 Ga0496100_0000919 3300048903 Bacteria 14036
1648 Ga0496100_0006499 3300048903 Bacteria 6377
1649 Ga0496100_0019742 3300048903 Bacteria 4027
1650 Ga0496100_0027242 3300048903 Bacteria 3513
1651 Ga0496100_0038257 3300048903 Bacteria 3039
1652 Ga0496100_0066987 3300048903 Bacteria 2383
1653 Ga0496100_0139605 3300048903 Bacteria 1716
1654 Ga0496100_0174481 3300048903 Bacteria 1551
1655 Ga0496100_0264740 3300048903 Bacteria 1276
1656 Ga0496100_0365725 3300048903 Bacteria 1092
1657 Ga0496101_0000569 3300048904 Bacteria 22604
1658 Ga0496101_0012497 3300048904 Bacteria 5666
1659 Ga0496101_0024358 3300048904 Bacteria 4188
1660 Ga0496101_0088947 3300048904 Bacteria 2294
1661 Ga0496101_0161752 3300048904 Bacteria 1717
1662 Ga0496101_0270579 3300048904 Bacteria 1326
1663 Ga0496101_0273467 3300048904 Bacteria 1319
1664 Ga0496101_0306739 3300048904 Bacteria 1244
1665 Ga0496101_0597260 3300048904 Bacteria 873
1666 Ga0496102_0008204 3300048905 Bacteria 8939
1667 Ga0496102_0017532 3300048905 Bacteria 6272
1668 Ga0496102_0032540 3300048905 Bacteria 4684
1669 Ga0496102_0033436 3300048905 Bacteria 4621
1670 Ga0496102_0044888 3300048905 Bacteria 4011
1671 Ga0496102_0141274 3300048905 Bacteria 2258
1672 Ga0496102_0158894 3300048905 Bacteria 2126
1673 Ga0496102_0232147 3300048905 Bacteria 1739
1674 Ga0496102_0427547 3300048905 Bacteria 1244
1675 Ga0496102_0673704 3300048905 Bacteria 957
1676 Ga0496102_0760608 3300048905 Bacteria 891
1677 Ga0496103_0001432 3300048906 Bacteria 16005
1678 Ga0496103_0004579 3300048906 Bacteria 8373
1679 Ga0496103_0012887 3300048906 Bacteria 4959
1680 Ga0496103_0056458 3300048906 Bacteria 2437
1681 Ga0496103_0089717 3300048906 Bacteria 1939
1682 Ga0496103_0129074 3300048906 Bacteria 1614
1683 Ga0496104_0000239 3300048907 Bacteria 48386
1684 Ga0496104_0002113 3300048907 Bacteria 17249
1685 Ga0496104_0002280 3300048907 Bacteria 16544
1686 Ga0496104_0003037 3300048907 Bacteria 14457
1687 Ga0496104_0006583 3300048907 Bacteria 10216
1688 Ga0496104_0009456 3300048907 Bacteria 8672
1689 Ga0496104_0021769 3300048907 Bacteria 5888
1690 Ga0496104_0059203 3300048907 Bacteria 3626
1691 Ga0496104_0079916 3300048907 Bacteria 3117
1692 Ga0496104_0093981 3300048907 Bacteria 2868
1693 Ga0496104_0115058 3300048907 Bacteria 2581
1694 Ga0496104_0138130 3300048907 Bacteria 2342
1695 Ga0496104_0141028 3300048907 Bacteria 2315
1696 Ga0496104_0683279 3300048907 Bacteria 934
1697 Ga0496105_0002071 3300048908 Bacteria 14509
1698 Ga0496105_0006702 3300048908 Bacteria 8864
1699 Ga0496105_0006961 3300048908 Bacteria 8711
1700 Ga0496105_0021912 3300048908 Bacteria 5172
1701 Ga0496105_0032767 3300048908 Bacteria 4265
1702 Ga0496105_0041467 3300048908 Bacteria 3794
1703 Ga0496105_0083517 3300048908 Bacteria 2638
1704 Ga0496105_0089019 3300048908 Bacteria 2550
1705 Ga0496105_0089523 3300048908 Bacteria 2542
1706 Ga0496105_0110435 3300048908 Bacteria 2270
1707 Ga0496105_0235798 3300048908 Bacteria 1486
1708 Ga0496106_0000491 3300048909 Bacteria 28020
1709 Ga0496106_0005632 3300048909 Bacteria 9268
1710 Ga0496106_0007949 3300048909 Bacteria 7837
1711 Ga0496106_0033580 3300048909 Bacteria 3828
1712 Ga0496106_0068253 3300048909 Bacteria 2712
1713 Ga0496106_0110672 3300048909 Bacteria 2138
1714 Ga0496106_0114853 3300048909 Bacteria 2099
1715 Ga0496106_0127117 3300048909 Bacteria 1996
1716 Ga0496106_0404935 3300048909 Bacteria 1096
1717 Ga0496106_0407312 3300048909 Bacteria 1093
1718 Ga0496107_0000327 3300048910 Bacteria 25714
1719 Ga0496107_0001121 3300048910 Bacteria 16149
1720 Ga0496107_0008877 3300048910 Bacteria 6964
1721 Ga0496107_0012293 3300048910 Bacteria 5975
1722 Ga0496107_0015183 3300048910 Bacteria 5395
1723 Ga0496107_0031442 3300048910 Bacteria 3788
1724 Ga0496107_0071203 3300048910 Bacteria 2526
1725 Ga0496107_0103484 3300048910 Bacteria 2089
1726 Ga0496107_0138410 3300048910 Bacteria 1799
1727 Ga0496107_0145816 3300048910 Bacteria 1750
1728 Ga0496107_0281241 3300048910 Bacteria 1238
1729 Ga0496108_0004390 3300048911 Bacteria 11350
1730 Ga0496108_0006898 3300048911 Bacteria 9191
1731 Ga0496108_0011233 3300048911 Bacteria 7274
1732 Ga0496108_0016572 3300048911 Bacteria 6016
1733 Ga0496108_0097238 3300048911 Bacteria 2508
1734 Ga0496108_0278723 3300048911 Bacteria 1455
1735 Ga0496108_0325528 3300048911 Bacteria 1340
1736 Ga0496108_0434532 3300048911 Bacteria 1146
1737 Ga0496108_0539560 3300048911 Bacteria 1018
1738 Ga0496109_0000925 3300048912 Bacteria 24421
1739 Ga0496109_0007037 3300048912 Bacteria 9492
1740 Ga0496109_0021125 3300048912 Bacteria 5755
1741 Ga0496109_0029032 3300048912 Bacteria 4951
1742 Ga0496109_0045546 3300048912 Bacteria 3981
1743 Ga0496109_0065028 3300048912 Bacteria 3339
1744 Ga0496109_0084279 3300048912 Bacteria 2932
1745 Ga0496109_0165837 3300048912 Bacteria 2070
1746 Ga0496109_0277551 3300048912 Bacteria 1579
1747 Ga0496109_0425101 3300048912 Bacteria 1255
1748 Ga0496109_0673353 3300048912 Bacteria 972
1749 Ga0496110_0001215 3300048913 Bacteria 18339
1750 Ga0496110_0001775 3300048913 Bacteria 15895
1751 Ga0496110_0002587 3300048913 Bacteria 13609
1752 Ga0496110_0017600 3300048913 Bacteria 5975
1753 Ga0496110_0039582 3300048913 Bacteria 4105
1754 Ga0496110_0118444 3300048913 Bacteria 2384
1755 Ga0496110_0332263 3300048913 Bacteria 1385
1756 Ga0496110_0470355 3300048913 Bacteria 1145
1757 Ga0496110_0579877 3300048913 Bacteria 1018
1758 Ga0496110_0678163 3300048913 Bacteria 931
1759 Ga0496110_0696273 3300048913 Bacteria 917
1760 Ga0496111_0004183 3300048914 Bacteria 9080
1761 Ga0496111_0012152 3300048914 Bacteria 5823
1762 Ga0496111_0021771 3300048914 Bacteria 4479
1763 Ga0496111_0126663 3300048914 Bacteria 1888
1764 Ga0496111_0165119 3300048914 Bacteria 1644
1765 Ga0496111_0475177 3300048914 Bacteria 921
1766 Ga0496111_0524209 3300048914 Bacteria 871
1767 Ga0496112_0005890 3300048915 Bacteria 10681
1768 Ga0496112_0013125 3300048915 Bacteria 7645
1769 Ga0496112_0014646 3300048915 Bacteria 7286
1770 Ga0496112_0060529 3300048915 Bacteria 3732
1771 Ga0496112_0146319 3300048915 Bacteria 2331
1772 Ga0496112_0218273 3300048915 Bacteria 1863
1773 Ga0496112_0230093 3300048915 Bacteria 1808
1774 Ga0496112_0280006 3300048915 Bacteria 1615
1775 Ga0496112_0332097 3300048915 Bacteria 1464
1776 Ga0496112_0698260 3300048915 Bacteria 942
1777 Ga0496113_0000285 3300048916 Bacteria 23890
1778 Ga0496113_0000465 3300048916 Bacteria 19801
1779 Ga0496113_0006001 3300048916 Bacteria 7646
1780 Ga0496113_0017270 3300048916 Bacteria 5004
1781 Ga0496113_0032574 3300048916 Bacteria 3788
1782 Ga0496113_0065939 3300048916 Bacteria 2741
1783 Ga0496113_0082796 3300048916 Bacteria 2461
1784 Ga0496113_0289967 3300048916 Bacteria 1309
1785 Ga0496113_0457702 3300048916 Bacteria 1025
1786 Ga0496113_0567031 3300048916 Bacteria 910
1787 Ga0496113_0787461 3300048916 Bacteria 756
1788 Ga0496114_0014271 3300048917 Bacteria 6374
1789 Ga0496114_0017597 3300048917 Bacteria 5771
1790 Ga0496114_0019622 3300048917 Bacteria 5478
1791 Ga0496114_0112527 3300048917 Bacteria 2333
1792 Ga0496114_0183954 3300048917 Bacteria 1825
1793 Ga0496114_0323705 3300048917 Bacteria 1362
1794 Ga0496114_0473044 3300048917 Bacteria 1109
1795 Ga0496114_0520262 3300048917 Bacteria 1052
1796 Ga0496115_0000673 3300048918 Bacteria 25278
1797 Ga0496115_0028117 3300048918 Bacteria 4405
1798 Ga0496115_0038417 3300048918 Bacteria 3799
1799 Ga0496115_0054936 3300048918 Bacteria 3198
1800 Ga0496115_0060964 3300048918 Bacteria 3041
1801 Ga0496115_0071316 3300048918 Bacteria 2817
1802 Ga0496115_0193911 3300048918 Bacteria 1678
1803 Ga0496115_0286675 3300048918 Bacteria 1351
1804 Ga0496115_0298007 3300048918 Bacteria 1321
1805 Ga0496115_0330680 3300048918 Bacteria 1245
1806 Ga0496117_0037784 3300048920 Bacteria 3591
1807 Ga0496121_0260581 3300048924 Bacteria 1197
1808 Ga0496122_0000074 3300048925 Bacteria 219900
1809 Ga0496123_0000062 3300048926 Bacteria 219882
1810 Ga0496123_0028666 3300048926 Bacteria 4115
1811 Ga0496123_0067278 3300048926 Bacteria 2263
1812 Ga0496124_0017561 3300048927 Bacteria 6739
1813 Ga0496124_0103122 3300048927 Bacteria 2308
1814 Ga0496126_0131026 3300048929 Bacteria 2167
1815 Ga0495678_103576 3300049459 Bacteria 983
1816 Ga0501031_0003691 3300049568 Bacteria 9849
1817 Ga0501031_0234738 3300049568 Bacteria 1193
1818 Ga0501031_0251105 3300049568 Bacteria 1149
1819 Ga0501032_0009043 3300049569 Bacteria 7238
1820 Ga0501032_0029180 3300049569 Bacteria 3788
1821 Ga0501032_0317789 3300049569 Bacteria 1005
1822 Ga0501033_0031141 3300049570 Bacteria 4010
1823 Ga0501033_0044079 3300049570 Bacteria 3320
1824 Ga0501033_0247833 3300049570 Bacteria 1263
1825 Ga0501033_0345718 3300049570 Bacteria 1042
1826 Ga0501034_0000286 3300049571 Bacteria 90126
1827 Ga0501034_0005591 3300049571 Bacteria 13694
1828 Ga0501034_0024972 3300049571 Bacteria 6080
1829 Ga0501034_0064368 3300049571 Bacteria 3681
1830 Ga0501034_0073247 3300049571 Bacteria 3434
1831 Ga0501034_0113968 3300049571 Bacteria 2692
1832 Ga0501034_0163594 3300049571 Bacteria 2194
1833 Ga0501034_0271490 3300049571 Bacteria 1637
1834 Ga0501034_0286262 3300049571 Bacteria 1587
1835 Ga0501034_0300972 3300049571 Bacteria 1540
1836 Ga0501034_0369466 3300049571 Bacteria 1361
1837 Ga0501036_0003843 3300049572 Bacteria 12047
1838 Ga0501036_0024488 3300049572 Bacteria 5089
1839 Ga0501036_0174295 3300049572 Bacteria 1811
1840 Ga0501036_0441382 3300049572 Bacteria 1085
1841 Ga0501037_0148919 3300049573 Bacteria 1673
1842 Ga0501038_0015789 3300049574 Bacteria 6862
1843 Ga0501038_0019883 3300049574 Bacteria 6043
1844 Ga0501038_0051587 3300049574 Bacteria 3549
1845 Ga0501038_0229555 3300049574 Bacteria 1478
1846 Ga0501039_0002615 3300049575 Bacteria 13445
1847 Ga0501039_0280799 3300049575 Bacteria 1309
1848 Ga0501039_0335357 3300049575 Bacteria 1188
1849 Ga0501039_0365640 3300049575 Bacteria 1133
1850 Ga0501042_0062147 3300049578 Bacteria 2668
1851 Ga0501042_0122911 3300049578 Bacteria 1869
