F496507
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2174 | 656 | 4348 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300046477|Ga0495664_0305100|Ga0495664_0305100_433_831 |
| Length | 132 |
| Sequence | MIPIPSGVRVWLATGHTDMRKGFPSLALQVQEVLKHDPLSGHLFCFRGRRGDLLKVIWHDGQGACLFTKRLERGRFLWPSPTDGVVAISAAQMGYLLSGIDWASSPRNLASDACRVITLPLKRDGECDSPEM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 6 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 104 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 108 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 109 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 110 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 114 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 115 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 121 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 122 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 123 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 124 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 125 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 126 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 129 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 130 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 131 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 132 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 151 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 152 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 153 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 154 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 155 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 156 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 157 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 174 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 175 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 176 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 177 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 255 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 256 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 257 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 261 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 265 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 266 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 267 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 268 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 270 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 272 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 273 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 274 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 275 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 276 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 277 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 278 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 279 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 280 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 281 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 282 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 284 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 285 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 286 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 287 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 288 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 289 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 291 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 292 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 293 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 294 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 295 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 296 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 297 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 298 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 299 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 300 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 301 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 302 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 303 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 305 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 306 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 308 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 309 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 310 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 311 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 312 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 313 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 314 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 315 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 316 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 317 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 318 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 319 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 321 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 322 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 323 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 324 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 325 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 326 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 327 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 328 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 329 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 330 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 331 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 332 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 333 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 334 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 335 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 336 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 337 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 338 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 339 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 340 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 341 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 342 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 343 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 344 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 345 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 346 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 347 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 348 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 349 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 350 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 351 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 352 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 353 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 354 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 355 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 356 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 357 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 358 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 359 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 360 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 361 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 362 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 363 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 364 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 365 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 366 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 367 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 368 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 369 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 370 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 371 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 372 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 373 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 374 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 375 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 376 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 377 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 378 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 379 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 380 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 381 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 382 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 383 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 384 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 385 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 386 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 387 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 388 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 389 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 390 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 391 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 392 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 393 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 493 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 494 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 495 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 496 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 497 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 498 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 499 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 500 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 501 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 502 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 503 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 504 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 505 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 506 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 507 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 508 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 509 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 510 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 511 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 512 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 513 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 514 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 515 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 516 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 517 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 518 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 519 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 526 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 529 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 530 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 531 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 532 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 533 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 534 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 535 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 536 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 537 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 538 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 539 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 541 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 542 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 543 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 544 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 545 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 546 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 547 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 548 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 549 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 550 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 551 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 552 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 553 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 554 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 555 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 556 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 557 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 558 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 559 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 560 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 561 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 562 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 563 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 564 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 565 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 566 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 567 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 573 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 574 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 575 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 576 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 577 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 578 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 579 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 580 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 581 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 582 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 583 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 584 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 585 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 586 | 3300053112 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere | Metagenome | Endosphere |
| 587 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 588 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 589 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 590 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 591 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 592 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 593 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 594 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 595 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 596 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 597 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 598 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 599 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 600 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 601 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 602 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 603 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 604 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 605 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 606 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 607 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 608 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 609 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 610 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 611 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 612 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 613 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 614 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 615 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 616 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 617 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 618 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 619 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 620 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 621 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 622 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 623 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 624 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 625 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 626 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 627 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 628 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 629 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 630 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 631 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 632 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 633 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 634 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 635 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 636 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 637 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 638 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 639 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 640 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 641 | 2904699407 | |||
| 642 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 643 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 644 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 645 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 646 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 647 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 648 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 649 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 650 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 651 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 652 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 653 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 654 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 655 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 656 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.42 |
| Metatranscriptomes | 0.18 |
| Isolates | 2.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.42 |
| Nodule | 1.7 |
| Rhizoplane | 6.81 |
| Rhizosphere | 82.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495664_0305100 | 3300046477 | Bacteria | 961 |
| 2 | SwRhRL2b_contig_1110102 | 2162886007 | Bacteria | 2135 |
| 3 | CNBas_1000120 | 3300000531 | Bacteria | 2542 |
| 4 | CNAas_1001029 | 3300000532 | Bacteria | 2579 |
| 5 | JGI24746J21847_1003278 | 3300001977 | Bacteria | 2548 |
| 6 | JGI24746J21847_1004618 | 3300001977 | Bacteria | 2169 |
| 7 | JGI24747J21853_1013922 | 3300001978 | Bacteria | 833 |
| 8 | JGI24739J22299_10156133 | 3300001989 | Bacteria | 674 |
| 9 | JGI24737J22298_10015005 | 3300001990 | Bacteria | 2509 |
| 10 | JGI24743J22301_10001477 | 3300001991 | Bacteria | 3260 |
| 11 | JGI24743J22301_10004069 | 3300001991 | Bacteria | 2356 |
| 12 | JGI24750J21931_1001967 | 3300002070 | Bacteria | 2510 |
| 13 | JGI24750J21931_1002451 | 3300002070 | Bacteria | 2234 |
| 14 | JGI24745J21846_1001121 | 3300002073 | Bacteria | 2541 |
| 15 | JGI24745J21846_1013583 | 3300002073 | Bacteria | 940 |
| 16 | JGI24748J21848_1000896 | 3300002074 | Bacteria | 3226 |
| 17 | JGI24748J21848_1001876 | 3300002074 | Bacteria | 2340 |
| 18 | JGI24738J21930_10018131 | 3300002075 | Bacteria | 1473 |
| 19 | JGI24749J21850_1001481 | 3300002076 | Bacteria | 3318 |
| 20 | JGI24749J21850_1003226 | 3300002076 | Bacteria | 2275 |
| 21 | JGI24749J21850_1040645 | 3300002076 | Bacteria | 681 |
| 22 | JGI24744J21845_10003565 | 3300002077 | Bacteria | 3205 |
| 23 | JGI24744J21845_10039858 | 3300002077 | Bacteria | 880 |
| 24 | JGI24034J26672_10001347 | 3300002239 | Bacteria | 3247 |
| 25 | JGI24742J22300_10002290 | 3300002244 | Bacteria | 3059 |
| 26 | JGI24742J22300_10014005 | 3300002244 | Bacteria | 1343 |
| 27 | JGI24742J22300_10056886 | 3300002244 | Bacteria | 715 |
| 28 | rootH2_10055222 | 3300003320 | Bacteria | 2146 |
| 29 | JGI25404J52841_10000141 | 3300003659 | Bacteria | 7805 |
| 30 | Ga0055528_1014369 | 3300003790 | Bacteria | 2932 |
| 31 | JGI25405J52794_10125556 | 3300003911 | Bacteria | 580 |
| 32 | Ga0065704_10003761 | 3300005289 | Bacteria | 3823 |
| 33 | Ga0065712_10091158 | 3300005290 | Bacteria | 2388 |
| 34 | Ga0065715_10101018 | 3300005293 | Bacteria | 3245 |
| 35 | Ga0065715_10103975 | 3300005293 | Bacteria | 2995 |
| 36 | Ga0065707_10004119 | 3300005295 | Bacteria | 3356 |
| 37 | Ga0070658_10059578 | 3300005327 | Bacteria | 3108 |
| 38 | Ga0070658_10816897 | 3300005327 | Bacteria | 810 |
| 39 | Ga0070676_10141473 | 3300005328 | Bacteria | 1532 |
| 40 | Ga0070676_10222000 | 3300005328 | Bacteria | 1248 |
| 41 | Ga0070676_10344730 | 3300005328 | Bacteria | 1023 |
| 42 | Ga0070683_100049008 | 3300005329 | Bacteria | 3905 |
| 43 | Ga0070683_100237481 | 3300005329 | Bacteria | 1733 |
| 44 | Ga0070683_100260545 | 3300005329 | Bacteria | 1649 |
| 45 | Ga0070690_100088397 | 3300005330 | Bacteria | 2037 |
| 46 | Ga0070690_100314257 | 3300005330 | Bacteria | 1127 |
| 47 | Ga0070690_100326145 | 3300005330 | Bacteria | 1108 |
| 48 | Ga0070670_100062702 | 3300005331 | Bacteria | 3191 |
| 49 | Ga0070670_100152289 | 3300005331 | Bacteria | 2001 |
| 50 | Ga0070677_10016017 | 3300005333 | Bacteria | 2664 |
| 51 | Ga0070677_10025393 | 3300005333 | Bacteria | 2212 |
| 52 | Ga0068869_100245657 | 3300005334 | Bacteria | 1427 |
| 53 | Ga0068869_101950395 | 3300005334 | Bacteria | 527 |
| 54 | Ga0070666_10035884 | 3300005335 | Bacteria | 3288 |
| 55 | Ga0070666_10071735 | 3300005335 | Bacteria | 2357 |
| 56 | Ga0070666_10237379 | 3300005335 | Bacteria | 1289 |
| 57 | Ga0070680_100020639 | 3300005336 | Bacteria | 5230 |
| 58 | Ga0070680_100308825 | 3300005336 | Bacteria | 1341 |
| 59 | Ga0070680_101228241 | 3300005336 | Bacteria | 648 |
| 60 | Ga0070682_100028047 | 3300005337 | Bacteria | 3384 |
| 61 | Ga0070682_100116632 | 3300005337 | Bacteria | 1787 |
| 62 | Ga0070682_100414061 | 3300005337 | Bacteria | 1023 |
| 63 | Ga0068868_100049166 | 3300005338 | Bacteria | 3310 |
| 64 | Ga0068868_100052530 | 3300005338 | Bacteria | 3208 |
| 65 | Ga0068868_100354245 | 3300005338 | Bacteria | 1258 |
| 66 | Ga0068868_101299379 | 3300005338 | Bacteria | 676 |
| 67 | Ga0070660_100377024 | 3300005339 | Bacteria | 1171 |
| 68 | Ga0070660_100381673 | 3300005339 | Bacteria | 1163 |
| 69 | Ga0070660_100488134 | 3300005339 | Bacteria | 1024 |
| 70 | Ga0070660_100523066 | 3300005339 | Bacteria | 988 |
| 71 | Ga0070660_100603146 | 3300005339 | Bacteria | 918 |
| 72 | Ga0070689_100042940 | 3300005340 | Bacteria | 3473 |
| 73 | Ga0070689_100138647 | 3300005340 | Bacteria | 1955 |
| 74 | Ga0070689_100369612 | 3300005340 | Bacteria | 1206 |
| 75 | Ga0070691_10030971 | 3300005341 | Bacteria | 2507 |
| 76 | Ga0070691_10060711 | 3300005341 | Bacteria | 1817 |
| 77 | Ga0070691_10210479 | 3300005341 | Bacteria | 1026 |
| 78 | Ga0070691_10525001 | 3300005341 | Bacteria | 688 |
| 79 | Ga0070691_10935492 | 3300005341 | Bacteria | 537 |
| 80 | Ga0070687_100016246 | 3300005343 | Bacteria | 3389 |
| 81 | Ga0070687_100041965 | 3300005343 | Bacteria | 2315 |
| 82 | Ga0070687_100871751 | 3300005343 | Bacteria | 643 |
| 83 | Ga0070661_100102324 | 3300005344 | Bacteria | 2132 |
| 84 | Ga0070661_100378666 | 3300005344 | Bacteria | 1115 |
| 85 | Ga0070692_10036208 | 3300005345 | Bacteria | 2503 |
| 86 | Ga0070692_10396885 | 3300005345 | Bacteria | 870 |
| 87 | Ga0070668_100046001 | 3300005347 | Bacteria | 3350 |
| 88 | Ga0070668_100048950 | 3300005347 | Bacteria | 3251 |
| 89 | Ga0070668_100075625 | 3300005347 | Bacteria | 2629 |
| 90 | Ga0070668_100114760 | 3300005347 | Bacteria | 2147 |
| 91 | Ga0070668_100243294 | 3300005347 | Bacteria | 1491 |
| 92 | Ga0070668_100476582 | 3300005347 | Bacteria | 1077 |
| 93 | Ga0070668_100527243 | 3300005347 | Bacteria | 1025 |
| 94 | Ga0070668_100537173 | 3300005347 | Bacteria | 1016 |
| 95 | Ga0070668_100891865 | 3300005347 | Bacteria | 794 |
| 96 | Ga0070668_101180724 | 3300005347 | Bacteria | 693 |
| 97 | Ga0070668_101388732 | 3300005347 | Bacteria | 640 |
| 98 | Ga0070669_100041051 | 3300005353 | Bacteria | 3364 |
| 99 | Ga0070669_100051754 | 3300005353 | Bacteria | 3003 |
| 100 | Ga0070669_100400299 | 3300005353 | Bacteria | 1123 |
| 101 | Ga0070669_100563196 | 3300005353 | Bacteria | 951 |
| 102 | Ga0070675_100044532 | 3300005354 | Bacteria | 3629 |
| 103 | Ga0070675_100090999 | 3300005354 | Bacteria | 2555 |
| 104 | Ga0070675_101188489 | 3300005354 | Bacteria | 702 |
| 105 | Ga0070671_100051993 | 3300005355 | Bacteria | 3407 |
| 106 | Ga0070671_100267379 | 3300005355 | Bacteria | 1453 |
| 107 | Ga0070671_100378638 | 3300005355 | Bacteria | 1209 |
| 108 | Ga0070671_100428094 | 3300005355 | Bacteria | 1134 |
| 109 | Ga0070674_100048632 | 3300005356 | Bacteria | 2911 |
| 110 | Ga0070674_100193244 | 3300005356 | Bacteria | 1567 |
| 111 | Ga0070674_100259447 | 3300005356 | Bacteria | 1368 |
| 112 | Ga0070674_100537113 | 3300005356 | Bacteria | 979 |
| 113 | Ga0070674_101820662 | 3300005356 | Bacteria | 552 |
| 114 | Ga0070673_100046119 | 3300005364 | Bacteria | 3383 |
| 115 | Ga0070673_100046378 | 3300005364 | Bacteria | 3375 |
| 116 | Ga0070673_100272177 | 3300005364 | Bacteria | 1483 |
| 117 | Ga0070673_101244932 | 3300005364 | Bacteria | 698 |