1852 Ga0501042_0146303 3300049578 Bacteria 1704
1853 Ga0501042_0193467 3300049578 Bacteria 1467
1854 Ga0501042_0560354 3300049578 Bacteria 831
1855 Ga0501042_0577164 3300049578 Bacteria 817
1856 Ga0501043_0047574 3300049579 Bacteria 3372
1857 Ga0501043_0050425 3300049579 Bacteria 3271
1858 Ga0501043_0076572 3300049579 Bacteria 2628
1859 Ga0501043_0172612 3300049579 Bacteria 1686
1860 Ga0501043_0361478 3300049579 Bacteria 1102
1861 Ga0501043_0414734 3300049579 Bacteria 1016
1862 Ga0501046_0008490 3300049580 Bacteria 8945
1863 Ga0501046_0015232 3300049580 Bacteria 6466
1864 Ga0501046_0094483 3300049580 Bacteria 2298
1865 Ga0501046_0143560 3300049580 Bacteria 1805
1866 Ga0501046_0169306 3300049580 Bacteria 1640
1867 Ga0501046_0341264 3300049580 Bacteria 1089
1868 Ga0501047_0077981 3300049581 Bacteria 3186
1869 Ga0501047_0085143 3300049581 Bacteria 3037
1870 Ga0501047_0156909 3300049581 Bacteria 2149
1871 Ga0501047_0166283 3300049581 Bacteria 2076
1872 Ga0501047_0345118 3300049581 Bacteria 1326
1873 Ga0501048_0009248 3300049582 Bacteria 7404
1874 Ga0501048_0117010 3300049582 Bacteria 1883
1875 Ga0501048_0175869 3300049582 Bacteria 1517
1876 Ga0501048_0325907 3300049582 Bacteria 1094
1877 Ga0501067_0001333 3300049583 Bacteria 13379
1878 Ga0501067_0058225 3300049583 Bacteria 2140
1879 Ga0501068_0003078 3300049584 Bacteria 8907
1880 Ga0501068_0222915 3300049584 Bacteria 1199
1881 Ga0501069_0005694 3300049585 Bacteria 6489
1882 Ga0501069_0014035 3300049585 Bacteria 4279
1883 Ga0501069_0052326 3300049585 Bacteria 2273
1884 Ga0501069_0053979 3300049585 Bacteria 2238
1885 Ga0501069_0067407 3300049585 Bacteria 2002
1886 Ga0501070_0013017 3300049586 Bacteria 7010
1887 Ga0501070_0067345 3300049586 Bacteria 2965
1888 Ga0501070_0098289 3300049586 Bacteria 2421
1889 Ga0501070_0121215 3300049586 Bacteria 2161
1890 Ga0501070_0130170 3300049586 Bacteria 2079
1891 Ga0501070_0344369 3300049586 Bacteria 1210
1892 Ga0501071_0157377 3300049587 Bacteria 1697
1893 Ga0501071_0261633 3300049587 Bacteria 1307
1894 Ga0501071_0495796 3300049587 Bacteria 937
1895 Ga0501072_0000394 3300049588 Bacteria 31235
1896 Ga0501072_0115857 3300049588 Bacteria 2134
1897 Ga0501072_0256826 3300049588 Bacteria 1391
1898 Ga0501072_0373709 3300049588 Bacteria 1131
1899 Ga0501073_0002088 3300049589 Bacteria 14957
1900 Ga0501073_0004584 3300049589 Bacteria 10387
1901 Ga0501073_0024120 3300049589 Bacteria 4368
1902 Ga0501073_0205035 3300049589 Bacteria 1363
1903 Ga0501073_0229779 3300049589 Bacteria 1282
1904 Ga0501073_0251337 3300049589 Bacteria 1220
1905 Ga0501074_0136864 3300049590 Bacteria 1752
1906 Ga0501074_0148802 3300049590 Bacteria 1674
1907 Ga0501074_0167895 3300049590 Bacteria 1567
1908 Ga0501074_0214655 3300049590 Bacteria 1370
1909 Ga0501075_0017438 3300049591 Bacteria 5188
1910 Ga0501075_0045437 3300049591 Bacteria 3297
1911 Ga0501075_0258978 3300049591 Bacteria 1326
1912 Ga0501076_0082339 3300049592 Bacteria 2583
1913 Ga0501076_0109082 3300049592 Bacteria 2237
1914 Ga0501076_0251287 3300049592 Bacteria 1447
1915 Ga0501077_0118869 3300049593 Bacteria 1675
1916 Ga0501077_0170845 3300049593 Bacteria 1381
1917 Ga0501077_0295147 3300049593 Bacteria 1032
1918 Ga0501079_0019376 3300049741 Bacteria 5196
1919 Ga0501079_0153520 3300049741 Bacteria 1795
1920 Ga0501079_0178301 3300049741 Bacteria 1658
1921 Ga0501079_0212618 3300049741 Bacteria 1511
1922 Ga0501079_0414344 3300049741 Bacteria 1057
1923 Ga0501080_0008622 3300049742 Bacteria 9252
1924 Ga0501080_0038365 3300049742 Bacteria 4472
1925 Ga0501080_0102537 3300049742 Bacteria 2654
1926 Ga0501080_0157781 3300049742 Bacteria 2096
1927 Ga0501080_0399092 3300049742 Bacteria 1237
1928 Ga0501080_0903976 3300049742 Bacteria 769
1929 Ga0501081_0127738 3300049743 Bacteria 1815
1930 Ga0501081_0342327 3300049743 Bacteria 1101
1931 Ga0501081_0431453 3300049743 Bacteria 978
1932 Ga0501081_0526093 3300049743 Bacteria 882
1933 Ga0501081_0616156 3300049743 Bacteria 813
1934 Ga0501081_0691805 3300049743 Bacteria 765
1935 Ga0501083_0054982 3300049744 Bacteria 2670
1936 Ga0501083_0180003 3300049744 Bacteria 1380
1937 Ga0501083_0223960 3300049744 Bacteria 1225
1938 Ga0501083_0388169 3300049744 Bacteria 908
1939 Ga0501035_0000366 3300049822 Bacteria 52132
1940 Ga0501035_0004315 3300049822 Bacteria 13512
1941 Ga0501035_0287424 3300049822 Bacteria 1388
1942 Ga0501035_0322480 3300049822 Bacteria 1298
1943 Ga0501035_0396206 3300049822 Bacteria 1149
1944 Ga0501035_0412764 3300049822 Bacteria 1122
1945 Ga0501035_0506405 3300049822 Bacteria 993
1946 Ga0501035_0825876 3300049822 Bacteria 739
1947 Ga0501044_0000411 3300049823 Bacteria 52862
1948 Ga0501044_0010794 3300049823 Bacteria 9909
1949 Ga0501044_0168342 3300049823 Bacteria 2164
1950 Ga0501044_0235588 3300049823 Bacteria 1776
1951 Ga0501044_0364766 3300049823 Bacteria 1362
1952 Ga0501044_0548348 3300049823 Bacteria 1053
1953 Ga0501044_0698945 3300049823 Bacteria 900
1954 Ga0501045_0236103 3300049824 Bacteria 1361
1955 nmdc:mga03683_50658_c1 3300050489 Bacteria 1731
1956 nmdc:mga03n38_27804_c1 3300050490 Bacteria 2350
1957 nmdc:mga00v17_180081_c1 3300050491 Bacteria 1364
1958 nmdc:mga00v17_20140_c1 3300050491 Bacteria 3818
1959 nmdc:mga00v17_28756_c1 3300050491 Bacteria 3258
1960 nmdc:mga00v17_407945_c1 3300050491 Bacteria 883
1961 nmdc:mga00v17_90210_c1 3300050491 Bacteria 1924
1962 nmdc:mga0yw44_1214_c1 3300050492 Bacteria 10094
1963 nmdc:mga0yw44_145695_c1 3300050492 Bacteria 1542
1964 nmdc:mga0yw44_18317_c1 3300050492 Bacteria 3831
1965 nmdc:mga0yw44_3468_c1 3300050492 Bacteria 7006
1966 nmdc:mga0yw44_393180_c1 3300050492 Bacteria 937
1967 nmdc:mga0yw44_417972_c1 3300050492 Bacteria 908
1968 nmdc:mga0k408_20068_c1 3300050493 Bacteria 3739
1969 nmdc:mga0k408_237741_c1 3300050493 Bacteria 1088
1970 nmdc:mga0k408_33374_c1 3300050493 Bacteria 2944
1971 nmdc:mga0k408_3509_c1 3300050493 Bacteria 8286
1972 nmdc:mga06z11_109408_c1 3300050494 Bacteria 1528
1973 nmdc:mga06z11_25471_c2 3300050494 Bacteria 1358
1974 nmdc:mga06z11_44907_c1 3300050494 Bacteria 2231
1975 nmdc:mga06z11_6960_c1 3300050494 Bacteria 4634
1976 nmdc:mga07m45_129250_c1 3300050496 Bacteria 1461
1977 nmdc:mga07m45_14938_c1 3300050496 Bacteria 4146
1978 nmdc:mga07m45_35923_c1 3300050496 Bacteria 2757
1979 nmdc:mga07m45_42676_c1 3300050496 Bacteria 2543
1980 nmdc:mga05p37_105379_c1 3300050507 Bacteria 3469
1981 nmdc:mga05p37_285_c1 3300050507 Bacteria 52916
1982 nmdc:mga05p37_290_c1 3300050507 Bacteria 52425
1983 nmdc:mga05p37_38352_c1 3300050507 Bacteria 5877
1984 nmdc:mga05p37_430768_c1 3300050507 Bacteria 1532
1985 nmdc:mga05p37_488186_c1 3300050507 Bacteria 1417
1986 nmdc:mga05p37_585068_c1 3300050507 Bacteria 1263
1987 nmdc:mga09592_168998_c1 3300050508 Bacteria 1890
1988 nmdc:mga09592_8025_c1 3300050508 Bacteria 8584
1989 nmdc:mga0qj67_139644_c1 3300050509 Bacteria 1964
1990 nmdc:mga0qj67_215932_c1 3300050509 Bacteria 1557
1991 nmdc:mga0qj67_290975_c1 3300050509 Bacteria 1324
1992 nmdc:mga0qj67_347_c1 3300050509 Bacteria 31880
1993 nmdc:mga0qj67_527193_c1 3300050509 Bacteria 948
1994 nmdc:mga0qj67_606000_c1 3300050509 Bacteria 876
1995 nmdc:mga0qj67_880_c1 3300050509 Bacteria 20589
1996 nmdc:mga06r32_118_c1 3300050510 Bacteria 56778
1997 nmdc:mga06r32_267466_c1 3300050510 Bacteria 1697
1998 nmdc:mga06r32_352166_c1 3300050510 Bacteria 1457
1999 nmdc:mga06r32_374633_c1 3300050510 Bacteria 1406
2000 nmdc:mga06r32_649_c1 3300050510 Bacteria 30358
2001 nmdc:mga08y16_103693_c1 3300050511 Bacteria 2961
2002 nmdc:mga08y16_119854_c1 3300050511 Bacteria 2738
2003 nmdc:mga08y16_153738_c1 3300050511 Bacteria 2391
2004 nmdc:mga08y16_16589_c1 3300050511 Bacteria 7747
2005 nmdc:mga08y16_211704_c1 3300050511 Bacteria 2008
2006 nmdc:mga08y16_452689_c1 3300050511 Bacteria 1309
2007 nmdc:mga08y16_66189_c1 3300050511 Bacteria 3771
2008 nmdc:mga08y16_7099_c1 3300050511 Bacteria 11758
2009 nmdc:mga08y16_851_c1 3300050511 Bacteria 29277
2010 nmdc:mga08y16_89_c1 3300050511 Bacteria 76793
2011 nmdc:mga08y16_98412_c1 3300050511 Bacteria 3046
2012 nmdc:mga0n895_104899_c1 3300050512 Bacteria 2839
2013 nmdc:mga0n895_157640_c1 3300050512 Bacteria 2301
2014 nmdc:mga0n895_173292_c1 3300050512 Bacteria 2189
2015 nmdc:mga0n895_196757_c1 3300050512 Bacteria 2047
2016 nmdc:mga0n895_309610_c1 3300050512 Bacteria 1601
2017 nmdc:mga0n895_369_c1 3300050512 Bacteria 30447
2018 nmdc:mga0n895_376459_c1 3300050512 Bacteria 1437
2019 nmdc:mga0n895_46361_c1 3300050512 Bacteria 4246
2020 nmdc:mga0n895_552_c1 3300050512 Bacteria 25634
2021 nmdc:mga0rr50_11023_c1 3300050513 Bacteria 5764
2022 nmdc:mga0rr50_137806_c1 3300050513 Bacteria 1960
2023 nmdc:mga0rr50_236400_c1 3300050513 Bacteria 1513
2024 nmdc:mga0rr50_245951_c1 3300050513 Bacteria 1484
2025 nmdc:mga0rr50_469070_c1 3300050513 Bacteria 1068
2026 nmdc:mga0rr50_52321_c1 3300050513 Bacteria 3034
2027 nmdc:mga0rr50_574_c1 3300050513 Bacteria 19721
2028 nmdc:mga0rr50_6149_c1 3300050513 Bacteria 7268
2029 nmdc:mga0rr50_798081_c1 3300050513 Bacteria 805
2030 nmdc:mga08x19_154993_c1 3300050514 Bacteria 1553
2031 nmdc:mga08x19_307807_c1 3300050514 Bacteria 1101
2032 nmdc:mga08x19_9501_c1 3300050514 Bacteria 5824
2033 nmdc:mga0a205_1059_c1 3300050515 Bacteria 22915
2034 nmdc:mga0a205_124111_c1 3300050515 Bacteria 2482
2035 nmdc:mga0a205_148593_c1 3300050515 Bacteria 2243
2036 nmdc:mga0a205_21310_c1 3300050515 Bacteria 6131
2037 nmdc:mga0a205_251366_c1 3300050515 Bacteria 1647
2038 nmdc:mga0a205_2568_c1 3300050515 Bacteria 16009
2039 nmdc:mga0a205_26046_c1 3300050515 Bacteria 5572
2040 nmdc:mga0a205_298175_c1 3300050515 Bacteria 1485
2041 nmdc:mga0a205_353181_c1 3300050515 Bacteria 1337
2042 nmdc:mga0sz30_144168_c1 3300050516 Bacteria 1052
2043 Ga0495601_0000016 3300053077 Bacteria 207486
2044 Ga0495601_0000205 3300053077 Bacteria 31542
2045 Ga0495601_0001742 3300053077 Bacteria 12023
2046 Ga0495601_0001966 3300053077 Bacteria 11489
2047 Ga0495601_0003031 3300053077 Bacteria 9577
2048 Ga0495601_0004702 3300053077 Bacteria 7911
2049 Ga0495601_0005657 3300053077 Bacteria 7289
2050 Ga0495601_0006040 3300053077 Bacteria 7064
2051 Ga0495601_0036612 3300053077 Bacteria 3065
2052 Ga0495601_0050863 3300053077 Bacteria 2614
2053 Ga0495601_0052938 3300053077 Bacteria 2564
2054 Ga0495601_0057737 3300053077 Bacteria 2458
2055 Ga0495601_0064935 3300053077 Bacteria 2322
2056 Ga0495601_0071850 3300053077 Bacteria 2210
2057 Ga0495612_0000041 3300053078 Bacteria 62752
2058 Ga0495612_0000896 3300053078 Bacteria 12191
2059 Ga0495612_0003681 3300053078 Bacteria 6360
2060 Ga0495612_0004543 3300053078 Bacteria 5762
2061 Ga0495612_0012951 3300053078 Bacteria 3360
2062 Ga0495612_0014629 3300053078 Bacteria 3153
2063 Ga0495612_0026997 3300053078 Bacteria 2308
2064 Ga0495612_0027352 3300053078 Bacteria 2293
2065 Ga0495612_0050413 3300053078 Bacteria 1709
2066 Ga0495612_0062696 3300053078 Bacteria 1541
2067 Ga0495612_0110598 3300053078 Bacteria 1175
2068 Ga0500610_0115490 3300053079 Bacteria 1376
2069 Ga0495655_0000378 3300053083 Bacteria 7658
2070 Ga0495655_0019851 3300053083 Bacteria 1499
2071 Ga0495595_0000161 3300053084 Bacteria 26762
2072 Ga0495595_0001105 3300053084 Bacteria 10462
2073 Ga0495595_0001119 3300053084 Bacteria 10385
2074 Ga0495595_0004084 3300053084 Bacteria 5849
2075 Ga0495595_0006277 3300053084 Bacteria 4840
2076 Ga0495595_0011917 3300053084 Bacteria 3645
2077 Ga0495595_0014655 3300053084 Bacteria 3329
2078 Ga0495595_0185538 3300053084 Bacteria 1032
2079 Ga0495595_0189050 3300053084 Bacteria 1023
2080 Ga0495619_0000050 3300053085 Bacteria 101361
2081 Ga0495619_0000139 3300053085 Bacteria 54165
2082 Ga0495619_0000957 3300053085 Bacteria 18932
2083 Ga0495619_0003087 3300053085 Bacteria 10812
2084 Ga0495619_0003733 3300053085 Bacteria 9812
2085 Ga0495619_0007273 3300053085 Bacteria 7011
2086 Ga0495619_0008115 3300053085 Bacteria 6647
2087 Ga0495619_0009272 3300053085 Bacteria 6216
2088 Ga0495619_0021121 3300053085 Bacteria 4154
2089 Ga0495619_0034965 3300053085 Bacteria 3267
2090 Ga0495619_0053482 3300053085 Bacteria 2671
2091 Ga0495619_0074099 3300053085 Bacteria 2282
2092 Ga0495619_0075261 3300053085 Bacteria 2265
2093 Ga0495619_0078936 3300053085 Bacteria 2213
2094 Ga0495619_0093382 3300053085 Bacteria 2039
2095 Ga0495619_0105009 3300053085 Bacteria 1926
2096 Ga0495619_0143877 3300053085 Bacteria 1643
2097 Ga0495619_0175462 3300053085 Bacteria 1482
2098 Ga0495619_0296555 3300053085 Bacteria 1120
2099 Ga0495619_0355856 3300053085 Bacteria 1013
2100 Ga0500643_025908 3300053087 Bacteria 1843
2101 Ga0500644_0000839 3300053088 Bacteria 10266
2102 Ga0500646_0021421 3300053090 Bacteria 1722
2103 Ga0500651_0036353 3300053093 Bacteria 3103
2104 Ga0500651_0256398 3300053093 Bacteria 1015
2105 Ga0500566_0170404 3300053094 Bacteria 1126
2106 Ga0500641_0000457 3300053096 Bacteria 14851
2107 Ga0500641_0013326 3300053096 Bacteria 3019
2108 Ga0500641_0013957 3300053096 Bacteria 2958
2109 Ga0500641_0016990 3300053096 Bacteria 2714
2110 Ga0500641_0078607 3300053096 Bacteria 1397
2111 Ga0500654_042304 3300053099 Bacteria 2568
2112 Ga0500557_072589 3300053105 Bacteria 1130
2113 Ga0500562_033612 3300053108 Bacteria 1356
2114 Ga0500562_035649 3300053108 Bacteria 1318
2115 Ga0500593_016699 3300053117 Bacteria 3182
2116 Ga0500595_000001 3300053119 Bacteria 1088438
2117 Ga0500595_021247 3300053119 Bacteria 2320
2118 Ga0500595_035998 3300053119 Bacteria 1625
2119 Ga0500608_143136 3300053122 Bacteria 1057
2120 Ga0500618_017858 3300053125 Bacteria 1761
2121 Ga0500618_029346 3300053125 Bacteria 1298
2122 Ga0500642_0002438 3300053130 Bacteria 5459
2123 Ga0500642_0259228 3300053130 Bacteria 796
2124 Ga0500652_000069 3300053131 Bacteria 45026
2125 Ga0500652_003823 3300053131 Bacteria 4598
2126 Ga0500652_075254 3300053131 Bacteria 1403
2127 Ga0500658_0035326 3300053134 Bacteria 1978
2128 Ga0500616_0000001 3300053153 Bacteria 1986011
2129 Ga0500616_0012716 3300053153 Bacteria 4918
2130 Ga0500616_0016192 3300053153 Bacteria 4249
2131 Ga0500616_0037804 3300053153 Bacteria 2611
2132 Ga0500616_0068585 3300053153 Bacteria 1816
2133 Ga0500622_0001259 3300053156 Bacteria 20680
2134 Ga0500627_0154463 3300053158 Bacteria 1036
2135 Ga0500636_0014182 3300053177 Bacteria 4685
2136 Ga0500636_0020014 3300053177 Bacteria 3958
2137 Ga0500611_016270 3300053727 Bacteria 1333
2138 Ga0500657_126448 3300053728 Bacteria 1001
2139 Ga0500645_000418 3300053730 Bacteria 29391
2140 Ga0500552_027558 3300053733 Bacteria 855
2141 Ga0501084_0023301 3300054114 Bacteria 5169
2142 Ga0501084_0044229 3300054114 Bacteria 3728
2143 Ga0501084_0077505 3300054114 Bacteria 2787
2144 Ga0501084_0325438 3300054114 Bacteria 1298
2145 Ga0501084_0398433 3300054114 Bacteria 1163
2146 Ga0501084_0619231 3300054114 Bacteria 914
2147 Ga0501082_0013821 3300060353 Bacteria 6943
2148 Ga0501082_0085747 3300060353 Bacteria 2716
2149 Ga0501082_0112796 3300060353 Bacteria 2354
2150 Ga0501082_0219481 3300060353 Bacteria 1654
2151 Ga0501082_0286855 3300060353 Bacteria 1433
2152 Ga0501082_0782765 3300060353 Bacteria 835
2153 Ga0466962_0049979 3300061719 Bacteria 1999
2154 Ga0530510_0022504 3300061734 Bacteria 4490
2155 Ga0530510_0053232 3300061734 Bacteria 2925
2156 Ga0530510_0399907 3300061734 Bacteria 1035
2157 Ga0530510_0444126 3300061734 Bacteria 980
2158 2585997793 2585427633 Bacteria 6413184
2159 2586002379 2585427634 Bacteria 6455027
2160 2599720347 2599185236 Bacteria 6875203
2161 2644730983 2643221733 Bacteria 5690728
2162 2819722241 2818991467 Bacteria 5893227
2163 2821128736 2821123053 Bacteria 7836056
2164 2838741752 2838736955 Bacteria 5760694
2165 2841845414 2841840854 Bacteria 5761912
2166 2842145117 2842140634 Bacteria 5759631
2167 2854919494 2854916844 Bacteria 5725939
2168 2857534111 2857531043 Bacteria 6754041
2169 2919175773 2919171160 Bacteria 6499771
2170 641335761 641228493 Bacteria 3999591
2171 8054564098 8054563764 Bacteria 5592885
2172 8056878208 8056875544 Bacteria 4355797
2173 Ga0530510_0091635
2174 SwRhRL2b_contig_103294
2175 2214828525
2176 ARcpr5oldR_c000051
2177 ARSoilYngRDRAFT_c00005
2178 ARcpr5yngRDRAFT_c000005
2179 ARSoilOldRDRAFT_c000003
2180 ARCol0oldRDRAFT_c00049
2181 CNBas_1002440
2182 ARCol0yngRDRAFT_1000007
2183 SwM_106758
2184 JGI24032J14994_100411
2185 JGI24741J21665_1003075
2186 JGI24752J21851_1002865
2187 JGI24752J21851_1003059
2188 JGI24746J21847_1000487
2189 JGI24746J21847_1005435
2190 JGI24739J22299_10000027
2191 JGI24739J22299_10047696
2192 JGI24739J22299_10081951
2193 JGI24737J22298_10006724
2194 JGI24737J22298_10008091
2195 JGI24743J22301_10001138
2196 JGI24743J22301_10008358
2197 JGI24750J21931_1000003
2198 JGI24745J21846_1000027
2199 JGI24745J21846_1006416
2200 JGI24748J21848_1000421
2201 JGI24738J21930_10000032
2202 JGI24749J21850_1000320
2203 JGI24749J21850_1004740
2204 JGI24749J21850_1008927
2205 JGI24744J21845_10001709
2206 JGI24035J26624_1000017
2207 JGI24033J26618_1000528
2208 JGI24033J26618_1006673
2209 JGI24034J26672_10002708
2210 JGI24034J26672_10004055
2211 JGI24034J26672_10004686
2212 JGI24742J22300_10000479
2213 JGI24742J22300_10006180
2214 JGI24742J22300_10014308
2215 JGI24751J29686_10002694
2216 JGI24751J29686_10007181
2217 JGI25406J46586_10044912
2218 JGI25153J46596_10026532
2219 JGI25404J52841_10020892
2220 Ga0055524_1026287
2221 Ga0055536_1001690
2222 Ga0055540_1009128
2223 Ga0055531_10006983
2224 JGI25405J52794_10002320
2225 JGI25405J52794_10008886
2226 Ga0065717_1001936
2227 Ga0065716_1001733
2228 Ga0065704_10071648
2229 Ga0065712_10069491
2230 Ga0065712_10069860
2231 Ga0065712_10071460
2232 Ga0065715_10002372
2233 Ga0065715_10089909
2234 Ga0065707_10089899
2235 Ga0065707_10237060
2236 Ga0070658_10060574
2237 Ga0070658_10112610
2238 Ga0070676_10001346
2239 Ga0070676_10064265
2240 Ga0070676_10172931
2241 Ga0070676_10188218
2242 Ga0070676_10215012
2243 Ga0070683_100002452
2244 Ga0070683_100396768
2245 Ga0070690_100006735
2246 Ga0070690_100038138
2247 Ga0070690_100038458
2248 Ga0070690_100056679
2249 Ga0070690_100082686
2250 Ga0070690_100325641
2251 Ga0070690_100427276
2252 Ga0070690_100550881
2253 Ga0070670_100019209
2254 Ga0070670_100020107
2255 Ga0070670_100035824
2256 Ga0070670_100037375
2257 Ga0070677_10000240
2258 Ga0068869_100000013
2259 Ga0070666_10014037
2260 Ga0070666_10146036
2261 Ga0070680_100001807
2262 Ga0070680_100015245
2263 Ga0070680_100022501
2264 Ga0070680_100091598
2265 Ga0070680_100267422
2266 Ga0070680_100484131
2267 Ga0070682_100000611
2268 Ga0070682_100066793
2269 Ga0070682_100121945
2270 Ga0070682_100191438
2271 Ga0070682_100192842
2272 Ga0068868_100010701
2273 Ga0068868_100018781
2274 Ga0068868_100050631
2275 Ga0068868_100428396
2276 Ga0070660_100000554
2277 Ga0070660_100013100
2278 Ga0070660_100023479
2279 Ga0070660_100137260
2280 Ga0070660_100355120
2281 Ga0070660_100441865
2282 Ga0070689_100005543
2283 Ga0070689_100007858
2284 Ga0070689_100014756
2285 Ga0070689_100037914
2286 Ga0070689_100059973
2287 Ga0070691_10000093
2288 Ga0070691_10012176
2289 Ga0070691_10025049
2290 Ga0070691_10026914
2291 Ga0070687_100000097
2292 Ga0070687_100014202
2293 Ga0070687_100064527
2294 Ga0070687_100071834
2295 Ga0070687_100267592
2296 Ga0070661_100000228
2297 Ga0070661_100056368
2298 Ga0070661_100443636
2299 Ga0070692_10052614
2300 Ga0070668_100004073
2301 Ga0070668_100047757
2302 Ga0070668_100072567
2303 Ga0070668_100155362
2304 Ga0070669_100000368
2305 Ga0070669_100079252
2306 Ga0070675_100000752
2307 Ga0070675_100008586
2308 Ga0070675_100149971
2309 Ga0070675_100272096
2310 Ga0070675_100342940
2311 Ga0070671_100000142
2312 Ga0070671_100010354
2313 Ga0070671_100011531
2314 Ga0070671_100071428
2315 Ga0070671_100095786
2316 Ga0070671_100099630
2317 Ga0070674_100090668
2318 Ga0070673_100007057
2319 Ga0070673_100142110
2320 Ga0070673_100151560
2321 Ga0070673_100269417
2322 Ga0070673_100435297
2323 Ga0070688_100020344
2324 Ga0070688_100056806
2325 Ga0070688_100107996