| 118 | Ga0070688_100025517 | 3300005365 | Bacteria | 3499 |
| 119 | Ga0070688_100026473 | 3300005365 | Bacteria | 3446 |
| 120 | Ga0070688_100142555 | 3300005365 | Bacteria | 1630 |
| 121 | Ga0070659_100196270 | 3300005366 | Bacteria | 1660 |
| 122 | Ga0070659_100300321 | 3300005366 | Bacteria | 1339 |
| 123 | Ga0070659_100539515 | 3300005366 | Bacteria | 998 |
| 124 | Ga0070667_100051801 | 3300005367 | Bacteria | 3461 |
| 125 | Ga0070667_100273930 | 3300005367 | Bacteria | 1514 |
| 126 | Ga0070667_100662985 | 3300005367 | Bacteria | 964 |
| 127 | Ga0070667_100667272 | 3300005367 | Bacteria | 961 |
| 128 | Ga0070703_10010510 | 3300005406 | Bacteria | 2611 |
| 129 | Ga0070703_10011425 | 3300005406 | Bacteria | 2508 |
| 130 | Ga0070709_10029246 | 3300005434 | Bacteria | 3294 |
| 131 | Ga0070709_10029935 | 3300005434 | Bacteria | 3262 |
| 132 | Ga0070709_10040883 | 3300005434 | Bacteria | 2853 |
| 133 | Ga0070709_10056165 | 3300005434 | Bacteria | 2489 |
| 134 | Ga0070709_10251498 | 3300005434 | Bacteria | 1273 |
| 135 | Ga0070714_100048072 | 3300005435 | Bacteria | 3627 |
| 136 | Ga0070714_100049300 | 3300005435 | Bacteria | 3584 |
| 137 | Ga0070714_100068579 | 3300005435 | Bacteria | 3060 |
| 138 | Ga0070714_100195684 | 3300005435 | Bacteria | 1847 |
| 139 | Ga0070714_100343550 | 3300005435 | Bacteria | 1400 |
| 140 | Ga0070714_100403320 | 3300005435 | Bacteria | 1293 |
| 141 | Ga0070714_100990414 | 3300005435 | Bacteria | 818 |
| 142 | Ga0070713_100016241 | 3300005436 | Bacteria | 5595 |
| 143 | Ga0070713_100124786 | 3300005436 | Bacteria | 2263 |
| 144 | Ga0070713_100329051 | 3300005436 | Bacteria | 1413 |
| 145 | Ga0070713_100894660 | 3300005436 | Bacteria | 854 |
| 146 | Ga0070713_100905407 | 3300005436 | Bacteria | 848 |
| 147 | Ga0070710_10017785 | 3300005437 | Bacteria | 3646 |
| 148 | Ga0070710_10115219 | 3300005437 | Bacteria | 1619 |
| 149 | Ga0070710_10236399 | 3300005437 | Bacteria | 1169 |
| 150 | Ga0070710_10275291 | 3300005437 | Bacteria | 1090 |
| 151 | Ga0070701_10012140 | 3300005438 | Bacteria | 3876 |
| 152 | Ga0070701_10048532 | 3300005438 | Bacteria | 2191 |
| 153 | Ga0070701_10260551 | 3300005438 | Bacteria | 1051 |
| 154 | Ga0070711_100015435 | 3300005439 | Bacteria | 4835 |
| 155 | Ga0070711_100027809 | 3300005439 | Bacteria | 3716 |
| 156 | Ga0070711_100053839 | 3300005439 | Bacteria | 2775 |
| 157 | Ga0070711_100102323 | 3300005439 | Bacteria | 2086 |
| 158 | Ga0070711_100215128 | 3300005439 | Bacteria | 1491 |
| 159 | Ga0070711_100234692 | 3300005439 | Bacteria | 1431 |
| 160 | Ga0070711_100690364 | 3300005439 | Bacteria | 859 |
| 161 | Ga0070711_100762046 | 3300005439 | Bacteria | 819 |
| 162 | Ga0070705_100011195 | 3300005440 | Bacteria | 4518 |
| 163 | Ga0070705_100346044 | 3300005440 | Bacteria | 1082 |
| 164 | Ga0070705_101202494 | 3300005440 | Bacteria | 624 |
| 165 | Ga0070700_100027556 | 3300005441 | Bacteria | 3370 |
| 166 | Ga0070700_100194371 | 3300005441 | Bacteria | 1421 |
| 167 | Ga0070700_100374687 | 3300005441 | Bacteria | 1063 |
| 168 | Ga0070694_100019015 | 3300005444 | Bacteria | 4365 |
| 169 | Ga0070694_100048216 | 3300005444 | Bacteria | 2865 |
| 170 | Ga0070694_100064730 | 3300005444 | Bacteria | 2503 |
| 171 | Ga0070708_100182126 | 3300005445 | Bacteria | 1964 |
| 172 | Ga0070708_100701134 | 3300005445 | Bacteria | 953 |
| 173 | Ga0070708_100803969 | 3300005445 | Bacteria | 884 |
| 174 | Ga0070663_100035515 | 3300005455 | Bacteria | 3459 |
| 175 | Ga0070663_100036289 | 3300005455 | Bacteria | 3425 |
| 176 | Ga0070663_100036982 | 3300005455 | Bacteria | 3395 |
| 177 | Ga0070663_100037621 | 3300005455 | Bacteria | 3370 |
| 178 | Ga0070663_100082745 | 3300005455 | Bacteria | 2362 |
| 179 | Ga0070663_100092086 | 3300005455 | Bacteria | 2247 |
| 180 | Ga0070663_100212616 | 3300005455 | Bacteria | 1515 |
| 181 | Ga0070663_100513144 | 3300005455 | Bacteria | 997 |
| 182 | Ga0070663_100561414 | 3300005455 | Bacteria | 955 |
| 183 | Ga0070663_100864896 | 3300005455 | Bacteria | 779 |
| 184 | Ga0070663_101274916 | 3300005455 | Bacteria | 648 |
| 185 | Ga0070678_100036628 | 3300005456 | Bacteria | 3436 |
| 186 | Ga0070678_100157776 | 3300005456 | Bacteria | 1835 |
| 187 | Ga0070678_100347983 | 3300005456 | Bacteria | 1273 |
| 188 | Ga0070678_101695823 | 3300005456 | Bacteria | 594 |
| 189 | Ga0070662_100043985 | 3300005457 | Bacteria | 3198 |
| 190 | Ga0070662_100074789 | 3300005457 | Bacteria | 2507 |
| 191 | Ga0070662_100169000 | 3300005457 | Bacteria | 1716 |
| 192 | Ga0070662_100175252 | 3300005457 | Bacteria | 1687 |
| 193 | Ga0070662_100326474 | 3300005457 | Bacteria | 1252 |
| 194 | Ga0070662_100347556 | 3300005457 | Bacteria | 1214 |
| 195 | Ga0070662_101205465 | 3300005457 | Bacteria | 651 |
| 196 | Ga0070662_101628309 | 3300005457 | Bacteria | 557 |
| 197 | Ga0070681_10053152 | 3300005458 | Bacteria | 4036 |
| 198 | Ga0070681_10101479 | 3300005458 | Bacteria | 2823 |
| 199 | Ga0070681_10925719 | 3300005458 | Bacteria | 790 |
| 200 | Ga0068867_100032454 | 3300005459 | Bacteria | 3777 |
| 201 | Ga0068867_100058513 | 3300005459 | Bacteria | 2856 |
| 202 | Ga0068867_100122486 | 3300005459 | Bacteria | 2011 |
| 203 | Ga0068867_100152082 | 3300005459 | Bacteria | 1819 |
| 204 | Ga0068867_100220332 | 3300005459 | Bacteria | 1529 |
| 205 | Ga0068867_100428651 | 3300005459 | Bacteria | 1122 |
| 206 | Ga0068867_100518892 | 3300005459 | Bacteria | 1027 |
| 207 | Ga0070685_10023711 | 3300005466 | Bacteria | 3363 |
| 208 | Ga0070685_10095214 | 3300005466 | Bacteria | 1810 |
| 209 | Ga0070685_10119850 | 3300005466 | Bacteria | 1632 |
| 210 | Ga0070706_100074412 | 3300005467 | Bacteria | 3144 |
| 211 | Ga0070706_100143529 | 3300005467 | Bacteria | 2229 |
| 212 | Ga0070707_100050232 | 3300005468 | Bacteria | 3997 |
| 213 | Ga0070707_100055593 | 3300005468 | Bacteria | 3795 |
| 214 | Ga0070698_100074135 | 3300005471 | Bacteria | 3409 |
| 215 | Ga0070698_100144896 | 3300005471 | Bacteria | 2325 |
| 216 | Ga0070698_100417014 | 3300005471 | Bacteria | 1277 |
| 217 | Ga0070698_100486239 | 3300005471 | Bacteria | 1172 |
| 218 | Ga0070699_100049687 | 3300005518 | Bacteria | 3630 |
| 219 | Ga0070699_100053367 | 3300005518 | Bacteria | 3498 |
| 220 | Ga0070699_100688009 | 3300005518 | Bacteria | 934 |
| 221 | Ga0070679_100137354 | 3300005530 | Bacteria | 2426 |
| 222 | Ga0070679_100259059 | 3300005530 | Bacteria | 1694 |
| 223 | Ga0070679_100334615 | 3300005530 | Bacteria | 1462 |
| 224 | Ga0070679_100470158 | 3300005530 | Unclassified | 1202 |
| 225 | Ga0070679_101142222 | 3300005530 | Bacteria | 724 |
| 226 | Ga0070679_101286477 | 3300005530 | Bacteria | 677 |
| 227 | Ga0070684_100261722 | 3300005535 | Bacteria | 1582 |
| 228 | Ga0070684_100369311 | 3300005535 | Bacteria | 1321 |
| 229 | Ga0070684_100409197 | 3300005535 | Bacteria | 1251 |
| 230 | Ga0070684_100458135 | 3300005535 | Bacteria | 1179 |
| 231 | Ga0070684_101024268 | 3300005535 | Bacteria | 775 |
| 232 | Ga0070697_100074790 | 3300005536 | Bacteria | 2784 |
| 233 | Ga0070697_100866084 | 3300005536 | Bacteria | 801 |
| 234 | Ga0070697_100893188 | 3300005536 | Bacteria | 788 |
| 235 | Ga0070697_101328257 | 3300005536 | Bacteria | 642 |
| 236 | Ga0068853_100078844 | 3300005539 | Bacteria | 2879 |
| 237 | Ga0068853_100107208 | 3300005539 | Bacteria | 2477 |
| 238 | Ga0068853_100343772 | 3300005539 | Bacteria | 1387 |
| 239 | Ga0068853_100394814 | 3300005539 | Bacteria | 1294 |
| 240 | Ga0070672_100036561 | 3300005543 | Bacteria | 3742 |
| 241 | Ga0070672_100082892 | 3300005543 | Bacteria | 2573 |
| 242 | Ga0070672_100134145 | 3300005543 | Bacteria | 2038 |
| 243 | Ga0070672_100777424 | 3300005543 | Bacteria | 841 |
| 244 | Ga0070686_100027360 | 3300005544 | Bacteria | 3451 |
| 245 | Ga0070686_100032964 | 3300005544 | Bacteria | 3180 |
| 246 | Ga0070686_100216163 | 3300005544 | Bacteria | 1383 |
| 247 | Ga0070686_100658618 | 3300005544 | Bacteria | 831 |
| 248 | Ga0070695_100000761 | 3300005545 | Bacteria | 17304 |
| 249 | Ga0070695_100126516 | 3300005545 | Bacteria | 1756 |
| 250 | Ga0070695_100529353 | 3300005545 | Bacteria | 916 |
| 251 | Ga0070695_100547725 | 3300005545 | Bacteria | 901 |
| 252 | Ga0070695_100603881 | 3300005545 | Bacteria | 862 |
| 253 | Ga0070695_100988490 | 3300005545 | Bacteria | 684 |
| 254 | Ga0070696_100009177 | 3300005546 | Bacteria | 6621 |
| 255 | Ga0070696_100386587 | 3300005546 | Bacteria | 1092 |
| 256 | Ga0070696_100481764 | 3300005546 | Bacteria | 984 |
| 257 | Ga0070696_100714545 | 3300005546 | Bacteria | 818 |
| 258 | Ga0070693_100666780 | 3300005547 | Bacteria | 758 |
| 259 | Ga0070693_100840681 | 3300005547 | Bacteria | 683 |
| 260 | Ga0070693_100929297 | 3300005547 | Bacteria | 654 |
| 261 | Ga0070693_101041432 | 3300005547 | Bacteria | 621 |
| 262 | Ga0070693_101282099 | 3300005547 | Bacteria | 566 |
| 263 | Ga0070665_100047877 | 3300005548 | Bacteria | 4291 |
| 264 | Ga0070665_100066764 | 3300005548 | Bacteria | 3608 |
| 265 | Ga0070665_100079823 | 3300005548 | Bacteria | 3277 |
| 266 | Ga0070665_100096618 | 3300005548 | Bacteria | 2959 |
| 267 | Ga0070665_100704220 | 3300005548 | Bacteria | 1023 |
| 268 | Ga0070665_100928444 | 3300005548 | Bacteria | 883 |
| 269 | Ga0070704_100003711 | 3300005549 | Bacteria | 8798 |
| 270 | Ga0070704_100253895 | 3300005549 | Bacteria | 1445 |
| 271 | Ga0070704_100467806 | 3300005549 | Bacteria | 1089 |
| 272 | Ga0070704_101940537 | 3300005549 | Bacteria | 546 |
| 273 | Ga0068855_100087137 | 3300005563 | Bacteria | 3609 |
| 274 | Ga0068855_100222649 | 3300005563 | Bacteria | 2115 |
| 275 | Ga0068855_100774381 | 3300005563 | Bacteria | 1021 |
| 276 | Ga0070664_100087450 | 3300005564 | Bacteria | 2694 |
| 277 | Ga0070664_100100441 | 3300005564 | Bacteria | 2515 |
| 278 | Ga0070664_100676753 | 3300005564 | Bacteria | 960 |
| 279 | Ga0070664_101673868 | 3300005564 | Bacteria | 603 |
| 280 | Ga0068857_100073259 | 3300005577 | Bacteria | 3051 |
| 281 | Ga0068857_100101836 | 3300005577 | Bacteria | 2577 |
| 282 | Ga0068857_102031924 | 3300005577 | Bacteria | 564 |
| 283 | Ga0068854_100016323 | 3300005578 | Bacteria | 4947 |
| 284 | Ga0068854_100467060 | 3300005578 | Bacteria | 1057 |
| 285 | Ga0068854_100539602 | 3300005578 | Bacteria | 988 |
| 286 | Ga0068856_100305891 | 3300005614 | Bacteria | 1608 |
| 287 | Ga0068856_100495528 | 3300005614 | Bacteria | 1243 |
| 288 | Ga0068856_100547542 | 3300005614 | Bacteria | 1178 |
| 289 | Ga0068856_100677779 | 3300005614 | Bacteria | 1051 |
| 290 | Ga0068856_100836036 | 3300005614 | Bacteria | 940 |
| 291 | Ga0070702_100031319 | 3300005615 | Bacteria | 2908 |
| 292 | Ga0070702_100038575 | 3300005615 | Bacteria | 2661 |
| 293 | Ga0068852_100111021 | 3300005616 | Bacteria | 2493 |
| 294 | Ga0068852_100171267 | 3300005616 | Bacteria | 2035 |
| 295 | Ga0068852_100324128 | 3300005616 | Bacteria | 1497 |
| 296 | Ga0068859_100011678 | 3300005617 | Bacteria | 8826 |
| 297 | Ga0068859_100085071 | 3300005617 | Bacteria | 3208 |
| 298 | Ga0068859_100272394 | 3300005617 | Bacteria | 1785 |
| 299 | Ga0068859_100387367 | 3300005617 | Bacteria | 1493 |
| 300 | Ga0068859_101649249 | 3300005617 | Bacteria | 708 |
| 301 | Ga0068864_100048004 | 3300005618 | Bacteria | 3670 |
| 302 | Ga0068864_100055954 | 3300005618 | Bacteria | 3408 |
| 303 | Ga0068864_100069722 | 3300005618 | Bacteria | 3057 |
| 304 | Ga0068864_100253904 | 3300005618 | Bacteria | 1633 |
| 305 | Ga0068866_10213700 | 3300005718 | Bacteria | 1159 |
| 306 | Ga0068866_10260781 | 3300005718 | Bacteria | 1065 |
| 307 | Ga0068866_10370374 | 3300005718 | Bacteria | 916 |
| 308 | Ga0068866_10687219 | 3300005718 | Bacteria | 700 |
| 309 | Ga0068866_10798969 | 3300005718 | Bacteria | 656 |
| 310 | Ga0068866_11243486 | 3300005718 | Bacteria | 539 |
| 311 | Ga0068861_100044898 | 3300005719 | Bacteria | 3325 |
| 312 | Ga0068861_100070508 | 3300005719 | Bacteria | 2706 |
| 313 | Ga0068861_100657826 | 3300005719 | Bacteria | 969 |
| 314 | Ga0068851_10014991 | 3300005834 | Bacteria | 3687 |
| 315 | Ga0068851_10371046 | 3300005834 | Bacteria | 836 |
| 316 | Ga0068870_10098283 | 3300005840 | Bacteria | 1649 |
| 317 | Ga0068870_10102054 | 3300005840 | Bacteria | 1623 |
| 318 | Ga0068870_10386400 | 3300005840 | Bacteria | 907 |
| 319 | Ga0068863_100071988 | 3300005841 | Bacteria | 3271 |
| 320 | Ga0068863_100094753 | 3300005841 | Bacteria | 2833 |
| 321 | Ga0068863_101365437 | 3300005841 | Bacteria | 716 |
| 322 | Ga0068858_100073499 | 3300005842 | Bacteria | 3173 |
| 323 | Ga0068858_100075217 | 3300005842 | Bacteria | 3137 |
| 324 | Ga0068858_100129472 | 3300005842 | Bacteria | 2365 |
| 325 | Ga0068858_100412615 | 3300005842 | Bacteria | 1298 |
| 326 | Ga0068858_100691728 | 3300005842 | Bacteria | 992 |
| 327 | Ga0068860_100039418 | 3300005843 | Bacteria | 4518 |
| 328 | Ga0068860_100508457 | 3300005843 | Bacteria | 1203 |
| 329 | Ga0068860_100519824 | 3300005843 | Bacteria | 1190 |
| 330 | Ga0068860_100787866 | 3300005843 | Bacteria | 964 |
| 331 | Ga0068860_101058700 | 3300005843 | Bacteria | 830 |
| 332 | Ga0068862_100030867 | 3300005844 | Bacteria | 4518 |
| 333 | Ga0068862_100045888 | 3300005844 | Bacteria | 3729 |
| 334 | Ga0068862_100382029 | 3300005844 | Bacteria | 1314 |
| 335 | Ga0068862_100724970 | 3300005844 | Bacteria | 965 |
| 336 | Ga0068862_102274705 | 3300005844 | Bacteria | 554 |
| 337 | Ga0081455_10034250 | 3300005937 | Bacteria | 4553 |
| 338 | Ga0081455_10035218 | 3300005937 | Bacteria | 4476 |
| 339 | Ga0081455_10050401 | 3300005937 | Bacteria | 3581 |
| 340 | Ga0081455_10078452 | 3300005937 | Bacteria | 2714 |
| 341 | Ga0081538_10150740 | 3300005981 | Bacteria | 1053 |
| 342 | Ga0081540_1001779 | 3300005983 | Bacteria | 18070 |
| 343 | Ga0081540_1018312 | 3300005983 | Bacteria | 4302 |
| 344 | Ga0081540_1025593 | 3300005983 | Bacteria | 3391 |
| 345 | Ga0081540_1218874 | 3300005983 | Bacteria | 679 |
| 346 | Ga0081539_10025774 | 3300005985 | Bacteria | 3772 |
| 347 | Ga0070717_10105913 | 3300006028 | Bacteria | 2394 |
| 348 | Ga0070717_10171211 | 3300006028 | Bacteria | 1889 |
| 349 | Ga0070717_10341413 | 3300006028 | Bacteria | 1337 |
| 350 | Ga0070717_10342952 | 3300006028 | Bacteria | 1334 |
| 351 | Ga0070717_10533546 | 3300006028 | Bacteria | 1062 |
| 352 | Ga0070717_10841879 | 3300006028 | Bacteria | 835 |
| 353 | Ga0075365_10057535 | 3300006038 | Bacteria | 2587 |
| 354 | Ga0075365_10062430 | 3300006038 | Bacteria | 2492 |
| 355 | Ga0075365_10265072 | 3300006038 | Bacteria | 1208 |
| 356 | Ga0075363_100049350 | 3300006048 | Bacteria | 2241 |
| 357 | Ga0075363_100204548 | 3300006048 | Bacteria | 1129 |
| 358 | Ga0075363_100306901 | 3300006048 | Bacteria | 922 |
| 359 | Ga0075364_10069351 | 3300006051 | Bacteria | 2320 |
| 360 | Ga0075364_10659798 | 3300006051 | Bacteria | 714 |
| 361 | Ga0075432_10068731 | 3300006058 | Bacteria | 1270 |
| 362 | Ga0075432_10193399 | 3300006058 | Bacteria | 802 |
| 363 | Ga0070715_10017421 | 3300006163 | Bacteria | 2720 |
| 364 | Ga0070715_10139137 | 3300006163 | Bacteria | 1177 |
| 365 | Ga0070715_10203507 | 3300006163 | Bacteria | 1007 |
| 366 | Ga0070715_10273988 | 3300006163 | Bacteria | 892 |
| 367 | Ga0070715_10987669 | 3300006163 | Bacteria | 524 |
| 368 | Ga0070716_100026033 | 3300006173 | Bacteria | 3128 |
| 369 | Ga0070716_100028509 | 3300006173 | Bacteria | 3008 |
| 370 | Ga0070716_100038887 | 3300006173 | Bacteria | 2637 |
| 371 | Ga0070716_100042692 | 3300006173 | Bacteria | 2533 |
| 372 | Ga0070716_100166173 | 3300006173 | Bacteria | 1435 |
| 373 | Ga0070716_100202083 | 3300006173 | Bacteria | 1322 |
| 374 | Ga0070716_100391819 | 3300006173 | Bacteria | 996 |
| 375 | Ga0070712_100047152 | 3300006175 | Bacteria | 2981 |
| 376 | Ga0070712_100071069 | 3300006175 | Bacteria | 2489 |
| 377 | Ga0070712_100116792 | 3300006175 | Bacteria | 2001 |
| 378 | Ga0070712_100164380 | 3300006175 | Bacteria | 1716 |
| 379 | Ga0070712_100422736 | 3300006175 | Bacteria | 1105 |
| 380 | Ga0070712_101255352 | 3300006175 | Bacteria | 645 |
| 381 | Ga0075367_10019662 | 3300006178 | Bacteria | 3748 |
| 382 | Ga0075367_10022674 | 3300006178 | Bacteria | 3524 |
| 383 | Ga0075367_10033074 | 3300006178 | Bacteria | 2979 |
| 384 | Ga0075369_10192367 | 3300006186 | Bacteria | 940 |
| 385 | Ga0075366_10038579 | 3300006195 | Bacteria | 2822 |
| 386 | Ga0097621_100048477 | 3300006237 | Bacteria | 3446 |
| 387 | Ga0097621_100097813 | 3300006237 | Bacteria | 2465 |
| 388 | Ga0097621_100887072 | 3300006237 | Bacteria | 830 |
| 389 | Ga0075370_10074605 | 3300006353 | Bacteria | 1944 |
| 390 | Ga0068871_100052029 | 3300006358 | Bacteria | 3316 |
| 391 | Ga0068871_100490261 | 3300006358 | Bacteria | 1106 |
| 392 | Ga0068871_100624947 | 3300006358 | Bacteria | 981 |
| 393 | Ga0075428_100058953 | 3300006844 | Bacteria | 4204 |
| 394 | Ga0075428_100145960 | 3300006844 | Bacteria | 2571 |
| 395 | Ga0075428_100725120 | 3300006844 | Bacteria | 1058 |
| 396 | Ga0075428_100790114 | 3300006844 | Bacteria | 1009 |
| 397 | Ga0075428_101056121 | 3300006844 | Bacteria | 859 |
| 398 | Ga0075428_101228393 | 3300006844 | Bacteria | 789 |
| 399 | Ga0075430_100029135 | 3300006846 | Bacteria | 4686 |
| 400 | Ga0075430_100060840 | 3300006846 | Bacteria | 3174 |
| 401 | Ga0075430_100529851 | 3300006846 | Bacteria | 972 |
| 402 | Ga0075431_100096669 | 3300006847 | Bacteria | 3049 |
| 403 | Ga0075431_100132609 | 3300006847 | Bacteria | 2569 |
| 404 | Ga0075431_100568870 | 3300006847 | Bacteria | 1119 |
| 405 | Ga0075431_100625973 | 3300006847 | Bacteria | 1058 |
| 406 | Ga0075431_100690271 | 3300006847 | Bacteria | 999 |
| 407 | Ga0075431_101177461 | 3300006847 | Bacteria | 730 |
| 408 | Ga0075431_102030226 | 3300006847 | Bacteria | 530 |
| 409 | Ga0075433_10071440 | 3300006852 | Bacteria | 3051 |
| 410 | Ga0075433_10770998 | 3300006852 | Bacteria | 841 |
| 411 | Ga0075433_11823144 | 3300006852 | Bacteria | 523 |
| 412 | Ga0075434_100077731 | 3300006871 | Bacteria | 3314 |
| 413 | Ga0075434_100932156 | 3300006871 | Bacteria | 883 |
| 414 | Ga0075434_101318390 | 3300006871 | Bacteria | 733 |
| 415 | Ga0075429_100069945 | 3300006880 | Bacteria | 3055 |
| 416 | Ga0075429_100135350 | 3300006880 | Bacteria | 2156 |
| 417 | Ga0075429_100366215 | 3300006880 | Bacteria | 1262 |
| 418 | Ga0075429_100721746 | 3300006880 | Bacteria | 873 |
| 419 | Ga0068865_100029322 | 3300006881 | Bacteria | 3650 |
| 420 | Ga0068865_100034960 | 3300006881 | Bacteria | 3376 |
| 421 | Ga0068865_100038148 | 3300006881 | Bacteria | 3250 |
| 422 | Ga0068865_100100724 | 3300006881 | Bacteria | 2114 |
| 423 | Ga0068865_100291352 | 3300006881 | Bacteria | 1303 |
| 424 | Ga0068865_100323542 | 3300006881 | Bacteria | 1241 |
| 425 | Ga0068865_100359283 | 3300006881 | Bacteria | 1182 |
| 426 | Ga0068865_100411250 | 3300006881 | Bacteria | 1110 |
| 427 | Ga0075436_100610479 | 3300006914 | Bacteria | 804 |
| 428 | Ga0097620_100011678 | 3300006931 | Bacteria | 8826 |
| 429 | Ga0097620_100085069 | 3300006931 | Bacteria | 3208 |
| 430 | Ga0097620_100272414 | 3300006931 | Bacteria | 1785 |
| 431 | Ga0097620_100387352 | 3300006931 | Bacteria | 1493 |
| 432 | Ga0097620_101649882 | 3300006931 | Bacteria | 708 |
| 433 | Ga0099822_1039366 | 3300006943 | Bacteria | 2713 |
| 434 | Ga0075435_100061941 | 3300007076 | Bacteria | 3036 |
| 435 | Ga0075435_100507336 | 3300007076 | Bacteria | 1043 |
| 436 | Ga0075435_100905559 | 3300007076 | Bacteria | 769 |
| 437 | Ga0099794_10140625 | 3300007265 | Bacteria | 1222 |
| 438 | Ga0099794_10215816 | 3300007265 | Bacteria | 985 |
| 439 | Ga0099794_10569938 | 3300007265 | Bacteria | 598 |
| 440 | Ga0099795_10187193 | 3300007788 | Bacteria | 867 |
| 441 | Ga0105251_10083153 | 3300009011 | Bacteria | 1478 |
| 442 | Ga0105244_10071717 | 3300009036 | Bacteria | 1727 |
| 443 | Ga0105250_10145102 | 3300009092 | Bacteria | 985 |
| 444 | Ga0105240_10000214 | 3300009093 | Bacteria | 117038 |
| 445 | Ga0105240_10048136 | 3300009093 | Bacteria | 5390 |
| 446 | Ga0105240_10123137 | 3300009093 | Bacteria | 3120 |
| 447 | Ga0105240_10259521 | 3300009093 | Bacteria | 2005 |
| 448 | Ga0105240_10564827 | 3300009093 | Bacteria | 1257 |
| 449 | Ga0105240_12089436 | 3300009093 | Bacteria | 588 |
| 450 | Ga0105240_12388680 | 3300009093 | Bacteria | 547 |
| 451 | Ga0111539_10046008 | 3300009094 | Bacteria | 5222 |
| 452 | Ga0111539_10121699 | 3300009094 | Bacteria | 3057 |
| 453 | Ga0111539_10634290 | 3300009094 | Bacteria | 1244 |
| 454 | Ga0111539_10744055 | 3300009094 | Bacteria | 1141 |
| 455 | Ga0111539_10768976 | 3300009094 | Bacteria | 1121 |
| 456 | Ga0105245_10058201 | 3300009098 | Bacteria | 3478 |
| 457 | Ga0105245_10201832 | 3300009098 | Bacteria | 1910 |
| 458 | Ga0105245_10260608 | 3300009098 | Bacteria | 1687 |
| 459 | Ga0105245_10336940 | 3300009098 | Bacteria | 1490 |
| 460 | Ga0105245_10663966 | 3300009098 | Bacteria | 1073 |
| 461 | Ga0105247_10044897 | 3300009101 | Bacteria | 2711 |
| 462 | Ga0105247_10058541 | 3300009101 | Bacteria | 2384 |
| 463 | Ga0105247_10074819 | 3300009101 | Bacteria | 2125 |
| 464 | Ga0105247_10084110 | 3300009101 | Bacteria | 2010 |
| 465 | Ga0105247_10132222 | 3300009101 | Bacteria | 1627 |
| 466 | Ga0105247_10308587 | 3300009101 | Bacteria | 1100 |
| 467 | Ga0114129_10113312 | 3300009147 | Bacteria | 3740 |
| 468 | Ga0114129_10126637 | 3300009147 | Bacteria | 3511 |
| 469 | Ga0114129_10158638 | 3300009147 | Bacteria | 3093 |
| 470 | Ga0114129_10395340 | 3300009147 | Bacteria | 1822 |
| 471 | Ga0114129_10782585 | 3300009147 | Bacteria | 1219 |
| 472 | Ga0114129_11129687 | 3300009147 | Bacteria | 979 |
| 473 | Ga0114129_11803568 | 3300009147 | Bacteria | 744 |
| 474 | Ga0105243_10043376 | 3300009148 | Bacteria | 3525 |
| 475 | Ga0105243_10044601 | 3300009148 | Bacteria | 3479 |
| 476 | Ga0105243_10230172 | 3300009148 | Bacteria | 1644 |
| 477 | Ga0105243_10278244 | 3300009148 | Bacteria | 1506 |
| 478 | Ga0105243_10554114 | 3300009148 | Bacteria | 1099 |
| 479 | Ga0105243_10934174 | 3300009148 | Bacteria | 865 |
| 480 | Ga0105241_10507221 | 3300009174 | Bacteria | 1077 |
| 481 | Ga0105242_10052866 | 3300009176 | Bacteria | 3316 |
| 482 | Ga0105242_10231413 | 3300009176 | Bacteria | 1656 |
| 483 | Ga0105242_10318447 | 3300009176 | Bacteria | 1426 |
| 484 | Ga0105242_10954539 | 3300009176 | Bacteria | 862 |
| 485 | Ga0105242_11049044 | 3300009176 | Bacteria | 826 |
| 486 | Ga0105248_10065986 | 3300009177 | Bacteria | 4064 |
| 487 | Ga0105248_10122696 | 3300009177 | Bacteria | 2931 |
| 488 | Ga0105248_10485519 | 3300009177 | Bacteria | 1392 |
| 489 | Ga0105248_10534410 | 3300009177 | Bacteria | 1322 |
| 490 | Ga0105248_10952725 | 3300009177 | Bacteria | 969 |
| 491 | Ga0105248_11257672 | 3300009177 | Bacteria | 837 |
| 492 | Ga0105248_11746359 | 3300009177 | Bacteria | 705 |
| 493 | Ga0105237_10073967 | 3300009545 | Bacteria | 3399 |
| 494 | Ga0105237_10102477 | 3300009545 | Bacteria | 2854 |
| 495 | Ga0105237_10412752 | 3300009545 | Bacteria | 1355 |
| 496 | Ga0105237_12362333 | 3300009545 | Bacteria | 542 |
| 497 | Ga0105238_10387337 | 3300009551 | Bacteria | 1390 |
| 498 | Ga0105238_10645527 | 3300009551 | Bacteria | 1068 |
| 499 | Ga0105238_11476117 | 3300009551 | Bacteria | 708 |
| 500 | Ga0105238_12641994 | 3300009551 | Bacteria | 538 |
| 501 | Ga0105249_10028066 | 3300009553 | Bacteria | 5080 |
| 502 | Ga0105249_10055087 | 3300009553 | Bacteria | 3637 |
| 503 | Ga0105249_10087337 | 3300009553 | Bacteria | 2910 |
| 504 | Ga0105249_10114680 | 3300009553 | Bacteria | 2551 |
| 505 | Ga0105249_10138614 | 3300009553 | Bacteria | 2330 |
| 506 | Ga0105249_10201224 | 3300009553 | Bacteria | 1949 |
| 507 | Ga0105249_10273096 | 3300009553 | Bacteria | 1685 |
| 508 | Ga0105249_10654618 | 3300009553 | Bacteria | 1108 |
| 509 | Ga0099796_10025508 | 3300010159 | Bacteria | 1867 |
| 510 | Ga0099796_10026637 | 3300010159 | Bacteria | 1838 |
| 511 | Ga0099796_10071967 | 3300010159 | Bacteria | 1250 |
| 512 | Ga0105239_10105018 | 3300010375 | Bacteria | 3128 |
| 513 | Ga0105239_10111045 | 3300010375 | Bacteria | 3039 |
| 514 | Ga0105239_10299303 | 3300010375 | Bacteria | 1811 |
| 515 | Ga0105239_10357001 | 3300010375 | Bacteria | 1650 |
| 516 | Ga0105239_10557915 | 3300010375 | Bacteria | 1305 |
| 517 | Ga0105239_10968536 | 3300010375 | Bacteria | 978 |
| 518 | Ga0105246_10031533 | 3300011119 | Bacteria | 3508 |
| 519 | Ga0105246_10052543 | 3300011119 | Bacteria | 2801 |
| 520 | Ga0105246_10055636 | 3300011119 | Bacteria | 2731 |
| 521 | Ga0105246_10077333 | 3300011119 | Bacteria | 2360 |
| 522 | Ga0105246_10201464 | 3300011119 | Bacteria | 1548 |
| 523 | Ga0105246_11297140 | 3300011119 | Bacteria | 675 |
| 524 | Ga0157323_1008223 | 3300012495 | Bacteria | 772 |
| 525 | Ga0157323_1049526 | 3300012495 | Bacteria | 507 |
| 526 | Ga0157319_1004757 | 3300012497 | Bacteria | 905 |
| 527 | Ga0157319_1015828 | 3300012497 | Bacteria | 678 |
| 528 | Ga0157345_1032691 | 3300012498 | Bacteria | 591 |
| 529 | Ga0157339_1008392 | 3300012505 | Bacteria | 890 |
| 530 | Ga0157342_1000363 | 3300012507 | Bacteria | 2647 |
| 531 | Ga0157316_1026130 | 3300012510 | Bacteria | 675 |
| 532 | Ga0157326_1087187 | 3300012513 | Bacteria | 520 |
| 533 | Ga0157371_10618375 | 3300013102 | Bacteria | 807 |
| 534 | Ga0157370_10064658 | 3300013104 | Bacteria | 3462 |
| 535 | Ga0157369_10101001 | 3300013105 | Bacteria | 3075 |
| 536 | Ga0157369_10144292 | 3300013105 | Bacteria | 2517 |