2326 Ga0070659_100000183
2327 Ga0070659_100025219
2328 Ga0070659_100054734
2329 Ga0070659_100094213
2330 Ga0070659_100390899
2331 Ga0070667_100005458
2332 Ga0070667_100074773
2333 Ga0070703_10014438
2334 Ga0070709_10014058
2335 Ga0070709_10053514
2336 Ga0070709_10088689
2337 Ga0070714_100108241
2338 Ga0070714_100356557
2339 Ga0070714_100567442
2340 Ga0070713_100026299
2341 Ga0070713_100051151
2342 Ga0070713_100103256
2343 Ga0070713_100117558
2344 Ga0070713_100126719
2345 Ga0070713_100128660
2346 Ga0070713_100153972
2347 Ga0070713_100250349
2348 Ga0070710_10021492
2349 Ga0070710_10035682
2350 Ga0070710_10096932
2351 Ga0070710_10218412
2352 Ga0070710_10259224
2353 Ga0070701_10000008
2354 Ga0070701_10049861
2355 Ga0070701_10061601
2356 Ga0070711_100003097
2357 Ga0070711_100026562
2358 Ga0070711_100029559
2359 Ga0070711_100033924
2360 Ga0070711_100062238
2361 Ga0070711_100069294
2362 Ga0070711_100124194
2363 Ga0070711_100187201
2364 Ga0070705_100074101
2365 Ga0070700_100001950
2366 Ga0070700_100005827
2367 Ga0070700_100008830
2368 Ga0070700_100045582
2369 Ga0070700_100276060
2370 Ga0070700_100667213
2371 Ga0070694_100001186
2372 Ga0070694_100080518
2373 Ga0070694_100089169
2374 Ga0070708_100099590
2375 Ga0070708_100100031
2376 Ga0070708_100239063
2377 Ga0070708_100251856
2378 Ga0070708_100283793
2379 Ga0070708_100353560
2380 Ga0070708_100645067
2381 Ga0070663_100000385
2382 Ga0070663_100036093
2383 Ga0070678_100001994
2384 Ga0070678_100012171
2385 Ga0070678_100215214
2386 Ga0070678_100271298
2387 Ga0070662_100003682
2388 Ga0070662_100009811
2389 Ga0070662_100010178
2390 Ga0070662_100059826
2391 Ga0070662_100129850
2392 Ga0070681_10008332
2393 Ga0070681_10047059
2394 Ga0070681_10145682
2395 Ga0070681_10217724
2396 Ga0070681_10252174
2397 Ga0068867_100000160
2398 Ga0070685_10128882
2399 Ga0070685_10321057
2400 Ga0070706_100040915
2401 Ga0070706_100526234
2402 Ga0070706_100556637
2403 Ga0070707_100219196
2404 Ga0070707_100522148
2405 Ga0070698_100722378
2406 Ga0074259_10011108
2407 Ga0070699_100065122
2408 Ga0070699_100552794
2409 Ga0070679_100017517
2410 Ga0070679_100048351
2411 Ga0070679_100077883
2412 Ga0070679_100104854
2413 Ga0070679_100115052
2414 Ga0070679_100156421
2415 Ga0070679_100276899
2416 Ga0070679_100407853
2417 Ga0070679_100523416
2418 Ga0070684_100004278
2419 Ga0070684_100256293
2420 Ga0070697_100210394
2421 Ga0070697_100401129
2422 Ga0070697_100403873
2423 Ga0068853_100017859
2424 Ga0068853_100065138
2425 Ga0068853_100258612
2426 Ga0068853_100614488
2427 Ga0070672_100000348
2428 Ga0070672_100009899
2429 Ga0070672_100127133
2430 Ga0070686_100000688
2431 Ga0070686_100056657
2432 Ga0070686_100066046
2433 Ga0070695_100008662
2434 Ga0070695_100018808
2435 Ga0070695_100196585
2436 Ga0070696_100007141
2437 Ga0070696_100047322
2438 Ga0070696_100134936
2439 Ga0070696_100373843
2440 Ga0070693_100001722
2441 Ga0070693_100043419
2442 Ga0070693_100049011
2443 Ga0070693_100167687
2444 Ga0070665_100023397
2445 Ga0070665_100025642
2446 Ga0070665_100042480
2447 Ga0070665_100084962
2448 Ga0070665_100154853
2449 Ga0070665_100618980
2450 Ga0070704_100008342
2451 Ga0070704_100077073
2452 Ga0070704_100147222
2453 Ga0070704_100345255
2454 Ga0070704_100374657
2455 Ga0068855_100005199
2456 Ga0068855_100014630
2457 Ga0068855_100028763
2458 Ga0068855_100167649
2459 Ga0068855_100261036
2460 Ga0070664_100021119
2461 Ga0070664_100033837
2462 Ga0070664_100255936
2463 Ga0068857_100000307
2464 Ga0068854_100000131
2465 Ga0068854_100032775
2466 Ga0068856_100001866
2467 Ga0068856_100355506
2468 Ga0068856_100658686
2469 Ga0070702_100000197
2470 Ga0070702_100093165
2471 Ga0068852_100000151
2472 Ga0068852_100036565
2473 Ga0068852_100219594
2474 Ga0068852_100255172
2475 Ga0068859_100018300
2476 Ga0068859_100100457
2477 Ga0068859_100227137
2478 Ga0068859_100445267
2479 Ga0068859_100479110
2480 Ga0068859_101154642
2481 Ga0068864_100001095
2482 Ga0068864_100024767
2483 Ga0068866_10001144
2484 Ga0068866_10188871
2485 Ga0068861_100000436
2486 Ga0068861_100101811
2487 Ga0068861_100151746
2488 Ga0068861_100237244
2489 Ga0068861_100295240
2490 Ga0068851_10043282
2491 Ga0068851_10092720
2492 Ga0068870_10000120
2493 Ga0068870_10000985
2494 Ga0068870_10075164
2495 Ga0068863_100000418
2496 Ga0068863_100119754
2497 Ga0068863_100290787
2498 Ga0068858_100015337
2499 Ga0068858_100086580
2500 Ga0068858_100126013
2501 Ga0068858_100145088
2502 Ga0068858_100306920
2503 Ga0068860_100004963
2504 Ga0068860_100103776
2505 Ga0068860_100106624
2506 Ga0068860_100148273
2507 Ga0068862_100029273
2508 Ga0068862_100483181
2509 Ga0081455_10000002
2510 Ga0081455_10001354
2511 Ga0081455_10006240
2512 Ga0081455_10012128
2513 Ga0081455_10027662
2514 Ga0081455_10053652
2515 Ga0081455_10343110
2516 Ga0081538_10011656
2517 Ga0081538_10053528
2518 Ga0081540_1000166
2519 Ga0081540_1002025
2520 Ga0081540_1015548
2521 Ga0081540_1016475
2522 Ga0081540_1061250
2523 Ga0081540_1113203
2524 Ga0081540_1156102
2525 Ga0081539_10010724
2526 Ga0081539_10044788
2527 Ga0081539_10140099
2528 Ga0070717_10013275
2529 Ga0070717_10036603
2530 Ga0070717_10040398
2531 Ga0070717_10043212
2532 Ga0070717_10185683
2533 Ga0070717_10267089
2534 Ga0070717_10390143
2535 Ga0070717_10896061
2536 Ga0075365_10002199
2537 Ga0075365_10007282
2538 Ga0075365_10015116
2539 Ga0075365_10079674
2540 Ga0075365_10293793
2541 Ga0075368_10050125
2542 Ga0075363_100003290
2543 Ga0075363_100046416
2544 Ga0075363_100117367
2545 Ga0075364_10003576
2546 Ga0075364_10048755
2547 Ga0075364_10048826
2548 Ga0075364_10156148
2549 Ga0075364_10160278
2550 Ga0070715_10004035
2551 Ga0070715_10071020
2552 Ga0070715_10082331
2553 Ga0070715_10134237
2554 Ga0070716_100032365
2555 Ga0070716_100167105
2556 Ga0070716_100303562
2557 Ga0070712_100021809
2558 Ga0070712_100022609
2559 Ga0070712_100037456
2560 Ga0070712_100054250
2561 Ga0070712_100065597
2562 Ga0070712_100069678
2563 Ga0070712_100104739
2564 Ga0070712_100111932
2565 Ga0070712_100150909
2566 Ga0070712_100234045
2567 Ga0070712_100257634
2568 Ga0070712_100323361
2569 Ga0070712_100435213
2570 Ga0070712_100616661
2571 Ga0070712_100657811
2572 Ga0075362_10011461
2573 Ga0075362_10037226
2574 Ga0075362_10103811
2575 Ga0075362_10128187
2576 Ga0075367_10011511
2577 Ga0075367_10017973
2578 Ga0075367_10032143
2579 Ga0075367_10045294
2580 Ga0075367_10124301
2581 Ga0075367_10243531
2582 Ga0075367_10335353
2583 Ga0075369_10076405
2584 Ga0075369_10080932
2585 Ga0075427_10000036
2586 Ga0075366_10001260
2587 Ga0075366_10018230
2588 Ga0075366_10266495
2589 Ga0075366_10338888
2590 Ga0097621_100000887
2591 Ga0097621_100113804
2592 Ga0097621_100208933
2593 Ga0097621_100224616
2594 Ga0075370_10077581
2595 Ga0075370_10335825
2596 Ga0068871_100000484
2597 Ga0068871_100001991
2598 Ga0068871_100020759
2599 Ga0068871_100023143
2600 Ga0068871_100308560
2601 Ga0075428_100001081
2602 Ga0075428_100002972
2603 Ga0075428_100023291
2604 Ga0075428_100103169
2605 Ga0075428_100302813
2606 Ga0075428_100365093
2607 Ga0075428_100423317
2608 Ga0075428_100555795
2609 Ga0075430_100000045
2610 Ga0075430_100000274
2611 Ga0075430_100144888
2612 Ga0075431_100000059
2613 Ga0075431_100000219
2614 Ga0075431_100258813
2615 Ga0075431_100310825
2616 Ga0075431_100331438
2617 Ga0075433_10001892
2618 Ga0075433_10034114
2619 Ga0075433_10043556
2620 Ga0075433_10186304
2621 Ga0075433_10221632
2622 Ga0075433_10232214
2623 Ga0075434_100003622
2624 Ga0075434_100006246
2625 Ga0075434_100078022
2626 Ga0075434_100243412
2627 Ga0075434_100363060
2628 Ga0075434_100372665
2629 Ga0075429_100003392
2630 Ga0075429_100014917
2631 Ga0075429_100133092
2632 Ga0075429_100446866
2633 Ga0068865_100000613
2634 Ga0075436_100005027
2635 Ga0075436_100060170
2636 Ga0075436_100125224
2637 Ga0075436_100216483
2638 Ga0075436_100408373
2639 Ga0097620_100018301
2640 Ga0097620_100100460
2641 Ga0097620_100227140
2642 Ga0097620_100445249
2643 Ga0097620_100479046
2644 Ga0097620_101154661
2645 Ga0079104_1000195
2646 Ga0075435_100044561
2647 Ga0075435_100052359
2648 Ga0075435_100072187
2649 Ga0075435_100090548
2650 Ga0075435_100114913
2651 Ga0075435_100174407
2652 Ga0075435_100322592
2653 Ga0075435_100426336
2654 Ga0075435_100591792
2655 Ga0099794_10007909
2656 Ga0099794_10031163
2657 Ga0099795_10110463
2658 Ga0099795_10154416
2659 Ga0099795_10175236
2660 Ga0105251_10031791
2661 Ga0105251_10048048
2662 Ga0105244_10017634
2663 Ga0105250_10012131
2664 Ga0105240_10023181
2665 Ga0105240_10189033
2666 Ga0105240_10609018
2667 Ga0105240_10915440
2668 Ga0105240_11245333
2669 Ga0111539_10000679
2670 Ga0111539_10000693
2671 Ga0111539_10000925
2672 Ga0111539_10001296
2673 Ga0111539_10048622
2674 Ga0111539_10123739
2675 Ga0111539_10132601
2676 Ga0111539_10165942
2677 Ga0111539_10220232
2678 Ga0111539_10274557
2679 Ga0111539_10863039
2680 Ga0111539_11275377
2681 Ga0111539_11339110
2682 Ga0111539_11411435
2683 Ga0105245_10000090
2684 Ga0105245_10010517
2685 Ga0105245_10036531
2686 Ga0105245_10071370
2687 Ga0105245_10409644
2688 Ga0105245_10512313
2689 Ga0105245_10945090
2690 Ga0105245_11005301
2691 Ga0105247_10003560
2692 Ga0105247_10007854
2693 Ga0105247_10019461
2694 Ga0105247_10115510
2695 Ga0114129_10006313
2696 Ga0114129_10008707
2697 Ga0114129_10024738
2698 Ga0114129_10037360
2699 Ga0114129_10381844
2700 Ga0114129_10544573
2701 Ga0114129_10664413
2702 Ga0114129_10783267
2703 Ga0114129_10908682
2704 Ga0105243_10001004
2705 Ga0105243_10027743
2706 Ga0105243_10037418
2707 Ga0105243_10077516
2708 Ga0105243_11178051
2709 Ga0105241_10000053
2710 Ga0105241_10309814
2711 Ga0105241_10555788
2712 Ga0105242_10004018
2713 Ga0105242_10171984
2714 Ga0105242_10187774
2715 Ga0105242_10381302
2716 Ga0105242_11219152
2717 Ga0105248_10000964
2718 Ga0105248_10020015
2719 Ga0105248_10020708
2720 Ga0105248_10022530
2721 Ga0105248_10027546
2722 Ga0105248_10149687
2723 Ga0105248_10216999
2724 Ga0105237_10005610
2725 Ga0105237_10045785
2726 Ga0105237_10116760
2727 Ga0105237_10126352
2728 Ga0105237_10296065
2729 Ga0105238_10068323
2730 Ga0105238_10079941
2731 Ga0105238_10454156
2732 Ga0105249_10009773
2733 Ga0099796_10009779
2734 Ga0099796_10042857
2735 Ga0099796_10113552
2736 Ga0099796_10146835
2737 Ga0105239_10007674
2738 Ga0105239_10092138
2739 Ga0105239_10097118
2740 Ga0105239_10462312
2741 Ga0105239_10644202
2742 Ga0105246_10000052
2743 Ga0105246_10075238
2744 Ga0105246_10095324
2745 Ga0105246_10379958
2746 Ga0157339_1001686
2747 Ga0157342_1000555
2748 Ga0157338_1000120
2749 Ga0157373_10039051
2750 Ga0157371_10006781
2751 Ga0157371_10177791
2752 Ga0157370_10237622
2753 Ga0157370_10282380
2754 Ga0157370_10582633
2755 Ga0157369_10508677
2756 Ga0157369_10541970
2757 Ga0157374_10000476
2758 Ga0157374_10055453
2759 Ga0157374_10105147
2760 Ga0157374_10567490
2761 Ga0157374_10951380
2762 Ga0157378_10002229
2763 Ga0157378_10294896
2764 Ga0157378_10348777
2765 Ga0157378_10397742
2766 Ga0163162_10000308
2767 Ga0163162_10050166
2768 Ga0163162_10146941
2769 Ga0163162_10193333
2770 Ga0163162_10242765
2771 Ga0163162_10268386
2772 Ga0163162_10570554
2773 Ga0157372_10572295
2774 Ga0157375_10000414
2775 Ga0157375_10056632
2776 Ga0157375_10090677
2777 Ga0157375_10257419
2778 Ga0157375_10796255
2779 Ga0163163_10002595
2780 Ga0163163_10003463
2781 Ga0163163_10010358
2782 Ga0163163_10029326
2783 Ga0157380_10000122
2784 Ga0157380_10208227
2785 Ga0157380_10225848
2786 Ga0157377_10001747
2787 Ga0157377_10037359
2788 Ga0157377_10058897
2789 Ga0157377_10069104
2790 Ga0157379_10000261
2791 Ga0157379_10028513
2792 Ga0157379_10047295
2793 Ga0157379_10049326
2794 Ga0157379_10059283
2795 Ga0157379_10832212
2796 Ga0157376_10000283
2797 Ga0157376_10147361
2798 Ga0157376_10249144
2799 Ga0157376_10972670
2800 Ga0163161_10000199
2801 Ga0206356_11625837
2802 Ga0206356_11859219
2803 Ga0213872_10041990
2804 Ga0213876_10052325
2805 Ga0213876_10086180
2806 Ga0213876_10241168
2807 Ga0213875_10000053
2808 Ga0213875_10078217
2809 Ga0213875_10158350
2810 Ga0224572_1003469
2811 Ga0209233_1007144
2812 Ga0207666_1000861
2813 Ga0207666_1002383
2814 Ga0207673_1000489
2815 Ga0209676_1032510
2816 Ga0209758_1001119
2817 Ga0209758_1004320
2818 Ga0209050_1025171
2819 Ga0209256_1009023
2820 Ga0209051_1009812
2821 Ga0209257_1010796
2822 Ga0207697_10000335
2823 Ga0207697_10004744
2824 Ga0207653_10001210
2825 Ga0207682_10000042
2826 Ga0207692_10007314
2827 Ga0207692_10010700
2828 Ga0207692_10038756
2829 Ga0207692_10141611
2830 Ga0207642_10000725
2831 Ga0207642_10080842
2832 Ga0207710_10002054
2833 Ga0207710_10038983
2834 Ga0207710_10062509
2835 Ga0207710_10098804
2836 Ga0207688_10000053
2837 Ga0207688_10000303
2838 Ga0207688_10021480
2839 Ga0207688_10046434
2840 Ga0207688_10089188
2841 Ga0207680_10001204
2842 Ga0207680_10022210
2843 Ga0207680_10045668
2844 Ga0207647_10003927
2845 Ga0207647_10004389
2846 Ga0207647_10053679
2847 Ga0207685_10062000
2848 Ga0207685_10063480
2849 Ga0207685_10064913
2850 Ga0207699_10055238
2851 Ga0207699_10177379
2852 Ga0207699_10192061
2853 Ga0207699_10661932
2854 Ga0207645_10000090
2855 Ga0207645_10027127
2856 Ga0207645_10044860
2857 Ga0207645_10079551
2858 Ga0207645_10151056
2859 Ga0207645_10428663
2860 Ga0207645_10429959
2861 Ga0207643_10000044
2862 Ga0207643_10001489
2863 Ga0207643_10143305
2864 Ga0207705_10059249
2865 Ga0207705_10168933
2866 Ga0207684_10006762
2867 Ga0207684_10035923
2868 Ga0207684_10099712
2869 Ga0207684_10187027
2870 Ga0207684_10288055
2871 Ga0207684_10613266
2872 Ga0207654_10000397
2873 Ga0207654_10029294
2874 Ga0207654_10057163
2875 Ga0207707_10001536
2876 Ga0207707_10187436
2877 Ga0207707_10301162
2878 Ga0207707_10436914
2879 Ga0207695_10156553
2880 Ga0207695_10183913
2881 Ga0207671_10007530
2882 Ga0207671_10136584
2883 Ga0207671_10341351
2884 Ga0207671_10429836
2885 Ga0207693_10002841
2886 Ga0207693_10023723
2887 Ga0207693_10024688
2888 Ga0207693_10033027
2889 Ga0207693_10065540
2890 Ga0207693_10088650
2891 Ga0207693_10097277
2892 Ga0207693_10127778
2893 Ga0207693_10161041
2894 Ga0207693_10175786
2895 Ga0207693_10221353
2896 Ga0207693_10496113
2897 Ga0207693_10529246
2898 Ga0207693_10547110
2899 Ga0207693_10614071
2900 Ga0207693_10676278
2901 Ga0207663_10012583
2902 Ga0207663_10078915
2903 Ga0207663_10093246
2904 Ga0207663_10120068
2905 Ga0207663_10315585
2906 Ga0207663_10508650
2907 Ga0207660_10000083
2908 Ga0207660_10014742
2909 Ga0207660_10038833
2910 Ga0207660_10085535
2911 Ga0207660_10355796
2912 Ga0207662_10000230
2913 Ga0207662_10025780
2914 Ga0207662_10029808
2915 Ga0207662_10076174
2916 Ga0207657_10001336
2917 Ga0207657_10043359
2918 Ga0207657_10051527
2919 Ga0207657_10057189
2920 Ga0207657_10118613
2921 Ga0207657_10238867
2922 Ga0207657_10379870
2923 Ga0207649_10000260
2924 Ga0207649_10062643
2925 Ga0207652_10002829
2926 Ga0207652_10041895
2927 Ga0207652_10048055
2928 Ga0207652_10065015
2929 Ga0207652_10101081
2930 Ga0207652_10123939
2931 Ga0207652_10127047
2932 Ga0207652_10289647
2933 Ga0207646_10050403
2934 Ga0207646_10128543
2935 Ga0207646_10269889
2936 Ga0207681_10000271
2937 Ga0207681_10072398
2938 Ga0207681_10097997
2939 Ga0207694_10013167
2940 Ga0207694_10153669
2941 Ga0207694_10504424
2942 Ga0207650_10006320
2943 Ga0207650_10014750
2944 Ga0207650_10023350
2945 Ga0207650_10026553
2946 Ga0207650_10045459
2947 Ga0207650_10151005
2948 Ga0207659_10000258
2949 Ga0207659_10040244
2950 Ga0207659_10057381
2951 Ga0207659_10113354
2952 Ga0207659_10191778
2953 Ga0207659_10237474
2954 Ga0207659_10313108
2955 Ga0207687_10000063
2956 Ga0207687_10013043
2957 Ga0207687_10086242
2958 Ga0207687_10421539
2959 Ga0207687_10640576
2960 Ga0207700_10022871
2961 Ga0207700_10046001
2962 Ga0207700_10062363
2963 Ga0207700_10128057
2964 Ga0207700_10172519
2965 Ga0207700_10347125
2966 Ga0207700_10822302
2967 Ga0207664_10038216
2968 Ga0207664_10054501
2969 Ga0207664_10128655
2970 Ga0207664_10254745
2971 Ga0207664_10524073
2972 Ga0207644_10000524
2973 Ga0207644_10006692
2974 Ga0207644_10045806
2975 Ga0207644_10074067
2976 Ga0207644_10129632
2977 Ga0207644_10207058
2978 Ga0207690_10001251
2979 Ga0207690_10230639
2980 Ga0207690_10388623
2981 Ga0207706_10001197
2982 Ga0207706_10002752
2983 Ga0207706_10009072
2984 Ga0207706_10032010
2985 Ga0207706_10099317
2986 Ga0207706_10182028
2987 Ga0207706_10412473
2988 Ga0207686_10000456
2989 Ga0207686_10108312
2990 Ga0207686_10158898
2991 Ga0207686_10257159
2992 Ga0207709_10000372
2993 Ga0207709_10068200
2994 Ga0207670_10000345
2995 Ga0207670_10003254
2996 Ga0207670_10006141
2997 Ga0207670_10007621
2998 Ga0207670_10058416
2999 Ga0207670_10072520
3000 Ga0207669_10000019
3001 Ga0207704_10007530
3002 Ga0207704_10160016
3003 Ga0207665_10008520
3004 Ga0207665_10043429
3005 Ga0207665_10142024
3006 Ga0207665_10226485
3007 Ga0207665_10312167
3008 Ga0207665_10414586
3009 Ga0207691_10000987
3010 Ga0207691_10003130
3011 Ga0207691_10035947
3012 Ga0207691_10087771
3013 Ga0207691_10138784
3014 Ga0207691_10183730
3015 Ga0207691_10680101
3016 Ga0207711_10001673
3017 Ga0207711_10011969
3018 Ga0207711_10057086
3019 Ga0207711_10263308
3020 Ga0207711_10300267
3021 Ga0207711_10404704
3022 Ga0207689_10000916
3023 Ga0207689_10043776
3024 Ga0207661_10000107
3025 Ga0207661_10008359
3026 Ga0207661_10355257
3027 Ga0207679_10000026
3028 Ga0207679_10010198
3029 Ga0207679_10180970
3030 Ga0207679_10531988
3031 Ga0207679_10683305
3032 Ga0207667_10003336
3033 Ga0207667_10016894
3034 Ga0207667_10026958
3035 Ga0207667_10240610
3036 Ga0207667_10352694
3037 Ga0207667_10671609
3038 Ga0207651_10000855
3039 Ga0207651_10007700
3040 Ga0207651_10048298
3041 Ga0207651_10417901
3042 Ga0207712_10000242
3043 Ga0207712_10005698
3044 Ga0207712_10109207
3045 Ga0207712_10178669
3046 Ga0207668_10000049
3047 Ga0207668_10035376
3048 Ga0207668_10183307
3049 Ga0207668_10664834
3050 Ga0207640_10000234
3051 Ga0207640_10054433
3052 Ga0207640_10418870
3053 Ga0207658_10000804
3054 Ga0207658_10081866
3055 Ga0207658_10530498
3056 Ga0207658_10593474
3057 Ga0207677_10010292
3058 Ga0207677_10014242
3059 Ga0207677_10399653
3060 Ga0207703_10001356
3061 Ga0207703_10013541
3062 Ga0207703_10052590
3063 Ga0207639_10063261
3064 Ga0207678_10000831
3065 Ga0207678_10020178
3066 Ga0207678_10047638
3067 Ga0207678_10217103
3068 Ga0207678_10233442
3069 Ga0207708_10001403
3070 Ga0207708_10003197
3071 Ga0207708_10008657
3072 Ga0207708_10048004
3073 Ga0207708_10093743
3074 Ga0207708_10111840
3075 Ga0207708_10134596
3076 Ga0207702_10001965
3077 Ga0207702_10021193
3078 Ga0207702_10037163
3079 Ga0207702_10430239
3080 Ga0207702_10769345
3081 Ga0207641_10000669
3082 Ga0207641_10020291
3083 Ga0207641_10116676
3084 Ga0207641_10203724
3085 Ga0207641_10244333
3086 Ga0207641_10617020
3087 Ga0207648_10001440
3088 Ga0207648_10007865
3089 Ga0207648_10135059
3090 Ga0207648_10145029
3091 Ga0207648_10150751
3092 Ga0207676_10002834
3093 Ga0207676_10038734
3094 Ga0207676_10317214
3095 Ga0207674_10001207
3096 Ga0207674_10048795
3097 Ga0207674_10079903
3098 Ga0207675_100000983
3099 Ga0207675_100008958
3100 Ga0207675_100060262
3101 Ga0207683_10000324
3102 Ga0207683_10003263
3103 Ga0207683_10009172
3104 Ga0207683_10032197
3105 Ga0207683_10034197
3106 Ga0207683_10082323
3107 Ga0207683_10231898
3108 Ga0207683_10273012
3109 Ga0207698_10037934
3110 Ga0207698_10055015
3111 Ga0207698_10083712
3112 Ga0207698_10317619
3113 Ga0207698_10867889
3114 Ga0209281_1000028
3115 Ga0209973_1012614
3116 Ga0209967_1033312
3117 Ga0209999_1030856
3118 Ga0209982_1014071
3119 Ga0210002_1000535
3120 Ga0209588_1008486
3121 Ga0209971_1009254
3122 Ga0209966_1001462
3123 Ga0209966_1001844
3124 Ga0209998_10003317
3125 Ga0209998_10003343
3126 Ga0209998_10021479
3127 Ga0209974_10000294
3128 Ga0207428_10000130
3129 Ga0207428_10000180
3130 Ga0207428_10000286
3131 Ga0207428_10021017
3132 Ga0207428_10108503
3133 Ga0268266_10018041
3134 Ga0268266_10082954
3135 Ga0268266_10096310
3136 Ga0268266_10228212
3137 Ga0268265_10001031
3138 Ga0268264_10001139