| 537 | Ga0157369_10815287 | 3300013105 | Bacteria | 959 |
| 538 | Ga0157369_11188084 | 3300013105 | Bacteria | 779 |
| 539 | Ga0157374_10058616 | 3300013296 | Bacteria | 3598 |
| 540 | Ga0157374_10076268 | 3300013296 | Bacteria | 3170 |
| 541 | Ga0157374_10598273 | 3300013296 | Bacteria | 1113 |
| 542 | Ga0157374_10611843 | 3300013296 | Bacteria | 1100 |
| 543 | Ga0157374_11143053 | 3300013296 | Bacteria | 799 |
| 544 | Ga0157378_10041017 | 3300013297 | Bacteria | 4106 |
| 545 | Ga0157378_10369096 | 3300013297 | Bacteria | 1406 |
| 546 | Ga0157378_10871815 | 3300013297 | Bacteria | 930 |
| 547 | Ga0157378_11223202 | 3300013297 | Bacteria | 791 |
| 548 | Ga0157378_11721835 | 3300013297 | Bacteria | 674 |
| 549 | Ga0157378_12204585 | 3300013297 | Bacteria | 602 |
| 550 | Ga0163162_10060990 | 3300013306 | Bacteria | 3809 |
| 551 | Ga0163162_10064322 | 3300013306 | Bacteria | 3713 |
| 552 | Ga0163162_10091115 | 3300013306 | Bacteria | 3131 |
| 553 | Ga0163162_10224089 | 3300013306 | Bacteria | 2010 |
| 554 | Ga0163162_10247417 | 3300013306 | Bacteria | 1914 |
| 555 | Ga0163162_10511741 | 3300013306 | Bacteria | 1330 |
| 556 | Ga0163162_10574284 | 3300013306 | Bacteria | 1255 |
| 557 | Ga0163162_11550495 | 3300013306 | Bacteria | 755 |
| 558 | Ga0157372_10190801 | 3300013307 | Bacteria | 2374 |
| 559 | Ga0157372_10294740 | 3300013307 | Bacteria | 1886 |
| 560 | Ga0157372_11125182 | 3300013307 | Bacteria | 908 |
| 561 | Ga0157375_10054329 | 3300013308 | Bacteria | 3944 |
| 562 | Ga0157375_10074384 | 3300013308 | Bacteria | 3419 |
| 563 | Ga0157375_10219534 | 3300013308 | Bacteria | 2059 |
| 564 | Ga0157375_11202325 | 3300013308 | Bacteria | 889 |
| 565 | Ga0157375_12270665 | 3300013308 | Bacteria | 647 |
| 566 | Ga0163163_10071117 | 3300014325 | Bacteria | 3466 |
| 567 | Ga0163163_10072960 | 3300014325 | Bacteria | 3422 |
| 568 | Ga0163163_10104982 | 3300014325 | Bacteria | 2851 |
| 569 | Ga0163163_10854593 | 3300014325 | Bacteria | 973 |
| 570 | Ga0163163_11299038 | 3300014325 | Bacteria | 790 |
| 571 | Ga0163163_11927232 | 3300014325 | Bacteria | 651 |
| 572 | Ga0163163_12516882 | 3300014325 | Bacteria | 573 |
| 573 | Ga0157380_10044229 | 3300014326 | Bacteria | 3489 |
| 574 | Ga0157380_10076607 | 3300014326 | Bacteria | 2723 |
| 575 | Ga0157380_10400435 | 3300014326 | Bacteria | 1302 |
| 576 | Ga0157380_10512190 | 3300014326 | Bacteria | 1168 |
| 577 | Ga0157377_10049881 | 3300014745 | Bacteria | 2355 |
| 578 | Ga0157377_10174301 | 3300014745 | Bacteria | 1347 |
| 579 | Ga0157379_10063563 | 3300014968 | Bacteria | 3299 |
| 580 | Ga0157379_10094922 | 3300014968 | Bacteria | 2676 |
| 581 | Ga0157379_10466088 | 3300014968 | Bacteria | 1168 |
| 582 | Ga0157376_10037388 | 3300014969 | Bacteria | 3940 |
| 583 | Ga0157376_10975433 | 3300014969 | Bacteria | 869 |
| 584 | Ga0157376_11329171 | 3300014969 | Bacteria | 749 |
| 585 | Ga0157376_12002407 | 3300014969 | Bacteria | 617 |
| 586 | Ga0163161_10048134 | 3300017792 | Bacteria | 3079 |
| 587 | Ga0163161_10053149 | 3300017792 | Bacteria | 2937 |
| 588 | Ga0163161_10106676 | 3300017792 | Bacteria | 2090 |
| 589 | Ga0163161_10123130 | 3300017792 | Bacteria | 1950 |
| 590 | Ga0163161_10171661 | 3300017792 | Bacteria | 1658 |
| 591 | Ga0163161_10361394 | 3300017792 | Bacteria | 1156 |
| 592 | Ga0163161_10399896 | 3300017792 | Bacteria | 1101 |
| 593 | Ga0206356_11796761 | 3300020070 | Bacteria | 2748 |
| 594 | Ga0206353_11171063 | 3300020082 | Bacteria | 1000 |
| 595 | Ga0213872_10013559 | 3300021361 | Bacteria | 3816 |
| 596 | Ga0213872_10022770 | 3300021361 | Bacteria | 2882 |
| 597 | Ga0213872_10034001 | 3300021361 | Bacteria | 2335 |
| 598 | Ga0213872_10217498 | 3300021361 | Bacteria | 814 |
| 599 | Ga0213876_10032700 | 3300021384 | Bacteria | 2743 |
| 600 | Ga0213876_10076761 | 3300021384 | Bacteria | 1764 |
| 601 | Ga0213876_10144797 | 3300021384 | Bacteria | 1263 |
| 602 | Ga0213875_10010246 | 3300021388 | Bacteria | 4702 |
| 603 | Ga0213875_10309100 | 3300021388 | Bacteria | 748 |
| 604 | Ga0213871_10039146 | 3300021441 | Bacteria | 1268 |
| 605 | Ga0207672_1002512 | 3300025223 | Bacteria | 1101 |
| 606 | Ga0209437_102087 | 3300025233 | Bacteria | 4051 |
| 607 | Ga0209677_100346 | 3300025253 | Bacteria | 29099 |
| 608 | Ga0209233_1000402 | 3300025261 | Bacteria | 35366 |
| 609 | Ga0207666_1013324 | 3300025271 | Bacteria | 1154 |
| 610 | Ga0209673_1015007 | 3300025273 | Bacteria | 2967 |
| 611 | Ga0207673_1002966 | 3300025290 | Bacteria | 1967 |
| 612 | Ga0209564_1010110 | 3300025295 | Bacteria | 4391 |
| 613 | Ga0209758_1002437 | 3300025297 | Bacteria | 18988 |
| 614 | Ga0207697_10014111 | 3300025315 | Bacteria | 3323 |
| 615 | Ga0207697_10027176 | 3300025315 | Bacteria | 2340 |
| 616 | Ga0207656_10020255 | 3300025321 | Bacteria | 2642 |
| 617 | Ga0207656_10325523 | 3300025321 | Bacteria | 764 |
| 618 | Ga0207653_10011706 | 3300025885 | Bacteria | 2736 |
| 619 | Ga0207653_10085715 | 3300025885 | Bacteria | 1097 |
| 620 | Ga0207682_10018078 | 3300025893 | Bacteria | 2754 |
| 621 | Ga0207682_10023002 | 3300025893 | Bacteria | 2459 |
| 622 | Ga0207692_10013797 | 3300025898 | Bacteria | 3514 |
| 623 | Ga0207692_10234580 | 3300025898 | Bacteria | 1093 |
| 624 | Ga0207692_10470230 | 3300025898 | Bacteria | 794 |
| 625 | Ga0207642_10188674 | 3300025899 | Bacteria | 1129 |
| 626 | Ga0207642_10281136 | 3300025899 | Bacteria | 957 |
| 627 | Ga0207642_10340061 | 3300025899 | Bacteria | 882 |
| 628 | Ga0207710_10098738 | 3300025900 | Bacteria | 1375 |
| 629 | Ga0207710_10110612 | 3300025900 | Bacteria | 1304 |
| 630 | Ga0207710_10136388 | 3300025900 | Bacteria | 1182 |
| 631 | Ga0207710_10569616 | 3300025900 | Bacteria | 591 |
| 632 | Ga0207688_10017957 | 3300025901 | Bacteria | 3849 |
| 633 | Ga0207688_10032419 | 3300025901 | Bacteria | 2888 |
| 634 | Ga0207680_10029231 | 3300025903 | Bacteria | 3094 |
| 635 | Ga0207680_10057008 | 3300025903 | Bacteria | 2362 |
| 636 | Ga0207680_10164083 | 3300025903 | Bacteria | 1492 |
| 637 | Ga0207680_10214418 | 3300025903 | Bacteria | 1317 |
| 638 | Ga0207680_10288643 | 3300025903 | Bacteria | 1141 |
| 639 | Ga0207680_10514127 | 3300025903 | Bacteria | 853 |
| 640 | Ga0207647_10027482 | 3300025904 | Bacteria | 3709 |
| 641 | Ga0207647_10041135 | 3300025904 | Bacteria | 2908 |
| 642 | Ga0207647_10201857 | 3300025904 | Bacteria | 1150 |
| 643 | Ga0207647_10220174 | 3300025904 | Bacteria | 1094 |
| 644 | Ga0207647_10275142 | 3300025904 | Bacteria | 962 |
| 645 | Ga0207647_10341703 | 3300025904 | Bacteria | 848 |
| 646 | Ga0207685_10033118 | 3300025905 | Bacteria | 1865 |
| 647 | Ga0207685_10093616 | 3300025905 | Bacteria | 1271 |
| 648 | Ga0207685_10112532 | 3300025905 | Bacteria | 1182 |
| 649 | Ga0207685_10127574 | 3300025905 | Bacteria | 1125 |
| 650 | Ga0207685_10218696 | 3300025905 | Bacteria | 905 |
| 651 | Ga0207685_10271856 | 3300025905 | Bacteria | 828 |
| 652 | Ga0207685_10504803 | 3300025905 | Bacteria | 637 |
| 653 | Ga0207685_10651419 | 3300025905 | Bacteria | 569 |
| 654 | Ga0207685_10652877 | 3300025905 | Bacteria | 569 |
| 655 | Ga0207699_10021781 | 3300025906 | Bacteria | 3461 |
| 656 | Ga0207699_10075229 | 3300025906 | Bacteria | 2077 |
| 657 | Ga0207699_10202107 | 3300025906 | Bacteria | 1347 |
| 658 | Ga0207699_10457832 | 3300025906 | Bacteria | 916 |
| 659 | Ga0207645_10083525 | 3300025907 | Bacteria | 2048 |
| 660 | Ga0207645_10173537 | 3300025907 | Bacteria | 1414 |
| 661 | Ga0207645_10381154 | 3300025907 | Bacteria | 947 |
| 662 | Ga0207643_10019057 | 3300025908 | Bacteria | 3759 |
| 663 | Ga0207643_10036307 | 3300025908 | Bacteria | 2763 |
| 664 | Ga0207643_10229868 | 3300025908 | Bacteria | 1137 |
| 665 | Ga0207705_10037903 | 3300025909 | Bacteria | 3449 |
| 666 | Ga0207705_10329417 | 3300025909 | Bacteria | 1174 |
| 667 | Ga0207705_10965368 | 3300025909 | Bacteria | 659 |
| 668 | Ga0207684_10057454 | 3300025910 | Bacteria | 3301 |
| 669 | Ga0207684_10059245 | 3300025910 | Bacteria | 3251 |
| 670 | Ga0207684_10079032 | 3300025910 | Bacteria | 2798 |
| 671 | Ga0207684_10132219 | 3300025910 | Bacteria | 2142 |
| 672 | Ga0207684_10648829 | 3300025910 | Bacteria | 899 |
| 673 | Ga0207684_11595628 | 3300025910 | Bacteria | 528 |
| 674 | Ga0207654_10260322 | 3300025911 | Bacteria | 1166 |
| 675 | Ga0207707_10043465 | 3300025912 | Bacteria | 3920 |
| 676 | Ga0207707_10315427 | 3300025912 | Bacteria | 1350 |
| 677 | Ga0207707_10360963 | 3300025912 | Bacteria | 1251 |
| 678 | Ga0207707_10520062 | 3300025912 | Bacteria | 1013 |
| 679 | Ga0207695_10000373 | 3300025913 | Bacteria | 101687 |
| 680 | Ga0207695_10354600 | 3300025913 | Bacteria | 1354 |
| 681 | Ga0207695_10505813 | 3300025913 | Bacteria | 1090 |
| 682 | Ga0207695_10599499 | 3300025913 | Bacteria | 983 |
| 683 | Ga0207671_10053523 | 3300025914 | Bacteria | 2991 |
| 684 | Ga0207671_10066355 | 3300025914 | Bacteria | 2686 |
| 685 | Ga0207671_10090272 | 3300025914 | Bacteria | 2307 |
| 686 | Ga0207671_10867702 | 3300025914 | Bacteria | 714 |
| 687 | Ga0207693_10035440 | 3300025915 | Bacteria | 3934 |
| 688 | Ga0207693_10113530 | 3300025915 | Bacteria | 2125 |
| 689 | Ga0207693_10146311 | 3300025915 | Bacteria | 1858 |
| 690 | Ga0207693_10161471 | 3300025915 | Bacteria | 1763 |
| 691 | Ga0207693_10338896 | 3300025915 | Bacteria | 1177 |
| 692 | Ga0207693_10384622 | 3300025915 | Bacteria | 1097 |
| 693 | Ga0207693_10395674 | 3300025915 | Bacteria | 1080 |
| 694 | Ga0207663_10016641 | 3300025916 | Bacteria | 4083 |
| 695 | Ga0207663_10101216 | 3300025916 | Bacteria | 1935 |
| 696 | Ga0207663_10209216 | 3300025916 | Bacteria | 1412 |
| 697 | Ga0207663_10406352 | 3300025916 | Bacteria | 1042 |
| 698 | Ga0207663_10534523 | 3300025916 | Bacteria | 915 |
| 699 | Ga0207663_10534684 | 3300025916 | Bacteria | 914 |
| 700 | Ga0207663_10579879 | 3300025916 | Bacteria | 879 |
| 701 | Ga0207663_10721559 | 3300025916 | Bacteria | 790 |
| 702 | Ga0207660_10013681 | 3300025917 | Bacteria | 5323 |
| 703 | Ga0207660_10485303 | 3300025917 | Bacteria | 1002 |
| 704 | Ga0207660_10628137 | 3300025917 | Bacteria | 875 |
| 705 | Ga0207662_10015080 | 3300025918 | Bacteria | 4343 |
| 706 | Ga0207662_10015662 | 3300025918 | Bacteria | 4268 |
| 707 | Ga0207662_10353364 | 3300025918 | Bacteria | 988 |
| 708 | Ga0207657_10081116 | 3300025919 | Bacteria | 2726 |
| 709 | Ga0207657_10461619 | 3300025919 | Bacteria | 996 |
| 710 | Ga0207657_10831295 | 3300025919 | Bacteria | 713 |
| 711 | Ga0207657_11301182 | 3300025919 | Bacteria | 549 |
| 712 | Ga0207649_10691393 | 3300025920 | Bacteria | 790 |
| 713 | Ga0207652_10146948 | 3300025921 | Bacteria | 2110 |
| 714 | Ga0207652_10196399 | 3300025921 | Bacteria | 1815 |
| 715 | Ga0207652_10513533 | 3300025921 | Bacteria | 1078 |
| 716 | Ga0207652_11037248 | 3300025921 | Bacteria | 719 |
| 717 | Ga0207652_11613162 | 3300025921 | Bacteria | 553 |
| 718 | Ga0207646_10024612 | 3300025922 | Bacteria | 5514 |
| 719 | Ga0207646_10062385 | 3300025922 | Bacteria | 3327 |
| 720 | Ga0207646_10323444 | 3300025922 | Bacteria | 1394 |
| 721 | Ga0207681_10044241 | 3300025923 | Bacteria | 2983 |
| 722 | Ga0207681_10619943 | 3300025923 | Bacteria | 895 |
| 723 | Ga0207681_10884088 | 3300025923 | Bacteria | 748 |
| 724 | Ga0207694_10548808 | 3300025924 | Bacteria | 970 |
| 725 | Ga0207650_10042359 | 3300025925 | Bacteria | 3340 |
| 726 | Ga0207650_10074168 | 3300025925 | Bacteria | 2564 |
| 727 | Ga0207650_10676470 | 3300025925 | Bacteria | 871 |
| 728 | Ga0207659_10040650 | 3300025926 | Bacteria | 3253 |
| 729 | Ga0207659_10055283 | 3300025926 | Bacteria | 2838 |
| 730 | Ga0207659_10924743 | 3300025926 | Bacteria | 750 |
| 731 | Ga0207687_10108753 | 3300025927 | Bacteria | 2053 |
| 732 | Ga0207687_10171529 | 3300025927 | Bacteria | 1673 |
| 733 | Ga0207687_10189473 | 3300025927 | Bacteria | 1600 |
| 734 | Ga0207687_10311030 | 3300025927 | Bacteria | 1272 |
| 735 | Ga0207687_10446735 | 3300025927 | Bacteria | 1072 |
| 736 | Ga0207687_11728663 | 3300025927 | Bacteria | 536 |
| 737 | Ga0207700_10050574 | 3300025928 | Bacteria | 3097 |
| 738 | Ga0207700_10266281 | 3300025928 | Bacteria | 1469 |
| 739 | Ga0207700_10290412 | 3300025928 | Bacteria | 1409 |
| 740 | Ga0207700_10500532 | 3300025928 | Bacteria | 1075 |
| 741 | Ga0207664_10057769 | 3300025929 | Bacteria | 3085 |
| 742 | Ga0207664_10072284 | 3300025929 | Bacteria | 2780 |
| 743 | Ga0207664_10190231 | 3300025929 | Bacteria | 1766 |
| 744 | Ga0207664_10406806 | 3300025929 | Bacteria | 1211 |
| 745 | Ga0207664_10421030 | 3300025929 | Bacteria | 1190 |
| 746 | Ga0207664_10528836 | 3300025929 | Bacteria | 1057 |
| 747 | Ga0207644_10041840 | 3300025931 | Bacteria | 3243 |
| 748 | Ga0207644_10085832 | 3300025931 | Bacteria | 2335 |
| 749 | Ga0207644_10206802 | 3300025931 | Bacteria | 1550 |
| 750 | Ga0207644_10314235 | 3300025931 | Bacteria | 1265 |
| 751 | Ga0207690_10144873 | 3300025932 | Bacteria | 1755 |
| 752 | Ga0207690_10582285 | 3300025932 | Bacteria | 912 |
| 753 | Ga0207690_10654371 | 3300025932 | Bacteria | 861 |
| 754 | Ga0207690_10670192 | 3300025932 | Bacteria | 851 |
| 755 | Ga0207690_10996633 | 3300025932 | Bacteria | 697 |
| 756 | Ga0207706_10038063 | 3300025933 | Bacteria | 4268 |
| 757 | Ga0207706_10058630 | 3300025933 | Bacteria | 3391 |
| 758 | Ga0207706_10063148 | 3300025933 | Bacteria | 3261 |
| 759 | Ga0207706_10107655 | 3300025933 | Bacteria | 2453 |
| 760 | Ga0207706_10298514 | 3300025933 | Bacteria | 1404 |
| 761 | Ga0207686_10072212 | 3300025934 | Bacteria | 2223 |
| 762 | Ga0207686_10240942 | 3300025934 | Bacteria | 1316 |
| 763 | Ga0207686_10370266 | 3300025934 | Bacteria | 1084 |
| 764 | Ga0207686_10684826 | 3300025934 | Bacteria | 814 |
| 765 | Ga0207709_10049575 | 3300025935 | Bacteria | 2564 |
| 766 | Ga0207709_10052277 | 3300025935 | Bacteria | 2508 |
| 767 | Ga0207709_10258510 | 3300025935 | Bacteria | 1276 |
| 768 | Ga0207709_10402527 | 3300025935 | Bacteria | 1047 |
| 769 | Ga0207709_10479840 | 3300025935 | Bacteria | 966 |
| 770 | Ga0207709_10608380 | 3300025935 | Bacteria | 866 |
| 771 | Ga0207670_10041706 | 3300025936 | Bacteria | 3019 |
| 772 | Ga0207670_10073740 | 3300025936 | Bacteria | 2367 |
| 773 | Ga0207670_10245373 | 3300025936 | Bacteria | 1381 |
| 774 | Ga0207670_10299663 | 3300025936 | Bacteria | 1258 |
| 775 | Ga0207669_10020122 | 3300025937 | Bacteria | 3491 |
| 776 | Ga0207669_10028158 | 3300025937 | Bacteria | 3087 |
| 777 | Ga0207669_10259148 | 3300025937 | Bacteria | 1299 |
| 778 | Ga0207669_10288327 | 3300025937 | Bacteria | 1242 |
| 779 | Ga0207669_10779628 | 3300025937 | Bacteria | 791 |
| 780 | Ga0207704_10019520 | 3300025938 | Bacteria | 3562 |
| 781 | Ga0207704_10047130 | 3300025938 | Bacteria | 2574 |
| 782 | Ga0207704_10155737 | 3300025938 | Bacteria | 1619 |
| 783 | Ga0207704_11546685 | 3300025938 | Bacteria | 569 |
| 784 | Ga0207665_10032332 | 3300025939 | Bacteria | 3464 |
| 785 | Ga0207665_10063608 | 3300025939 | Bacteria | 2506 |
| 786 | Ga0207665_10075494 | 3300025939 | Bacteria | 2309 |
| 787 | Ga0207665_10200975 | 3300025939 | Bacteria | 1452 |
| 788 | Ga0207665_10290355 | 3300025939 | Bacteria | 1220 |
| 789 | Ga0207665_10359520 | 3300025939 | Bacteria | 1101 |
| 790 | Ga0207665_10377588 | 3300025939 | Bacteria | 1075 |
| 791 | Ga0207665_10655482 | 3300025939 | Bacteria | 823 |
| 792 | Ga0207691_10046187 | 3300025940 | Bacteria | 4004 |
| 793 | Ga0207691_10062282 | 3300025940 | Bacteria | 3386 |
| 794 | Ga0207691_10336746 | 3300025940 | Bacteria | 1292 |
| 795 | Ga0207711_10224051 | 3300025941 | Bacteria | 1721 |
| 796 | Ga0207711_10241817 | 3300025941 | Bacteria | 1655 |
| 797 | Ga0207711_10309986 | 3300025941 | Bacteria | 1457 |
| 798 | Ga0207711_10345749 | 3300025941 | Bacteria | 1377 |
| 799 | Ga0207711_10584138 | 3300025941 | Bacteria | 1042 |
| 800 | Ga0207711_10712365 | 3300025941 | Bacteria | 936 |
| 801 | Ga0207711_11556663 | 3300025941 | Bacteria | 604 |
| 802 | Ga0207689_10059772 | 3300025942 | Bacteria | 3135 |
| 803 | Ga0207689_10069587 | 3300025942 | Bacteria | 2892 |
| 804 | Ga0207689_10755058 | 3300025942 | Bacteria | 821 |
| 805 | Ga0207661_10103934 | 3300025944 | Bacteria | 2391 |
| 806 | Ga0207661_10252382 | 3300025944 | Bacteria | 1568 |
| 807 | Ga0207661_10489546 | 3300025944 | Bacteria | 1123 |
| 808 | Ga0207679_10218180 | 3300025945 | Bacteria | 1604 |
| 809 | Ga0207679_10290636 | 3300025945 | Bacteria | 1405 |
| 810 | Ga0207679_11123884 | 3300025945 | Bacteria | 721 |
| 811 | Ga0207667_10055801 | 3300025949 | Bacteria | 4151 |
| 812 | Ga0207667_10103589 | 3300025949 | Bacteria | 2935 |
| 813 | Ga0207667_10169711 | 3300025949 | Bacteria | 2242 |
| 814 | Ga0207651_10035608 | 3300025960 | Bacteria | 3239 |
| 815 | Ga0207651_10056350 | 3300025960 | Bacteria | 2704 |
| 816 | Ga0207651_10202112 | 3300025960 | Bacteria | 1593 |
| 817 | Ga0207712_10000585 | 3300025961 | Bacteria | 29451 |
| 818 | Ga0207712_10048335 | 3300025961 | Bacteria | 2959 |
| 819 | Ga0207712_10064412 | 3300025961 | Bacteria | 2614 |
| 820 | Ga0207712_10077573 | 3300025961 | Bacteria | 2408 |
| 821 | Ga0207712_10126146 | 3300025961 | Bacteria | 1943 |
| 822 | Ga0207712_10144232 | 3300025961 | Bacteria | 1831 |
| 823 | Ga0207712_10247782 | 3300025961 | Bacteria | 1438 |
| 824 | Ga0207712_10637831 | 3300025961 | Bacteria | 925 |
| 825 | Ga0207712_11501394 | 3300025961 | Bacteria | 604 |
| 826 | Ga0207668_10061777 | 3300025972 | Bacteria | 2636 |
| 827 | Ga0207668_10089892 | 3300025972 | Bacteria | 2252 |
| 828 | Ga0207668_10102105 | 3300025972 | Bacteria | 2133 |
| 829 | Ga0207668_10167073 | 3300025972 | Bacteria | 1721 |
| 830 | Ga0207668_10258154 | 3300025972 | Bacteria | 1418 |
| 831 | Ga0207668_10640428 | 3300025972 | Bacteria | 929 |
| 832 | Ga0207668_10836542 | 3300025972 | Bacteria | 816 |
| 833 | Ga0207668_11467762 | 3300025972 | Bacteria | 615 |
| 834 | Ga0207640_10034177 | 3300025981 | Bacteria | 3170 |
| 835 | Ga0207640_10371398 | 3300025981 | Bacteria | 1156 |
| 836 | Ga0207640_10423834 | 3300025981 | Bacteria | 1090 |
| 837 | Ga0207658_10102726 | 3300025986 | Bacteria | 2242 |
| 838 | Ga0207658_10365241 | 3300025986 | Bacteria | 1260 |
| 839 | Ga0207658_10410207 | 3300025986 | Bacteria | 1192 |
| 840 | Ga0207658_10490358 | 3300025986 | Bacteria | 1093 |
| 841 | Ga0207658_10661470 | 3300025986 | Bacteria | 942 |
| 842 | Ga0207658_12187782 | 3300025986 | Bacteria | 502 |
| 843 | Ga0207677_10073181 | 3300026023 | Bacteria | 2425 |
| 844 | Ga0207677_10692798 | 3300026023 | Bacteria | 903 |
| 845 | Ga0207677_10858439 | 3300026023 | Bacteria | 816 |
| 846 | Ga0207703_10054702 | 3300026035 | Bacteria | 3246 |
| 847 | Ga0207703_10071624 | 3300026035 | Bacteria | 2863 |
| 848 | Ga0207703_10122142 | 3300026035 | Bacteria | 2237 |
| 849 | Ga0207703_10641907 | 3300026035 | Bacteria | 1007 |
| 850 | Ga0207703_11369969 | 3300026035 | Bacteria | 680 |
| 851 | Ga0207639_10082447 | 3300026041 | Bacteria | 2549 |
| 852 | Ga0207639_10276728 | 3300026041 | Bacteria | 1474 |
| 853 | Ga0207639_10364480 | 3300026041 | Bacteria | 1294 |
| 854 | Ga0207639_10459927 | 3300026041 | Bacteria | 1157 |
| 855 | Ga0207639_10585532 | 3300026041 | Bacteria | 1027 |
| 856 | Ga0207678_10015379 | 3300026067 | Bacteria | 6729 |
| 857 | Ga0207678_10037550 | 3300026067 | Bacteria | 4213 |
| 858 | Ga0207678_10062555 | 3300026067 | Bacteria | 3199 |
| 859 | Ga0207678_10078969 | 3300026067 | Bacteria | 2818 |
| 860 | Ga0207678_10088720 | 3300026067 | Bacteria | 2643 |
| 861 | Ga0207678_10091072 | 3300026067 | Bacteria | 2606 |
| 862 | Ga0207678_10282334 | 3300026067 | Bacteria | 1425 |
| 863 | Ga0207678_10831716 | 3300026067 | Bacteria | 815 |
| 864 | Ga0207708_10029482 | 3300026075 | Bacteria | 4160 |
| 865 | Ga0207708_10066148 | 3300026075 | Bacteria | 2764 |
| 866 | Ga0207708_10071628 | 3300026075 | Bacteria | 2655 |
| 867 | Ga0207708_10085476 | 3300026075 | Bacteria | 2427 |
| 868 | Ga0207708_10596160 | 3300026075 | Bacteria | 936 |
| 869 | Ga0207702_10290190 | 3300026078 | Bacteria | 1549 |
| 870 | Ga0207702_10292819 | 3300026078 | Bacteria | 1543 |
| 871 | Ga0207702_10639362 | 3300026078 | Bacteria | 1046 |
| 872 | Ga0207702_10641390 | 3300026078 | Bacteria | 1044 |
| 873 | Ga0207702_10935740 | 3300026078 | Bacteria | 859 |
| 874 | Ga0207641_10062575 | 3300026088 | Bacteria | 3176 |
| 875 | Ga0207641_10088324 | 3300026088 | Bacteria | 2706 |
| 876 | Ga0207641_11140882 | 3300026088 | Bacteria | 778 |
| 877 | Ga0207648_10065723 | 3300026089 | Bacteria | 3162 |
| 878 | Ga0207648_10076181 | 3300026089 | Bacteria | 2924 |
| 879 | Ga0207648_10121289 | 3300026089 | Bacteria | 2299 |
| 880 | Ga0207648_10229568 | 3300026089 | Bacteria | 1651 |
| 881 | Ga0207648_10360949 | 3300026089 | Bacteria | 1311 |
| 882 | Ga0207648_10511333 | 3300026089 | Bacteria | 1100 |
| 883 | Ga0207676_10072021 | 3300026095 | Bacteria | 2776 |
| 884 | Ga0207676_10150874 | 3300026095 | Bacteria | 2001 |
| 885 | Ga0207676_10991268 | 3300026095 | Bacteria | 827 |
| 886 | Ga0207676_11124931 | 3300026095 | Bacteria | 777 |
| 887 | Ga0207674_10023599 | 3300026116 | Bacteria | 6586 |
| 888 | Ga0207674_10343974 | 3300026116 | Bacteria | 1442 |
| 889 | Ga0207674_12026797 | 3300026116 | Bacteria | 540 |
| 890 | Ga0207675_100020156 | 3300026118 | Bacteria | 6217 |
| 891 | Ga0207675_100024147 | 3300026118 | Bacteria | 5652 |
| 892 | Ga0207675_100064100 | 3300026118 | Bacteria | 3434 |
| 893 | Ga0207675_100110238 | 3300026118 | Bacteria | 2597 |
| 894 | Ga0207675_100181364 | 3300026118 | Bacteria | 2016 |
| 895 | Ga0207675_100687112 | 3300026118 | Bacteria | 1031 |
| 896 | Ga0207683_10048793 | 3300026121 | Bacteria | 3705 |
| 897 | Ga0207683_10091106 | 3300026121 | Bacteria | 2716 |
| 898 | Ga0207683_10200171 | 3300026121 | Bacteria | 1815 |
| 899 | Ga0207683_10265202 | 3300026121 | Bacteria | 1568 |
| 900 | Ga0207683_11102760 | 3300026121 | Bacteria | 736 |
| 901 | Ga0207683_11685538 | 3300026121 | Bacteria | 583 |
| 902 | Ga0207698_10064868 | 3300026142 | Bacteria | 2865 |
| 903 | Ga0207698_10086511 | 3300026142 | Bacteria | 2549 |
| 904 | Ga0207698_10437020 | 3300026142 | Bacteria | 1260 |
| 905 | Ga0207698_10726811 | 3300026142 | Bacteria | 990 |
| 906 | Ga0207698_11348378 | 3300026142 | Bacteria | 728 |
| 907 | Ga0209389_1052241 | 3300027296 | Bacteria | 2784 |
| 908 | Ga0209589_1030082 | 3300027357 | Bacteria | 3037 |
| 909 | Ga0209489_100917 | 3300027361 | Bacteria | 58978 |
| 910 | Ga0209179_1056343 | 3300027512 | Bacteria | 849 |
| 911 | Ga0209588_1107203 | 3300027671 | Bacteria | 898 |
| 912 | Ga0209588_1212191 | 3300027671 | Bacteria | 600 |
| 913 | Ga0209813_10026024 | 3300027866 | Bacteria | 1688 |
| 914 | Ga0207428_10087032 | 3300027907 | Bacteria | 2431 |
| 915 | Ga0207428_10150666 | 3300027907 | Bacteria | 1770 |
| 916 | Ga0207428_10765185 | 3300027907 | Bacteria | 688 |
| 917 | Ga0268266_10022204 | 3300028379 | Bacteria | 5409 |
| 918 | Ga0268266_10096154 | 3300028379 | Bacteria | 2602 |
| 919 | Ga0268266_10129863 | 3300028379 | Bacteria | 2252 |
| 920 | Ga0268266_10187007 | 3300028379 | Bacteria | 1889 |
| 921 | Ga0268266_10651002 | 3300028379 | Bacteria | 1014 |
| 922 | Ga0268266_10747104 | 3300028379 | Bacteria | 944 |
| 923 | Ga0268266_11150034 | 3300028379 | Bacteria | 751 |
| 924 | Ga0268265_10005126 | 3300028380 | Bacteria | 8971 |
| 925 | Ga0268265_10061359 | 3300028380 | Bacteria | 2884 |
| 926 | Ga0268265_10188845 | 3300028380 | Bacteria | 1777 |
| 927 | Ga0268264_10002941 | 3300028381 | Bacteria | 14794 |
| 928 | Ga0268264_10241539 | 3300028381 | Bacteria | 1673 |
| 929 | Ga0268264_10283213 | 3300028381 | Bacteria | 1554 |
| 930 | Ga0268264_10498493 | 3300028381 | Bacteria | 1187 |
| 931 | Ga0268264_10674219 | 3300028381 | Bacteria | 1025 |
| 932 | Ga0268264_10938664 | 3300028381 | Bacteria | 870 |
| 933 | Ga0268264_12509937 | 3300028381 | Bacteria | 521 |
| 934 | Ga0307517_10275345 | 3300028786 | Bacteria | 964 |
| 935 | Ga0307515_10132155 | 3300028794 | Bacteria | 2740 |
| 936 | Ga0307515_10135239 | 3300028794 | Bacteria | 2685 |
| 937 | Ga0265338_10111787 | 3300028800 | Bacteria | 2198 |
| 938 | Ga0314311_1180298 | 3300030733 | Bacteria | 1147 |
| 939 | Ga0265760_10086322 | 3300031090 | Bacteria | 977 |
| 940 | Ga0265330_10015341 | 3300031235 | Bacteria | 3545 |
| 941 | Ga0265332_10066572 | 3300031238 | Bacteria | 1537 |
| 942 | Ga0265328_10012873 | 3300031239 | Bacteria | 3323 |
| 943 | Ga0265328_10021593 | 3300031239 | Bacteria | 2454 |
| 944 | Ga0265325_10081294 | 3300031241 | Bacteria | 1610 |
| 945 | Ga0265329_10015870 | 3300031242 | Bacteria | 2622 |
| 946 | Ga0265329_10064518 | 3300031242 | Bacteria | 1159 |
| 947 | Ga0265340_10386724 | 3300031247 | Bacteria | 617 |
| 948 | Ga0265339_10023122 | 3300031249 | Bacteria | 3595 |
| 949 | Ga0265339_10335853 | 3300031249 | Bacteria | 714 |
| 950 | Ga0265331_10249325 | 3300031250 | Bacteria | 796 |
| 951 | Ga0265331_10456075 | 3300031250 | Bacteria | 574 |
| 952 | Ga0265327_10064012 | 3300031251 | Bacteria | 1865 |
| 953 | Ga0265316_10055809 | 3300031344 | Bacteria | 3087 |
| 954 | Ga0265316_10070620 | 3300031344 | Bacteria | 2693 |
| 955 | Ga0265316_10105171 | 3300031344 | Bacteria | 2142 |
| 956 | Ga0265316_10217038 | 3300031344 | Bacteria | 1413 |
| 957 | Ga0265316_10348004 | 3300031344 | Bacteria | 1073 |
| 958 | Ga0307513_10127711 | 3300031456 | Bacteria | 2494 |
| 959 | Ga0307513_10280811 | 3300031456 | Bacteria | 1442 |
| 960 | Ga0307509_10133492 | 3300031507 | Bacteria | 2433 |
| 961 | Ga0307509_10213794 | 3300031507 | Bacteria | 1750 |
| 962 | Ga0307508_10435988 | 3300031616 | Bacteria | 902 |
| 963 | Ga0265314_10038605 | 3300031711 | Bacteria | 3447 |
| 964 | Ga0265314_10267978 | 3300031711 | Bacteria | 972 |
| 965 | Ga0265342_10223132 | 3300031712 | Bacteria | 1015 |
| 966 | Ga0265342_10289723 | 3300031712 | Bacteria | 865 |
| 967 | Ga0307516_10007599 | 3300031730 | Bacteria | 12424 |
| 968 | Ga0307516_10283404 | 3300031730 | Bacteria | 1338 |
| 969 | Ga0307413_11761563 | 3300031824 | Bacteria | 554 |
| 970 | Ga0307410_10820099 | 3300031852 | Bacteria | 792 |
| 971 | Ga0326468_10000972 | 3300031889 | Bacteria | 2763 |
| 972 | Ga0307412_10447903 | 3300031911 | Bacteria | 1063 |
| 973 | Ga0316593_10320748 | 3300032168 | Bacteria | 589 |
| 974 | Ga0307507_10316188 | 3300033179 | Bacteria | 944 |
| 975 | Ga0307510_10073274 | 3300033180 | Bacteria | 3394 |
| 976 | Ga0307510_10239140 | 3300033180 | Bacteria | 1312 |
| 977 | Ga0373930_0050834 | 3300034816 | Bacteria | 905 |
| 978 | Ga0373948_0013335 | 3300034817 | Bacteria | 1483 |
| 979 | Ga0373950_0072790 | 3300034818 | Bacteria | 707 |
| 980 | Ga0373950_0103580 | 3300034818 | Bacteria | 615 |
| 981 | Ga0373958_0039695 | 3300034819 | Bacteria | 958 |
| 982 | Ga0373926_0129624 | 3300035083 | Bacteria | 954 |
| 983 | Ga0373926_0161906 | 3300035083 | Bacteria | 854 |
| 984 | Ga0373928_0052617 | 3300035084 | Bacteria | 966 |
| 985 | Ga0373929_0127820 | 3300035085 | Bacteria | 664 |
| 986 | Ga0373934_0053150 | 3300035086 | Bacteria | 1607 |
| 987 | Ga0373934_0360956 | 3300035086 | Bacteria | 605 |
| 988 | Ga0373940_0129157 | 3300035088 | Bacteria | 790 |
| 989 | Ga0373944_0022663 | 3300035089 | Bacteria | 1826 |
| 990 | Ga0373944_0031391 | 3300035089 | Bacteria | 1598 |
| 991 | Ga0373944_0185074 | 3300035089 | Bacteria | 748 |
| 992 | Ga0373944_0278407 | 3300035089 | Bacteria | 623 |
| 993 | Ga0373949_0054229 | 3300035090 | Bacteria | 1017 |
| 994 | Ga0373949_0060088 | 3300035090 | Bacteria | 976 |
| 995 | Ga0373951_0216243 | 3300035091 | Bacteria | 564 |
| 996 | Ga0373952_0082468 | 3300035092 | Bacteria | 823 |
| 997 | Ga0373923_0025299 | 3300035111 | Bacteria | 2351 |
| 998 | Ga0373923_0050567 | 3300035111 | Bacteria | 1741 |
| 999 | Ga0373923_0087226 | 3300035111 | Bacteria | 1361 |
| 1000 | Ga0373923_0118740 | 3300035111 | Bacteria | 1180 |
| 1001 | Ga0373923_0145989 | 3300035111 | Bacteria | 1072 |
| 1002 | Ga0373923_0160180 | 3300035111 | Bacteria | 1026 |
| 1003 | Ga0373923_0300089 | 3300035111 | Bacteria | 760 |
| 1004 | Ga0373923_0348574 | 3300035111 | Bacteria | 707 |
| 1005 | Ga0373932_0031151 | 3300035112 | Bacteria | 1484 |
| 1006 | Ga0373932_0033969 | 3300035112 | Bacteria | 1435 |
| 1007 | Ga0373936_0149967 | 3300035113 | Bacteria | 1010 |
| 1008 | Ga0373936_0172059 | 3300035113 | Bacteria | 947 |
| 1009 | Ga0373936_0211367 | 3300035113 | Bacteria | 858 |
| 1010 | Ga0373936_0629493 | 3300035113 | Bacteria | 505 |
| 1011 | Ga0373939_0026226 | 3300035114 | Bacteria | 1641 |
| 1012 | Ga0373939_0164496 | 3300035114 | Bacteria | 817 |
| 1013 | Ga0373939_0173128 | 3300035114 | Bacteria | 800 |
| 1014 | Ga0373941_0040463 | 3300035115 | Bacteria | 1438 |
| 1015 | Ga0373941_0304236 | 3300035115 | Bacteria | 637 |
| 1016 | Ga0373945_0040015 | 3300035116 | Bacteria | 1691 |
| 1017 | Ga0373945_0105413 | 3300035116 | Bacteria | 1107 |
| 1018 | Ga0373945_0148942 | 3300035116 | Bacteria | 947 |
| 1019 | Ga0373945_0157335 | 3300035116 | Bacteria | 924 |
| 1020 | Ga0373945_0425744 | 3300035116 | Bacteria | 584 |
| 1021 | Ga0373953_0015051 | 3300035117 | Bacteria | 2794 |
| 1022 | Ga0373953_0050058 | 3300035117 | Bacteria | 1687 |
| 1023 | Ga0373953_0074586 | 3300035117 | Bacteria | 1403 |
| 1024 | Ga0373953_0480816 | 3300035117 | Bacteria | 550 |
| 1025 | Ga0373953_0540871 | 3300035117 | Bacteria | 517 |
| 1026 | Ga0373954_0019849 | 3300035118 | Bacteria | 3034 |
| 1027 | Ga0373954_0019918 | 3300035118 | Bacteria | 3029 |
| 1028 | Ga0373954_0028236 | 3300035118 | Bacteria | 2579 |
| 1029 | Ga0373954_0047550 | 3300035118 | Bacteria | 2008 |
| 1030 | Ga0373954_0085363 | 3300035118 | Bacteria | 1511 |
| 1031 | Ga0373954_0326512 | 3300035118 | Bacteria | 757 |
| 1032 | Ga0373954_0399468 | 3300035118 | Bacteria | 680 |
| 1033 | Ga0373956_0030765 | 3300035119 | Bacteria | 2348 |
| 1034 | Ga0373956_0114428 | 3300035119 | Bacteria | 1257 |
| 1035 | Ga0373956_0487274 | 3300035119 | Bacteria | 588 |
| 1036 | Ga0373957_0016532 | 3300035120 | Bacteria | 2554 |
| 1037 | Ga0373957_0232347 | 3300035120 | Bacteria | 773 |
| 1038 | Ga0373957_0245714 | 3300035120 | Bacteria | 752 |
| 1039 | Ga0373960_0101701 | 3300035121 | Bacteria | 932 |
| 1040 | Ga0373943_0080587 | 3300035170 | Bacteria | 1668 |
| 1041 | Ga0373943_0109288 | 3300035170 | Bacteria | 1456 |
| 1042 | Ga0373943_0114353 | 3300035170 | Bacteria | 1427 |
| 1043 | Ga0373943_0124022 | 3300035170 | Bacteria | 1375 |
| 1044 | Ga0373943_0270664 | 3300035170 | Bacteria | 958 |
| 1045 | Ga0373943_0309456 | 3300035170 | Bacteria | 898 |
| 1046 | Ga0373943_0321230 | 3300035170 | Bacteria | 882 |
| 1047 | Ga0373943_0567817 | 3300035170 | Bacteria | 666 |
| 1048 | Ga0373943_0572643 | 3300035170 | Bacteria | 664 |
| 1049 | Ga0373943_0580769 | 3300035170 | Bacteria | 659 |
| 1050 | Ga0373943_0617100 | 3300035170 | Bacteria | 639 |
| 1051 | Ga0373943_0636921 | 3300035170 | Bacteria | 629 |
| 1052 | Ga0373946_0006182 | 3300035171 | Bacteria | 4337 |
| 1053 | Ga0373946_0018765 | 3300035171 | Bacteria | 2658 |
| 1054 | Ga0373946_0078762 | 3300035171 | Bacteria | 1438 |
| 1055 | Ga0373946_0082082 | 3300035171 | Bacteria | 1413 |
| 1056 | Ga0373946_0186245 | 3300035171 | Bacteria | 987 |
| 1057 | Ga0373946_0216407 | 3300035171 | Bacteria | 923 |
| 1058 | Ga0373955_0048305 | 3300035172 | Bacteria | 2307 |
| 1059 | Ga0373955_0072544 | 3300035172 | Bacteria | 1928 |
| 1060 | Ga0373955_0147722 | 3300035172 | Bacteria | 1382 |
| 1061 | Ga0373955_0158079 | 3300035172 | Bacteria | 1336 |
| 1062 | Ga0373955_0290198 | 3300035172 | Bacteria | 985 |
| 1063 | Ga0373955_0334770 | 3300035172 | Bacteria | 915 |
| 1064 | Ga0373955_0342671 | 3300035172 | Bacteria | 904 |
| 1065 | Ga0373942_0120640 | 3300035207 | Bacteria | 819 |
| 1066 | Ga0373942_0143157 | 3300035207 | Bacteria | 763 |
| 1067 | Ga0373961_0092534 | 3300035241 | Bacteria | 968 |
| 1068 | Ga0373962_0011074 | 3300035242 | Bacteria | 2256 |
| 1069 | Ga0373962_0108194 | 3300035242 | Bacteria | 874 |
| 1070 | Ga0316574_0198250 | 3300035398 | Bacteria | 1290 |
| 1071 | Ga0373924_0015840 | 3300035410 | Bacteria | 2871 |
| 1072 | Ga0373924_0018409 | 3300035410 | Bacteria | 2691 |
| 1073 | Ga0373924_0038098 | 3300035410 | Bacteria | 1960 |
| 1074 | Ga0373924_0067477 | 3300035410 | Bacteria | 1504 |
| 1075 | Ga0373924_0219718 | 3300035410 | Bacteria | 839 |
| 1076 | Ga0373931_0159956 | 3300035691 | Bacteria | 1319 |
| 1077 | Ga0373931_0166604 | 3300035691 | Bacteria | 1295 |
| 1078 | Ga0373931_0208178 | 3300035691 | Bacteria | 1172 |
| 1079 | Ga0373931_0357718 | 3300035691 | Bacteria | 915 |
| 1080 | Ga0373935_0056141 | 3300035692 | Bacteria | 2510 |
| 1081 | Ga0373935_0085775 | 3300035692 | Bacteria | 2053 |
| 1082 | Ga0373935_0102093 | 3300035692 | Bacteria | 1892 |
| 1083 | Ga0373935_0117294 | 3300035692 | Bacteria | 1774 |
| 1084 | Ga0373935_0120671 | 3300035692 | Bacteria | 1751 |
| 1085 | Ga0373935_0126546 | 3300035692 | Bacteria | 1712 |
| 1086 | Ga0373935_0382960 | 3300035692 | Bacteria | 1007 |
| 1087 | Ga0373935_1443899 | 3300035692 | Bacteria | 515 |
| 1088 | Ga0373927_0049063 | 3300035695 | Bacteria | 2730 |
| 1089 | Ga0373927_0049705 | 3300035695 | Bacteria | 2711 |
| 1090 | Ga0373927_0065746 | 3300035695 | Bacteria | 2345 |
| 1091 | Ga0373927_0171715 | 3300035695 | Bacteria | 1421 |
| 1092 | Ga0373927_0263915 | 3300035695 | Bacteria | 1132 |
| 1093 | Ga0373927_0383764 | 3300035695 | Bacteria | 926 |
| 1094 | Ga0373927_0563662 | 3300035695 | Bacteria | 753 |
| 1095 | Ga0373927_1090734 | 3300035695 | Bacteria | 526 |
| 1096 | Ga0373933_0029830 | 3300035724 | Bacteria | 3156 |
| 1097 | Ga0373933_0056507 | 3300035724 | Bacteria | 2356 |
| 1098 | Ga0373933_0074087 | 3300035724 | Bacteria | 2075 |
| 1099 | Ga0373933_0132843 | 3300035724 | Bacteria | 1566 |
| 1100 | Ga0373933_0234409 | 3300035724 | Bacteria | 1179 |
| 1101 | Ga0373933_0832656 | 3300035724 | Bacteria | 607 |
| 1102 | Ga0373933_0995154 | 3300035724 | Bacteria | 552 |
| 1103 | Ga0373947_0042460 | 3300035725 | Bacteria | 2714 |
| 1104 | Ga0373947_0076942 | 3300035725 | Bacteria | 2057 |
| 1105 | Ga0373947_0098906 | 3300035725 | Bacteria | 1830 |
| 1106 | Ga0373947_0145046 | 3300035725 | Bacteria | 1525 |
| 1107 | Ga0373947_0213055 | 3300035725 | Bacteria | 1268 |
| 1108 | Ga0373947_0260879 | 3300035725 | Bacteria | 1148 |
| 1109 | Ga0373947_0296121 | 3300035725 | Bacteria | 1078 |
| 1110 | Ga0373947_0370111 | 3300035725 | Bacteria | 963 |
| 1111 | Ga0373947_0537903 | 3300035725 | Bacteria | 795 |
| 1112 | Ga0373947_0799024 | 3300035725 | Bacteria | 644 |
| 1113 | Ga0373947_0846433 | 3300035725 | Bacteria | 624 |
| 1114 | Ga0373937_0084987 | 3300036401 | Bacteria | 2928 |
| 1115 | Ga0373937_0140309 | 3300036401 | Bacteria | 2261 |
| 1116 | Ga0373937_0147539 | 3300036401 | Bacteria | 2202 |
| 1117 | Ga0373937_0158539 | 3300036401 | Bacteria | 2121 |
| 1118 | Ga0373937_0194428 | 3300036401 | Bacteria | 1906 |
| 1119 | Ga0373937_0644374 | 3300036401 | Bacteria | 1005 |
| 1120 | Ga0373937_1573313 | 3300036401 | Bacteria | 605 |
| 1121 | Ga0373937_1624880 | 3300036401 | Bacteria | 593 |
| 1122 | Ga0316582_0047627 | 3300036647 | Bacteria | 2707 |
| 1123 | Ga0316582_0933269 | 3300036647 | Bacteria | 593 |
| 1124 | Ga0373925_0067612 | 3300037068 | Bacteria | 2695 |
| 1125 | Ga0373925_0069733 | 3300037068 | Bacteria | 2656 |
| 1126 | Ga0373925_0210031 | 3300037068 | Bacteria | 1550 |
| 1127 | Ga0373925_0325420 | 3300037068 | Bacteria | 1244 |
| 1128 | Ga0373925_0356362 | 3300037068 | Bacteria | 1188 |
| 1129 | Ga0373925_0427912 | 3300037068 | Bacteria | 1082 |
| 1130 | Ga0373925_0490255 | 3300037068 | Bacteria | 1008 |
| 1131 | Ga0373925_1222496 | 3300037068 | Bacteria | 617 |
| 1132 | Ga0373925_1616746 | 3300037068 | Bacteria | 529 |
| 1133 | Ga0395899_0021806 | 3300037312 | Bacteria | 4858 |
| 1134 | Ga0395900_0006417 | 3300037418 | Bacteria | 12257 |
| 1135 | Ga0395900_0118804 | 3300037418 | Bacteria | 2713 |
| 1136 | Ga0395900_0163631 | 3300037418 | Bacteria | 2268 |
| 1137 | Ga0395900_0169067 | 3300037418 | Bacteria | 2226 |
| 1138 | Ga0395900_0222368 | 3300037418 | Bacteria | 1902 |
| 1139 | Ga0395900_0676247 | 3300037418 | Bacteria | 967 |
| 1140 | Ga0395900_1280666 | 3300037418 | Bacteria | 647 |
| 1141 | Ga0395900_1799298 | 3300037418 | Bacteria | 523 |
| 1142 | Ga0395898_0017413 | 3300037466 | Bacteria | 7340 |
| 1143 | Ga0395898_0047908 | 3300037466 | Bacteria | 4192 |
| 1144 | Ga0395898_0407867 | 3300037466 | Bacteria | 1295 |
| 1145 | Ga0395898_0420041 | 3300037466 | Bacteria | 1274 |
| 1146 | Ga0395898_0993533 | 3300037466 | Bacteria | 775 |
| 1147 | Ga0395898_1010067 | 3300037466 | Bacteria | 767 |
| 1148 | Ga0395905_0028981 | 3300037471 | Bacteria | 5218 |
| 1149 | Ga0395905_0049044 | 3300037471 | Bacteria | 3956 |
| 1150 | Ga0395905_0091869 | 3300037471 | Bacteria | 2846 |
| 1151 | Ga0395905_0098054 | 3300037471 | Bacteria | 2752 |
| 1152 | Ga0395905_0825347 | 3300037471 | Bacteria | 830 |
| 1153 | Ga0436364_0326510 | 3300037853 | Bacteria | 2934 |
| 1154 | Ga0436364_0962972 | 3300037853 | Bacteria | 3150 |
| 1155 | Ga0436364_1456246 | 3300037853 | Bacteria | 548 |
| 1156 | Ga0395901_0059404 | 3300038443 | Bacteria | 3978 |
| 1157 | Ga0395901_0144785 | 3300038443 | Bacteria | 2498 |
| 1158 | Ga0395901_0199103 | 3300038443 | Bacteria | 2099 |
| 1159 | Ga0395901_0362760 | 3300038443 | Bacteria | 1494 |
| 1160 | Ga0400485_04215 | 3300038735 | Unclassified | 1573 |
| 1161 | Ga0400485_16768 | 3300038735 | Bacteria | 1043 |
| 1162 | Ga0400488_47058 | 3300038741 | Bacteria | 1834 |
| 1163 | Ga0400486_01382 | 3300038742 | Bacteria | 1505 |
| 1164 | Ga0400486_07939 | 3300038742 | Bacteria | 2386 |
| 1165 | Ga0400486_14467 | 3300038742 | Bacteria | 4137 |
| 1166 | Ga0400486_23044 | 3300038742 | Bacteria | 1137 |
| 1167 | Ga0400483_111038 | 3300039062 | Bacteria | 1837 |
| 1168 | Ga0400483_212980 | 3300039062 | Bacteria | 1959 |
| 1169 | Ga0400487_54562 | 3300039110 | Bacteria | 2839 |
| 1170 | Ga0436365_0243347 | 3300039437 | Bacteria | 3119 |
| 1171 | Ga0436365_0583808 | 3300039437 | Bacteria | 663 |
| 1172 | Ga0436365_0658513 | 3300039437 | Bacteria | 3022 |
| 1173 | Ga0436365_0771598 | 3300039437 | Bacteria | 1855 |
| 1174 | Ga0436360_0073076 | 3300039438 | Bacteria | 3965 |
| 1175 | Ga0436360_0074255 | 3300039438 | Bacteria | 515 |
| 1176 | Ga0436360_0361390 | 3300039438 | Bacteria | 682 |
| 1177 | Ga0436360_0645085 | 3300039438 | Bacteria | 2456 |
| 1178 | Ga0436361_0060530 | 3300039447 | Bacteria | 5319 |
| 1179 | Ga0436361_0085954 | 3300039447 | Bacteria | 4223 |
| 1180 | Ga0436361_0376942 | 3300039447 | Bacteria | 769 |
| 1181 | Ga0436361_0720791 | 3300039447 | Bacteria | 1516 |
| 1182 | Ga0436361_1074467 | 3300039447 | Bacteria | 1493 |
| 1183 | Ga0436363_1069702 | 3300039450 | Bacteria | 707 |
| 1184 | Ga0436363_1090990 | 3300039450 | Bacteria | 1048 |
| 1185 | Ga0436362_0436830 | 3300039453 | Bacteria | 1255 |
| 1186 | Ga0439453_0000974 | 3300041408 | Bacteria | 3470 |
| 1187 | Ga0439453_0002632 | 3300041408 | Bacteria | 2498 |
| 1188 | Ga0439453_0002710 | 3300041408 | Bacteria | 2470 |
| 1189 | Ga0439466_0086054 | 3300041411 | Bacteria | 988 |
| 1190 | Ga0439466_0220831 | 3300041411 | Bacteria | 575 |
| 1191 | Ga0439465_0047282 | 3300041413 | Bacteria | 1402 |
| 1192 | Ga0451791_1072700 | 3300041451 | Bacteria | 940 |
| 1193 | Ga0451793_1805825 | 3300041452 | Bacteria | 1076 |
| 1194 | Ga0451833_0245952 | 3300041491 | Bacteria | 1283 |
| 1195 | Ga0451839_1046304 | 3300041496 | Bacteria | 543 |
| 1196 | Ga0451845_0321414 | 3300041501 | Bacteria | 1281 |
| 1197 | Ga0451849_0779732 | 3300041505 | Bacteria | 599 |
| 1198 | Ga0451851_0301071 | 3300041507 | Bacteria | 632 |
| 1199 | Ga0451851_0384489 | 3300041507 | Bacteria | 876 |
| 1200 | Ga0451853_1441035 | 3300041512 | Bacteria | 596 |
| 1201 | Ga0439441_011328 | 3300042001 | Bacteria | 1511 |
| 1202 | Ga0439441_017699 | 3300042001 | Bacteria | 1282 |
| 1203 | Ga0439443_000643 | 3300042003 | Bacteria | 3315 |
| 1204 | Ga0439443_001673 | 3300042003 | Bacteria | 2513 |
| 1205 | Ga0439443_027850 | 3300042003 | Bacteria | 919 |
| 1206 | Ga0439448_0087253 | 3300042005 | Bacteria | 1052 |
| 1207 | Ga0439451_018834 | 3300042009 | Bacteria | 1393 |
| 1208 | Ga0439451_024473 | 3300042009 | Bacteria | 1216 |
| 1209 | Ga0439454_022390 | 3300042011 | Bacteria | 941 |
| 1210 | Ga0439455_0071297 | 3300042012 | Bacteria | 934 |
| 1211 | Ga0439456_010219 | 3300042013 | Bacteria | 1938 |
| 1212 | Ga0439456_038963 | 3300042013 | Bacteria | 1028 |
| 1213 | Ga0450923_011547 | 3300042125 | Bacteria | 1590 |
| 1214 | Ga0450923_031299 | 3300042125 | Bacteria | 1086 |
| 1215 | Ga0450894_051929 | 3300042131 | Bacteria | 605 |
| 1216 | Ga0450899_012083 | 3300042135 | Bacteria | 968 |
| 1217 | Ga0450905_018577 | 3300042142 | Bacteria | 1014 |
| 1218 | Ga0450905_019166 | 3300042142 | Bacteria | 1000 |
| 1219 | Ga0450889_000730 | 3300042144 | Bacteria | 3532 |
| 1220 | Ga0439446_0086363 | 3300042156 | Bacteria | 977 |
| 1221 | Ga0439458_0032965 | 3300042157 | Bacteria | 1239 |
| 1222 | Ga0439434_0038583 | 3300042435 | Bacteria | 1464 |
| 1223 | Ga0439435_0000915 | 3300042436 | Bacteria | 5100 |
| 1224 | Ga0439435_0005323 | 3300042436 | Bacteria | 2825 |
| 1225 | Ga0439435_0064266 | 3300042436 | Bacteria | 1075 |
| 1226 | Ga0439444_0012859 | 3300042437 | Bacteria | 1378 |
| 1227 | Ga0439444_0017794 | 3300042437 | Bacteria | 1224 |
| 1228 | Ga0439444_0029522 | 3300042437 | Bacteria | 1022 |
| 1229 | Ga0439464_0015957 | 3300042439 | Bacteria | 2030 |
| 1230 | Ga0439464_0058586 | 3300042439 | Bacteria | 1124 |
| 1231 | Ga0439464_0168107 | 3300042439 | Bacteria | 691 |
| 1232 | Ga0439460_0003019 | 3300042461 | Bacteria | 4063 |
| 1233 | Ga0439460_0004287 | 3300042461 | Bacteria | 3474 |
| 1234 | Ga0439460_0010794 | 3300042461 | Bacteria | 2346 |
| 1235 | Ga0439460_0290017 | 3300042461 | Bacteria | 571 |
| 1236 | Ga0450918_004800 | 3300042531 | Bacteria | 2446 |
| 1237 | Ga0439440_0006576 | 3300042993 | Bacteria | 2345 |
| 1238 | Ga0439440_0007577 | 3300042993 | Bacteria | 2208 |
| 1239 | Ga0439440_0054601 | 3300042993 | Bacteria | 1006 |
| 1240 | Ga0439440_0066460 | 3300042993 | Bacteria | 930 |
| 1241 | Ga0466969_0025434 | 3300044656 | Bacteria | 3043 |
| 1242 | Ga0466969_0106421 | 3300044656 | Bacteria | 1316 |
| 1243 | Ga0466969_0213760 | 3300044656 | Bacteria | 878 |
| 1244 | Ga0466972_0030572 | 3300044658 | Bacteria | 2650 |
| 1245 | Ga0466972_0601028 | 3300044658 | Bacteria | 520 |
| 1246 | Ga0466965_0028301 | 3300044683 | Bacteria | 2722 |
| 1247 | Ga0466965_0089407 | 3300044683 | Bacteria | 1565 |
| 1248 | Ga0466966_0059696 | 3300044684 | Bacteria | 2408 |
| 1249 | Ga0466966_0114637 | 3300044684 | Bacteria | 1659 |
| 1250 | Ga0466966_0239806 | 3300044684 | Bacteria | 1093 |
| 1251 | Ga0466966_0692337 | 3300044684 | Bacteria | 614 |
| 1252 | Ga0466966_0728717 | 3300044684 | Bacteria | 598 |
| 1253 | Ga0466961_0047623 | 3300044693 | Bacteria | 2741 |
| 1254 | Ga0466961_0104863 | 3300044693 | Bacteria | 1780 |
| 1255 | Ga0466961_0131493 | 3300044693 | Bacteria | 1568 |
| 1256 | Ga0466964_0022238 | 3300044706 | Bacteria | 2458 |
| 1257 | Ga0466964_0114626 | 3300044706 | Bacteria | 1206 |
| 1258 | Ga0466964_0139074 | 3300044706 | Bacteria | 1114 |
| 1259 | Ga0466971_0022392 | 3300044719 | Bacteria | 2815 |
| 1260 | Ga0466971_0077053 | 3300044719 | Bacteria | 1517 |
| 1261 | Ga0466968_0018946 | 3300044735 | Bacteria | 2764 |
| 1262 | Ga0466968_0137700 | 3300044735 | Bacteria | 1114 |
| 1263 | Ga0466970_0031500 | 3300044765 | Bacteria | 2800 |
| 1264 | Ga0466970_0033311 | 3300044765 | Bacteria | 2723 |
| 1265 | Ga0466957_0030133 | 3300044842 | Bacteria | 3239 |
| 1266 | Ga0466957_0805755 | 3300044842 | Bacteria | 667 |
| 1267 | Ga0466959_0007283 | 3300045049 | Bacteria | 7753 |
| 1268 | Ga0466959_0044833 | 3300045049 | Bacteria | 3257 |
| 1269 | Ga0466959_0048707 | 3300045049 | Bacteria | 3114 |
| 1270 | Ga0466959_0059094 | 3300045049 | Bacteria | 2792 |
| 1271 | Ga0466958_0038401 | 3300045836 | Bacteria | 2873 |
| 1272 | Ga0466958_0080061 | 3300045836 | Bacteria | 2009 |
| 1273 | Ga0466958_0118709 | 3300045836 | Bacteria | 1654 |
| 1274 | Ga0466967_0055644 | 3300045976 | Bacteria | 3485 |
| 1275 | Ga0466967_0377913 | 3300045976 | Bacteria | 1375 |
| 1276 | Ga0466967_0801456 | 3300045976 | Bacteria | 935 |
| 1277 | Ga0495617_011509 | 3300046452 | Bacteria | 3017 |
| 1278 | Ga0495617_124154 | 3300046452 | Bacteria | 830 |
| 1279 | Ga0495617_212901 | 3300046452 | Bacteria | 602 |
| 1280 | Ga0495617_235163 | 3300046452 | Bacteria | 567 |
| 1281 | Ga0495592_0034042 | 3300046454 | Bacteria | 3842 |
| 1282 | Ga0495592_0062015 | 3300046454 | Bacteria | 2746 |
| 1283 | Ga0495592_0115689 | 3300046454 | Bacteria | 1893 |
| 1284 | Ga0495592_0125527 | 3300046454 | Bacteria | 1801 |
| 1285 | Ga0495592_0394875 | 3300046454 | Bacteria | 877 |
| 1286 | Ga0495592_0878709 | 3300046454 | Bacteria | 528 |
| 1287 | Ga0495603_0028379 | 3300046455 | Bacteria | 3375 |
| 1288 | Ga0495603_0043799 | 3300046455 | Bacteria | 2671 |
| 1289 | Ga0495603_0084848 | 3300046455 | Bacteria | 1854 |
| 1290 | Ga0495603_0333379 | 3300046455 | Bacteria | 870 |
| 1291 | Ga0495603_0537240 | 3300046455 | Bacteria | 669 |
| 1292 | Ga0495590_0052462 | 3300046457 | Bacteria | 1424 |
| 1293 | Ga0495590_0170136 | 3300046457 | Bacteria | 794 |
| 1294 | Ga0495591_040818 | 3300046458 | Bacteria | 1320 |
| 1295 | Ga0495629_0009117 | 3300046459 | Bacteria | 7268 |
| 1296 | Ga0495629_0070675 | 3300046459 | Bacteria | 2435 |
| 1297 | Ga0495629_0124723 | 3300046459 | Bacteria | 1794 |
| 1298 | Ga0495629_0176819 | 3300046459 | Bacteria | 1480 |
| 1299 | Ga0495629_0309682 | 3300046459 | Bacteria | 1080 |
| 1300 | Ga0495629_0430622 | 3300046459 | Bacteria | 894 |
| 1301 | Ga0495629_0726952 | 3300046459 | Bacteria | 658 |
| 1302 | Ga0495638_0045797 | 3300046460 | Bacteria | 2750 |
| 1303 | Ga0495638_0103122 | 3300046460 | Bacteria | 1703 |
| 1304 | Ga0495638_0172792 | 3300046460 | Bacteria | 1239 |
| 1305 | Ga0495638_0242461 | 3300046460 | Bacteria | 997 |
| 1306 | Ga0495641_0026128 | 3300046461 | Bacteria | 2854 |
| 1307 | Ga0495641_0082650 | 3300046461 | Bacteria | 1438 |
| 1308 | Ga0495641_0110844 | 3300046461 | Bacteria | 1224 |
| 1309 | Ga0495641_0143317 | 3300046461 | Bacteria | 1067 |
| 1310 | Ga0495641_0550869 | 3300046461 | Bacteria | 526 |
| 1311 | Ga0495651_0061261 | 3300046462 | Bacteria | 2880 |
| 1312 | Ga0495651_0070182 | 3300046462 | Bacteria | 2666 |
| 1313 | Ga0495651_0107552 | 3300046462 | Bacteria | 2066 |
| 1314 | Ga0495651_0152403 | 3300046462 | Bacteria | 1664 |
| 1315 | Ga0495651_0202741 | 3300046462 | Bacteria | 1387 |
| 1316 | Ga0495653_0056811 | 3300046463 | Bacteria | 2981 |
| 1317 | Ga0495653_0060562 | 3300046463 | Bacteria | 2867 |
| 1318 | Ga0495653_0157331 | 3300046463 | Bacteria | 1581 |
| 1319 | Ga0495653_0261320 | 3300046463 | Bacteria | 1144 |
| 1320 | Ga0495650_0065317 | 3300046471 | Bacteria | 1444 |
| 1321 | Ga0495580_0089774 | 3300046472 | Bacteria | 2139 |
| 1322 | Ga0495580_0315671 | 3300046472 | Bacteria | 1062 |
| 1323 | Ga0495580_0463423 | 3300046472 | Bacteria | 849 |
| 1324 | Ga0495580_0635017 | 3300046472 | Bacteria | 703 |
| 1325 | Ga0495582_0020733 | 3300046473 | Bacteria | 3599 |
| 1326 | Ga0495582_0032858 | 3300046473 | Bacteria | 2851 |
| 1327 | Ga0495582_0043305 | 3300046473 | Bacteria | 2479 |
| 1328 | Ga0495582_0163725 | 3300046473 | Bacteria | 1265 |
| 1329 | Ga0495582_0317432 | 3300046473 | Bacteria | 896 |
| 1330 | Ga0495605_0028279 | 3300046474 | Bacteria | 2895 |
| 1331 | Ga0495605_0030113 | 3300046474 | Bacteria | 2785 |
| 1332 | Ga0495605_0190743 | 3300046474 | Bacteria | 897 |
| 1333 | Ga0495639_0049712 | 3300046475 | Bacteria | 1903 |
| 1334 | Ga0495639_0394540 | 3300046475 | Bacteria | 698 |
| 1335 | Ga0495662_0026586 | 3300046476 | Bacteria | 2794 |
| 1336 | Ga0495662_0027992 | 3300046476 | Bacteria | 2721 |
| 1337 | Ga0495662_0046409 | 3300046476 | Bacteria | 2098 |
| 1338 | Ga0495662_0076352 | 3300046476 | Bacteria | 1626 |
| 1339 | Ga0495662_0092732 | 3300046476 | Bacteria | 1473 |
| 1340 | Ga0495662_0151838 | 3300046476 | Bacteria | 1141 |
| 1341 | Ga0495662_0238744 | 3300046476 | Bacteria | 895 |
| 1342 | Ga0495662_0417372 | 3300046476 | Bacteria | 659 |
| 1343 | Ga0495664_0077133 | 3300046477 | Bacteria | 1995 |
| 1344 | Ga0495664_0127458 | 3300046477 | Bacteria | 1540 |
| 1345 | Ga0495664_0254220 | 3300046477 | Bacteria | 1062 |
| 1346 | Ga0495584_0032240 | 3300046491 | Bacteria | 2653 |
| 1347 | Ga0495584_0033821 | 3300046491 | Bacteria | 2586 |
| 1348 | Ga0495584_0059407 | 3300046491 | Bacteria | 1923 |
| 1349 | Ga0495584_0169127 | 3300046491 | Bacteria | 1111 |
| 1350 | Ga0495584_0386770 | 3300046491 | Bacteria | 711 |
| 1351 | Ga0495585_0060776 | 3300046492 | Bacteria | 2079 |
| 1352 | Ga0495585_0068173 | 3300046492 | Bacteria | 1944 |
| 1353 | Ga0495585_0079974 | 3300046492 | Bacteria | 1772 |
| 1354 | Ga0495585_0093234 | 3300046492 | Bacteria | 1619 |
| 1355 | Ga0495585_0153374 | 3300046492 | Bacteria | 1200 |
| 1356 | Ga0495594_0117169 | 3300046499 | Bacteria | 1504 |
| 1357 | Ga0495594_0202441 | 3300046499 | Bacteria | 1131 |
| 1358 | Ga0495594_0293299 | 3300046499 | Bacteria | 927 |
| 1359 | Ga0495594_0354465 | 3300046499 | Bacteria | 835 |
| 1360 | Ga0495594_0374714 | 3300046499 | Bacteria | 810 |
| 1361 | Ga0495594_0544935 | 3300046499 | Bacteria | 658 |
| 1362 | Ga0495594_0673723 | 3300046499 | Bacteria | 585 |
| 1363 | Ga0495594_0781265 | 3300046499 | Bacteria | 538 |
| 1364 | Ga0495596_0022489 | 3300046500 | Bacteria | 2566 |
| 1365 | Ga0495596_0041204 | 3300046500 | Bacteria | 1821 |
| 1366 | Ga0495596_0056584 | 3300046500 | Bacteria | 1531 |
| 1367 | Ga0495596_0168659 | 3300046500 | Bacteria | 851 |
| 1368 | Ga0495596_0421846 | 3300046500 | Bacteria | 520 |
| 1369 | Ga0495607_0044200 | 3300046501 | Bacteria | 2627 |
| 1370 | Ga0495607_0063211 | 3300046501 | Bacteria | 2095 |
| 1371 | Ga0495607_0191272 | 3300046501 | Bacteria | 1019 |
| 1372 | Ga0495607_0209316 | 3300046501 | Bacteria | 960 |
| 1373 | Ga0495607_0458032 | 3300046501 | Bacteria | 571 |
| 1374 | Ga0495583_0031533 | 3300046506 | Bacteria | 2568 |
| 1375 | Ga0495583_0237173 | 3300046506 | Bacteria | 734 |
| 1376 | Ga0495583_0293689 | 3300046506 | Bacteria | 646 |
| 1377 | Ga0495606_0051477 | 3300046507 | Bacteria | 2685 |
| 1378 | Ga0495608_0063326 | 3300046511 | Bacteria | 2427 |
| 1379 | Ga0495608_0066556 | 3300046511 | Bacteria | 2358 |
| 1380 | Ga0495608_0084137 | 3300046511 | Bacteria | 2064 |
| 1381 | Ga0495608_0089109 | 3300046511 | Bacteria | 1997 |
| 1382 | Ga0495608_0264381 | 3300046511 | Bacteria | 1070 |
| 1383 | Ga0495608_0315023 | 3300046511 | Bacteria | 967 |
| 1384 | Ga0495608_0346439 | 3300046511 | Bacteria | 915 |
| 1385 | Ga0495608_0361855 | 3300046511 | Bacteria | 891 |