3139 Ga0268264_10052458
3140 Ga0268264_10053079
3141 Ga0268264_10158196
3142 Ga0268264_10208891
3143 Ga0268264_10406525
3144 Ga0268264_10475908
3145 Ga0265337_1005487
3146 Ga0265318_10020071
3147 Ga0265338_10027443
3148 Ga0265338_10041953
3149 Ga0265338_10279590
3150 Ga0307511_10162010
3151 Ga0265762_1009325
3152 Ga0265763_1000858
3153 Ga0265760_10015831
3154 Ga0265330_10012081
3155 Ga0265330_10040936
3156 Ga0265330_10086514
3157 Ga0265320_10020669
3158 Ga0265325_10000011
3159 Ga0265325_10003712
3160 Ga0265325_10014736
3161 Ga0265325_10022034
3162 Ga0265325_10057438
3163 Ga0265325_10062114
3164 Ga0265329_10029376
3165 Ga0265329_10032779
3166 Ga0265340_10013469
3167 Ga0265340_10021550
3168 Ga0265340_10064325
3169 Ga0265340_10120326
3170 Ga0265339_10000323
3171 Ga0265339_10001920
3172 Ga0265339_10054498
3173 Ga0265339_10072814
3174 Ga0265339_10123366
3175 Ga0265339_10168861
3176 Ga0265331_10003347
3177 Ga0265331_10021350
3178 Ga0265331_10091038
3179 Ga0265331_10121371
3180 Ga0265327_10001225
3181 Ga0265316_10034538
3182 Ga0307513_10104188
3183 Ga0307408_100107474
3184 Ga0265313_10001449
3185 Ga0265313_10001589
3186 Ga0265313_10003565
3187 Ga0265313_10009692
3188 Ga0265313_10020730
3189 Ga0265313_10029784
3190 Ga0265313_10040888
3191 Ga0316575_10070445
3192 Ga0316579_10055021
3193 Ga0265314_10013869
3194 Ga0265314_10015442
3195 Ga0265314_10045240
3196 Ga0265314_10076897
3197 Ga0265342_10000149
3198 Ga0265342_10007848
3199 Ga0265342_10019096
3200 Ga0265342_10039757
3201 Ga0265342_10045575
3202 Ga0265342_10119218
3203 Ga0316576_10107181
3204 Ga0316578_10048911
3205 Ga0307413_10112006
3206 Ga0307410_10760394
3207 Ga0307406_10181064
3208 Ga0307406_10288537
3209 Ga0307412_10153401
3210 Ga0307412_10535256
3211 Ga0307409_100646148
3212 Ga0307416_100451831
3213 Ga0316583_10000030
3214 Ga0373930_0000095
3215 Ga0373948_0000228
3216 Ga0373958_0000068
3217 Ga0373958_0007995
3218 Ga0373959_0000647
3219 Ga0373938_0000024
3220 Ga0373938_0000123
3221 Ga0373926_0018881
3222 Ga0373926_0020863
3223 Ga0373926_0034034
3224 Ga0373926_0147383
3225 Ga0373928_0000414
3226 Ga0373928_0005868
3227 Ga0373928_0043229
3228 Ga0373928_0062581
3229 Ga0373929_0000244
3230 Ga0373929_0000851
3231 Ga0373929_0011780
3232 Ga0373934_0020094
3233 Ga0373934_0039777
3234 Ga0373940_0000883
3235 Ga0373940_0042643
3236 Ga0373944_0004335
3237 Ga0373944_0022951
3238 Ga0373944_0055312
3239 Ga0373944_0110928
3240 Ga0373944_0124588
3241 Ga0373944_0135960
3242 Ga0373951_0000589
3243 Ga0373951_0065173
3244 Ga0373952_0001678
3245 Ga0373952_0019323
3246 Ga0373923_0001460
3247 Ga0373923_0090664
3248 Ga0373923_0211333
3249 Ga0373932_0004049
3250 Ga0373932_0028908
3251 Ga0373936_0000207
3252 Ga0373936_0011857
3253 Ga0373936_0026559
3254 Ga0373936_0055171
3255 Ga0373936_0125171
3256 Ga0373939_0000144
3257 Ga0373939_0000494
3258 Ga0373941_0000087
3259 Ga0373941_0006414
3260 Ga0373941_0021021
3261 Ga0373941_0042002
3262 Ga0373945_0000777
3263 Ga0373945_0001428
3264 Ga0373945_0021379
3265 Ga0373945_0077652
3266 Ga0373953_0001671
3267 Ga0373953_0005830
3268 Ga0373953_0039509
3269 Ga0373953_0059627
3270 Ga0373954_0001529
3271 Ga0373954_0003918
3272 Ga0373954_0102689
3273 Ga0373954_0133876
3274 Ga0373956_0003195
3275 Ga0373956_0007244
3276 Ga0373956_0009272
3277 Ga0373957_0015185
3278 Ga0373957_0027588
3279 Ga0373957_0029065
3280 Ga0373957_0036106
3281 Ga0373957_0041093
3282 Ga0373957_0045754
3283 Ga0373957_0054452
3284 Ga0373960_0000084
3285 Ga0373960_0090397
3286 Ga0373960_0102997
3287 Ga0373943_0000284
3288 Ga0373943_0002532
3289 Ga0373943_0014380
3290 Ga0373943_0019966
3291 Ga0373943_0038607
3292 Ga0373943_0120226
3293 Ga0373943_0141050
3294 Ga0373946_0000695
3295 Ga0373946_0002959
3296 Ga0373946_0009548
3297 Ga0373946_0096209
3298 Ga0373955_0000939
3299 Ga0373955_0020961
3300 Ga0373955_0022592
3301 Ga0373955_0025875
3302 Ga0373955_0069900
3303 Ga0373955_0115527
3304 Ga0373955_0195555
3305 Ga0373942_0000345
3306 Ga0373942_0024473
3307 Ga0373961_0000298
3308 Ga0373961_0119758
3309 Ga0373962_0000490
3310 Ga0373962_0026721
3311 Ga0373962_0038087
3312 Ga0373962_0071855
3313 Ga0316574_0000211
3314 Ga0373924_0000420
3315 Ga0373924_0010729
3316 Ga0373924_0018992
3317 Ga0373924_0019629
3318 Ga0373924_0022643
3319 Ga0373924_0050885
3320 Ga0373924_0075188
3321 Ga0373931_0002660
3322 Ga0373931_0006309
3323 Ga0373931_0009404
3324 Ga0373931_0009501
3325 Ga0373931_0019643
3326 Ga0373931_0077504
3327 Ga0373931_0095815
3328 Ga0373931_0416183
3329 Ga0373935_0000068
3330 Ga0373935_0001340
3331 Ga0373935_0004603
3332 Ga0373935_0033167
3333 Ga0373935_0035234
3334 Ga0373935_0047368
3335 Ga0373935_0124991
3336 Ga0373935_0291884
3337 Ga0373927_0000892
3338 Ga0373927_0007778
3339 Ga0373927_0013606
3340 Ga0373927_0017506
3341 Ga0373927_0028055
3342 Ga0373927_0040077
3343 Ga0373927_0044599
3344 Ga0373927_0068542
3345 Ga0373927_0089508
3346 Ga0373927_0107455
3347 Ga0373927_0122064
3348 Ga0373927_0165875
3349 Ga0373927_0237513
3350 Ga0373927_0407104
3351 Ga0373933_0002505
3352 Ga0373933_0006990
3353 Ga0373933_0019730
3354 Ga0373933_0035338
3355 Ga0373933_0169074
3356 Ga0373933_0216853
3357 Ga0373933_0438419
3358 Ga0373947_0001171
3359 Ga0373947_0001272
3360 Ga0373947_0023230
3361 Ga0373947_0024918
3362 Ga0373947_0040448
3363 Ga0373947_0057180
3364 Ga0373947_0071540
3365 Ga0373947_0144980
3366 Ga0373947_0159507
3367 Ga0373947_0180941
3368 Ga0373947_0201741
3369 Ga0373947_0265333
3370 Ga0373947_0420068
3371 Ga0373937_0000347
3372 Ga0373937_0008050
3373 Ga0373937_0011304
3374 Ga0373937_0026143
3375 Ga0373937_0027513
3376 Ga0373937_0057623
3377 Ga0373937_0098779
3378 Ga0373937_0188576
3379 Ga0373937_0229258
3380 Ga0373937_0232213
3381 Ga0373937_0469428
3382 Ga0373937_0495646
3383 Ga0316582_0353427
3384 Ga0316584_0008194
3385 Ga0373925_0000081
3386 Ga0373925_0000653
3387 Ga0373925_0001023
3388 Ga0373925_0008272
3389 Ga0373925_0025054
3390 Ga0373925_0030678
3391 Ga0373925_0046325
3392 Ga0373925_0049791
3393 Ga0373925_0050717
3394 Ga0373925_0058583
3395 Ga0373925_0095524
3396 Ga0373925_0155767
3397 Ga0373925_0164207
3398 Ga0373925_0191875
3399 Ga0373925_0229783
3400 Ga0373925_0294800
3401 Ga0373925_0507200
3402 Ga0373925_0758593
3403 Ga0395899_0032551
3404 Ga0395899_0213489
3405 Ga0395900_0006665
3406 Ga0395900_0028654
3407 Ga0395900_0098941
3408 Ga0395900_0172509
3409 Ga0395900_0200420
3410 Ga0395898_0035860
3411 Ga0395898_0038265
3412 Ga0395898_0085008
3413 Ga0395898_0092455
3414 Ga0395898_0283432
3415 Ga0395905_0302093
3416 Ga0436364_0121626
3417 Ga0436364_0338040
3418 Ga0436364_0627969
3419 Ga0436364_0660984
3420 Ga0436364_0901640
3421 Ga0436364_0916700
3422 Ga0436364_1474445
3423 Ga0436364_1519170
3424 Ga0395901_0025427
3425 Ga0395901_0026822
3426 Ga0395901_0040513
3427 Ga0395901_0902692
3428 Ga0242420_002911
3429 Ga0436365_0059281
3430 Ga0436365_0122255
3431 Ga0436365_0248540
3432 Ga0436365_1138132
3433 Ga0436365_1168875
3434 Ga0436365_1227273
3435 Ga0436365_1288986
3436 Ga0436365_1489999
3437 Ga0436365_1546564
3438 Ga0436365_1586594
3439 Ga0436365_1636132
3440 Ga0436365_1743112
3441 Ga0436365_1808718
3442 Ga0436360_0104217
3443 Ga0436360_0526234
3444 Ga0436361_0396460
3445 Ga0436361_0537381
3446 Ga0436363_1053196
3447 Ga0436362_0029375
3448 Ga0436362_0103934
3449 Ga0436362_0842372
3450 Ga0451793_1602144
3451 Ga0451798_0255151
3452 Ga0451800_0275571
3453 Ga0439441_046807
3454 Ga0439443_001105
3455 Ga0439448_0009804
3456 Ga0439450_003605
3457 Ga0439452_038943
3458 Ga0439455_0077232
3459 Ga0439456_012957
3460 Ga0439458_0072824
3461 Ga0439434_0095338
3462 Ga0439435_0013920
3463 Ga0439435_0033029
3464 Ga0439459_0010364
3465 Ga0439460_0024666
3466 Ga0439460_0030144
3467 Ga0450916_015667
3468 Ga0450893_0026988
3469 Ga0466961_0213607
3470 Ga0466963_0015054
3471 Ga0466963_0050712
3472 Ga0466964_0199296
3473 Ga0453684_0016107
3474 Ga0466971_0011557
3475 Ga0466968_0043860
3476 Ga0466957_0007649
3477 Ga0466957_0030543
3478 Ga0466959_0053759
3479 Ga0466959_0128956
3480 Ga0451576_0092818
3481 Ga0451576_0288386
3482 Ga0466958_0016565
3483 Ga0466958_0162419
3484 Ga0466958_0245248
3485 Ga0466967_0018949
3486 Ga0466967_0217467
3487 Ga0466967_0469013
3488 Ga0495617_050620
3489 Ga0495617_078054
3490 Ga0495627_036133
3491 Ga0495592_0000196
3492 Ga0495592_0008970
3493 Ga0495592_0025624
3494 Ga0495592_0037087
3495 Ga0495592_0053905
3496 Ga0495603_0000093
3497 Ga0495603_0054690
3498 Ga0495603_0128064
3499 Ga0495603_0214608
3500 Ga0495603_0360902
3501 Ga0495591_057995
3502 Ga0495629_0001201
3503 Ga0495629_0010557
3504 Ga0495629_0012746
3505 Ga0495629_0027735
3506 Ga0495629_0059328
3507 Ga0495629_0064371
3508 Ga0495629_0086242
3509 Ga0495629_0225442
3510 Ga0495638_0012740
3511 Ga0495638_0021453
3512 Ga0495641_0020177
3513 Ga0495641_0021631
3514 Ga0495641_0114948
3515 Ga0495641_0223227
3516 Ga0495651_0002348
3517 Ga0495651_0002948
3518 Ga0495651_0005382
3519 Ga0495651_0021551
3520 Ga0495651_0042323
3521 Ga0495651_0083231
3522 Ga0495651_0094627
3523 Ga0495651_0171422
3524 Ga0495653_0000193
3525 Ga0495653_0009994
3526 Ga0495653_0019439
3527 Ga0495653_0035077
3528 Ga0495653_0057712
3529 Ga0495653_0097052
3530 Ga0495653_0227148
3531 Ga0495653_0400753
3532 Ga0495580_0007841
3533 Ga0495580_0010786
3534 Ga0495580_0096357
3535 Ga0495582_0005327
3536 Ga0495582_0152078
3537 Ga0495582_0190635
3538 Ga0495582_0282348
3539 Ga0495582_0415554
3540 Ga0495605_0156893
3541 Ga0495639_0005974
3542 Ga0495639_0011892
3543 Ga0495639_0044738
3544 Ga0495639_0059835
3545 Ga0495639_0074989
3546 Ga0495639_0131573
3547 Ga0495662_0002058
3548 Ga0495662_0015755
3549 Ga0495662_0018838
3550 Ga0495662_0038790
3551 Ga0495662_0220777
3552 Ga0495664_0000016
3553 Ga0495664_0008894
3554 Ga0495664_0027162
3555 Ga0495664_0031450
3556 Ga0495664_0109799
3557 Ga0495664_0121094
3558 Ga0495584_0015525
3559 Ga0495584_0028278
3560 Ga0495584_0200121
3561 Ga0495585_0000744
3562 Ga0495594_0000721
3563 Ga0495594_0087294
3564 Ga0495607_0004149