| 1386 | Ga0495610_0085229 | 3300046512 | Bacteria | 1442 |
| 1387 | Ga0495616_0035314 | 3300046513 | Bacteria | 2588 |
| 1388 | Ga0495616_0171757 | 3300046513 | Bacteria | 969 |
| 1389 | Ga0495616_0339392 | 3300046513 | Bacteria | 627 |
| 1390 | Ga0495618_0030788 | 3300046514 | Bacteria | 3353 |
| 1391 | Ga0495618_0045946 | 3300046514 | Bacteria | 2755 |
| 1392 | Ga0495618_0239771 | 3300046514 | Bacteria | 1140 |
| 1393 | Ga0495618_0300502 | 3300046514 | Bacteria | 997 |
| 1394 | Ga0495620_0027304 | 3300046515 | Bacteria | 2672 |
| 1395 | Ga0495620_0140753 | 3300046515 | Bacteria | 943 |
| 1396 | Ga0495620_0418237 | 3300046515 | Bacteria | 507 |
| 1397 | Ga0495628_0064743 | 3300046516 | Bacteria | 2861 |
| 1398 | Ga0495628_0071936 | 3300046516 | Bacteria | 2695 |
| 1399 | Ga0495628_0073219 | 3300046516 | Bacteria | 2669 |
| 1400 | Ga0495628_0077027 | 3300046516 | Bacteria | 2594 |
| 1401 | Ga0495628_0147428 | 3300046516 | Bacteria | 1793 |
| 1402 | Ga0495628_0340875 | 3300046516 | Bacteria | 1103 |
| 1403 | Ga0495628_0343117 | 3300046516 | Bacteria | 1099 |
| 1404 | Ga0495628_0769235 | 3300046516 | Bacteria | 676 |
| 1405 | Ga0495630_0067618 | 3300046517 | Bacteria | 2686 |
| 1406 | Ga0495630_0083785 | 3300046517 | Bacteria | 2407 |
| 1407 | Ga0495630_0099150 | 3300046517 | Bacteria | 2204 |
| 1408 | Ga0495630_0124283 | 3300046517 | Bacteria | 1958 |
| 1409 | Ga0495630_0126766 | 3300046517 | Bacteria | 1937 |
| 1410 | Ga0495630_0394297 | 3300046517 | Bacteria | 1060 |
| 1411 | Ga0495630_0447945 | 3300046517 | Bacteria | 989 |
| 1412 | Ga0495630_0608549 | 3300046517 | Bacteria | 837 |
| 1413 | Ga0495631_0021185 | 3300046518 | Bacteria | 3028 |
| 1414 | Ga0495631_0021998 | 3300046518 | Bacteria | 2966 |
| 1415 | Ga0495631_0038774 | 3300046518 | Bacteria | 2117 |
| 1416 | Ga0495631_0097429 | 3300046518 | Bacteria | 1266 |
| 1417 | Ga0495631_0270570 | 3300046518 | Bacteria | 724 |
| 1418 | Ga0495632_0042906 | 3300046519 | Bacteria | 2264 |
| 1419 | Ga0495632_0140395 | 3300046519 | Bacteria | 1121 |
| 1420 | Ga0495632_0396750 | 3300046519 | Bacteria | 603 |
| 1421 | Ga0495632_0397598 | 3300046519 | Bacteria | 602 |
| 1422 | Ga0495637_0068306 | 3300046520 | Bacteria | 1440 |
| 1423 | Ga0495637_0140547 | 3300046520 | Bacteria | 916 |
| 1424 | Ga0495637_0180979 | 3300046520 | Bacteria | 781 |
| 1425 | Ga0495643_0043886 | 3300046522 | Bacteria | 2430 |
| 1426 | Ga0495643_0159367 | 3300046522 | Bacteria | 1111 |
| 1427 | Ga0495643_0166248 | 3300046522 | Bacteria | 1081 |
| 1428 | Ga0495643_0310259 | 3300046522 | Bacteria | 716 |
| 1429 | Ga0495644_0015161 | 3300046523 | Bacteria | 2952 |
| 1430 | Ga0495644_0058722 | 3300046523 | Bacteria | 1446 |
| 1431 | Ga0495644_0081101 | 3300046523 | Bacteria | 1223 |
| 1432 | Ga0495644_0204042 | 3300046523 | Bacteria | 762 |
| 1433 | Ga0495648_0035636 | 3300046524 | Bacteria | 3223 |
| 1434 | Ga0495648_0213465 | 3300046524 | Bacteria | 957 |
| 1435 | Ga0495663_0006259 | 3300046525 | Bacteria | 3286 |
| 1436 | Ga0495663_0024013 | 3300046525 | Bacteria | 1770 |
| 1437 | Ga0495663_0088554 | 3300046525 | Bacteria | 1006 |
| 1438 | Ga0495666_0049718 | 3300046526 | Bacteria | 2017 |
| 1439 | Ga0495666_0055281 | 3300046526 | Bacteria | 1902 |
| 1440 | Ga0495666_0065508 | 3300046526 | Bacteria | 1732 |
| 1441 | Ga0495666_0107399 | 3300046526 | Bacteria | 1312 |
| 1442 | Ga0495642_0053027 | 3300046528 | Bacteria | 1670 |
| 1443 | Ga0495652_0045362 | 3300046529 | Bacteria | 3779 |
| 1444 | Ga0495652_0084339 | 3300046529 | Bacteria | 2613 |
| 1445 | Ga0495652_0097164 | 3300046529 | Bacteria | 2396 |
| 1446 | Ga0495652_0148276 | 3300046529 | Bacteria | 1836 |
| 1447 | Ga0495652_0163337 | 3300046529 | Bacteria | 1726 |
| 1448 | Ga0495652_0176844 | 3300046529 | Bacteria | 1642 |
| 1449 | Ga0495652_0316794 | 3300046529 | Bacteria | 1128 |
| 1450 | Ga0495652_0467017 | 3300046529 | Bacteria | 880 |
| 1451 | Ga0495654_0027733 | 3300046530 | Bacteria | 2899 |
| 1452 | Ga0495654_0164710 | 3300046530 | Bacteria | 971 |
| 1453 | Ga0495665_0034337 | 3300046531 | Bacteria | 2712 |
| 1454 | Ga0495665_0124543 | 3300046531 | Bacteria | 1349 |
| 1455 | Ga0495665_0485708 | 3300046531 | Bacteria | 623 |
| 1456 | Ga0495640_0026054 | 3300046533 | Bacteria | 4232 |
| 1457 | Ga0495640_0044793 | 3300046533 | Bacteria | 3074 |
| 1458 | Ga0495640_0056221 | 3300046533 | Bacteria | 2688 |
| 1459 | Ga0495640_0222683 | 3300046533 | Bacteria | 1189 |
| 1460 | Ga0495640_0357585 | 3300046533 | Bacteria | 900 |
| 1461 | Ga0495640_0560534 | 3300046533 | Bacteria | 692 |
| 1462 | Ga0495640_0660720 | 3300046533 | Bacteria | 628 |
| 1463 | Ga0495586_0015600 | 3300046535 | Bacteria | 4042 |
| 1464 | Ga0495586_0048376 | 3300046535 | Bacteria | 2297 |
| 1465 | Ga0495586_0170467 | 3300046535 | Bacteria | 1230 |
| 1466 | Ga0495587_0039574 | 3300046536 | Bacteria | 2820 |
| 1467 | Ga0495587_0043246 | 3300046536 | Bacteria | 2683 |
| 1468 | Ga0495587_0048454 | 3300046536 | Bacteria | 2516 |
| 1469 | Ga0495587_0069942 | 3300046536 | Bacteria | 2043 |
| 1470 | Ga0495587_0449867 | 3300046536 | Bacteria | 714 |
| 1471 | Ga0495598_0011363 | 3300046537 | Bacteria | 2157 |
| 1472 | Ga0495598_0091536 | 3300046537 | Bacteria | 992 |
| 1473 | Ga0495609_0010002 | 3300046538 | Bacteria | 4567 |
| 1474 | Ga0495609_0240184 | 3300046538 | Bacteria | 748 |
| 1475 | Ga0495609_0308001 | 3300046538 | Bacteria | 644 |
| 1476 | Ga0495609_0374734 | 3300046538 | Bacteria | 572 |
| 1477 | Ga0495621_0133315 | 3300046539 | Bacteria | 968 |
| 1478 | Ga0495621_0192741 | 3300046539 | Bacteria | 817 |
| 1479 | Ga0495621_0237032 | 3300046539 | Bacteria | 742 |
| 1480 | Ga0495597_0019065 | 3300046542 | Bacteria | 3213 |
| 1481 | Ga0495597_0155503 | 3300046542 | Bacteria | 936 |
| 1482 | Ga0495645_0078325 | 3300046543 | Bacteria | 2375 |
| 1483 | Ga0495645_0122032 | 3300046543 | Bacteria | 1833 |
| 1484 | Ga0495645_0129608 | 3300046543 | Bacteria | 1769 |
| 1485 | Ga0495645_0215278 | 3300046543 | Bacteria | 1295 |
| 1486 | Ga0495645_0262614 | 3300046543 | Bacteria | 1142 |
| 1487 | Ga0495645_0778157 | 3300046543 | Bacteria | 576 |
| 1488 | Ga0495622_0112229 | 3300046557 | Bacteria | 1248 |
| 1489 | Ga0495622_0197118 | 3300046557 | Bacteria | 898 |
| 1490 | Ga0495622_0407221 | 3300046557 | Bacteria | 585 |
| 1491 | Ga0495633_0105180 | 3300046558 | Bacteria | 1309 |
| 1492 | Ga0495633_0156527 | 3300046558 | Bacteria | 1051 |
| 1493 | Ga0495633_0202617 | 3300046558 | Bacteria | 910 |
| 1494 | Ga0495667_0060445 | 3300046559 | Bacteria | 2485 |
| 1495 | Ga0495667_0078636 | 3300046559 | Bacteria | 2144 |
| 1496 | Ga0495667_0193854 | 3300046559 | Bacteria | 1301 |
| 1497 | Ga0495667_0216710 | 3300046559 | Bacteria | 1222 |
| 1498 | Ga0495667_0292083 | 3300046559 | Bacteria | 1033 |
| 1499 | Ga0495667_0441970 | 3300046559 | Bacteria | 817 |
| 1500 | Ga0495667_0507152 | 3300046559 | Bacteria | 755 |
| 1501 | Ga0495656_0017487 | 3300046615 | Bacteria | 2737 |
| 1502 | Ga0495656_0031010 | 3300046615 | Bacteria | 2165 |
| 1503 | Ga0495656_0088110 | 3300046615 | Bacteria | 1414 |
| 1504 | Ga0495656_0091682 | 3300046615 | Bacteria | 1390 |
| 1505 | Ga0495656_0102017 | 3300046615 | Bacteria | 1328 |
| 1506 | Ga0495656_0106442 | 3300046615 | Bacteria | 1305 |
| 1507 | Ga0495656_0242791 | 3300046615 | Bacteria | 907 |
| 1508 | Ga0495668_0035060 | 3300046616 | Bacteria | 2812 |
| 1509 | Ga0495668_0049863 | 3300046616 | Bacteria | 2321 |
| 1510 | Ga0495668_0053952 | 3300046616 | Bacteria | 2222 |
| 1511 | Ga0495668_0207318 | 3300046616 | Bacteria | 1073 |
| 1512 | Ga0495668_0291816 | 3300046616 | Bacteria | 894 |
| 1513 | Ga0495668_0440815 | 3300046616 | Bacteria | 716 |
| 1514 | Ga0495634_0054370 | 3300046642 | Bacteria | 2680 |
| 1515 | Ga0495634_0057052 | 3300046642 | Bacteria | 2607 |
| 1516 | Ga0495634_0173727 | 3300046642 | Bacteria | 1353 |
| 1517 | Ga0495634_0493158 | 3300046642 | Bacteria | 719 |
| 1518 | Ga0495634_0524633 | 3300046642 | Bacteria | 692 |
| 1519 | Ga0495634_0619093 | 3300046642 | Bacteria | 627 |
| 1520 | Ga0495611_0022373 | 3300046648 | Bacteria | 2735 |
| 1521 | Ga0495611_0053042 | 3300046648 | Bacteria | 1830 |
| 1522 | Ga0495611_0071167 | 3300046648 | Bacteria | 1590 |
| 1523 | Ga0495611_0085756 | 3300046648 | Bacteria | 1452 |
| 1524 | Ga0495611_0104001 | 3300046648 | Bacteria | 1320 |
| 1525 | Ga0495611_0134367 | 3300046648 | Bacteria | 1154 |
| 1526 | Ga0495625_0044700 | 3300046660 | Bacteria | 3205 |
| 1527 | Ga0495625_0063282 | 3300046660 | Bacteria | 2612 |
| 1528 | Ga0495625_0259517 | 3300046660 | Bacteria | 1125 |
| 1529 | Ga0495625_0345969 | 3300046660 | Bacteria | 941 |
| 1530 | Ga0495635_0046621 | 3300046663 | Bacteria | 2989 |
| 1531 | Ga0495635_0068736 | 3300046663 | Bacteria | 2429 |
| 1532 | Ga0495635_0139156 | 3300046663 | Bacteria | 1654 |
| 1533 | Ga0495635_0206223 | 3300046663 | Bacteria | 1332 |
| 1534 | Ga0495635_0210582 | 3300046663 | Bacteria | 1316 |
| 1535 | Ga0495635_0241895 | 3300046663 | Bacteria | 1217 |
| 1536 | Ga0495635_0308540 | 3300046663 | Bacteria | 1060 |
| 1537 | Ga0495659_0032186 | 3300046664 | Bacteria | 1834 |
| 1538 | Ga0495659_0068228 | 3300046664 | Bacteria | 1328 |
| 1539 | Ga0495659_0095983 | 3300046664 | Bacteria | 1143 |
| 1540 | Ga0495661_0090647 | 3300046665 | Bacteria | 1739 |
| 1541 | Ga0495661_0136596 | 3300046665 | Bacteria | 1338 |
| 1542 | Ga0495661_0170788 | 3300046665 | Bacteria | 1160 |
| 1543 | Ga0495661_0378962 | 3300046665 | Bacteria | 691 |
| 1544 | Ga0495588_0162852 | 3300046674 | Bacteria | 1179 |
| 1545 | Ga0495588_0201426 | 3300046674 | Bacteria | 1051 |
| 1546 | Ga0495588_0209609 | 3300046674 | Bacteria | 1029 |
| 1547 | Ga0495588_0213189 | 3300046674 | Bacteria | 1019 |
| 1548 | Ga0495588_0588948 | 3300046674 | Bacteria | 583 |
| 1549 | Ga0495657_0047293 | 3300046675 | Bacteria | 2909 |
| 1550 | Ga0495657_0063438 | 3300046675 | Bacteria | 2437 |
| 1551 | Ga0495657_0390353 | 3300046675 | Bacteria | 820 |
| 1552 | Ga0495657_0718762 | 3300046675 | Bacteria | 573 |
| 1553 | Ga0495599_0020141 | 3300046678 | Bacteria | 4155 |
| 1554 | Ga0495599_0049373 | 3300046678 | Bacteria | 2637 |
| 1555 | Ga0495599_0107415 | 3300046678 | Bacteria | 1739 |
| 1556 | Ga0495599_0146384 | 3300046678 | Bacteria | 1464 |
| 1557 | Ga0495623_0039816 | 3300046679 | Bacteria | 3002 |
| 1558 | Ga0495623_0097935 | 3300046679 | Bacteria | 1791 |
| 1559 | Ga0495623_0115130 | 3300046679 | Bacteria | 1625 |
| 1560 | Ga0495646_0046026 | 3300046680 | Bacteria | 2662 |
| 1561 | Ga0495646_0052986 | 3300046680 | Bacteria | 2448 |
| 1562 | Ga0495646_0161201 | 3300046680 | Bacteria | 1241 |
| 1563 | Ga0495646_0301501 | 3300046680 | Bacteria | 847 |
| 1564 | Ga0495646_0657580 | 3300046680 | Bacteria | 529 |
| 1565 | Ga0495647_0124910 | 3300046681 | Bacteria | 1085 |
| 1566 | Ga0495647_0189260 | 3300046681 | Bacteria | 898 |
| 1567 | Ga0495658_0036107 | 3300046683 | Bacteria | 2724 |
| 1568 | Ga0495658_0058866 | 3300046683 | Bacteria | 2198 |
| 1569 | Ga0495658_0270609 | 3300046683 | Bacteria | 1071 |
| 1570 | Ga0495658_0296851 | 3300046683 | Bacteria | 1021 |
| 1571 | Ga0495669_0023253 | 3300046684 | Bacteria | 2696 |
| 1572 | Ga0495669_0078578 | 3300046684 | Bacteria | 1512 |
| 1573 | Ga0495669_0163317 | 3300046684 | Bacteria | 1057 |
| 1574 | Ga0495613_0092975 | 3300046689 | Bacteria | 2183 |
| 1575 | Ga0495613_0130557 | 3300046689 | Bacteria | 1799 |
| 1576 | Ga0495613_0190105 | 3300046689 | Bacteria | 1451 |
| 1577 | Ga0495613_0203450 | 3300046689 | Bacteria | 1395 |
| 1578 | Ga0495613_0528363 | 3300046689 | Bacteria | 792 |
| 1579 | Ga0495613_0946123 | 3300046689 | Bacteria | 556 |
| 1580 | Ga0495624_0074942 | 3300046690 | Bacteria | 2102 |
| 1581 | Ga0495624_0269087 | 3300046690 | Bacteria | 1029 |
| 1582 | Ga0495624_0307959 | 3300046690 | Bacteria | 954 |
| 1583 | Ga0495624_0357985 | 3300046690 | Bacteria | 877 |
| 1584 | Ga0495624_0434106 | 3300046690 | Bacteria | 787 |
| 1585 | Ga0495624_0594687 | 3300046690 | Bacteria | 659 |
| 1586 | Ga0495670_0102677 | 3300046691 | Bacteria | 1473 |
| 1587 | Ga0495670_0287468 | 3300046691 | Bacteria | 880 |
| 1588 | Ga0495670_0356454 | 3300046691 | Bacteria | 787 |
| 1589 | Ga0495671_0019113 | 3300046692 | Bacteria | 3625 |
| 1590 | Ga0495671_0049524 | 3300046692 | Bacteria | 2094 |
| 1591 | Ga0495649_0037041 | 3300046694 | Bacteria | 2678 |
| 1592 | Ga0495649_0113526 | 3300046694 | Bacteria | 1435 |
| 1593 | Ga0495589_0031511 | 3300046794 | Bacteria | 2668 |
| 1594 | Ga0495589_0054354 | 3300046794 | Bacteria | 1974 |
| 1595 | Ga0495589_0063925 | 3300046794 | Bacteria | 1805 |
| 1596 | Ga0495589_0157741 | 3300046794 | Bacteria | 1081 |
| 1597 | Ga0495589_0253341 | 3300046794 | Bacteria | 822 |
| 1598 | Ga0495600_0040708 | 3300046809 | Bacteria | 3027 |
| 1599 | Ga0495600_0048766 | 3300046809 | Bacteria | 2762 |
| 1600 | Ga0495600_0108977 | 3300046809 | Bacteria | 1803 |
| 1601 | Ga0495600_0147244 | 3300046809 | Bacteria | 1526 |
| 1602 | Ga0495600_0153516 | 3300046809 | Bacteria | 1490 |
| 1603 | Ga0495600_0290222 | 3300046809 | Bacteria | 1034 |
| 1604 | Ga0495600_0334437 | 3300046809 | Bacteria | 950 |
| 1605 | Ga0495660_0040912 | 3300046810 | Bacteria | 2567 |
| 1606 | Ga0495660_0373796 | 3300046810 | Bacteria | 629 |
| 1607 | Ga0495581_0044716 | 3300047315 | Bacteria | 2560 |
| 1608 | Ga0495581_0046483 | 3300047315 | Bacteria | 2508 |
| 1609 | Ga0495581_0150808 | 3300047315 | Bacteria | 1357 |
| 1610 | Ga0495581_0404522 | 3300047315 | Bacteria | 796 |
| 1611 | Ga0495581_0477351 | 3300047315 | Bacteria | 725 |
| 1612 | Ga0495604_0065677 | 3300047317 | Bacteria | 2761 |
| 1613 | Ga0495604_0082032 | 3300047317 | Bacteria | 2412 |
| 1614 | Ga0495604_0140151 | 3300047317 | Bacteria | 1728 |
| 1615 | Ga0495604_0156385 | 3300047317 | Bacteria | 1614 |
| 1616 | Ga0495604_0169557 | 3300047317 | Bacteria | 1536 |
| 1617 | Ga0495604_0304468 | 3300047317 | Bacteria | 1069 |
| 1618 | Ga0495604_0756387 | 3300047317 | Bacteria | 614 |
| 1619 | Ga0495636_0025240 | 3300047318 | Bacteria | 2412 |
| 1620 | Ga0495636_0075677 | 3300047318 | Bacteria | 1443 |
| 1621 | Ga0495636_0230194 | 3300047318 | Bacteria | 852 |
| 1622 | Ga0495674_0070814 | 3300047319 | Bacteria | 3012 |
| 1623 | Ga0495674_0082948 | 3300047319 | Bacteria | 2748 |
| 1624 | Ga0495674_0098331 | 3300047319 | Bacteria | 2492 |
| 1625 | Ga0495674_0107191 | 3300047319 | Bacteria | 2372 |
| 1626 | Ga0495674_0223786 | 3300047319 | Bacteria | 1555 |
| 1627 | Ga0495674_0271300 | 3300047319 | Bacteria | 1392 |
| 1628 | Ga0495674_0357593 | 3300047319 | Bacteria | 1184 |
| 1629 | Ga0495674_0636627 | 3300047319 | Bacteria | 842 |
| 1630 | Ga0495674_0686008 | 3300047319 | Bacteria | 805 |
| 1631 | Ga0495674_0845580 | 3300047319 | Bacteria | 709 |
| 1632 | Ga0495672_0020520 | 3300047320 | Bacteria | 4327 |
| 1633 | Ga0495676_0076229 | 3300047321 | Bacteria | 2561 |
| 1634 | Ga0495676_0320470 | 3300047321 | Bacteria | 1041 |
| 1635 | Ga0495676_0394196 | 3300047321 | Bacteria | 919 |
| 1636 | Ga0495676_0733148 | 3300047321 | Bacteria | 638 |
| 1637 | Ga0495676_0770011 | 3300047321 | Bacteria | 621 |
| 1638 | Ga0495680_0068759 | 3300047322 | Bacteria | 2704 |
| 1639 | Ga0495680_0084686 | 3300047322 | Bacteria | 2388 |
| 1640 | Ga0495680_0108851 | 3300047322 | Bacteria | 2056 |
| 1641 | Ga0495680_0110977 | 3300047322 | Bacteria | 2032 |
| 1642 | Ga0495680_0125317 | 3300047322 | Bacteria | 1893 |
| 1643 | Ga0495680_0271084 | 3300047322 | Bacteria | 1198 |
| 1644 | Ga0495683_0105953 | 3300047323 | Bacteria | 1347 |
| 1645 | Ga0495683_0151155 | 3300047323 | Bacteria | 1080 |
| 1646 | Ga0495683_0379029 | 3300047323 | Bacteria | 592 |
| 1647 | Ga0495687_035270 | 3300047443 | Bacteria | 2251 |
| 1648 | Ga0495687_209566 | 3300047443 | Bacteria | 612 |
| 1649 | Ga0495675_0030291 | 3300047444 | Bacteria | 3453 |
| 1650 | Ga0495675_0137113 | 3300047444 | Bacteria | 1518 |
| 1651 | Ga0495675_0190196 | 3300047444 | Bacteria | 1253 |
| 1652 | Ga0495675_0387461 | 3300047444 | Bacteria | 816 |
| 1653 | Ga0495677_0030661 | 3300047445 | Bacteria | 1957 |
| 1654 | Ga0495677_0074035 | 3300047445 | Bacteria | 1271 |
| 1655 | Ga0495677_0086230 | 3300047445 | Bacteria | 1180 |
| 1656 | Ga0495677_0090202 | 3300047445 | Bacteria | 1154 |
| 1657 | Ga0495677_0349795 | 3300047445 | Bacteria | 583 |
| 1658 | Ga0495679_016898 | 3300047446 | Bacteria | 2626 |
| 1659 | Ga0495679_123362 | 3300047446 | Bacteria | 707 |
| 1660 | Ga0495685_016847 | 3300047447 | Bacteria | 2497 |
| 1661 | Ga0495685_040740 | 3300047447 | Bacteria | 1588 |
| 1662 | Ga0495685_083333 | 3300047447 | Bacteria | 1064 |
| 1663 | Ga0495673_0014867 | 3300047469 | Bacteria | 4031 |
| 1664 | Ga0495673_0143002 | 3300047469 | Bacteria | 931 |
| 1665 | Ga0495673_0233448 | 3300047469 | Bacteria | 677 |
| 1666 | Ga0495681_0120447 | 3300047470 | Bacteria | 1126 |
| 1667 | Ga0495681_0141787 | 3300047470 | Bacteria | 1014 |
| 1668 | Ga0495681_0146476 | 3300047470 | Bacteria | 994 |
| 1669 | Ga0495684_0063483 | 3300047471 | Bacteria | 2807 |
| 1670 | Ga0495684_0190957 | 3300047471 | Bacteria | 1514 |
| 1671 | Ga0495684_0403312 | 3300047471 | Bacteria | 959 |
| 1672 | Ga0495684_0410765 | 3300047471 | Bacteria | 948 |
| 1673 | Ga0495686_0019899 | 3300047472 | Bacteria | 4480 |
| 1674 | Ga0495686_0036615 | 3300047472 | Bacteria | 3149 |
| 1675 | Ga0495686_0372477 | 3300047472 | Bacteria | 772 |
| 1676 | Ga0495593_0026520 | 3300047673 | Bacteria | 3198 |
| 1677 | Ga0495593_0029374 | 3300047673 | Bacteria | 3014 |
| 1678 | Ga0495593_0076571 | 3300047673 | Bacteria | 1734 |
| 1679 | Ga0495593_0546373 | 3300047673 | Bacteria | 581 |
| 1680 | Ga0495602_0073723 | 3300048088 | Bacteria | 2904 |
| 1681 | Ga0495602_0087738 | 3300048088 | Bacteria | 2592 |
| 1682 | Ga0495602_0087779 | 3300048088 | Bacteria | 2591 |
| 1683 | Ga0495602_0094258 | 3300048088 | Bacteria | 2474 |
| 1684 | Ga0495602_0104315 | 3300048088 | Bacteria | 2320 |
| 1685 | Ga0495602_0133355 | 3300048088 | Bacteria | 1977 |
| 1686 | Ga0495602_0262546 | 3300048088 | Bacteria | 1280 |
| 1687 | Ga0495602_0463231 | 3300048088 | Bacteria | 892 |
| 1688 | Ga0495602_0608660 | 3300048088 | Bacteria | 750 |
| 1689 | Ga0495614_0021101 | 3300048089 | Bacteria | 2815 |
| 1690 | Ga0495614_0069460 | 3300048089 | Bacteria | 1517 |
| 1691 | Ga0495614_0167900 | 3300048089 | Bacteria | 984 |
| 1692 | Ga0495615_0005371 | 3300048090 | Bacteria | 2300 |
| 1693 | Ga0495626_0078934 | 3300048091 | Bacteria | 1465 |
| 1694 | Ga0495626_0082699 | 3300048091 | Bacteria | 1423 |
| 1695 | Ga0495626_0125730 | 3300048091 | Bacteria | 1099 |
| 1696 | Ga0496100_0028776 | 3300048903 | Bacteria | 3430 |
| 1697 | Ga0496100_0031597 | 3300048903 | Bacteria | 3293 |
| 1698 | Ga0496100_0159178 | 3300048903 | Bacteria | 1617 |
| 1699 | Ga0496100_0173868 | 3300048903 | Bacteria | 1553 |
| 1700 | Ga0496100_0250894 | 3300048903 | Bacteria | 1309 |
| 1701 | Ga0496100_0395550 | 3300048903 | Bacteria | 1051 |
| 1702 | Ga0496100_0574853 | 3300048903 | Bacteria | 873 |
| 1703 | Ga0496100_0706214 | 3300048903 | Bacteria | 787 |
| 1704 | Ga0496100_0708531 | 3300048903 | Bacteria | 786 |
| 1705 | Ga0496100_0741270 | 3300048903 | Bacteria | 768 |
| 1706 | Ga0496100_0879341 | 3300048903 | Bacteria | 703 |
| 1707 | Ga0496101_0033751 | 3300048904 | Bacteria | 3611 |
| 1708 | Ga0496101_0035887 | 3300048904 | Bacteria | 3508 |
| 1709 | Ga0496101_0038247 | 3300048904 | Bacteria | 3407 |
| 1710 | Ga0496101_0044644 | 3300048904 | Bacteria | 3171 |
| 1711 | Ga0496101_0115824 | 3300048904 | Bacteria | 2022 |
| 1712 | Ga0496101_0175211 | 3300048904 | Bacteria | 1649 |
| 1713 | Ga0496101_0209661 | 3300048904 | Bacteria | 1509 |
| 1714 | Ga0496101_0241630 | 3300048904 | Bacteria | 1405 |
| 1715 | Ga0496101_0280317 | 3300048904 | Bacteria | 1303 |
| 1716 | Ga0496101_0283747 | 3300048904 | Bacteria | 1295 |
| 1717 | Ga0496101_0460772 | 3300048904 | Bacteria | 1003 |
| 1718 | Ga0496102_0049876 | 3300048905 | Bacteria | 3809 |
| 1719 | Ga0496102_0066054 | 3300048905 | Bacteria | 3315 |
| 1720 | Ga0496102_0070976 | 3300048905 | Bacteria | 3198 |
| 1721 | Ga0496102_0092734 | 3300048905 | Bacteria | 2797 |
| 1722 | Ga0496102_0122950 | 3300048905 | Bacteria | 2425 |
| 1723 | Ga0496102_0200069 | 3300048905 | Bacteria | 1883 |
| 1724 | Ga0496102_0206161 | 3300048905 | Bacteria | 1853 |
| 1725 | Ga0496102_0244581 | 3300048905 | Bacteria | 1692 |
| 1726 | Ga0496102_0853763 | 3300048905 | Bacteria | 832 |
| 1727 | Ga0496102_1095028 | 3300048905 | Bacteria | 716 |
| 1728 | Ga0496102_1833519 | 3300048905 | Bacteria | 523 |
| 1729 | Ga0496103_0002742 | 3300048906 | Bacteria | 10994 |
| 1730 | Ga0496103_0014996 | 3300048906 | Bacteria | 4607 |
| 1731 | Ga0496103_0040276 | 3300048906 | Bacteria | 2871 |
| 1732 | Ga0496103_0071615 | 3300048906 | Bacteria | 2170 |
| 1733 | Ga0496103_0284373 | 3300048906 | Bacteria | 1064 |
| 1734 | Ga0496103_0445742 | 3300048906 | Bacteria | 830 |
| 1735 | Ga0496103_0494078 | 3300048906 | Bacteria | 783 |
| 1736 | Ga0496103_0717327 | 3300048906 | Bacteria | 633 |
| 1737 | Ga0496104_0045734 | 3300048907 | Bacteria | 4118 |
| 1738 | Ga0496104_0059400 | 3300048907 | Bacteria | 3620 |
| 1739 | Ga0496104_0104024 | 3300048907 | Bacteria | 2720 |
| 1740 | Ga0496104_0108983 | 3300048907 | Bacteria | 2654 |
| 1741 | Ga0496104_0111917 | 3300048907 | Bacteria | 2618 |
| 1742 | Ga0496104_0113312 | 3300048907 | Bacteria | 2600 |
| 1743 | Ga0496104_0430973 | 3300048907 | Bacteria | 1230 |
| 1744 | Ga0496104_0466879 | 3300048907 | Bacteria | 1174 |
| 1745 | Ga0496104_0588308 | 3300048907 | Bacteria | 1023 |
| 1746 | Ga0496104_0847309 | 3300048907 | Bacteria | 819 |
| 1747 | Ga0496104_0862176 | 3300048907 | Bacteria | 811 |
| 1748 | Ga0496105_0046657 | 3300048908 | Bacteria | 3575 |
| 1749 | Ga0496105_0107197 | 3300048908 | Bacteria | 2306 |
| 1750 | Ga0496105_0193747 | 3300048908 | Bacteria | 1661 |
| 1751 | Ga0496105_0282763 | 3300048908 | Bacteria | 1337 |
| 1752 | Ga0496105_0307149 | 3300048908 | Bacteria | 1274 |
| 1753 | Ga0496105_0803009 | 3300048908 | Bacteria | 715 |
| 1754 | Ga0496105_1026656 | 3300048908 | Bacteria | 615 |
| 1755 | Ga0496106_0033983 | 3300048909 | Bacteria | 3807 |
| 1756 | Ga0496106_0041823 | 3300048909 | Bacteria | 3435 |
| 1757 | Ga0496106_0047349 | 3300048909 | Bacteria | 3235 |
| 1758 | Ga0496106_0063367 | 3300048909 | Bacteria | 2809 |
| 1759 | Ga0496106_0078768 | 3300048909 | Bacteria | 2529 |
| 1760 | Ga0496106_0140505 | 3300048909 | Bacteria | 1899 |
| 1761 | Ga0496106_0258857 | 3300048909 | Bacteria | 1392 |
| 1762 | Ga0496106_0303710 | 3300048909 | Bacteria | 1280 |
| 1763 | Ga0496106_0489559 | 3300048909 | Bacteria | 988 |
| 1764 | Ga0496106_0530453 | 3300048909 | Bacteria | 945 |
| 1765 | Ga0496106_0583970 | 3300048909 | Bacteria | 895 |
| 1766 | Ga0496106_0620293 | 3300048909 | Bacteria | 865 |
| 1767 | Ga0496106_0714773 | 3300048909 | Bacteria | 798 |
| 1768 | Ga0496107_0038488 | 3300048910 | Bacteria | 3430 |
| 1769 | Ga0496107_0041834 | 3300048910 | Bacteria | 3291 |
| 1770 | Ga0496107_0046145 | 3300048910 | Bacteria | 3135 |
| 1771 | Ga0496107_0046304 | 3300048910 | Bacteria | 3130 |
| 1772 | Ga0496107_0050391 | 3300048910 | Bacteria | 3001 |
| 1773 | Ga0496107_0097275 | 3300048910 | Bacteria | 2155 |
| 1774 | Ga0496107_0165038 | 3300048910 | Bacteria | 1642 |
| 1775 | Ga0496107_0258697 | 3300048910 | Bacteria | 1295 |
| 1776 | Ga0496107_0260074 | 3300048910 | Bacteria | 1291 |
| 1777 | Ga0496107_0414938 | 3300048910 | Bacteria | 1001 |
| 1778 | Ga0496108_0049607 | 3300048911 | Bacteria | 3511 |
| 1779 | Ga0496108_0056182 | 3300048911 | Bacteria | 3306 |
| 1780 | Ga0496108_0057291 | 3300048911 | Bacteria | 3274 |
| 1781 | Ga0496108_0065118 | 3300048911 | Bacteria | 3072 |
| 1782 | Ga0496108_0104141 | 3300048911 | Bacteria | 2422 |
| 1783 | Ga0496108_0132378 | 3300048911 | Bacteria | 2143 |
| 1784 | Ga0496108_0233812 | 3300048911 | Bacteria | 1598 |
| 1785 | Ga0496108_0289327 | 3300048911 | Bacteria | 1426 |
| 1786 | Ga0496108_1449746 | 3300048911 | Bacteria | 573 |
| 1787 | Ga0496108_1794362 | 3300048911 | Bacteria | 502 |
| 1788 | Ga0496109_0064560 | 3300048912 | Bacteria | 3350 |
| 1789 | Ga0496109_0071023 | 3300048912 | Bacteria | 3195 |
| 1790 | Ga0496109_0099071 | 3300048912 | Bacteria | 2703 |
| 1791 | Ga0496109_0125562 | 3300048912 | Bacteria | 2392 |
| 1792 | Ga0496109_0161194 | 3300048912 | Bacteria | 2101 |
| 1793 | Ga0496109_0277168 | 3300048912 | Bacteria | 1580 |
| 1794 | Ga0496109_0312563 | 3300048912 | Bacteria | 1482 |
| 1795 | Ga0496109_0646531 | 3300048912 | Bacteria | 994 |
| 1796 | Ga0496109_0771174 | 3300048912 | Bacteria | 900 |
| 1797 | Ga0496109_1722258 | 3300048912 | Bacteria | 560 |
| 1798 | Ga0496110_0029621 | 3300048913 | Bacteria | 4713 |
| 1799 | Ga0496110_0054071 | 3300048913 | Bacteria | 3531 |
| 1800 | Ga0496110_0066313 | 3300048913 | Bacteria | 3192 |
| 1801 | Ga0496110_0190197 | 3300048913 | Bacteria | 1864 |
| 1802 | Ga0496110_0317333 | 3300048913 | Bacteria | 1419 |
| 1803 | Ga0496110_0333749 | 3300048913 | Bacteria | 1381 |
| 1804 | Ga0496110_0393917 | 3300048913 | Bacteria | 1263 |
| 1805 | Ga0496110_0573283 | 3300048913 | Bacteria | 1025 |
| 1806 | Ga0496111_0043157 | 3300048914 | Bacteria | 3240 |
| 1807 | Ga0496111_0102061 | 3300048914 | Bacteria | 2108 |
| 1808 | Ga0496112_0080792 | 3300048915 | Bacteria | 3215 |
| 1809 | Ga0496112_0088190 | 3300048915 | Bacteria | 3070 |
| 1810 | Ga0496112_0157687 | 3300048915 | Bacteria | 2236 |
| 1811 | Ga0496112_0184317 | 3300048915 | Bacteria | 2051 |
| 1812 | Ga0496112_0213937 | 3300048915 | Bacteria | 1884 |
| 1813 | Ga0496112_0231503 | 3300048915 | Bacteria | 1802 |
| 1814 | Ga0496112_0277572 | 3300048915 | Bacteria | 1623 |
| 1815 | Ga0496112_0530485 | 3300048915 | Bacteria | 1111 |
| 1816 | Ga0496112_0896006 | 3300048915 | Bacteria | 809 |
| 1817 | Ga0496113_0079818 | 3300048916 | Bacteria | 2505 |
| 1818 | Ga0496113_0245033 | 3300048916 | Bacteria | 1430 |
| 1819 | Ga0496113_0261368 | 3300048916 | Bacteria | 1383 |
| 1820 | Ga0496113_0320469 | 3300048916 | Bacteria | 1242 |
| 1821 | Ga0496113_0389117 | 3300048916 | Bacteria | 1119 |
| 1822 | Ga0496113_0570480 | 3300048916 | Bacteria | 907 |
| 1823 | Ga0496113_0648512 | 3300048916 | Bacteria | 844 |
| 1824 | Ga0496113_0758133 | 3300048916 | Bacteria | 772 |
| 1825 | Ga0496114_0048749 | 3300048917 | Bacteria | 3523 |
| 1826 | Ga0496114_0055981 | 3300048917 | Bacteria | 3289 |
| 1827 | Ga0496114_0179653 | 3300048917 | Bacteria | 1847 |
| 1828 | Ga0496114_0217838 | 3300048917 | Bacteria | 1675 |
| 1829 | Ga0496114_0377381 | 3300048917 | Bacteria | 1255 |
| 1830 | Ga0496114_0469736 | 3300048917 | Bacteria | 1113 |
| 1831 | Ga0496115_0048757 | 3300048918 | Bacteria | 3388 |
| 1832 | Ga0496115_0057562 | 3300048918 | Bacteria | 3126 |
| 1833 | Ga0496115_0094618 | 3300048918 | Bacteria | 2444 |
| 1834 | Ga0496115_0110092 | 3300048918 | Bacteria | 2262 |
| 1835 | Ga0496115_0110839 | 3300048918 | Bacteria | 2254 |
| 1836 | Ga0496115_0185200 | 3300048918 | Bacteria | 1720 |
| 1837 | Ga0496115_0192847 | 3300048918 | Bacteria | 1683 |
| 1838 | Ga0496115_0382083 | 3300048918 | Bacteria | 1145 |
| 1839 | Ga0496115_0388745 | 3300048918 | Bacteria | 1133 |
| 1840 | Ga0496115_0629148 | 3300048918 | Bacteria | 850 |
| 1841 | Ga0496115_1102892 | 3300048918 | Bacteria | 601 |
| 1842 | Ga0496116_0010933 | 3300048919 | Bacteria | 7562 |
| 1843 | Ga0496117_0122713 | 3300048920 | Bacteria | 1592 |
| 1844 | Ga0496118_0148601 | 3300048921 | Bacteria | 1470 |
| 1845 | Ga0496119_0005832 | 3300048922 | Bacteria | 11641 |
| 1846 | Ga0496119_0010762 | 3300048922 | Bacteria | 7660 |
| 1847 | Ga0496119_0229257 | 3300048922 | Bacteria | 946 |
| 1848 | Ga0496120_0039244 | 3300048923 | Bacteria | 2795 |
| 1849 | Ga0496121_0017696 | 3300048924 | Bacteria | 7255 |
| 1850 | Ga0496121_0027619 | 3300048924 | Bacteria | 5306 |
| 1851 | Ga0496121_0052148 | 3300048924 | Bacteria | 3439 |
| 1852 | Ga0496121_0069941 | 3300048924 | Bacteria | 2829 |
| 1853 | Ga0496121_0102368 | 3300048924 | Bacteria | 2206 |
| 1854 | Ga0496122_0012905 | 3300048925 | Bacteria | 8250 |
| 1855 | Ga0496123_0008115 | 3300048926 | Bacteria | 9706 |
| 1856 | Ga0496124_0030225 | 3300048927 | Bacteria | 4811 |
| 1857 | Ga0496124_0071552 | 3300048927 | Bacteria | 2874 |
| 1858 | Ga0496124_0366663 | 3300048927 | Bacteria | 1013 |
| 1859 | Ga0496124_0479647 | 3300048927 | Bacteria | 840 |
| 1860 | Ga0496125_0010509 | 3300048928 | Bacteria | 9361 |
| 1861 | Ga0496125_0121389 | 3300048928 | Bacteria | 1863 |
| 1862 | Ga0496125_0373516 | 3300048928 | Bacteria | 843 |
| 1863 | Ga0496125_0395821 | 3300048928 | Bacteria | 809 |
| 1864 | Ga0496126_0031342 | 3300048929 | Bacteria | 5025 |
| 1865 | Ga0496126_0077582 | 3300048929 | Bacteria | 2945 |
| 1866 | Ga0496126_0097672 | 3300048929 | Bacteria | 2574 |
| 1867 | Ga0496126_0114241 | 3300048929 | Bacteria | 2349 |
| 1868 | Ga0495678_026834 | 3300049459 | Bacteria | 2451 |
| 1869 | Ga0495678_084642 | 3300049459 | Bacteria | 1130 |
| 1870 | Ga0495682_0022664 | 3300049460 | Bacteria | 2348 |
| 1871 | Ga0495682_0088775 | 3300049460 | Bacteria | 1111 |
| 1872 | Ga0495682_0321537 | 3300049460 | Bacteria | 545 |
| 1873 | Ga0501031_0000121 | 3300049568 | Bacteria | 42902 |
| 1874 | Ga0501031_0030516 | 3300049568 | Bacteria | 3516 |
| 1875 | Ga0501031_0287115 | 3300049568 | Bacteria | 1067 |
| 1876 | Ga0501032_0000043 | 3300049569 | Bacteria | 111758 |
| 1877 | Ga0501032_0033638 | 3300049569 | Bacteria | 3511 |
| 1878 | Ga0501032_0050389 | 3300049569 | Bacteria | 2808 |
| 1879 | Ga0501032_0099664 | 3300049569 | Bacteria | 1925 |
| 1880 | Ga0501032_0401845 | 3300049569 | Bacteria | 880 |
| 1881 | Ga0501033_0000055 | 3300049570 | Bacteria | 107959 |
| 1882 | Ga0501033_0006672 | 3300049570 | Bacteria | 9021 |
| 1883 | Ga0501033_0040343 | 3300049570 | Bacteria | 3485 |
| 1884 | Ga0501033_0137128 | 3300049570 | Bacteria | 1770 |
| 1885 | Ga0501033_0176881 | 3300049570 | Bacteria | 1531 |
| 1886 | Ga0501033_0227836 | 3300049570 | Bacteria | 1325 |
| 1887 | Ga0501033_0446696 | 3300049570 | Bacteria | 898 |
| 1888 | Ga0501034_0000204 | 3300049571 | Bacteria | 112606 |
| 1889 | Ga0501034_0044814 | 3300049571 | Bacteria | 4471 |
| 1890 | Ga0501034_0076963 | 3300049571 | Bacteria | 3343 |
| 1891 | Ga0501034_0088512 | 3300049571 | Bacteria | 3095 |
| 1892 | Ga0501036_0000017 | 3300049572 | Bacteria | 125802 |
| 1893 | Ga0501036_0047731 | 3300049572 | Bacteria | 3625 |
| 1894 | Ga0501036_0454043 | 3300049572 | Bacteria | 1068 |
| 1895 | Ga0501036_1053662 | 3300049572 | Bacteria | 665 |
| 1896 | Ga0501037_0000056 | 3300049573 | Bacteria | 108436 |
| 1897 | Ga0501037_0043358 | 3300049573 | Bacteria | 3306 |
| 1898 | Ga0501037_0063378 | 3300049573 | Bacteria | 2695 |
| 1899 | Ga0501037_0242802 | 3300049573 | Bacteria | 1262 |
| 1900 | Ga0501037_0972564 | 3300049573 | Bacteria | 554 |
| 1901 | Ga0501038_0000035 | 3300049574 | Bacteria | 125802 |
| 1902 | Ga0501038_0061132 | 3300049574 | Bacteria | 3222 |
| 1903 | Ga0501038_0976580 | 3300049574 | Bacteria | 623 |
| 1904 | Ga0501039_0000039 | 3300049575 | Bacteria | 117306 |
| 1905 | Ga0501039_0016834 | 3300049575 | Bacteria | 5603 |
| 1906 | Ga0501039_0285457 | 3300049575 | Bacteria | 1297 |
| 1907 | Ga0501039_1368708 | 3300049575 | Bacteria | 545 |
| 1908 | Ga0501040_0079614 | 3300049576 | Bacteria | 2268 |
| 1909 | Ga0501040_0370785 | 3300049576 | Bacteria | 1027 |
| 1910 | Ga0501041_0416158 | 3300049577 | Bacteria | 852 |
| 1911 | Ga0501043_0050164 | 3300049579 | Bacteria | 3280 |
| 1912 | Ga0501043_0085061 | 3300049579 | Bacteria | 2485 |
| 1913 | Ga0501043_0202238 | 3300049579 | Bacteria | 1541 |
| 1914 | Ga0501043_0332785 | 3300049579 | Bacteria | 1156 |
| 1915 | Ga0501046_0104481 | 3300049580 | Bacteria | 2171 |
| 1916 | Ga0501046_0173954 | 3300049580 | Bacteria | 1614 |
| 1917 | Ga0501046_0563386 | 3300049580 | Bacteria | 811 |
| 1918 | Ga0501046_0876218 | 3300049580 | Bacteria | 627 |
| 1919 | Ga0501047_0055416 | 3300049581 | Bacteria | 3834 |
| 1920 | Ga0501047_0067633 | 3300049581 | Bacteria | 3442 |
| 1921 | Ga0501047_0096060 | 3300049581 | Bacteria | 2842 |
| 1922 | Ga0501047_0249367 | 3300049581 | Bacteria | 1624 |
| 1923 | Ga0501047_0426757 | 3300049581 | Bacteria | 1157 |
| 1924 | Ga0501048_0546056 | 3300049582 | Bacteria | 831 |
| 1925 | Ga0501048_0968523 | 3300049582 | Bacteria | 612 |
| 1926 | Ga0501067_0288868 | 3300049583 | Bacteria | 913 |
| 1927 | Ga0501068_0161890 | 3300049584 | Bacteria | 1410 |
| 1928 | Ga0501068_0467328 | 3300049584 | Bacteria | 817 |
| 1929 | Ga0501068_0622293 | 3300049584 | Bacteria | 704 |
| 1930 | Ga0501069_0008003 | 3300049585 | Bacteria | 5551 |
| 1931 | Ga0501069_0053938 | 3300049585 | Bacteria | 2239 |
| 1932 | Ga0501069_0521051 | 3300049585 | Bacteria | 710 |
| 1933 | Ga0501070_0040455 | 3300049586 | Bacteria | 3886 |
| 1934 | Ga0501070_0428230 | 3300049586 | Bacteria | 1068 |
| 1935 | Ga0501070_0452209 | 3300049586 | Bacteria | 1035 |
| 1936 | Ga0501070_0480594 | 3300049586 | Bacteria | 999 |
| 1937 | Ga0501070_1529106 | 3300049586 | Bacteria | 504 |
| 1938 | Ga0501071_0075148 | 3300049587 | Bacteria | 2466 |
| 1939 | Ga0501071_0479139 | 3300049587 | Bacteria | 954 |
| 1940 | Ga0501071_0567749 | 3300049587 | Bacteria | 872 |
| 1941 | Ga0501071_0953018 | 3300049587 | Bacteria | 662 |
| 1942 | Ga0501072_0096401 | 3300049588 | Bacteria | 2350 |
| 1943 | Ga0501072_0399882 | 3300049588 | Bacteria | 1090 |
| 1944 | Ga0501072_0614770 | 3300049588 | Bacteria | 856 |
| 1945 | Ga0501073_0128194 | 3300049589 | Bacteria | 1759 |
| 1946 | Ga0501074_0201422 | 3300049590 | Bacteria | 1419 |
| 1947 | Ga0501074_0687484 | 3300049590 | Bacteria | 722 |
| 1948 | Ga0501076_0096833 | 3300049592 | Bacteria | 2377 |
| 1949 | Ga0501076_0545433 | 3300049592 | Bacteria | 956 |
| 1950 | Ga0501077_0038870 | 3300049593 | Bacteria | 3030 |
| 1951 | Ga0501077_0050816 | 3300049593 | Bacteria | 2635 |
| 1952 | Ga0501077_0131435 | 3300049593 | Bacteria | 1587 |
| 1953 | Ga0501079_0040332 | 3300049741 | Bacteria | 3600 |
| 1954 | Ga0501079_0655722 | 3300049741 | Bacteria | 826 |
| 1955 | Ga0501079_1461604 | 3300049741 | Bacteria | 538 |
| 1956 | Ga0501079_1675325 | 3300049741 | Bacteria | 500 |
| 1957 | Ga0501080_0084195 | 3300049742 | Bacteria | 2955 |
| 1958 | Ga0501080_0124938 | 3300049742 | Bacteria | 2383 |
| 1959 | Ga0501080_0542401 | 3300049742 | Bacteria | 1036 |
| 1960 | Ga0501081_0144195 | 3300049743 | Bacteria | 1708 |
| 1961 | Ga0501081_0389630 | 3300049743 | Bacteria | 1030 |
| 1962 | Ga0501083_0391724 | 3300049744 | Bacteria | 904 |
| 1963 | Ga0501241_000822 | 3300049758 | Bacteria | 6596 |
| 1964 | Ga0501035_0000528 | 3300049822 | Bacteria | 42921 |
| 1965 | Ga0501035_0001874 | 3300049822 | Bacteria | 21176 |
| 1966 | Ga0501035_0012296 | 3300049822 | Bacteria | 7913 |
| 1967 | Ga0501044_0000097 | 3300049823 | Bacteria | 107976 |
| 1968 | Ga0501044_0064812 | 3300049823 | Bacteria | 3728 |
| 1969 | Ga0501044_0082577 | 3300049823 | Bacteria | 3251 |
| 1970 | Ga0501044_0085227 | 3300049823 | Bacteria | 3192 |
| 1971 | Ga0501044_0146076 | 3300049823 | Bacteria | 2350 |
| 1972 | Ga0501044_0232967 | 3300049823 | Bacteria | 1788 |
| 1973 | Ga0501044_0417781 | 3300049823 | Bacteria | 1252 |
| 1974 | Ga0501044_0575365 | 3300049823 | Bacteria | 1021 |
| 1975 | Ga0501045_0134009 | 3300049824 | Bacteria | 1842 |
| 1976 | Ga0501045_1164075 | 3300049824 | Bacteria | 563 |
| 1977 | Ga0501045_1270796 | 3300049824 | Bacteria | 536 |
| 1978 | nmdc:mga03n38_20962_c1 | 3300050490 | Bacteria | 2623 |
| 1979 | nmdc:mga03n38_60482_c1 | 3300050490 | Bacteria | 1722 |
| 1980 | nmdc:mga00v17_1091400_c1 | 3300050491 | Bacteria | 500 |
| 1981 | nmdc:mga00v17_576289_c1 | 3300050491 | Bacteria | 727 |
| 1982 | nmdc:mga00v17_59260_c1 | 3300050491 | Bacteria | 2348 |
| 1983 | nmdc:mga0yw44_238574_c1 | 3300050492 | Bacteria | 1208 |
| 1984 | nmdc:mga0yw44_77967_c1 | 3300050492 | Bacteria | 2071 |
| 1985 | nmdc:mga0k408_34398_c1 | 3300050493 | Bacteria | 2901 |
| 1986 | nmdc:mga06z11_11382_c2 | 3300050494 | Bacteria | 3344 |
| 1987 | nmdc:mga06z11_117535_c1 | 3300050494 | Bacteria | 1480 |
| 1988 | nmdc:mga06z11_119173_c1 | 3300050494 | Bacteria | 1471 |
| 1989 | nmdc:mga06z11_21192_c1 | 3300050494 | Bacteria | 3017 |
| 1990 | nmdc:mga06z11_385687_c1 | 3300050494 | Bacteria | 842 |
| 1991 | nmdc:mga07m45_85194_c1 | 3300050496 | Bacteria | 1807 |
| 1992 | nmdc:mga05p37_108064_c1 | 3300050507 | Bacteria | 3422 |
| 1993 | nmdc:mga05p37_154109_c1 | 3300050507 | Bacteria | 2809 |
| 1994 | nmdc:mga05p37_172319_c1 | 3300050507 | Bacteria | 2639 |
| 1995 | nmdc:mga05p37_258511_c1 | 3300050507 | Bacteria | 2085 |
| 1996 | nmdc:mga05p37_695868_c1 | 3300050507 | Bacteria | 1130 |
| 1997 | nmdc:mga05p37_866554_c1 | 3300050507 | Bacteria | 979 |
| 1998 | nmdc:mga09592_512626_c1 | 3300050508 | Bacteria | 1032 |
| 1999 | nmdc:mga09592_53603_c1 | 3300050508 | Bacteria | 3406 |
| 2000 | nmdc:mga0qj67_123544_c1 | 3300050509 | Bacteria | 2094 |
| 2001 | nmdc:mga0qj67_48399_c1 | 3300050509 | Bacteria | 3359 |
| 2002 | nmdc:mga0qj67_62505_c1 | 3300050509 | Bacteria | 2959 |
| 2003 | nmdc:mga06r32_110446_c1 | 3300050510 | Bacteria | 2705 |
| 2004 | nmdc:mga06r32_122152_c1 | 3300050510 | Bacteria | 2570 |
| 2005 | nmdc:mga06r32_425563_c1 | 3300050510 | Bacteria | 1309 |
| 2006 | nmdc:mga06r32_541591_c1 | 3300050510 | Bacteria | 1138 |
| 2007 | nmdc:mga06r32_772374_c1 | 3300050510 | Bacteria | 923 |
| 2008 | nmdc:mga08y16_117930_c1 | 3300050511 | Bacteria | 2763 |
| 2009 | nmdc:mga08y16_362117_c1 | 3300050511 | Bacteria | 1489 |
| 2010 | nmdc:mga08y16_40443_c2 | 3300050511 | Bacteria | 4328 |
| 2011 | nmdc:mga08y16_558759_c1 | 3300050511 | Bacteria | 1157 |
| 2012 | nmdc:mga08y16_561824_c1 | 3300050511 | Bacteria | 1154 |
| 2013 | nmdc:mga0n895_113370_c1 | 3300050512 | Bacteria | 2729 |
| 2014 | nmdc:mga0n895_422580_c1 | 3300050512 | Bacteria | 1347 |
| 2015 | nmdc:mga0n895_786326_c1 | 3300050512 | Bacteria | 943 |
| 2016 | nmdc:mga0n895_803744_c1 | 3300050512 | Bacteria | 931 |
| 2017 | nmdc:mga0rr50_159802_c1 | 3300050513 | Bacteria | 1828 |
| 2018 | nmdc:mga0rr50_275473_c1 | 3300050513 | Bacteria | 1403 |
| 2019 | nmdc:mga0rr50_55934_c1 | 3300050513 | Bacteria | 2946 |
| 2020 | nmdc:mga0a205_50288_c1 | 3300050515 | Bacteria | 4024 |
| 2021 | nmdc:mga0a205_822344_c1 | 3300050515 | Bacteria | 776 |
| 2022 | Ga0495601_0043237 | 3300053077 | Bacteria | 2829 |
| 2023 | Ga0495601_0055886 | 3300053077 | Bacteria | 2499 |
| 2024 | Ga0495601_0076190 | 3300053077 | Bacteria | 2147 |
| 2025 | Ga0495601_0076892 | 3300053077 | Bacteria | 2137 |
| 2026 | Ga0495601_0271392 | 3300053077 | Bacteria | 1106 |
| 2027 | Ga0495601_0306949 | 3300053077 | Bacteria | 1033 |
| 2028 | Ga0495601_0313617 | 3300053077 | Bacteria | 1021 |
| 2029 | Ga0495601_0750320 | 3300053077 | Bacteria | 621 |
| 2030 | Ga0495612_0029881 | 3300053078 | Bacteria | 2195 |
| 2031 | Ga0495612_0032701 | 3300053078 | Bacteria | 2102 |
| 2032 | Ga0495612_0154268 | 3300053078 | Bacteria | 1001 |
| 2033 | Ga0495612_0176723 | 3300053078 | Bacteria | 936 |
| 2034 | Ga0495612_0193189 | 3300053078 | Bacteria | 896 |
| 2035 | Ga0495612_0203814 | 3300053078 | Bacteria | 873 |
| 2036 | Ga0495655_0005141 | 3300053083 | Bacteria | 2292 |
| 2037 | Ga0495655_0025384 | 3300053083 | Bacteria | 1386 |
| 2038 | Ga0495655_0072031 | 3300053083 | Bacteria | 968 |
| 2039 | Ga0495655_0253875 | 3300053083 | Bacteria | 592 |
| 2040 | Ga0495595_0019132 | 3300053084 | Bacteria | 2968 |
| 2041 | Ga0495595_0039211 | 3300053084 | Bacteria | 2160 |
| 2042 | Ga0495595_0050715 | 3300053084 | Bacteria | 1922 |
| 2043 | Ga0495595_0065464 | 3300053084 | Bacteria | 1709 |
| 2044 | Ga0495595_0253624 | 3300053084 | Bacteria | 881 |
| 2045 | Ga0495619_0017984 | 3300053085 | Bacteria | 4482 |
| 2046 | Ga0495619_0061773 | 3300053085 | Bacteria | 2493 |
| 2047 | Ga0495619_0063374 | 3300053085 | Bacteria | 2462 |
| 2048 | Ga0495619_0065800 | 3300053085 | Bacteria | 2418 |
| 2049 | Ga0495619_0080349 | 3300053085 | Bacteria | 2194 |
| 2050 | Ga0495619_0254368 | 3300053085 | Bacteria | 1217 |
| 2051 | Ga0495619_0256217 | 3300053085 | Bacteria | 1212 |
| 2052 | Ga0495619_0449299 | 3300053085 | Bacteria | 888 |
| 2053 | Ga0495619_0498479 | 3300053085 | Bacteria | 838 |
| 2054 | Ga0500578_0001652 | 3300053086 | Bacteria | 21484 |
| 2055 | Ga0500644_0161303 | 3300053088 | Bacteria | 906 |
| 2056 | Ga0500646_0004647 | 3300053090 | Bacteria | 3470 |
| 2057 | Ga0500646_0040337 | 3300053090 | Bacteria | 1312 |
| 2058 | Ga0500647_0069287 | 3300053091 | Bacteria | 1696 |
| 2059 | Ga0500583_0021044 | 3300053092 | Bacteria | 2705 |
| 2060 | Ga0500583_0223778 | 3300053092 | Bacteria | 932 |
| 2061 | Ga0500651_0039291 | 3300053093 | Bacteria | 2980 |
| 2062 | Ga0500651_0141259 | 3300053093 | Bacteria | 1451 |
| 2063 | Ga0500651_0317839 | 3300053093 | Bacteria | 890 |
| 2064 | Ga0500566_0001583 | 3300053094 | Bacteria | 13393 |
| 2065 | Ga0500566_0118345 | 3300053094 | Bacteria | 1431 |
| 2066 | Ga0500566_0335759 | 3300053094 | Bacteria | 698 |
| 2067 | Ga0500566_0470106 | 3300053094 | Bacteria | 547 |
| 2068 | Ga0500640_018467 | 3300053095 | Bacteria | 2974 |
| 2069 | Ga0500640_079371 | 3300053095 | Bacteria | 1394 |
| 2070 | Ga0500641_0013667 | 3300053096 | Bacteria | 2984 |
| 2071 | Ga0500641_0042220 | 3300053096 | Bacteria | 1847 |
| 2072 | Ga0500554_275472 | 3300053102 | Bacteria | 549 |
| 2073 | Ga0500555_154582 | 3300053103 | Bacteria | 561 |
| 2074 | Ga0500556_0031626 | 3300053104 | Bacteria | 1802 |
| 2075 | Ga0500562_008561 | 3300053108 | Bacteria | 2584 |
| 2076 | Ga0500572_001474 | 3300053111 | Bacteria | 6379 |
| 2077 | Ga0500575_072918 | 3300053112 | Bacteria | 1274 |
| 2078 | Ga0500591_048720 | 3300053115 | Bacteria | 1991 |
| 2079 | Ga0500591_138100 | 3300053115 | Bacteria | 968 |
| 2080 | Ga0500593_111199 | 3300053117 | Bacteria | 1126 |
| 2081 | Ga0500608_006036 | 3300053122 | Bacteria | 4885 |
| 2082 | Ga0500614_001887 | 3300053123 | Bacteria | 4825 |
| 2083 | Ga0500618_019149 | 3300053125 | Bacteria | 1686 |
| 2084 | Ga0500642_0018777 | 3300053130 | Bacteria | 2682 |
| 2085 | Ga0500652_077698 | 3300053131 | Bacteria | 1380 |
| 2086 | Ga0500655_058730 | 3300053133 | Bacteria | 773 |
| 2087 | Ga0500559_0019248 | 3300053136 | Bacteria | 2885 |
| 2088 | Ga0500559_0051481 | 3300053136 | Bacteria | 1818 |
| 2089 | Ga0500577_0278165 | 3300053142 | Bacteria | 729 |
| 2090 | Ga0500585_132815 | 3300053144 | Bacteria | 881 |
| 2091 | Ga0500585_223604 | 3300053144 | Bacteria | 614 |
| 2092 | Ga0500589_023249 | 3300053147 | Bacteria | 2856 |
| 2093 | Ga0500590_018670 | 3300053148 | Bacteria | 3590 |
| 2094 | Ga0500603_002379 | 3300053150 | Bacteria | 4126 |
| 2095 | Ga0500616_0030592 | 3300053153 | Bacteria | 2955 |
| 2096 | Ga0500624_001967 | 3300053157 | Bacteria | 2931 |
| 2097 | Ga0500627_0083571 | 3300053158 | Bacteria | 1425 |
| 2098 | Ga0500627_0350843 | 3300053158 | Bacteria | 636 |
| 2099 | Ga0500630_001264 | 3300053159 | Bacteria | 11915 |
| 2100 | Ga0500633_0210962 | 3300053160 | Bacteria | 726 |
| 2101 | Ga0500638_008813 | 3300053162 | Bacteria | 4323 |
| 2102 | Ga0500639_002503 | 3300053163 | Bacteria | 9190 |
| 2103 | Ga0500639_028090 | 3300053163 | Bacteria | 2972 |
| 2104 | Ga0500639_096985 | 3300053163 | Bacteria | 1458 |
| 2105 | Ga0500636_0224274 | 3300053177 | Bacteria | 977 |
| 2106 | Ga0500636_0238451 | 3300053177 | Bacteria | 936 |
| 2107 | Ga0500570_086394 | 3300053724 | Bacteria | 1387 |
| 2108 | Ga0500576_027874 | 3300053725 | Bacteria | 2574 |
| 2109 | Ga0500611_075707 | 3300053727 | Bacteria | 830 |
| 2110 | Ga0500657_031862 | 3300053728 | Bacteria | 2479 |
| 2111 | Ga0500645_010662 | 3300053730 | Bacteria | 3027 |
| 2112 | Ga0500596_002137 | 3300053735 | Bacteria | 3928 |
| 2113 | Ga0500601_001931 | 3300053737 | Bacteria | 2229 |
| 2114 | Ga0501084_0270777 | 3300054114 | Bacteria | 1434 |
| 2115 | Ga0501084_1098731 | 3300054114 | Bacteria | 668 |
| 2116 | Ga0590074_090061 | 3300059423 | Bacteria | 592 |
| 2117 | Ga0590075_031488 | 3300059424 | Bacteria | 1345 |
| 2118 | Ga0501082_1921878 | 3300060353 | Bacteria | 516 |
| 2119 | Ga0466962_0020422 | 3300061719 | Bacteria | 3182 |
| 2120 | Ga0530510_0060430 | 3300061734 | Bacteria | 2742 |
| 2121 | Ga0530510_0253426 | 3300061734 | Bacteria | 1312 |
| 2122 | 2507511625 | 2507262055 | Bacteria | 8048963 |
| 2123 | 2508540367 | 2508501009 | Bacteria | 7784016 |
| 2124 | 2513706296 | 2513237102 | Bacteria | 7703324 |
| 2125 | 2517407523 | 2517287029 | Bacteria | 6905599 |
| 2126 | 2517411700 | 2517287029 | Bacteria | 6905599 |
| 2127 | 2524542669 | 2524023228 | Bacteria | 10118060 |
| 2128 | 2524542685 | 2524023228 | Bacteria | 10118060 |
| 2129 | 2617379845 | 2617270741 | Bacteria | 8201522 |
| 2130 | 2617379905 | 2617270741 | Bacteria | 8201522 |
| 2131 | 2617382528 | 2617270742 | Bacteria | 6808054 |
| 2132 | 2805917807 | 2802429603 | Bacteria | 8777136 |
| 2133 | 2824780971 | 2824773399 | Bacteria | 8360218 |
| 2134 | 2856357377 | 2856356410 | Bacteria | 6297484 |
| 2135 | 2857515281 | 2857509624 | Bacteria | 7472071 |
| 2136 | 2857537751 | 2857531043 | Bacteria | 6754041 |
| 2137 | 2881369056 | 2881364244 | Bacteria | 7710352 |
| 2138 | 2881666703 | 2881665667 | Bacteria | 8175609 |
| 2139 | 2881666706 | 2881665667 | Bacteria | 8175609 |
| 2140 | 2885370908 | 2885366525 | Bacteria | 8326213 |
| 2141 | 2885414184 | 2885409591 | Bacteria | 9235467 |
| 2142 | 2889041514 | 2889033259 | Bacteria | 9099371 |
| 2143 | 2889310342 | 2889306138 | Bacteria | 6358934 |
| 2144 | 2904693887 | 2904690495 | Bacteria | 9412302 |
| 2145 | 2904707725 | |||
| 2146 | 2932800207 | 2932794094 | Bacteria | 7915132 |
| 2147 | 2935683943 | 2935675223 | Bacteria | 9928132 |
| 2148 | 2941546410 | 2941538514 | Bacteria | 9402094 |
| 2149 | 2961130649 | 2961127735 | Bacteria | 7196641 |
| 2150 | 8005316270 | 8005314921 | Bacteria | 7072929 |
| 2151 | 8006933869 | 8006933436 | Bacteria | 10410654 |
| 2152 | 8006936266 | 8006933436 | Bacteria | 10410654 |
| 2153 | 8006936763 | 8006933436 | Bacteria | 10410654 |
| 2154 | 8006937849 | 8006933436 | Bacteria | 10410654 |
| 2155 | 8006938564 | 8006933436 | Bacteria | 10410654 |
| 2156 | 8006939934 | 8006933436 | Bacteria | 10410654 |
| 2157 | 8006943413 | 8006933436 | Bacteria | 10410654 |
| 2158 | 8006943431 | 8006933436 | Bacteria | 10410654 |
| 2159 | 8006971383 | 8006964411 | Bacteria | 8966052 |
| 2160 | 8006974034 | 8006973647 | Bacteria | 10679141 |
| 2161 | 8006976232 | 8006973647 | Bacteria | 10679141 |
| 2162 | 8006977955 | 8006973647 | Bacteria | 10679141 |
| 2163 | 8006981616 | 8006973647 | Bacteria | 10679141 |
| 2164 | 8006983542 | 8006973647 | Bacteria | 10679141 |
| 2165 | 8006983666 | 8006973647 | Bacteria | 10679141 |
| 2166 | 8006983686 | 8006973647 | Bacteria | 10679141 |
| 2167 | 8016617201 | 8016613128 | Bacteria | 8794220 |
| 2168 | 8018130346 | 8018127388 | Bacteria | 7351159 |
| 2169 | 8019585402 | 8019576017 | Bacteria | 10049540 |
| 2170 | 8019598089 | 8019597564 | Bacteria | 10041141 |
| 2171 | 8019610293 | 8019608314 | Bacteria | 10042931 |
| 2172 | 8019648864 | 8019648815 | Bacteria | 10014479 |
| 2173 | 8019653918 | 8019648815 | Bacteria | 10014479 |
| 2174 | 8056683043 | 8056681323 | Bacteria | 8472857 |
| 2175 | Ga0495664_0305100 | |||
| 2176 | SwRhRL2b_contig_1110102 | |||
| 2177 | CNBas_1000120 | |||
| 2178 | CNAas_1001029 | |||
| 2179 | JGI24746J21847_1003278 | |||
| 2180 | JGI24746J21847_1004618 | |||
| 2181 | JGI24747J21853_1013922 | |||
| 2182 | JGI24739J22299_10156133 | |||
| 2183 | JGI24737J22298_10015005 | |||
| 2184 | JGI24743J22301_10001477 | |||
| 2185 | JGI24743J22301_10004069 | |||
| 2186 | JGI24750J21931_1001967 | |||
| 2187 | JGI24750J21931_1002451 | |||
| 2188 | JGI24745J21846_1001121 | |||
| 2189 | JGI24745J21846_1013583 | |||
| 2190 | JGI24748J21848_1000896 | |||
| 2191 | JGI24748J21848_1001876 | |||
| 2192 | JGI24738J21930_10018131 | |||
| 2193 | JGI24749J21850_1001481 | |||
| 2194 | JGI24749J21850_1003226 | |||
| 2195 | JGI24749J21850_1040645 | |||
| 2196 | JGI24744J21845_10003565 | |||
| 2197 | JGI24744J21845_10039858 | |||
| 2198 | JGI24034J26672_10001347 | |||
| 2199 | JGI24742J22300_10002290 | |||
| 2200 | JGI24742J22300_10014005 | |||
| 2201 | JGI24742J22300_10056886 | |||
| 2202 | rootH2_10055222 | |||
| 2203 | JGI25404J52841_10000141 | |||
| 2204 | Ga0055528_1014369 | |||
| 2205 | JGI25405J52794_10125556 | |||
| 2206 | Ga0065704_10003761 | |||
| 2207 | Ga0065712_10091158 | |||
| 2208 | Ga0065715_10101018 | |||
| 2209 | Ga0065715_10103975 | |||
| 2210 | Ga0065707_10004119 | |||
| 2211 | Ga0070658_10059578 | |||
| 2212 | Ga0070658_10816897 | |||
| 2213 | Ga0070676_10141473 | |||
| 2214 | Ga0070676_10222000 | |||
| 2215 | Ga0070676_10344730 | |||
| 2216 | Ga0070683_100049008 | |||
| 2217 | Ga0070683_100237481 | |||
| 2218 | Ga0070683_100260545 | |||
| 2219 | Ga0070690_100088397 | |||
| 2220 | Ga0070690_100314257 | |||
| 2221 | Ga0070690_100326145 | |||
| 2222 | Ga0070670_100062702 | |||
| 2223 | Ga0070670_100152289 | |||
| 2224 | Ga0070677_10016017 | |||
| 2225 | Ga0070677_10025393 | |||
| 2226 | Ga0068869_100245657 | |||
| 2227 | Ga0068869_101950395 | |||
| 2228 | Ga0070666_10035884 | |||
| 2229 | Ga0070666_10071735 | |||
| 2230 | Ga0070666_10237379 | |||
| 2231 | Ga0070680_100020639 | |||
| 2232 | Ga0070680_100308825 | |||
| 2233 | Ga0070680_101228241 | |||
| 2234 | Ga0070682_100028047 | |||
| 2235 | Ga0070682_100116632 | |||
| 2236 | Ga0070682_100414061 | |||
| 2237 | Ga0068868_100049166 | |||
| 2238 | Ga0068868_100052530 | |||
| 2239 | Ga0068868_100354245 | |||
| 2240 | Ga0068868_101299379 | |||
| 2241 | Ga0070660_100377024 | |||
| 2242 | Ga0070660_100381673 | |||
| 2243 | Ga0070660_100488134 | |||
| 2244 | Ga0070660_100523066 | |||
| 2245 | Ga0070660_100603146 | |||
| 2246 | Ga0070689_100042940 | |||
| 2247 | Ga0070689_100138647 | |||
| 2248 | Ga0070689_100369612 | |||
| 2249 | Ga0070691_10030971 | |||
| 2250 | Ga0070691_10060711 | |||
| 2251 | Ga0070691_10210479 | |||
| 2252 | Ga0070691_10525001 | |||
| 2253 | Ga0070691_10935492 | |||
| 2254 | Ga0070687_100016246 | |||
| 2255 | Ga0070687_100041965 | |||
| 2256 | Ga0070687_100871751 | |||
| 2257 | Ga0070661_100102324 | |||
| 2258 | Ga0070661_100378666 | |||
| 2259 | Ga0070692_10036208 | |||
| 2260 | Ga0070692_10396885 | |||
| 2261 | Ga0070668_100046001 | |||
| 2262 | Ga0070668_100048950 | |||
| 2263 | Ga0070668_100075625 | |||
| 2264 | Ga0070668_100114760 | |||
| 2265 | Ga0070668_100243294 | |||
| 2266 | Ga0070668_100476582 | |||
| 2267 | Ga0070668_100527243 | |||
| 2268 | Ga0070668_100537173 | |||
| 2269 | Ga0070668_100891865 | |||
| 2270 | Ga0070668_101180724 | |||