3565 Ga0495607_0136966
3566 Ga0495607_0210563
3567 Ga0495608_0000121
3568 Ga0495608_0000771
3569 Ga0495608_0014487
3570 Ga0495608_0040568
3571 Ga0495608_0112226
3572 Ga0495608_0113543
3573 Ga0495616_0016978
3574 Ga0495618_0000124
3575 Ga0495618_0005183
3576 Ga0495618_0017457
3577 Ga0495618_0018922
3578 Ga0495618_0042509
3579 Ga0495618_0055657
3580 Ga0495620_0172302
3581 Ga0495628_0000018
3582 Ga0495628_0000983
3583 Ga0495628_0009078
3584 Ga0495628_0027680
3585 Ga0495628_0036129
3586 Ga0495628_0130602
3587 Ga0495628_0258302
3588 Ga0495628_0514395
3589 Ga0495630_0003520
3590 Ga0495630_0017798
3591 Ga0495630_0024763
3592 Ga0495630_0077425
3593 Ga0495630_0085278
3594 Ga0495630_0160731
3595 Ga0495630_0276089
3596 Ga0495630_0278009
3597 Ga0495630_0289424
3598 Ga0495630_0341734
3599 Ga0495637_0037120
3600 Ga0495643_0196220
3601 Ga0495644_0001408
3602 Ga0495644_0167041
3603 Ga0495663_0117490
3604 Ga0495666_0042442
3605 Ga0495666_0043799
3606 Ga0495652_0000005
3607 Ga0495652_0002733
3608 Ga0495652_0051626
3609 Ga0495652_0058542
3610 Ga0495652_0066677
3611 Ga0495652_0089511
3612 Ga0495652_0106119
3613 Ga0495652_0125251
3614 Ga0495652_0141866
3615 Ga0495652_0190519
3616 Ga0495652_0286467
3617 Ga0495652_0342268
3618 Ga0495665_0009999
3619 Ga0495665_0058209
3620 Ga0495665_0118793
3621 Ga0495665_0134352
3622 Ga0495665_0146541
3623 Ga0495665_0309354
3624 Ga0495640_0000063
3625 Ga0495640_0006976
3626 Ga0495640_0008162
3627 Ga0495640_0020151
3628 Ga0495640_0026278
3629 Ga0495640_0028991
3630 Ga0495640_0073498
3631 Ga0495640_0084335
3632 Ga0495640_0111190
3633 Ga0495640_0225160
3634 Ga0495640_0282941
3635 Ga0495586_0013527
3636 Ga0495586_0193971
3637 Ga0495587_0000134
3638 Ga0495587_0001646
3639 Ga0495587_0002875
3640 Ga0495587_0029159
3641 Ga0495587_0039375
3642 Ga0495587_0039844
3643 Ga0495587_0078567
3644 Ga0495598_0003261
3645 Ga0495598_0051766
3646 Ga0495598_0095176
3647 Ga0495609_0093773
3648 Ga0495609_0198642
3649 Ga0495645_0000070
3650 Ga0495645_0000964
3651 Ga0495645_0010945
3652 Ga0495645_0032016
3653 Ga0495645_0101869
3654 Ga0495645_0169314
3655 Ga0495622_0000860
3656 Ga0495622_0046427
3657 Ga0495633_0001138
3658 Ga0495667_0000023
3659 Ga0495667_0001135
3660 Ga0495667_0001703
3661 Ga0495667_0012592
3662 Ga0495667_0013045
3663 Ga0495667_0033063
3664 Ga0495667_0045998
3665 Ga0495667_0077552
3666 Ga0495667_0353605
3667 Ga0495656_0000294
3668 Ga0495656_0031553
3669 Ga0495668_0109391
3670 Ga0495634_0001421
3671 Ga0495634_0010247
3672 Ga0495634_0010782
3673 Ga0495634_0021067
3674 Ga0495634_0081754
3675 Ga0495634_0098959
3676 Ga0495634_0253731
3677 Ga0495611_0023332
3678 Ga0495611_0075383
3679 Ga0495635_0000045
3680 Ga0495635_0012375
3681 Ga0495635_0013259
3682 Ga0495635_0015541
3683 Ga0495635_0025544
3684 Ga0495635_0086485
3685 Ga0495635_0153273
3686 Ga0495659_0000910
3687 Ga0495659_0007996
3688 Ga0495659_0028993
3689 Ga0495659_0051172
3690 Ga0495661_0142490
3691 Ga0495661_0268576
3692 Ga0495588_0015102
3693 Ga0495588_0035827
3694 Ga0495657_0001484
3695 Ga0495657_0009705
3696 Ga0495657_0020415
3697 Ga0495657_0061911
3698 Ga0495657_0357786
3699 Ga0495599_0000107
3700 Ga0495599_0004271
3701 Ga0495599_0012935
3702 Ga0495599_0140992
3703 Ga0495599_0172179
3704 Ga0495599_0249395
3705 Ga0495599_0253644
3706 Ga0495623_0001191
3707 Ga0495623_0007416
3708 Ga0495623_0008866
3709 Ga0495623_0014856
3710 Ga0495623_0055588
3711 Ga0495646_0000027
3712 Ga0495646_0032793
3713 Ga0495646_0037398
3714 Ga0495646_0047543
3715 Ga0495647_0011106
3716 Ga0495647_0120031
3717 Ga0495647_0221901
3718 Ga0495658_0011800
3719 Ga0495658_0041663
3720 Ga0495658_0051957
3721 Ga0495658_0069244
3722 Ga0495658_0166566
3723 Ga0495669_0029452
3724 Ga0495669_0050152
3725 Ga0495613_0001829
3726 Ga0495613_0001924
3727 Ga0495613_0006830
3728 Ga0495613_0090999
3729 Ga0495613_0138925
3730 Ga0495613_0146571
3731 Ga0495613_0163629
3732 Ga0495624_0003159
3733 Ga0495624_0039069
3734 Ga0495624_0115043
3735 Ga0495624_0188625
3736 Ga0495624_0394134
3737 Ga0495670_0002475
3738 Ga0495670_0134647
3739 Ga0495671_0055359
3740 Ga0495671_0300586
3741 Ga0495600_0000062
3742 Ga0495600_0007173
3743 Ga0495600_0011446
3744 Ga0495600_0022696
3745 Ga0495600_0063032
3746 Ga0495600_0170741
3747 Ga0495600_0337010
3748 Ga0495581_0001040
3749 Ga0495581_0024139
3750 Ga0495581_0038630
3751 Ga0495581_0046212
3752 Ga0495581_0079606
3753 Ga0495581_0138786
3754 Ga0495604_0000014
3755 Ga0495604_0002499
3756 Ga0495604_0053444
3757 Ga0495604_0055049
3758 Ga0495604_0078633
3759 Ga0495604_0080164
3760 Ga0495604_0099497
3761 Ga0495674_0000014
3762 Ga0495674_0016669
3763 Ga0495674_0023132
3764 Ga0495674_0049831
3765 Ga0495674_0049897
3766 Ga0495674_0057712
3767 Ga0495674_0059508
3768 Ga0495674_0216636
3769 Ga0495674_0356436
3770 Ga0495674_0357015
3771 Ga0495674_0361912
3772 Ga0495672_0065395
3773 Ga0495672_0164150
3774 Ga0495676_0046149
3775 Ga0495676_0080907
3776 Ga0495676_0084335
3777 Ga0495676_0153985
3778 Ga0495676_0190838
3779 Ga0495680_0002314
3780 Ga0495680_0005915
3781 Ga0495680_0009630
3782 Ga0495680_0014720
3783 Ga0495680_0035972
3784 Ga0495680_0054521
3785 Ga0495680_0059006
3786 Ga0495680_0181817
3787 Ga0495680_0247426
3788 Ga0495675_0000058
3789 Ga0495675_0002587
3790 Ga0495675_0017488
3791 Ga0495675_0049171
3792 Ga0495675_0081769
3793 Ga0495675_0237466
3794 Ga0495677_0108541
3795 Ga0495685_010080
3796 Ga0495684_0000059
3797 Ga0495684_0002058
3798 Ga0495684_0060169
3799 Ga0495684_0124863
3800 Ga0495684_0129220
3801 Ga0495684_0244855
3802 Ga0495593_0000892
3803 Ga0495593_0002389
3804 Ga0495593_0006746
3805 Ga0495593_0012827
3806 Ga0495593_0041503
3807 Ga0495593_0084739
3808 Ga0495602_0000017
3809 Ga0495602_0003589
3810 Ga0495602_0009345
3811 Ga0495602_0021745
3812 Ga0495602_0075453
3813 Ga0495602_0111881
3814 Ga0495602_0367535
3815 Ga0495614_0009570
3816 Ga0495614_0013572
3817 Ga0495614_0083069
3818 Ga0495614_0191860
3819 Ga0496100_0000919
3820 Ga0496100_0006499
3821 Ga0496100_0019742
3822 Ga0496100_0027242
3823 Ga0496100_0038257
3824 Ga0496100_0066987
3825 Ga0496100_0139605
3826 Ga0496100_0174481
3827 Ga0496100_0264740
3828 Ga0496100_0365725
3829 Ga0496101_0000569
3830 Ga0496101_0012497
3831 Ga0496101_0024358
3832 Ga0496101_0088947
3833 Ga0496101_0161752
3834 Ga0496101_0270579
3835 Ga0496101_0273467
3836 Ga0496101_0306739
3837 Ga0496101_0597260
3838 Ga0496102_0008204
3839 Ga0496102_0017532
3840 Ga0496102_0032540
3841 Ga0496102_0033436
3842 Ga0496102_0044888
3843 Ga0496102_0141274
3844 Ga0496102_0158894
3845 Ga0496102_0232147
3846 Ga0496102_0427547
3847 Ga0496102_0673704
3848 Ga0496102_0760608
3849 Ga0496103_0001432
3850 Ga0496103_0004579
3851 Ga0496103_0012887
3852 Ga0496103_0056458
3853 Ga0496103_0089717
3854 Ga0496103_0129074
3855 Ga0496104_0000239
3856 Ga0496104_0002113
3857 Ga0496104_0002280
3858 Ga0496104_0003037
3859 Ga0496104_0006583
3860 Ga0496104_0009456
3861 Ga0496104_0021769
3862 Ga0496104_0059203
3863 Ga0496104_0079916
3864 Ga0496104_0093981
3865 Ga0496104_0115058
3866 Ga0496104_0138130
3867 Ga0496104_0141028
3868 Ga0496104_0683279
3869 Ga0496105_0002071
3870 Ga0496105_0006702
3871 Ga0496105_0006961
3872 Ga0496105_0021912
3873 Ga0496105_0032767
3874 Ga0496105_0041467
3875 Ga0496105_0083517
3876 Ga0496105_0089019
3877 Ga0496105_0089523
3878 Ga0496105_0110435
3879 Ga0496105_0235798
3880 Ga0496106_0000491
3881 Ga0496106_0005632
3882 Ga0496106_0007949
3883 Ga0496106_0033580
3884 Ga0496106_0068253
3885 Ga0496106_0110672
3886 Ga0496106_0114853
3887 Ga0496106_0127117
3888 Ga0496106_0404935
3889 Ga0496106_0407312
3890 Ga0496107_0000327
3891 Ga0496107_0001121
3892 Ga0496107_0008877
3893 Ga0496107_0012293
3894 Ga0496107_0015183
3895 Ga0496107_0031442
3896 Ga0496107_0071203
3897 Ga0496107_0103484
3898 Ga0496107_0138410
3899 Ga0496107_0145816
3900 Ga0496107_0281241
3901 Ga0496108_0004390
3902 Ga0496108_0006898
3903 Ga0496108_0011233
3904 Ga0496108_0016572
3905 Ga0496108_0097238
3906 Ga0496108_0278723
3907 Ga0496108_0325528
3908 Ga0496108_0434532
3909 Ga0496108_0539560
3910 Ga0496109_0000925
3911 Ga0496109_0007037
3912 Ga0496109_0021125
3913 Ga0496109_0029032
3914 Ga0496109_0045546
3915 Ga0496109_0065028
3916 Ga0496109_0084279
3917 Ga0496109_0165837
3918 Ga0496109_0277551
3919 Ga0496109_0425101
3920 Ga0496109_0673353
3921 Ga0496110_0001215
3922 Ga0496110_0001775
3923 Ga0496110_0002587
3924 Ga0496110_0017600
3925 Ga0496110_0039582
3926 Ga0496110_0118444
3927 Ga0496110_0332263
3928 Ga0496110_0470355
3929 Ga0496110_0579877
3930 Ga0496110_0678163
3931 Ga0496110_0696273
3932 Ga0496111_0004183
3933 Ga0496111_0012152
3934 Ga0496111_0021771
3935 Ga0496111_0126663
3936 Ga0496111_0165119
3937 Ga0496111_0475177
3938 Ga0496111_0524209
3939 Ga0496112_0005890
3940 Ga0496112_0013125
3941 Ga0496112_0014646
3942 Ga0496112_0060529
3943 Ga0496112_0146319
3944 Ga0496112_0218273
3945 Ga0496112_0230093
3946 Ga0496112_0280006
3947 Ga0496112_0332097
3948 Ga0496112_0698260
3949 Ga0496113_0000285
3950 Ga0496113_0000465
3951 Ga0496113_0006001
3952 Ga0496113_0017270
3953 Ga0496113_0032574
3954 Ga0496113_0065939
3955 Ga0496113_0082796
3956 Ga0496113_0289967
3957 Ga0496113_0457702
3958 Ga0496113_0567031
3959 Ga0496113_0787461
3960 Ga0496114_0014271
3961 Ga0496114_0017597
3962 Ga0496114_0019622
3963 Ga0496114_0112527
3964 Ga0496114_0183954
3965 Ga0496114_0323705
3966 Ga0496114_0473044
3967 Ga0496114_0520262
3968 Ga0496115_0000673
3969 Ga0496115_0028117
3970 Ga0496115_0038417
3971 Ga0496115_0054936
3972 Ga0496115_0060964
3973 Ga0496115_0071316
3974 Ga0496115_0193911
3975 Ga0496115_0286675
3976 Ga0496115_0298007
3977 Ga0496115_0330680
3978 Ga0496117_0037784
3979 Ga0496121_0260581
3980 Ga0496122_0000074
3981 Ga0496123_0000062
3982 Ga0496123_0028666
3983 Ga0496123_0067278
3984 Ga0496124_0017561
3985 Ga0496124_0103122
3986 Ga0496126_0131026
3987 Ga0495678_103576
3988 Ga0501031_0003691
3989 Ga0501031_0234738
3990 Ga0501031_0251105
3991 Ga0501032_0009043
3992 Ga0501032_0029180