| 2271 | Ga0070668_101388732 | |||
| 2272 | Ga0070669_100041051 | |||
| 2273 | Ga0070669_100051754 | |||
| 2274 | Ga0070669_100400299 | |||
| 2275 | Ga0070669_100563196 | |||
| 2276 | Ga0070675_100044532 | |||
| 2277 | Ga0070675_100090999 | |||
| 2278 | Ga0070675_101188489 | |||
| 2279 | Ga0070671_100051993 | |||
| 2280 | Ga0070671_100267379 | |||
| 2281 | Ga0070671_100378638 | |||
| 2282 | Ga0070671_100428094 | |||
| 2283 | Ga0070674_100048632 | |||
| 2284 | Ga0070674_100193244 | |||
| 2285 | Ga0070674_100259447 | |||
| 2286 | Ga0070674_100537113 | |||
| 2287 | Ga0070674_101820662 | |||
| 2288 | Ga0070673_100046119 | |||
| 2289 | Ga0070673_100046378 | |||
| 2290 | Ga0070673_100272177 | |||
| 2291 | Ga0070673_101244932 | |||
| 2292 | Ga0070688_100025517 | |||
| 2293 | Ga0070688_100026473 | |||
| 2294 | Ga0070688_100142555 | |||
| 2295 | Ga0070659_100196270 | |||
| 2296 | Ga0070659_100300321 | |||
| 2297 | Ga0070659_100539515 | |||
| 2298 | Ga0070667_100051801 | |||
| 2299 | Ga0070667_100273930 | |||
| 2300 | Ga0070667_100662985 | |||
| 2301 | Ga0070667_100667272 | |||
| 2302 | Ga0070703_10010510 | |||
| 2303 | Ga0070703_10011425 | |||
| 2304 | Ga0070709_10029246 | |||
| 2305 | Ga0070709_10029935 | |||
| 2306 | Ga0070709_10040883 | |||
| 2307 | Ga0070709_10056165 | |||
| 2308 | Ga0070709_10251498 | |||
| 2309 | Ga0070714_100048072 | |||
| 2310 | Ga0070714_100049300 | |||
| 2311 | Ga0070714_100068579 | |||
| 2312 | Ga0070714_100195684 | |||
| 2313 | Ga0070714_100343550 | |||
| 2314 | Ga0070714_100403320 | |||
| 2315 | Ga0070714_100990414 | |||
| 2316 | Ga0070713_100016241 | |||
| 2317 | Ga0070713_100124786 | |||
| 2318 | Ga0070713_100329051 | |||
| 2319 | Ga0070713_100894660 | |||
| 2320 | Ga0070713_100905407 | |||
| 2321 | Ga0070710_10017785 | |||
| 2322 | Ga0070710_10115219 | |||
| 2323 | Ga0070710_10236399 | |||
| 2324 | Ga0070710_10275291 | |||
| 2325 | Ga0070701_10012140 | |||
| 2326 | Ga0070701_10048532 | |||
| 2327 | Ga0070701_10260551 | |||
| 2328 | Ga0070711_100015435 | |||
| 2329 | Ga0070711_100027809 | |||
| 2330 | Ga0070711_100053839 | |||
| 2331 | Ga0070711_100102323 | |||
| 2332 | Ga0070711_100215128 | |||
| 2333 | Ga0070711_100234692 | |||
| 2334 | Ga0070711_100690364 | |||
| 2335 | Ga0070711_100762046 | |||
| 2336 | Ga0070705_100011195 | |||
| 2337 | Ga0070705_100346044 | |||
| 2338 | Ga0070705_101202494 | |||
| 2339 | Ga0070700_100027556 | |||
| 2340 | Ga0070700_100194371 | |||
| 2341 | Ga0070700_100374687 | |||
| 2342 | Ga0070694_100019015 | |||
| 2343 | Ga0070694_100048216 | |||
| 2344 | Ga0070694_100064730 | |||
| 2345 | Ga0070708_100182126 | |||
| 2346 | Ga0070708_100701134 | |||
| 2347 | Ga0070708_100803969 | |||
| 2348 | Ga0070663_100035515 | |||
| 2349 | Ga0070663_100036289 | |||
| 2350 | Ga0070663_100036982 | |||
| 2351 | Ga0070663_100037621 | |||
| 2352 | Ga0070663_100082745 | |||
| 2353 | Ga0070663_100092086 | |||
| 2354 | Ga0070663_100212616 | |||
| 2355 | Ga0070663_100513144 | |||
| 2356 | Ga0070663_100561414 | |||
| 2357 | Ga0070663_100864896 | |||
| 2358 | Ga0070663_101274916 | |||
| 2359 | Ga0070678_100036628 | |||
| 2360 | Ga0070678_100157776 | |||
| 2361 | Ga0070678_100347983 | |||
| 2362 | Ga0070678_101695823 | |||
| 2363 | Ga0070662_100043985 | |||
| 2364 | Ga0070662_100074789 | |||
| 2365 | Ga0070662_100169000 | |||
| 2366 | Ga0070662_100175252 | |||
| 2367 | Ga0070662_100326474 | |||
| 2368 | Ga0070662_100347556 | |||
| 2369 | Ga0070662_101205465 | |||
| 2370 | Ga0070662_101628309 | |||
| 2371 | Ga0070681_10053152 | |||
| 2372 | Ga0070681_10101479 | |||
| 2373 | Ga0070681_10925719 | |||
| 2374 | Ga0068867_100032454 | |||
| 2375 | Ga0068867_100058513 | |||
| 2376 | Ga0068867_100122486 | |||
| 2377 | Ga0068867_100152082 | |||
| 2378 | Ga0068867_100220332 | |||
| 2379 | Ga0068867_100428651 | |||
| 2380 | Ga0068867_100518892 | |||
| 2381 | Ga0070685_10023711 | |||
| 2382 | Ga0070685_10095214 | |||
| 2383 | Ga0070685_10119850 | |||
| 2384 | Ga0070706_100074412 | |||
| 2385 | Ga0070706_100143529 | |||
| 2386 | Ga0070707_100050232 | |||
| 2387 | Ga0070707_100055593 | |||
| 2388 | Ga0070698_100074135 | |||
| 2389 | Ga0070698_100144896 | |||
| 2390 | Ga0070698_100417014 | |||
| 2391 | Ga0070698_100486239 | |||
| 2392 | Ga0070699_100049687 | |||
| 2393 | Ga0070699_100053367 | |||
| 2394 | Ga0070699_100688009 | |||
| 2395 | Ga0070679_100137354 | |||
| 2396 | Ga0070679_100259059 | |||
| 2397 | Ga0070679_100334615 | |||
| 2398 | Ga0070679_100470158 | |||
| 2399 | Ga0070679_101142222 | |||
| 2400 | Ga0070679_101286477 | |||
| 2401 | Ga0070684_100261722 | |||
| 2402 | Ga0070684_100369311 | |||
| 2403 | Ga0070684_100409197 | |||
| 2404 | Ga0070684_100458135 | |||
| 2405 | Ga0070684_101024268 | |||
| 2406 | Ga0070697_100074790 | |||
| 2407 | Ga0070697_100866084 | |||
| 2408 | Ga0070697_100893188 | |||
| 2409 | Ga0070697_101328257 | |||
| 2410 | Ga0068853_100078844 | |||
| 2411 | Ga0068853_100107208 | |||
| 2412 | Ga0068853_100343772 | |||
| 2413 | Ga0068853_100394814 | |||
| 2414 | Ga0070672_100036561 | |||
| 2415 | Ga0070672_100082892 | |||
| 2416 | Ga0070672_100134145 | |||
| 2417 | Ga0070672_100777424 | |||
| 2418 | Ga0070686_100027360 | |||
| 2419 | Ga0070686_100032964 | |||
| 2420 | Ga0070686_100216163 | |||
| 2421 | Ga0070686_100658618 | |||
| 2422 | Ga0070695_100000761 | |||
| 2423 | Ga0070695_100126516 | |||
| 2424 | Ga0070695_100529353 | |||
| 2425 | Ga0070695_100547725 | |||
| 2426 | Ga0070695_100603881 | |||
| 2427 | Ga0070695_100988490 | |||
| 2428 | Ga0070696_100009177 | |||
| 2429 | Ga0070696_100386587 | |||
| 2430 | Ga0070696_100481764 | |||
| 2431 | Ga0070696_100714545 | |||
| 2432 | Ga0070693_100666780 | |||
| 2433 | Ga0070693_100840681 | |||
| 2434 | Ga0070693_100929297 | |||
| 2435 | Ga0070693_101041432 | |||
| 2436 | Ga0070693_101282099 | |||
| 2437 | Ga0070665_100047877 | |||
| 2438 | Ga0070665_100066764 | |||
| 2439 | Ga0070665_100079823 | |||
| 2440 | Ga0070665_100096618 | |||
| 2441 | Ga0070665_100704220 | |||
| 2442 | Ga0070665_100928444 | |||
| 2443 | Ga0070704_100003711 | |||
| 2444 | Ga0070704_100253895 | |||
| 2445 | Ga0070704_100467806 | |||
| 2446 | Ga0070704_101940537 | |||
| 2447 | Ga0068855_100087137 | |||
| 2448 | Ga0068855_100222649 | |||
| 2449 | Ga0068855_100774381 | |||
| 2450 | Ga0070664_100087450 | |||
| 2451 | Ga0070664_100100441 | |||
| 2452 | Ga0070664_100676753 | |||
| 2453 | Ga0070664_101673868 | |||
| 2454 | Ga0068857_100073259 | |||
| 2455 | Ga0068857_100101836 | |||
| 2456 | Ga0068857_102031924 | |||
| 2457 | Ga0068854_100016323 | |||
| 2458 | Ga0068854_100467060 | |||
| 2459 | Ga0068854_100539602 | |||
| 2460 | Ga0068856_100305891 | |||
| 2461 | Ga0068856_100495528 | |||
| 2462 | Ga0068856_100547542 | |||
| 2463 | Ga0068856_100677779 | |||
| 2464 | Ga0068856_100836036 | |||
| 2465 | Ga0070702_100031319 | |||
| 2466 | Ga0070702_100038575 | |||
| 2467 | Ga0068852_100111021 | |||
| 2468 | Ga0068852_100171267 | |||
| 2469 | Ga0068852_100324128 | |||
| 2470 | Ga0068859_100011678 | |||
| 2471 | Ga0068859_100085071 | |||
| 2472 | Ga0068859_100272394 | |||
| 2473 | Ga0068859_100387367 | |||
| 2474 | Ga0068859_101649249 | |||
| 2475 | Ga0068864_100048004 | |||
| 2476 | Ga0068864_100055954 | |||
| 2477 | Ga0068864_100069722 | |||
| 2478 | Ga0068864_100253904 | |||
| 2479 | Ga0068866_10213700 | |||
| 2480 | Ga0068866_10260781 | |||
| 2481 | Ga0068866_10370374 | |||
| 2482 | Ga0068866_10687219 | |||
| 2483 | Ga0068866_10798969 | |||
| 2484 | Ga0068866_11243486 | |||
| 2485 | Ga0068861_100044898 | |||
| 2486 | Ga0068861_100070508 | |||
| 2487 | Ga0068861_100657826 | |||
| 2488 | Ga0068851_10014991 | |||
| 2489 | Ga0068851_10371046 | |||
| 2490 | Ga0068870_10098283 | |||
| 2491 | Ga0068870_10102054 | |||
| 2492 | Ga0068870_10386400 | |||
| 2493 | Ga0068863_100071988 | |||
| 2494 | Ga0068863_100094753 | |||
| 2495 | Ga0068863_101365437 | |||
| 2496 | Ga0068858_100073499 | |||
| 2497 | Ga0068858_100075217 | |||
| 2498 | Ga0068858_100129472 | |||
| 2499 | Ga0068858_100412615 | |||
| 2500 | Ga0068858_100691728 | |||
| 2501 | Ga0068860_100039418 | |||
| 2502 | Ga0068860_100508457 | |||
| 2503 | Ga0068860_100519824 | |||
| 2504 | Ga0068860_100787866 | |||
| 2505 | Ga0068860_101058700 | |||
| 2506 | Ga0068862_100030867 | |||
| 2507 | Ga0068862_100045888 | |||
| 2508 | Ga0068862_100382029 | |||
| 2509 | Ga0068862_100724970 | |||
| 2510 | Ga0068862_102274705 | |||
| 2511 | Ga0081455_10034250 | |||
| 2512 | Ga0081455_10035218 | |||
| 2513 | Ga0081455_10050401 | |||
| 2514 | Ga0081455_10078452 | |||
| 2515 | Ga0081538_10150740 | |||
| 2516 | Ga0081540_1001779 | |||
| 2517 | Ga0081540_1018312 | |||
| 2518 | Ga0081540_1025593 | |||
| 2519 | Ga0081540_1218874 | |||
| 2520 | Ga0081539_10025774 | |||
| 2521 | Ga0070717_10105913 | |||
| 2522 | Ga0070717_10171211 | |||
| 2523 | Ga0070717_10341413 | |||
| 2524 | Ga0070717_10342952 | |||
| 2525 | Ga0070717_10533546 | |||
| 2526 | Ga0070717_10841879 | |||
| 2527 | Ga0075365_10057535 | |||
| 2528 | Ga0075365_10062430 | |||
| 2529 | Ga0075365_10265072 | |||
| 2530 | Ga0075363_100049350 | |||
| 2531 | Ga0075363_100204548 | |||
| 2532 | Ga0075363_100306901 | |||
| 2533 | Ga0075364_10069351 | |||
| 2534 | Ga0075364_10659798 | |||
| 2535 | Ga0075432_10068731 | |||
| 2536 | Ga0075432_10193399 | |||
| 2537 | Ga0070715_10017421 | |||
| 2538 | Ga0070715_10139137 | |||
| 2539 | Ga0070715_10203507 | |||
| 2540 | Ga0070715_10273988 | |||
| 2541 | Ga0070715_10987669 | |||
| 2542 | Ga0070716_100026033 | |||
| 2543 | Ga0070716_100028509 | |||
| 2544 | Ga0070716_100038887 | |||
| 2545 | Ga0070716_100042692 | |||
| 2546 | Ga0070716_100166173 | |||
| 2547 | Ga0070716_100202083 | |||
| 2548 | Ga0070716_100391819 | |||
| 2549 | Ga0070712_100047152 | |||
| 2550 | Ga0070712_100071069 | |||
| 2551 | Ga0070712_100116792 | |||
| 2552 | Ga0070712_100164380 | |||
| 2553 | Ga0070712_100422736 | |||
| 2554 | Ga0070712_101255352 | |||
| 2555 | Ga0075367_10019662 | |||
| 2556 | Ga0075367_10022674 | |||
| 2557 | Ga0075367_10033074 | |||
| 2558 | Ga0075369_10192367 | |||
| 2559 | Ga0075366_10038579 | |||
| 2560 | Ga0097621_100048477 | |||
| 2561 | Ga0097621_100097813 | |||
| 2562 | Ga0097621_100887072 | |||
| 2563 | Ga0075370_10074605 | |||
| 2564 | Ga0068871_100052029 | |||
| 2565 | Ga0068871_100490261 | |||
| 2566 | Ga0068871_100624947 | |||
| 2567 | Ga0075428_100058953 | |||
| 2568 | Ga0075428_100145960 | |||
| 2569 | Ga0075428_100725120 | |||
| 2570 | Ga0075428_100790114 | |||
| 2571 | Ga0075428_101056121 | |||
| 2572 | Ga0075428_101228393 | |||
| 2573 | Ga0075430_100029135 | |||
| 2574 | Ga0075430_100060840 | |||
| 2575 | Ga0075430_100529851 | |||
| 2576 | Ga0075431_100096669 | |||
| 2577 | Ga0075431_100132609 | |||
| 2578 | Ga0075431_100568870 | |||
| 2579 | Ga0075431_100625973 | |||
| 2580 | Ga0075431_100690271 | |||
| 2581 | Ga0075431_101177461 | |||
| 2582 | Ga0075431_102030226 | |||
| 2583 | Ga0075433_10071440 | |||
| 2584 | Ga0075433_10770998 | |||
| 2585 | Ga0075433_11823144 | |||
| 2586 | Ga0075434_100077731 | |||
| 2587 | Ga0075434_100932156 | |||
| 2588 | Ga0075434_101318390 | |||
| 2589 | Ga0075429_100069945 | |||
| 2590 | Ga0075429_100135350 | |||
| 2591 | Ga0075429_100366215 | |||
| 2592 | Ga0075429_100721746 | |||
| 2593 | Ga0068865_100029322 | |||
| 2594 | Ga0068865_100034960 | |||
| 2595 | Ga0068865_100038148 | |||
| 2596 | Ga0068865_100100724 | |||
| 2597 | Ga0068865_100291352 | |||
| 2598 | Ga0068865_100323542 | |||
| 2599 | Ga0068865_100359283 | |||
| 2600 | Ga0068865_100411250 | |||
| 2601 | Ga0075436_100610479 | |||
| 2602 | Ga0097620_100011678 | |||
| 2603 | Ga0097620_100085069 | |||
| 2604 | Ga0097620_100272414 | |||
| 2605 | Ga0097620_100387352 | |||
| 2606 | Ga0097620_101649882 | |||
| 2607 | Ga0099822_1039366 | |||
| 2608 | Ga0075435_100061941 | |||
| 2609 | Ga0075435_100507336 | |||
| 2610 | Ga0075435_100905559 | |||
| 2611 | Ga0099794_10140625 | |||
| 2612 | Ga0099794_10215816 | |||
| 2613 | Ga0099794_10569938 | |||
| 2614 | Ga0099795_10187193 | |||
| 2615 | Ga0105251_10083153 | |||
| 2616 | Ga0105244_10071717 | |||
| 2617 | Ga0105250_10145102 | |||
| 2618 | Ga0105240_10000214 | |||
| 2619 | Ga0105240_10048136 | |||
| 2620 | Ga0105240_10123137 | |||
| 2621 | Ga0105240_10259521 | |||
| 2622 | Ga0105240_10564827 | |||
| 2623 | Ga0105240_12089436 | |||
| 2624 | Ga0105240_12388680 | |||
| 2625 | Ga0111539_10046008 | |||
| 2626 | Ga0111539_10121699 | |||
| 2627 | Ga0111539_10634290 | |||
| 2628 | Ga0111539_10744055 | |||
| 2629 | Ga0111539_10768976 | |||
| 2630 | Ga0105245_10058201 | |||
| 2631 | Ga0105245_10201832 | |||
| 2632 | Ga0105245_10260608 | |||
| 2633 | Ga0105245_10336940 | |||
| 2634 | Ga0105245_10663966 | |||
| 2635 | Ga0105247_10044897 | |||
| 2636 | Ga0105247_10058541 | |||
| 2637 | Ga0105247_10074819 | |||
| 2638 | Ga0105247_10084110 | |||
| 2639 | Ga0105247_10132222 | |||
| 2640 | Ga0105247_10308587 | |||
| 2641 | Ga0114129_10113312 | |||
| 2642 | Ga0114129_10126637 | |||
| 2643 | Ga0114129_10158638 | |||
| 2644 | Ga0114129_10395340 | |||
| 2645 | Ga0114129_10782585 | |||
| 2646 | Ga0114129_11129687 | |||
| 2647 | Ga0114129_11803568 | |||
| 2648 | Ga0105243_10043376 | |||
| 2649 | Ga0105243_10044601 | |||
| 2650 | Ga0105243_10230172 | |||
| 2651 | Ga0105243_10278244 | |||
| 2652 | Ga0105243_10554114 | |||
| 2653 | Ga0105243_10934174 | |||
| 2654 | Ga0105241_10507221 | |||
| 2655 | Ga0105242_10052866 | |||
| 2656 | Ga0105242_10231413 | |||
| 2657 | Ga0105242_10318447 | |||
| 2658 | Ga0105242_10954539 | |||
| 2659 | Ga0105242_11049044 | |||
| 2660 | Ga0105248_10065986 | |||
| 2661 | Ga0105248_10122696 | |||
| 2662 | Ga0105248_10485519 | |||
| 2663 | Ga0105248_10534410 | |||
| 2664 | Ga0105248_10952725 | |||
| 2665 | Ga0105248_11257672 | |||
| 2666 | Ga0105248_11746359 | |||
| 2667 | Ga0105237_10073967 | |||
| 2668 | Ga0105237_10102477 | |||
| 2669 | Ga0105237_10412752 | |||
| 2670 | Ga0105237_12362333 | |||
| 2671 | Ga0105238_10387337 | |||
| 2672 | Ga0105238_10645527 | |||
| 2673 | Ga0105238_11476117 | |||
| 2674 | Ga0105238_12641994 | |||
| 2675 | Ga0105249_10028066 | |||
| 2676 | Ga0105249_10055087 | |||
| 2677 | Ga0105249_10087337 | |||
| 2678 | Ga0105249_10114680 | |||
| 2679 | Ga0105249_10138614 | |||
| 2680 | Ga0105249_10201224 | |||
| 2681 | Ga0105249_10273096 | |||
| 2682 | Ga0105249_10654618 | |||
| 2683 | Ga0099796_10025508 | |||
| 2684 | Ga0099796_10026637 | |||
| 2685 | Ga0099796_10071967 | |||
| 2686 | Ga0105239_10105018 | |||
| 2687 | Ga0105239_10111045 | |||
| 2688 | Ga0105239_10299303 | |||
| 2689 | Ga0105239_10357001 | |||
| 2690 | Ga0105239_10557915 | |||
| 2691 | Ga0105239_10968536 | |||
| 2692 | Ga0105246_10031533 | |||
| 2693 | Ga0105246_10052543 | |||
| 2694 | Ga0105246_10055636 | |||
| 2695 | Ga0105246_10077333 | |||
| 2696 | Ga0105246_10201464 | |||
| 2697 | Ga0105246_11297140 | |||
| 2698 | Ga0157323_1008223 | |||
| 2699 | Ga0157323_1049526 | |||
| 2700 | Ga0157319_1004757 | |||
| 2701 | Ga0157319_1015828 | |||
| 2702 | Ga0157345_1032691 | |||
| 2703 | Ga0157339_1008392 | |||
| 2704 | Ga0157342_1000363 | |||
| 2705 | Ga0157316_1026130 | |||
| 2706 | Ga0157326_1087187 | |||
| 2707 | Ga0157371_10618375 | |||
| 2708 | Ga0157370_10064658 | |||
| 2709 | Ga0157369_10101001 | |||
| 2710 | Ga0157369_10144292 | |||
| 2711 | Ga0157369_10815287 | |||
| 2712 | Ga0157369_11188084 | |||
| 2713 | Ga0157374_10058616 | |||
| 2714 | Ga0157374_10076268 | |||
| 2715 | Ga0157374_10598273 | |||
| 2716 | Ga0157374_10611843 | |||
| 2717 | Ga0157374_11143053 | |||
| 2718 | Ga0157378_10041017 | |||
| 2719 | Ga0157378_10369096 | |||
| 2720 | Ga0157378_10871815 | |||
| 2721 | Ga0157378_11223202 | |||
| 2722 | Ga0157378_11721835 | |||
| 2723 | Ga0157378_12204585 | |||
| 2724 | Ga0163162_10060990 | |||
| 2725 | Ga0163162_10064322 | |||
| 2726 | Ga0163162_10091115 | |||
| 2727 | Ga0163162_10224089 | |||
| 2728 | Ga0163162_10247417 | |||
| 2729 | Ga0163162_10511741 | |||
| 2730 | Ga0163162_10574284 | |||
| 2731 | Ga0163162_11550495 | |||
| 2732 | Ga0157372_10190801 | |||
| 2733 | Ga0157372_10294740 | |||
| 2734 | Ga0157372_11125182 | |||
| 2735 | Ga0157375_10054329 | |||
| 2736 | Ga0157375_10074384 | |||
| 2737 | Ga0157375_10219534 | |||
| 2738 | Ga0157375_11202325 | |||
| 2739 | Ga0157375_12270665 | |||
| 2740 | Ga0163163_10071117 | |||
| 2741 | Ga0163163_10072960 | |||
| 2742 | Ga0163163_10104982 | |||
| 2743 | Ga0163163_10854593 | |||
| 2744 | Ga0163163_11299038 | |||
| 2745 | Ga0163163_11927232 | |||
| 2746 | Ga0163163_12516882 | |||
| 2747 | Ga0157380_10044229 | |||
| 2748 | Ga0157380_10076607 | |||
| 2749 | Ga0157380_10400435 | |||
| 2750 | Ga0157380_10512190 | |||
| 2751 | Ga0157377_10049881 | |||
| 2752 | Ga0157377_10174301 | |||
| 2753 | Ga0157379_10063563 | |||
| 2754 | Ga0157379_10094922 | |||
| 2755 | Ga0157379_10466088 | |||
| 2756 | Ga0157376_10037388 | |||
| 2757 | Ga0157376_10975433 | |||
| 2758 | Ga0157376_11329171 | |||
| 2759 | Ga0157376_12002407 | |||
| 2760 | Ga0163161_10048134 | |||
| 2761 | Ga0163161_10053149 | |||
| 2762 | Ga0163161_10106676 | |||
| 2763 | Ga0163161_10123130 | |||
| 2764 | Ga0163161_10171661 | |||
| 2765 | Ga0163161_10361394 | |||
| 2766 | Ga0163161_10399896 | |||
| 2767 | Ga0206356_11796761 | |||
| 2768 | Ga0206353_11171063 | |||
| 2769 | Ga0213872_10013559 | |||
| 2770 | Ga0213872_10022770 | |||
| 2771 | Ga0213872_10034001 | |||
| 2772 | Ga0213872_10217498 | |||
| 2773 | Ga0213876_10032700 | |||
| 2774 | Ga0213876_10076761 | |||
| 2775 | Ga0213876_10144797 | |||
| 2776 | Ga0213875_10010246 | |||
| 2777 | Ga0213875_10309100 | |||
| 2778 | Ga0213871_10039146 | |||
| 2779 | Ga0207672_1002512 | |||
| 2780 | Ga0209437_102087 | |||
| 2781 | Ga0209677_100346 | |||
| 2782 | Ga0209233_1000402 | |||
| 2783 | Ga0207666_1013324 | |||
| 2784 | Ga0209673_1015007 | |||
| 2785 | Ga0207673_1002966 | |||
| 2786 | Ga0209564_1010110 | |||
| 2787 | Ga0209758_1002437 | |||
| 2788 | Ga0207697_10014111 | |||
| 2789 | Ga0207697_10027176 | |||
| 2790 | Ga0207656_10020255 | |||
| 2791 | Ga0207656_10325523 | |||
| 2792 | Ga0207653_10011706 | |||
| 2793 | Ga0207653_10085715 | |||
| 2794 | Ga0207682_10018078 | |||
| 2795 | Ga0207682_10023002 | |||
| 2796 | Ga0207692_10013797 | |||
| 2797 | Ga0207692_10234580 | |||
| 2798 | Ga0207692_10470230 | |||
| 2799 | Ga0207642_10188674 | |||
| 2800 | Ga0207642_10281136 | |||
| 2801 | Ga0207642_10340061 | |||
| 2802 | Ga0207710_10098738 | |||
| 2803 | Ga0207710_10110612 | |||
| 2804 | Ga0207710_10136388 | |||
| 2805 | Ga0207710_10569616 | |||
| 2806 | Ga0207688_10017957 | |||
| 2807 | Ga0207688_10032419 | |||
| 2808 | Ga0207680_10029231 | |||
| 2809 | Ga0207680_10057008 | |||
| 2810 | Ga0207680_10164083 | |||
| 2811 | Ga0207680_10214418 | |||
| 2812 | Ga0207680_10288643 | |||
| 2813 | Ga0207680_10514127 | |||
| 2814 | Ga0207647_10027482 | |||
| 2815 | Ga0207647_10041135 | |||
| 2816 | Ga0207647_10201857 | |||
| 2817 | Ga0207647_10220174 | |||
| 2818 | Ga0207647_10275142 | |||
| 2819 | Ga0207647_10341703 | |||
| 2820 | Ga0207685_10033118 | |||
| 2821 | Ga0207685_10093616 | |||
| 2822 | Ga0207685_10112532 | |||
| 2823 | Ga0207685_10127574 | |||
| 2824 | Ga0207685_10218696 | |||
| 2825 | Ga0207685_10271856 | |||
| 2826 | Ga0207685_10504803 | |||
| 2827 | Ga0207685_10651419 | |||
| 2828 | Ga0207685_10652877 | |||
| 2829 | Ga0207699_10021781 | |||
| 2830 | Ga0207699_10075229 | |||
| 2831 | Ga0207699_10202107 | |||
| 2832 | Ga0207699_10457832 | |||
| 2833 | Ga0207645_10083525 | |||
| 2834 | Ga0207645_10173537 | |||
| 2835 | Ga0207645_10381154 | |||
| 2836 | Ga0207643_10019057 | |||
| 2837 | Ga0207643_10036307 | |||
| 2838 | Ga0207643_10229868 | |||
| 2839 | Ga0207705_10037903 | |||
| 2840 | Ga0207705_10329417 | |||
| 2841 | Ga0207705_10965368 | |||
| 2842 | Ga0207684_10057454 | |||
| 2843 | Ga0207684_10059245 | |||
| 2844 | Ga0207684_10079032 | |||
| 2845 | Ga0207684_10132219 | |||
| 2846 | Ga0207684_10648829 | |||
| 2847 | Ga0207684_11595628 | |||
| 2848 | Ga0207654_10260322 | |||
| 2849 | Ga0207707_10043465 | |||
| 2850 | Ga0207707_10315427 | |||
| 2851 | Ga0207707_10360963 | |||
| 2852 | Ga0207707_10520062 | |||
| 2853 | Ga0207695_10000373 | |||
| 2854 | Ga0207695_10354600 | |||
| 2855 | Ga0207695_10505813 | |||
| 2856 | Ga0207695_10599499 | |||
| 2857 | Ga0207671_10053523 | |||
| 2858 | Ga0207671_10066355 | |||
| 2859 | Ga0207671_10090272 | |||
| 2860 | Ga0207671_10867702 | |||
| 2861 | Ga0207693_10035440 | |||
| 2862 | Ga0207693_10113530 | |||
| 2863 | Ga0207693_10146311 | |||
| 2864 | Ga0207693_10161471 | |||
| 2865 | Ga0207693_10338896 | |||
| 2866 | Ga0207693_10384622 | |||
| 2867 | Ga0207693_10395674 | |||
| 2868 | Ga0207663_10016641 | |||
| 2869 | Ga0207663_10101216 | |||
| 2870 | Ga0207663_10209216 | |||
| 2871 | Ga0207663_10406352 | |||
| 2872 | Ga0207663_10534523 | |||
| 2873 | Ga0207663_10534684 | |||
| 2874 | Ga0207663_10579879 | |||
| 2875 | Ga0207663_10721559 | |||
| 2876 | Ga0207660_10013681 | |||
| 2877 | Ga0207660_10485303 | |||
| 2878 | Ga0207660_10628137 | |||
| 2879 | Ga0207662_10015080 | |||
| 2880 | Ga0207662_10015662 | |||
| 2881 | Ga0207662_10353364 | |||
| 2882 | Ga0207657_10081116 | |||
| 2883 | Ga0207657_10461619 | |||
| 2884 | Ga0207657_10831295 | |||
| 2885 | Ga0207657_11301182 | |||
| 2886 | Ga0207649_10691393 | |||
| 2887 | Ga0207652_10146948 | |||
| 2888 | Ga0207652_10196399 | |||
| 2889 | Ga0207652_10513533 | |||
| 2890 | Ga0207652_11037248 | |||
| 2891 | Ga0207652_11613162 | |||
| 2892 | Ga0207646_10024612 | |||
| 2893 | Ga0207646_10062385 | |||
| 2894 | Ga0207646_10323444 | |||
| 2895 | Ga0207681_10044241 | |||
| 2896 | Ga0207681_10619943 | |||
| 2897 | Ga0207681_10884088 | |||
| 2898 | Ga0207694_10548808 | |||
| 2899 | Ga0207650_10042359 | |||
| 2900 | Ga0207650_10074168 | |||
| 2901 | Ga0207650_10676470 | |||
| 2902 | Ga0207659_10040650 | |||
| 2903 | Ga0207659_10055283 | |||
| 2904 | Ga0207659_10924743 | |||
| 2905 | Ga0207687_10108753 | |||
| 2906 | Ga0207687_10171529 | |||
| 2907 | Ga0207687_10189473 | |||
| 2908 | Ga0207687_10311030 | |||
| 2909 | Ga0207687_10446735 | |||
| 2910 | Ga0207687_11728663 | |||
| 2911 | Ga0207700_10050574 | |||
| 2912 | Ga0207700_10266281 | |||
| 2913 | Ga0207700_10290412 | |||
| 2914 | Ga0207700_10500532 | |||
| 2915 | Ga0207664_10057769 | |||
| 2916 | Ga0207664_10072284 | |||
| 2917 | Ga0207664_10190231 | |||
| 2918 | Ga0207664_10406806 | |||
| 2919 | Ga0207664_10421030 | |||
| 2920 | Ga0207664_10528836 | |||
| 2921 | Ga0207644_10041840 | |||
| 2922 | Ga0207644_10085832 | |||
| 2923 | Ga0207644_10206802 | |||
| 2924 | Ga0207644_10314235 | |||
| 2925 | Ga0207690_10144873 | |||
| 2926 | Ga0207690_10582285 | |||
| 2927 | Ga0207690_10654371 | |||
| 2928 | Ga0207690_10670192 | |||
| 2929 | Ga0207690_10996633 | |||
| 2930 | Ga0207706_10038063 | |||
| 2931 | Ga0207706_10058630 | |||
| 2932 | Ga0207706_10063148 | |||
| 2933 | Ga0207706_10107655 | |||
| 2934 | Ga0207706_10298514 | |||
| 2935 | Ga0207686_10072212 | |||
| 2936 | Ga0207686_10240942 | |||
| 2937 | Ga0207686_10370266 | |||
| 2938 | Ga0207686_10684826 | |||
| 2939 | Ga0207709_10049575 | |||
| 2940 | Ga0207709_10052277 | |||
| 2941 | Ga0207709_10258510 | |||
| 2942 | Ga0207709_10402527 | |||
| 2943 | Ga0207709_10479840 | |||
| 2944 | Ga0207709_10608380 | |||
| 2945 | Ga0207670_10041706 | |||
| 2946 | Ga0207670_10073740 | |||
| 2947 | Ga0207670_10245373 | |||
| 2948 | Ga0207670_10299663 | |||
| 2949 | Ga0207669_10020122 | |||
| 2950 | Ga0207669_10028158 | |||
| 2951 | Ga0207669_10259148 | |||
| 2952 | Ga0207669_10288327 | |||
| 2953 | Ga0207669_10779628 | |||
| 2954 | Ga0207704_10019520 | |||
| 2955 | Ga0207704_10047130 | |||
| 2956 | Ga0207704_10155737 | |||
| 2957 | Ga0207704_11546685 | |||
| 2958 | Ga0207665_10032332 | |||
| 2959 | Ga0207665_10063608 | |||
| 2960 | Ga0207665_10075494 | |||
| 2961 | Ga0207665_10200975 | |||
| 2962 | Ga0207665_10290355 | |||
| 2963 | Ga0207665_10359520 | |||
| 2964 | Ga0207665_10377588 | |||
| 2965 | Ga0207665_10655482 | |||
| 2966 | Ga0207691_10046187 | |||
| 2967 | Ga0207691_10062282 | |||
| 2968 | Ga0207691_10336746 | |||
| 2969 | Ga0207711_10224051 | |||
| 2970 | Ga0207711_10241817 | |||
| 2971 | Ga0207711_10309986 | |||
| 2972 | Ga0207711_10345749 | |||
| 2973 | Ga0207711_10584138 | |||
| 2974 | Ga0207711_10712365 | |||
| 2975 | Ga0207711_11556663 | |||
| 2976 | Ga0207689_10059772 | |||
| 2977 | Ga0207689_10069587 | |||
| 2978 | Ga0207689_10755058 | |||
| 2979 | Ga0207661_10103934 | |||
| 2980 | Ga0207661_10252382 | |||
| 2981 | Ga0207661_10489546 | |||
| 2982 | Ga0207679_10218180 | |||
| 2983 | Ga0207679_10290636 | |||
| 2984 | Ga0207679_11123884 | |||
| 2985 | Ga0207667_10055801 | |||
| 2986 | Ga0207667_10103589 | |||
| 2987 | Ga0207667_10169711 | |||
| 2988 | Ga0207651_10035608 | |||
| 2989 | Ga0207651_10056350 | |||
| 2990 | Ga0207651_10202112 | |||
| 2991 | Ga0207712_10000585 | |||
| 2992 | Ga0207712_10048335 | |||
| 2993 | Ga0207712_10064412 | |||
| 2994 | Ga0207712_10077573 | |||
| 2995 | Ga0207712_10126146 | |||
| 2996 | Ga0207712_10144232 | |||
| 2997 | Ga0207712_10247782 | |||
| 2998 | Ga0207712_10637831 | |||
| 2999 | Ga0207712_11501394 | |||
| 3000 | Ga0207668_10061777 | |||
| 3001 | Ga0207668_10089892 | |||
| 3002 | Ga0207668_10102105 | |||
| 3003 | Ga0207668_10167073 | |||
| 3004 | Ga0207668_10258154 | |||
| 3005 | Ga0207668_10640428 | |||
| 3006 | Ga0207668_10836542 | |||
| 3007 | Ga0207668_11467762 | |||