3993 Ga0501032_0317789
3994 Ga0501033_0031141
3995 Ga0501033_0044079
3996 Ga0501033_0247833
3997 Ga0501033_0345718
3998 Ga0501034_0000286
3999 Ga0501034_0005591
4000 Ga0501034_0024972
4001 Ga0501034_0064368
4002 Ga0501034_0073247
4003 Ga0501034_0113968
4004 Ga0501034_0163594
4005 Ga0501034_0271490
4006 Ga0501034_0286262
4007 Ga0501034_0300972
4008 Ga0501034_0369466
4009 Ga0501036_0003843
4010 Ga0501036_0024488
4011 Ga0501036_0174295
4012 Ga0501036_0441382
4013 Ga0501037_0148919
4014 Ga0501038_0015789
4015 Ga0501038_0019883
4016 Ga0501038_0051587
4017 Ga0501038_0229555
4018 Ga0501039_0002615
4019 Ga0501039_0280799
4020 Ga0501039_0335357
4021 Ga0501039_0365640
4022 Ga0501042_0062147
4023 Ga0501042_0122911
4024 Ga0501042_0146303
4025 Ga0501042_0193467
4026 Ga0501042_0560354
4027 Ga0501042_0577164
4028 Ga0501043_0047574
4029 Ga0501043_0050425
4030 Ga0501043_0076572
4031 Ga0501043_0172612
4032 Ga0501043_0361478
4033 Ga0501043_0414734
4034 Ga0501046_0008490
4035 Ga0501046_0015232
4036 Ga0501046_0094483
4037 Ga0501046_0143560
4038 Ga0501046_0169306
4039 Ga0501046_0341264
4040 Ga0501047_0077981
4041 Ga0501047_0085143
4042 Ga0501047_0156909
4043 Ga0501047_0166283
4044 Ga0501047_0345118
4045 Ga0501048_0009248
4046 Ga0501048_0117010
4047 Ga0501048_0175869
4048 Ga0501048_0325907
4049 Ga0501067_0001333
4050 Ga0501067_0058225
4051 Ga0501068_0003078
4052 Ga0501068_0222915
4053 Ga0501069_0005694
4054 Ga0501069_0014035
4055 Ga0501069_0052326
4056 Ga0501069_0053979
4057 Ga0501069_0067407
4058 Ga0501070_0013017
4059 Ga0501070_0067345
4060 Ga0501070_0098289
4061 Ga0501070_0121215
4062 Ga0501070_0130170
4063 Ga0501070_0344369
4064 Ga0501071_0157377
4065 Ga0501071_0261633
4066 Ga0501071_0495796
4067 Ga0501072_0000394
4068 Ga0501072_0115857
4069 Ga0501072_0256826
4070 Ga0501072_0373709
4071 Ga0501073_0002088
4072 Ga0501073_0004584
4073 Ga0501073_0024120
4074 Ga0501073_0205035
4075 Ga0501073_0229779
4076 Ga0501073_0251337
4077 Ga0501074_0136864
4078 Ga0501074_0148802
4079 Ga0501074_0167895
4080 Ga0501074_0214655
4081 Ga0501075_0017438
4082 Ga0501075_0045437
4083 Ga0501075_0258978
4084 Ga0501076_0082339
4085 Ga0501076_0109082
4086 Ga0501076_0251287
4087 Ga0501077_0118869
4088 Ga0501077_0170845
4089 Ga0501077_0295147
4090 Ga0501079_0019376
4091 Ga0501079_0153520
4092 Ga0501079_0178301
4093 Ga0501079_0212618
4094 Ga0501079_0414344
4095 Ga0501080_0008622
4096 Ga0501080_0038365
4097 Ga0501080_0102537
4098 Ga0501080_0157781
4099 Ga0501080_0399092
4100 Ga0501080_0903976
4101 Ga0501081_0127738
4102 Ga0501081_0342327
4103 Ga0501081_0431453
4104 Ga0501081_0526093
4105 Ga0501081_0616156
4106 Ga0501081_0691805
4107 Ga0501083_0054982
4108 Ga0501083_0180003
4109 Ga0501083_0223960
4110 Ga0501083_0388169
4111 Ga0501035_0000366
4112 Ga0501035_0004315
4113 Ga0501035_0287424
4114 Ga0501035_0322480
4115 Ga0501035_0396206
4116 Ga0501035_0412764
4117 Ga0501035_0506405
4118 Ga0501035_0825876
4119 Ga0501044_0000411
4120 Ga0501044_0010794
4121 Ga0501044_0168342
4122 Ga0501044_0235588
4123 Ga0501044_0364766
4124 Ga0501044_0548348
4125 Ga0501044_0698945
4126 Ga0501045_0236103
4127 nmdc:mga03683_50658_c1
4128 nmdc:mga03n38_27804_c1
4129 nmdc:mga00v17_180081_c1
4130 nmdc:mga00v17_20140_c1
4131 nmdc:mga00v17_28756_c1
4132 nmdc:mga00v17_407945_c1
4133 nmdc:mga00v17_90210_c1
4134 nmdc:mga0yw44_1214_c1
4135 nmdc:mga0yw44_145695_c1
4136 nmdc:mga0yw44_18317_c1
4137 nmdc:mga0yw44_3468_c1
4138 nmdc:mga0yw44_393180_c1
4139 nmdc:mga0yw44_417972_c1
4140 nmdc:mga0k408_20068_c1
4141 nmdc:mga0k408_237741_c1
4142 nmdc:mga0k408_33374_c1
4143 nmdc:mga0k408_3509_c1
4144 nmdc:mga06z11_109408_c1
4145 nmdc:mga06z11_25471_c2
4146 nmdc:mga06z11_44907_c1
4147 nmdc:mga06z11_6960_c1
4148 nmdc:mga07m45_129250_c1
4149 nmdc:mga07m45_14938_c1
4150 nmdc:mga07m45_35923_c1
4151 nmdc:mga07m45_42676_c1
4152 nmdc:mga05p37_105379_c1
4153 nmdc:mga05p37_285_c1
4154 nmdc:mga05p37_290_c1
4155 nmdc:mga05p37_38352_c1
4156 nmdc:mga05p37_430768_c1
4157 nmdc:mga05p37_488186_c1
4158 nmdc:mga05p37_585068_c1
4159 nmdc:mga09592_168998_c1
4160 nmdc:mga09592_8025_c1
4161 nmdc:mga0qj67_139644_c1
4162 nmdc:mga0qj67_215932_c1
4163 nmdc:mga0qj67_290975_c1
4164 nmdc:mga0qj67_347_c1
4165 nmdc:mga0qj67_527193_c1
4166 nmdc:mga0qj67_606000_c1
4167 nmdc:mga0qj67_880_c1
4168 nmdc:mga06r32_118_c1
4169 nmdc:mga06r32_267466_c1
4170 nmdc:mga06r32_352166_c1
4171 nmdc:mga06r32_374633_c1
4172 nmdc:mga06r32_649_c1
4173 nmdc:mga08y16_103693_c1
4174 nmdc:mga08y16_119854_c1
4175 nmdc:mga08y16_153738_c1
4176 nmdc:mga08y16_16589_c1
4177 nmdc:mga08y16_211704_c1
4178 nmdc:mga08y16_452689_c1
4179 nmdc:mga08y16_66189_c1
4180 nmdc:mga08y16_7099_c1
4181 nmdc:mga08y16_851_c1
4182 nmdc:mga08y16_89_c1
4183 nmdc:mga08y16_98412_c1
4184 nmdc:mga0n895_104899_c1
4185 nmdc:mga0n895_157640_c1
4186 nmdc:mga0n895_173292_c1
4187 nmdc:mga0n895_196757_c1
4188 nmdc:mga0n895_309610_c1
4189 nmdc:mga0n895_369_c1
4190 nmdc:mga0n895_376459_c1
4191 nmdc:mga0n895_46361_c1
4192 nmdc:mga0n895_552_c1
4193 nmdc:mga0rr50_11023_c1
4194 nmdc:mga0rr50_137806_c1
4195 nmdc:mga0rr50_236400_c1
4196 nmdc:mga0rr50_245951_c1
4197 nmdc:mga0rr50_469070_c1
4198 nmdc:mga0rr50_52321_c1
4199 nmdc:mga0rr50_574_c1
4200 nmdc:mga0rr50_6149_c1
4201 nmdc:mga0rr50_798081_c1
4202 nmdc:mga08x19_154993_c1
4203 nmdc:mga08x19_307807_c1
4204 nmdc:mga08x19_9501_c1
4205 nmdc:mga0a205_1059_c1
4206 nmdc:mga0a205_124111_c1
4207 nmdc:mga0a205_148593_c1
4208 nmdc:mga0a205_21310_c1
4209 nmdc:mga0a205_251366_c1
4210 nmdc:mga0a205_2568_c1
4211 nmdc:mga0a205_26046_c1
4212 nmdc:mga0a205_298175_c1
4213 nmdc:mga0a205_353181_c1
4214 nmdc:mga0sz30_144168_c1
4215 Ga0495601_0000016
4216 Ga0495601_0000205
4217 Ga0495601_0001742
4218 Ga0495601_0001966
4219 Ga0495601_0003031
4220 Ga0495601_0004702
4221 Ga0495601_0005657
4222 Ga0495601_0006040
4223 Ga0495601_0036612
4224 Ga0495601_0050863
4225 Ga0495601_0052938
4226 Ga0495601_0057737
4227 Ga0495601_0064935
4228 Ga0495601_0071850
4229 Ga0495612_0000041
4230 Ga0495612_0000896
4231 Ga0495612_0003681
4232 Ga0495612_0004543
4233 Ga0495612_0012951
4234 Ga0495612_0014629
4235 Ga0495612_0026997
4236 Ga0495612_0027352
4237 Ga0495612_0050413
4238 Ga0495612_0062696
4239 Ga0495612_0110598
4240 Ga0500610_0115490
4241 Ga0495655_0000378
4242 Ga0495655_0019851
4243 Ga0495595_0000161
4244 Ga0495595_0001105
4245 Ga0495595_0001119
4246 Ga0495595_0004084
4247 Ga0495595_0006277
4248 Ga0495595_0011917
4249 Ga0495595_0014655
4250 Ga0495595_0185538
4251 Ga0495595_0189050
4252 Ga0495619_0000050
4253 Ga0495619_0000139
4254 Ga0495619_0000957
4255 Ga0495619_0003087
4256 Ga0495619_0003733
4257 Ga0495619_0007273
4258 Ga0495619_0008115
4259 Ga0495619_0009272
4260 Ga0495619_0021121
4261 Ga0495619_0034965
4262 Ga0495619_0053482
4263 Ga0495619_0074099
4264 Ga0495619_0075261
4265 Ga0495619_0078936
4266 Ga0495619_0093382
4267 Ga0495619_0105009
4268 Ga0495619_0143877
4269 Ga0495619_0175462
4270 Ga0495619_0296555
4271 Ga0495619_0355856
4272 Ga0500643_025908
4273 Ga0500644_0000839
4274 Ga0500646_0021421
4275 Ga0500651_0036353
4276 Ga0500651_0256398
4277 Ga0500566_0170404
4278 Ga0500641_0000457
4279 Ga0500641_0013326
4280 Ga0500641_0013957
4281 Ga0500641_0016990
4282 Ga0500641_0078607
4283 Ga0500654_042304
4284 Ga0500557_072589
4285 Ga0500562_033612
4286 Ga0500562_035649
4287 Ga0500593_016699
4288 Ga0500595_000001
4289 Ga0500595_021247
4290 Ga0500595_035998
4291 Ga0500608_143136
4292 Ga0500618_017858
4293 Ga0500618_029346
4294 Ga0500642_0002438
4295 Ga0500642_0259228
4296 Ga0500652_000069
4297 Ga0500652_003823
4298 Ga0500652_075254
4299 Ga0500658_0035326
4300 Ga0500616_0000001
4301 Ga0500616_0012716
4302 Ga0500616_0016192
4303 Ga0500616_0037804
4304 Ga0500616_0068585
4305 Ga0500622_0001259
4306 Ga0500627_0154463
4307 Ga0500636_0014182
4308 Ga0500636_0020014
4309 Ga0500611_016270
4310 Ga0500657_126448
4311 Ga0500645_000418
4312 Ga0500552_027558
4313 Ga0501084_0023301
4314 Ga0501084_0044229
4315 Ga0501084_0077505
4316 Ga0501084_0325438
4317 Ga0501084_0398433
4318 Ga0501084_0619231
4319 Ga0501082_0013821
4320 Ga0501082_0085747
4321 Ga0501082_0112796
4322 Ga0501082_0219481
4323 Ga0501082_0286855
4324 Ga0501082_0782765
4325 Ga0466962_0049979
4326 Ga0530510_0022504
4327 Ga0530510_0053232
4328 Ga0530510_0399907
4329 Ga0530510_0444126
4330 2585997793
4331 2586002379
4332 2599720347
4333 2644730983
4334 2819722241
4335 2821128736
4336 2838741752
4337 2841845414
4338 2842145117
4339 2854919494
4340 2857534111
4341 2919175773
4342 641335761
4343 8054564098
4344 8056878208

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

47

158

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

191

266

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9748 5 123
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9746 5 123
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9744 5 123
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9724 5 123
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.969 5 125
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9768 6 82 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9762 5 125 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9742 5 84 3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9682 3 123 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9678 5 84 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A448V449-F1-model_v4 Transcriptional regulatory protein AfsQ1 0.9911 5 123 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A6L8GBT5-F1-model_v4 Response regulator transcription factor 0.9852 2 128 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A5P9JUZ0-F1-model_v4 Response regulator 0.9649 1 228 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A6L8GBT5-F1-model_v4 Response regulator transcription factor 0.9627 2 128 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3A4NWN5-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.949 1 125 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565

Map