| 3008 | Ga0207640_10034177 | |||
| 3009 | Ga0207640_10371398 | |||
| 3010 | Ga0207640_10423834 | |||
| 3011 | Ga0207658_10102726 | |||
| 3012 | Ga0207658_10365241 | |||
| 3013 | Ga0207658_10410207 | |||
| 3014 | Ga0207658_10490358 | |||
| 3015 | Ga0207658_10661470 | |||
| 3016 | Ga0207658_12187782 | |||
| 3017 | Ga0207677_10073181 | |||
| 3018 | Ga0207677_10692798 | |||
| 3019 | Ga0207677_10858439 | |||
| 3020 | Ga0207703_10054702 | |||
| 3021 | Ga0207703_10071624 | |||
| 3022 | Ga0207703_10122142 | |||
| 3023 | Ga0207703_10641907 | |||
| 3024 | Ga0207703_11369969 | |||
| 3025 | Ga0207639_10082447 | |||
| 3026 | Ga0207639_10276728 | |||
| 3027 | Ga0207639_10364480 | |||
| 3028 | Ga0207639_10459927 | |||
| 3029 | Ga0207639_10585532 | |||
| 3030 | Ga0207678_10015379 | |||
| 3031 | Ga0207678_10037550 | |||
| 3032 | Ga0207678_10062555 | |||
| 3033 | Ga0207678_10078969 | |||
| 3034 | Ga0207678_10088720 | |||
| 3035 | Ga0207678_10091072 | |||
| 3036 | Ga0207678_10282334 | |||
| 3037 | Ga0207678_10831716 | |||
| 3038 | Ga0207708_10029482 | |||
| 3039 | Ga0207708_10066148 | |||
| 3040 | Ga0207708_10071628 | |||
| 3041 | Ga0207708_10085476 | |||
| 3042 | Ga0207708_10596160 | |||
| 3043 | Ga0207702_10290190 | |||
| 3044 | Ga0207702_10292819 | |||
| 3045 | Ga0207702_10639362 | |||
| 3046 | Ga0207702_10641390 | |||
| 3047 | Ga0207702_10935740 | |||
| 3048 | Ga0207641_10062575 | |||
| 3049 | Ga0207641_10088324 | |||
| 3050 | Ga0207641_11140882 | |||
| 3051 | Ga0207648_10065723 | |||
| 3052 | Ga0207648_10076181 | |||
| 3053 | Ga0207648_10121289 | |||
| 3054 | Ga0207648_10229568 | |||
| 3055 | Ga0207648_10360949 | |||
| 3056 | Ga0207648_10511333 | |||
| 3057 | Ga0207676_10072021 | |||
| 3058 | Ga0207676_10150874 | |||
| 3059 | Ga0207676_10991268 | |||
| 3060 | Ga0207676_11124931 | |||
| 3061 | Ga0207674_10023599 | |||
| 3062 | Ga0207674_10343974 | |||
| 3063 | Ga0207674_12026797 | |||
| 3064 | Ga0207675_100020156 | |||
| 3065 | Ga0207675_100024147 | |||
| 3066 | Ga0207675_100064100 | |||
| 3067 | Ga0207675_100110238 | |||
| 3068 | Ga0207675_100181364 | |||
| 3069 | Ga0207675_100687112 | |||
| 3070 | Ga0207683_10048793 | |||
| 3071 | Ga0207683_10091106 | |||
| 3072 | Ga0207683_10200171 | |||
| 3073 | Ga0207683_10265202 | |||
| 3074 | Ga0207683_11102760 | |||
| 3075 | Ga0207683_11685538 | |||
| 3076 | Ga0207698_10064868 | |||
| 3077 | Ga0207698_10086511 | |||
| 3078 | Ga0207698_10437020 | |||
| 3079 | Ga0207698_10726811 | |||
| 3080 | Ga0207698_11348378 | |||
| 3081 | Ga0209389_1052241 | |||
| 3082 | Ga0209589_1030082 | |||
| 3083 | Ga0209489_100917 | |||
| 3084 | Ga0209179_1056343 | |||
| 3085 | Ga0209588_1107203 | |||
| 3086 | Ga0209588_1212191 | |||
| 3087 | Ga0209813_10026024 | |||
| 3088 | Ga0207428_10087032 | |||
| 3089 | Ga0207428_10150666 | |||
| 3090 | Ga0207428_10765185 | |||
| 3091 | Ga0268266_10022204 | |||
| 3092 | Ga0268266_10096154 | |||
| 3093 | Ga0268266_10129863 | |||
| 3094 | Ga0268266_10187007 | |||
| 3095 | Ga0268266_10651002 | |||
| 3096 | Ga0268266_10747104 | |||
| 3097 | Ga0268266_11150034 | |||
| 3098 | Ga0268265_10005126 | |||
| 3099 | Ga0268265_10061359 | |||
| 3100 | Ga0268265_10188845 | |||
| 3101 | Ga0268264_10002941 | |||
| 3102 | Ga0268264_10241539 | |||
| 3103 | Ga0268264_10283213 | |||
| 3104 | Ga0268264_10498493 | |||
| 3105 | Ga0268264_10674219 | |||
| 3106 | Ga0268264_10938664 | |||
| 3107 | Ga0268264_12509937 | |||
| 3108 | Ga0307517_10275345 | |||
| 3109 | Ga0307515_10132155 | |||
| 3110 | Ga0307515_10135239 | |||
| 3111 | Ga0265338_10111787 | |||
| 3112 | Ga0314311_1180298 | |||
| 3113 | Ga0265760_10086322 | |||
| 3114 | Ga0265330_10015341 | |||
| 3115 | Ga0265332_10066572 | |||
| 3116 | Ga0265328_10012873 | |||
| 3117 | Ga0265328_10021593 | |||
| 3118 | Ga0265325_10081294 | |||
| 3119 | Ga0265329_10015870 | |||
| 3120 | Ga0265329_10064518 | |||
| 3121 | Ga0265340_10386724 | |||
| 3122 | Ga0265339_10023122 | |||
| 3123 | Ga0265339_10335853 | |||
| 3124 | Ga0265331_10249325 | |||
| 3125 | Ga0265331_10456075 | |||
| 3126 | Ga0265327_10064012 | |||
| 3127 | Ga0265316_10055809 | |||
| 3128 | Ga0265316_10070620 | |||
| 3129 | Ga0265316_10105171 | |||
| 3130 | Ga0265316_10217038 | |||
| 3131 | Ga0265316_10348004 | |||
| 3132 | Ga0307513_10127711 | |||
| 3133 | Ga0307513_10280811 | |||
| 3134 | Ga0307509_10133492 | |||
| 3135 | Ga0307509_10213794 | |||
| 3136 | Ga0307508_10435988 | |||
| 3137 | Ga0265314_10038605 | |||
| 3138 | Ga0265314_10267978 | |||
| 3139 | Ga0265342_10223132 | |||
| 3140 | Ga0265342_10289723 | |||
| 3141 | Ga0307516_10007599 | |||
| 3142 | Ga0307516_10283404 | |||
| 3143 | Ga0307413_11761563 | |||
| 3144 | Ga0307410_10820099 | |||
| 3145 | Ga0326468_10000972 | |||
| 3146 | Ga0307412_10447903 | |||
| 3147 | Ga0316593_10320748 | |||
| 3148 | Ga0307507_10316188 | |||
| 3149 | Ga0307510_10073274 | |||
| 3150 | Ga0307510_10239140 | |||
| 3151 | Ga0373930_0050834 | |||
| 3152 | Ga0373948_0013335 | |||
| 3153 | Ga0373950_0072790 | |||
| 3154 | Ga0373950_0103580 | |||
| 3155 | Ga0373958_0039695 | |||
| 3156 | Ga0373926_0129624 | |||
| 3157 | Ga0373926_0161906 | |||
| 3158 | Ga0373928_0052617 | |||
| 3159 | Ga0373929_0127820 | |||
| 3160 | Ga0373934_0053150 | |||
| 3161 | Ga0373934_0360956 | |||
| 3162 | Ga0373940_0129157 | |||
| 3163 | Ga0373944_0022663 | |||
| 3164 | Ga0373944_0031391 | |||
| 3165 | Ga0373944_0185074 | |||
| 3166 | Ga0373944_0278407 | |||
| 3167 | Ga0373949_0054229 | |||
| 3168 | Ga0373949_0060088 | |||
| 3169 | Ga0373951_0216243 | |||
| 3170 | Ga0373952_0082468 | |||
| 3171 | Ga0373923_0025299 | |||
| 3172 | Ga0373923_0050567 | |||
| 3173 | Ga0373923_0087226 | |||
| 3174 | Ga0373923_0118740 | |||
| 3175 | Ga0373923_0145989 | |||
| 3176 | Ga0373923_0160180 | |||
| 3177 | Ga0373923_0300089 | |||
| 3178 | Ga0373923_0348574 | |||
| 3179 | Ga0373932_0031151 | |||
| 3180 | Ga0373932_0033969 | |||
| 3181 | Ga0373936_0149967 | |||
| 3182 | Ga0373936_0172059 | |||
| 3183 | Ga0373936_0211367 | |||
| 3184 | Ga0373936_0629493 | |||
| 3185 | Ga0373939_0026226 | |||
| 3186 | Ga0373939_0164496 | |||
| 3187 | Ga0373939_0173128 | |||
| 3188 | Ga0373941_0040463 | |||
| 3189 | Ga0373941_0304236 | |||
| 3190 | Ga0373945_0040015 | |||
| 3191 | Ga0373945_0105413 | |||
| 3192 | Ga0373945_0148942 | |||
| 3193 | Ga0373945_0157335 | |||
| 3194 | Ga0373945_0425744 | |||
| 3195 | Ga0373953_0015051 | |||
| 3196 | Ga0373953_0050058 | |||
| 3197 | Ga0373953_0074586 | |||
| 3198 | Ga0373953_0480816 | |||
| 3199 | Ga0373953_0540871 | |||
| 3200 | Ga0373954_0019849 | |||
| 3201 | Ga0373954_0019918 | |||
| 3202 | Ga0373954_0028236 | |||
| 3203 | Ga0373954_0047550 | |||
| 3204 | Ga0373954_0085363 | |||
| 3205 | Ga0373954_0326512 | |||
| 3206 | Ga0373954_0399468 | |||
| 3207 | Ga0373956_0030765 | |||
| 3208 | Ga0373956_0114428 | |||
| 3209 | Ga0373956_0487274 | |||
| 3210 | Ga0373957_0016532 | |||
| 3211 | Ga0373957_0232347 | |||
| 3212 | Ga0373957_0245714 | |||
| 3213 | Ga0373960_0101701 | |||
| 3214 | Ga0373943_0080587 | |||
| 3215 | Ga0373943_0109288 | |||
| 3216 | Ga0373943_0114353 | |||
| 3217 | Ga0373943_0124022 | |||
| 3218 | Ga0373943_0270664 | |||
| 3219 | Ga0373943_0309456 | |||
| 3220 | Ga0373943_0321230 | |||
| 3221 | Ga0373943_0567817 | |||
| 3222 | Ga0373943_0572643 | |||
| 3223 | Ga0373943_0580769 | |||
| 3224 | Ga0373943_0617100 | |||
| 3225 | Ga0373943_0636921 | |||
| 3226 | Ga0373946_0006182 | |||
| 3227 | Ga0373946_0018765 | |||
| 3228 | Ga0373946_0078762 | |||
| 3229 | Ga0373946_0082082 | |||
| 3230 | Ga0373946_0186245 | |||
| 3231 | Ga0373946_0216407 | |||
| 3232 | Ga0373955_0048305 | |||
| 3233 | Ga0373955_0072544 | |||
| 3234 | Ga0373955_0147722 | |||
| 3235 | Ga0373955_0158079 | |||
| 3236 | Ga0373955_0290198 | |||
| 3237 | Ga0373955_0334770 | |||
| 3238 | Ga0373955_0342671 | |||
| 3239 | Ga0373942_0120640 | |||
| 3240 | Ga0373942_0143157 | |||
| 3241 | Ga0373961_0092534 | |||
| 3242 | Ga0373962_0011074 | |||
| 3243 | Ga0373962_0108194 | |||
| 3244 | Ga0316574_0198250 | |||
| 3245 | Ga0373924_0015840 | |||
| 3246 | Ga0373924_0018409 | |||
| 3247 | Ga0373924_0038098 | |||
| 3248 | Ga0373924_0067477 | |||
| 3249 | Ga0373924_0219718 | |||
| 3250 | Ga0373931_0159956 | |||
| 3251 | Ga0373931_0166604 | |||
| 3252 | Ga0373931_0208178 | |||
| 3253 | Ga0373931_0357718 | |||
| 3254 | Ga0373935_0056141 | |||
| 3255 | Ga0373935_0085775 | |||
| 3256 | Ga0373935_0102093 | |||
| 3257 | Ga0373935_0117294 | |||
| 3258 | Ga0373935_0120671 | |||
| 3259 | Ga0373935_0126546 | |||
| 3260 | Ga0373935_0382960 | |||
| 3261 | Ga0373935_1443899 | |||
| 3262 | Ga0373927_0049063 | |||
| 3263 | Ga0373927_0049705 | |||
| 3264 | Ga0373927_0065746 | |||
| 3265 | Ga0373927_0171715 | |||
| 3266 | Ga0373927_0263915 | |||
| 3267 | Ga0373927_0383764 | |||
| 3268 | Ga0373927_0563662 | |||
| 3269 | Ga0373927_1090734 | |||
| 3270 | Ga0373933_0029830 | |||
| 3271 | Ga0373933_0056507 | |||
| 3272 | Ga0373933_0074087 | |||
| 3273 | Ga0373933_0132843 | |||
| 3274 | Ga0373933_0234409 | |||
| 3275 | Ga0373933_0832656 | |||
| 3276 | Ga0373933_0995154 | |||
| 3277 | Ga0373947_0042460 | |||
| 3278 | Ga0373947_0076942 | |||
| 3279 | Ga0373947_0098906 | |||
| 3280 | Ga0373947_0145046 | |||
| 3281 | Ga0373947_0213055 | |||
| 3282 | Ga0373947_0260879 | |||
| 3283 | Ga0373947_0296121 | |||
| 3284 | Ga0373947_0370111 | |||
| 3285 | Ga0373947_0537903 | |||
| 3286 | Ga0373947_0799024 | |||
| 3287 | Ga0373947_0846433 | |||
| 3288 | Ga0373937_0084987 | |||
| 3289 | Ga0373937_0140309 | |||
| 3290 | Ga0373937_0147539 | |||
| 3291 | Ga0373937_0158539 | |||
| 3292 | Ga0373937_0194428 | |||
| 3293 | Ga0373937_0644374 | |||
| 3294 | Ga0373937_1573313 | |||
| 3295 | Ga0373937_1624880 | |||
| 3296 | Ga0316582_0047627 | |||
| 3297 | Ga0316582_0933269 | |||
| 3298 | Ga0373925_0067612 | |||
| 3299 | Ga0373925_0069733 | |||
| 3300 | Ga0373925_0210031 | |||
| 3301 | Ga0373925_0325420 | |||
| 3302 | Ga0373925_0356362 | |||
| 3303 | Ga0373925_0427912 | |||
| 3304 | Ga0373925_0490255 | |||
| 3305 | Ga0373925_1222496 | |||
| 3306 | Ga0373925_1616746 | |||
| 3307 | Ga0395899_0021806 | |||
| 3308 | Ga0395900_0006417 | |||
| 3309 | Ga0395900_0118804 | |||
| 3310 | Ga0395900_0163631 | |||
| 3311 | Ga0395900_0169067 | |||
| 3312 | Ga0395900_0222368 | |||
| 3313 | Ga0395900_0676247 | |||
| 3314 | Ga0395900_1280666 | |||
| 3315 | Ga0395900_1799298 | |||
| 3316 | Ga0395898_0017413 | |||
| 3317 | Ga0395898_0047908 | |||
| 3318 | Ga0395898_0407867 | |||
| 3319 | Ga0395898_0420041 | |||
| 3320 | Ga0395898_0993533 | |||
| 3321 | Ga0395898_1010067 | |||
| 3322 | Ga0395905_0028981 | |||
| 3323 | Ga0395905_0049044 | |||
| 3324 | Ga0395905_0091869 | |||
| 3325 | Ga0395905_0098054 | |||
| 3326 | Ga0395905_0825347 | |||
| 3327 | Ga0436364_0326510 | |||
| 3328 | Ga0436364_0962972 | |||
| 3329 | Ga0436364_1456246 | |||
| 3330 | Ga0395901_0059404 | |||
| 3331 | Ga0395901_0144785 | |||
| 3332 | Ga0395901_0199103 | |||
| 3333 | Ga0395901_0362760 | |||
| 3334 | Ga0400485_04215 | |||
| 3335 | Ga0400485_16768 | |||
| 3336 | Ga0400488_47058 | |||
| 3337 | Ga0400486_01382 | |||
| 3338 | Ga0400486_07939 | |||
| 3339 | Ga0400486_14467 | |||
| 3340 | Ga0400486_23044 | |||
| 3341 | Ga0400483_111038 | |||
| 3342 | Ga0400483_212980 | |||
| 3343 | Ga0400487_54562 | |||
| 3344 | Ga0436365_0243347 | |||
| 3345 | Ga0436365_0583808 | |||
| 3346 | Ga0436365_0658513 | |||
| 3347 | Ga0436365_0771598 | |||
| 3348 | Ga0436360_0073076 | |||
| 3349 | Ga0436360_0074255 | |||
| 3350 | Ga0436360_0361390 | |||
| 3351 | Ga0436360_0645085 | |||
| 3352 | Ga0436361_0060530 | |||
| 3353 | Ga0436361_0085954 | |||
| 3354 | Ga0436361_0376942 | |||
| 3355 | Ga0436361_0720791 | |||
| 3356 | Ga0436361_1074467 | |||
| 3357 | Ga0436363_1069702 | |||
| 3358 | Ga0436363_1090990 | |||
| 3359 | Ga0436362_0436830 | |||
| 3360 | Ga0439453_0000974 | |||
| 3361 | Ga0439453_0002632 | |||
| 3362 | Ga0439453_0002710 | |||
| 3363 | Ga0439466_0086054 | |||
| 3364 | Ga0439466_0220831 | |||
| 3365 | Ga0439465_0047282 | |||
| 3366 | Ga0451791_1072700 | |||
| 3367 | Ga0451793_1805825 | |||
| 3368 | Ga0451833_0245952 | |||
| 3369 | Ga0451839_1046304 | |||
| 3370 | Ga0451845_0321414 | |||
| 3371 | Ga0451849_0779732 | |||
| 3372 | Ga0451851_0301071 | |||
| 3373 | Ga0451851_0384489 | |||
| 3374 | Ga0451853_1441035 | |||
| 3375 | Ga0439441_011328 | |||
| 3376 | Ga0439441_017699 | |||
| 3377 | Ga0439443_000643 | |||
| 3378 | Ga0439443_001673 | |||
| 3379 | Ga0439443_027850 | |||
| 3380 | Ga0439448_0087253 | |||
| 3381 | Ga0439451_018834 | |||
| 3382 | Ga0439451_024473 | |||
| 3383 | Ga0439454_022390 | |||
| 3384 | Ga0439455_0071297 | |||
| 3385 | Ga0439456_010219 | |||
| 3386 | Ga0439456_038963 | |||
| 3387 | Ga0450923_011547 | |||
| 3388 | Ga0450923_031299 | |||
| 3389 | Ga0450894_051929 | |||
| 3390 | Ga0450899_012083 | |||
| 3391 | Ga0450905_018577 | |||
| 3392 | Ga0450905_019166 | |||
| 3393 | Ga0450889_000730 | |||
| 3394 | Ga0439446_0086363 | |||
| 3395 | Ga0439458_0032965 | |||
| 3396 | Ga0439434_0038583 | |||
| 3397 | Ga0439435_0000915 | |||
| 3398 | Ga0439435_0005323 | |||
| 3399 | Ga0439435_0064266 | |||
| 3400 | Ga0439444_0012859 | |||
| 3401 | Ga0439444_0017794 | |||
| 3402 | Ga0439444_0029522 | |||
| 3403 | Ga0439464_0015957 | |||
| 3404 | Ga0439464_0058586 | |||
| 3405 | Ga0439464_0168107 | |||
| 3406 | Ga0439460_0003019 | |||
| 3407 | Ga0439460_0004287 | |||
| 3408 | Ga0439460_0010794 | |||
| 3409 | Ga0439460_0290017 | |||
| 3410 | Ga0450918_004800 | |||
| 3411 | Ga0439440_0006576 | |||
| 3412 | Ga0439440_0007577 | |||
| 3413 | Ga0439440_0054601 | |||
| 3414 | Ga0439440_0066460 | |||
| 3415 | Ga0466969_0025434 | |||
| 3416 | Ga0466969_0106421 | |||
| 3417 | Ga0466969_0213760 | |||
| 3418 | Ga0466972_0030572 | |||
| 3419 | Ga0466972_0601028 | |||
| 3420 | Ga0466965_0028301 | |||
| 3421 | Ga0466965_0089407 | |||
| 3422 | Ga0466966_0059696 | |||
| 3423 | Ga0466966_0114637 | |||
| 3424 | Ga0466966_0239806 | |||
| 3425 | Ga0466966_0692337 | |||
| 3426 | Ga0466966_0728717 | |||
| 3427 | Ga0466961_0047623 | |||
| 3428 | Ga0466961_0104863 | |||
| 3429 | Ga0466961_0131493 | |||
| 3430 | Ga0466964_0022238 | |||
| 3431 | Ga0466964_0114626 | |||
| 3432 | Ga0466964_0139074 | |||
| 3433 | Ga0466971_0022392 | |||
| 3434 | Ga0466971_0077053 | |||
| 3435 | Ga0466968_0018946 | |||
| 3436 | Ga0466968_0137700 | |||
| 3437 | Ga0466970_0031500 | |||
| 3438 | Ga0466970_0033311 | |||
| 3439 | Ga0466957_0030133 | |||
| 3440 | Ga0466957_0805755 | |||
| 3441 | Ga0466959_0007283 | |||
| 3442 | Ga0466959_0044833 | |||
| 3443 | Ga0466959_0048707 | |||
| 3444 | Ga0466959_0059094 | |||
| 3445 | Ga0466958_0038401 | |||
| 3446 | Ga0466958_0080061 | |||
| 3447 | Ga0466958_0118709 | |||
| 3448 | Ga0466967_0055644 | |||
| 3449 | Ga0466967_0377913 | |||
| 3450 | Ga0466967_0801456 | |||
| 3451 | Ga0495617_011509 | |||
| 3452 | Ga0495617_124154 | |||
| 3453 | Ga0495617_212901 | |||
| 3454 | Ga0495617_235163 | |||
| 3455 | Ga0495592_0034042 | |||
| 3456 | Ga0495592_0062015 | |||
| 3457 | Ga0495592_0115689 | |||
| 3458 | Ga0495592_0125527 | |||
| 3459 | Ga0495592_0394875 | |||
| 3460 | Ga0495592_0878709 | |||
| 3461 | Ga0495603_0028379 | |||
| 3462 | Ga0495603_0043799 | |||
| 3463 | Ga0495603_0084848 | |||
| 3464 | Ga0495603_0333379 | |||
| 3465 | Ga0495603_0537240 | |||
| 3466 | Ga0495590_0052462 | |||
| 3467 | Ga0495590_0170136 | |||
| 3468 | Ga0495591_040818 | |||
| 3469 | Ga0495629_0009117 | |||
| 3470 | Ga0495629_0070675 | |||
| 3471 | Ga0495629_0124723 | |||
| 3472 | Ga0495629_0176819 | |||
| 3473 | Ga0495629_0309682 | |||
| 3474 | Ga0495629_0430622 | |||
| 3475 | Ga0495629_0726952 | |||
| 3476 | Ga0495638_0045797 | |||
| 3477 | Ga0495638_0103122 | |||
| 3478 | Ga0495638_0172792 | |||
| 3479 | Ga0495638_0242461 | |||
| 3480 | Ga0495641_0026128 | |||
| 3481 | Ga0495641_0082650 | |||
| 3482 | Ga0495641_0110844 | |||
| 3483 | Ga0495641_0143317 | |||
| 3484 | Ga0495641_0550869 | |||
| 3485 | Ga0495651_0061261 | |||
| 3486 | Ga0495651_0070182 | |||
| 3487 | Ga0495651_0107552 | |||
| 3488 | Ga0495651_0152403 | |||
| 3489 | Ga0495651_0202741 | |||
| 3490 | Ga0495653_0056811 | |||
| 3491 | Ga0495653_0060562 | |||
| 3492 | Ga0495653_0157331 | |||
| 3493 | Ga0495653_0261320 | |||
| 3494 | Ga0495650_0065317 | |||
| 3495 | Ga0495580_0089774 | |||
| 3496 | Ga0495580_0315671 | |||
| 3497 | Ga0495580_0463423 | |||
| 3498 | Ga0495580_0635017 | |||
| 3499 | Ga0495582_0020733 | |||
| 3500 | Ga0495582_0032858 | |||
| 3501 | Ga0495582_0043305 | |||
| 3502 | Ga0495582_0163725 | |||
| 3503 | Ga0495582_0317432 | |||
| 3504 | Ga0495605_0028279 | |||
| 3505 | Ga0495605_0030113 | |||
| 3506 | Ga0495605_0190743 | |||
| 3507 | Ga0495639_0049712 | |||
| 3508 | Ga0495639_0394540 | |||
| 3509 | Ga0495662_0026586 | |||
| 3510 | Ga0495662_0027992 | |||
| 3511 | Ga0495662_0046409 | |||
| 3512 | Ga0495662_0076352 | |||
| 3513 | Ga0495662_0092732 | |||
| 3514 | Ga0495662_0151838 | |||
| 3515 | Ga0495662_0238744 | |||
| 3516 | Ga0495662_0417372 | |||
| 3517 | Ga0495664_0077133 | |||
| 3518 | Ga0495664_0127458 | |||
| 3519 | Ga0495664_0254220 | |||
| 3520 | Ga0495584_0032240 | |||
| 3521 | Ga0495584_0033821 | |||
| 3522 | Ga0495584_0059407 | |||
| 3523 | Ga0495584_0169127 | |||
| 3524 | Ga0495584_0386770 | |||
| 3525 | Ga0495585_0060776 | |||
| 3526 | Ga0495585_0068173 | |||
| 3527 | Ga0495585_0079974 | |||
| 3528 | Ga0495585_0093234 | |||
| 3529 | Ga0495585_0153374 | |||
| 3530 | Ga0495594_0117169 | |||
| 3531 | Ga0495594_0202441 | |||
| 3532 | Ga0495594_0293299 | |||
| 3533 | Ga0495594_0354465 | |||
| 3534 | Ga0495594_0374714 | |||
| 3535 | Ga0495594_0544935 | |||
| 3536 | Ga0495594_0673723 | |||
| 3537 | Ga0495594_0781265 | |||
| 3538 | Ga0495596_0022489 | |||
| 3539 | Ga0495596_0041204 | |||
| 3540 | Ga0495596_0056584 | |||
| 3541 | Ga0495596_0168659 | |||
| 3542 | Ga0495596_0421846 | |||
| 3543 | Ga0495607_0044200 | |||
| 3544 | Ga0495607_0063211 | |||
| 3545 | Ga0495607_0191272 | |||
| 3546 | Ga0495607_0209316 | |||
| 3547 | Ga0495607_0458032 | |||
| 3548 | Ga0495583_0031533 | |||
| 3549 | Ga0495583_0237173 | |||
| 3550 | Ga0495583_0293689 | |||
| 3551 | Ga0495606_0051477 | |||
| 3552 | Ga0495608_0063326 | |||
| 3553 | Ga0495608_0066556 | |||
| 3554 | Ga0495608_0084137 | |||
| 3555 | Ga0495608_0089109 | |||
| 3556 | Ga0495608_0264381 | |||
| 3557 | Ga0495608_0315023 | |||
| 3558 | Ga0495608_0346439 | |||
| 3559 | Ga0495608_0361855 | |||
| 3560 | Ga0495610_0085229 | |||
| 3561 | Ga0495616_0035314 | |||
| 3562 | Ga0495616_0171757 | |||
| 3563 | Ga0495616_0339392 | |||
| 3564 | Ga0495618_0030788 | |||
| 3565 | Ga0495618_0045946 | |||
| 3566 | Ga0495618_0239771 | |||
| 3567 | Ga0495618_0300502 | |||
| 3568 | Ga0495620_0027304 | |||
| 3569 | Ga0495620_0140753 | |||
| 3570 | Ga0495620_0418237 | |||
| 3571 | Ga0495628_0064743 | |||
| 3572 | Ga0495628_0071936 | |||
| 3573 | Ga0495628_0073219 | |||
| 3574 | Ga0495628_0077027 | |||
| 3575 | Ga0495628_0147428 | |||
| 3576 | Ga0495628_0340875 | |||
| 3577 | Ga0495628_0343117 | |||
| 3578 | Ga0495628_0769235 | |||
| 3579 | Ga0495630_0067618 | |||
| 3580 | Ga0495630_0083785 | |||
| 3581 | Ga0495630_0099150 | |||
| 3582 | Ga0495630_0124283 | |||
| 3583 | Ga0495630_0126766 | |||
| 3584 | Ga0495630_0394297 | |||
| 3585 | Ga0495630_0447945 | |||
| 3586 | Ga0495630_0608549 | |||
| 3587 | Ga0495631_0021185 | |||
| 3588 | Ga0495631_0021998 | |||
| 3589 | Ga0495631_0038774 | |||
| 3590 | Ga0495631_0097429 | |||
| 3591 | Ga0495631_0270570 | |||
| 3592 | Ga0495632_0042906 | |||
| 3593 | Ga0495632_0140395 | |||
| 3594 | Ga0495632_0396750 | |||
| 3595 | Ga0495632_0397598 | |||
| 3596 | Ga0495637_0068306 | |||
| 3597 | Ga0495637_0140547 | |||
| 3598 | Ga0495637_0180979 | |||
| 3599 | Ga0495643_0043886 | |||
| 3600 | Ga0495643_0159367 | |||
| 3601 | Ga0495643_0166248 | |||
| 3602 | Ga0495643_0310259 | |||
| 3603 | Ga0495644_0015161 | |||
| 3604 | Ga0495644_0058722 | |||
| 3605 | Ga0495644_0081101 | |||
| 3606 | Ga0495644_0204042 | |||
| 3607 | Ga0495648_0035636 | |||
| 3608 | Ga0495648_0213465 | |||
| 3609 | Ga0495663_0006259 | |||
| 3610 | Ga0495663_0024013 | |||
| 3611 | Ga0495663_0088554 | |||
| 3612 | Ga0495666_0049718 | |||
| 3613 | Ga0495666_0055281 | |||
| 3614 | Ga0495666_0065508 | |||
| 3615 | Ga0495666_0107399 | |||
| 3616 | Ga0495642_0053027 | |||
| 3617 | Ga0495652_0045362 | |||
| 3618 | Ga0495652_0084339 | |||
| 3619 | Ga0495652_0097164 | |||
| 3620 | Ga0495652_0148276 | |||
| 3621 | Ga0495652_0163337 | |||
| 3622 | Ga0495652_0176844 | |||
| 3623 | Ga0495652_0316794 | |||
| 3624 | Ga0495652_0467017 | |||
| 3625 | Ga0495654_0027733 | |||
| 3626 | Ga0495654_0164710 | |||
| 3627 | Ga0495665_0034337 | |||
| 3628 | Ga0495665_0124543 | |||
| 3629 | Ga0495665_0485708 | |||
| 3630 | Ga0495640_0026054 | |||
| 3631 | Ga0495640_0044793 | |||
| 3632 | Ga0495640_0056221 | |||
| 3633 | Ga0495640_0222683 | |||
| 3634 | Ga0495640_0357585 | |||
| 3635 | Ga0495640_0560534 | |||
| 3636 | Ga0495640_0660720 | |||
| 3637 | Ga0495586_0015600 | |||
| 3638 | Ga0495586_0048376 | |||
| 3639 | Ga0495586_0170467 | |||
| 3640 | Ga0495587_0039574 | |||
| 3641 | Ga0495587_0043246 | |||
| 3642 | Ga0495587_0048454 | |||
| 3643 | Ga0495587_0069942 | |||
| 3644 | Ga0495587_0449867 | |||
| 3645 | Ga0495598_0011363 | |||
| 3646 | Ga0495598_0091536 | |||
| 3647 | Ga0495609_0010002 | |||
| 3648 | Ga0495609_0240184 | |||
| 3649 | Ga0495609_0308001 | |||
| 3650 | Ga0495609_0374734 | |||
| 3651 | Ga0495621_0133315 | |||
| 3652 | Ga0495621_0192741 | |||
| 3653 | Ga0495621_0237032 | |||
| 3654 | Ga0495597_0019065 | |||
| 3655 | Ga0495597_0155503 | |||
| 3656 | Ga0495645_0078325 | |||
| 3657 | Ga0495645_0122032 | |||
| 3658 | Ga0495645_0129608 | |||
| 3659 | Ga0495645_0215278 | |||
| 3660 | Ga0495645_0262614 | |||
| 3661 | Ga0495645_0778157 | |||
| 3662 | Ga0495622_0112229 | |||
| 3663 | Ga0495622_0197118 | |||
| 3664 | Ga0495622_0407221 | |||
| 3665 | Ga0495633_0105180 | |||
| 3666 | Ga0495633_0156527 | |||
| 3667 | Ga0495633_0202617 | |||
| 3668 | Ga0495667_0060445 | |||
| 3669 | Ga0495667_0078636 | |||
| 3670 | Ga0495667_0193854 | |||
| 3671 | Ga0495667_0216710 | |||
| 3672 | Ga0495667_0292083 | |||
| 3673 | Ga0495667_0441970 | |||
| 3674 | Ga0495667_0507152 | |||
| 3675 | Ga0495656_0017487 | |||
| 3676 | Ga0495656_0031010 | |||
| 3677 | Ga0495656_0088110 | |||
| 3678 | Ga0495656_0091682 | |||
| 3679 | Ga0495656_0102017 | |||
| 3680 | Ga0495656_0106442 | |||
| 3681 | Ga0495656_0242791 | |||
| 3682 | Ga0495668_0035060 | |||
| 3683 | Ga0495668_0049863 | |||
| 3684 | Ga0495668_0053952 | |||
| 3685 | Ga0495668_0207318 | |||
| 3686 | Ga0495668_0291816 | |||
| 3687 | Ga0495668_0440815 | |||
| 3688 | Ga0495634_0054370 | |||
| 3689 | Ga0495634_0057052 | |||
| 3690 | Ga0495634_0173727 | |||
| 3691 | Ga0495634_0493158 | |||
| 3692 | Ga0495634_0524633 | |||
| 3693 | Ga0495634_0619093 | |||
| 3694 | Ga0495611_0022373 | |||
| 3695 | Ga0495611_0053042 | |||
| 3696 | Ga0495611_0071167 | |||
| 3697 | Ga0495611_0085756 | |||
| 3698 | Ga0495611_0104001 | |||
| 3699 | Ga0495611_0134367 | |||
| 3700 | Ga0495625_0044700 | |||
| 3701 | Ga0495625_0063282 | |||
| 3702 | Ga0495625_0259517 | |||
| 3703 | Ga0495625_0345969 | |||
| 3704 | Ga0495635_0046621 | |||
| 3705 | Ga0495635_0068736 | |||
| 3706 | Ga0495635_0139156 | |||
| 3707 | Ga0495635_0206223 | |||
| 3708 | Ga0495635_0210582 | |||
| 3709 | Ga0495635_0241895 | |||
| 3710 | Ga0495635_0308540 | |||
| 3711 | Ga0495659_0032186 | |||
| 3712 | Ga0495659_0068228 | |||
| 3713 | Ga0495659_0095983 | |||
| 3714 | Ga0495661_0090647 | |||
| 3715 | Ga0495661_0136596 | |||
| 3716 | Ga0495661_0170788 | |||
| 3717 | Ga0495661_0378962 | |||
| 3718 | Ga0495588_0162852 | |||
| 3719 | Ga0495588_0201426 | |||
| 3720 | Ga0495588_0209609 | |||
| 3721 | Ga0495588_0213189 | |||
| 3722 | Ga0495588_0588948 | |||
| 3723 | Ga0495657_0047293 | |||
| 3724 | Ga0495657_0063438 | |||
| 3725 | Ga0495657_0390353 | |||
| 3726 | Ga0495657_0718762 | |||
| 3727 | Ga0495599_0020141 | |||
| 3728 | Ga0495599_0049373 | |||
| 3729 | Ga0495599_0107415 | |||
| 3730 | Ga0495599_0146384 | |||
| 3731 | Ga0495623_0039816 | |||
| 3732 | Ga0495623_0097935 | |||
| 3733 | Ga0495623_0115130 | |||
| 3734 | Ga0495646_0046026 | |||
| 3735 | Ga0495646_0052986 | |||
| 3736 | Ga0495646_0161201 | |||
| 3737 | Ga0495646_0301501 | |||
| 3738 | Ga0495646_0657580 | |||
| 3739 | Ga0495647_0124910 | |||
| 3740 | Ga0495647_0189260 | |||
| 3741 | Ga0495658_0036107 | |||
| 3742 | Ga0495658_0058866 | |||
| 3743 | Ga0495658_0270609 | |||
| 3744 | Ga0495658_0296851 | |||
| 3745 | Ga0495669_0023253 | |||
| 3746 | Ga0495669_0078578 | |||
| 3747 | Ga0495669_0163317 | |||
| 3748 | Ga0495613_0092975 | |||
| 3749 | Ga0495613_0130557 | |||
| 3750 | Ga0495613_0190105 | |||
| 3751 | Ga0495613_0203450 | |||
| 3752 | Ga0495613_0528363 | |||
| 3753 | Ga0495613_0946123 | |||
| 3754 | Ga0495624_0074942 | |||
| 3755 | Ga0495624_0269087 | |||
| 3756 | Ga0495624_0307959 | |||
| 3757 | Ga0495624_0357985 | |||
| 3758 | Ga0495624_0434106 | |||
| 3759 | Ga0495624_0594687 | |||
| 3760 | Ga0495670_0102677 | |||
| 3761 | Ga0495670_0287468 | |||
| 3762 | Ga0495670_0356454 | |||
| 3763 | Ga0495671_0019113 | |||
| 3764 | Ga0495671_0049524 | |||
| 3765 | Ga0495649_0037041 | |||
| 3766 | Ga0495649_0113526 | |||
| 3767 | Ga0495589_0031511 | |||
| 3768 | Ga0495589_0054354 | |||
| 3769 | Ga0495589_0063925 | |||
| 3770 | Ga0495589_0157741 | |||
| 3771 | Ga0495589_0253341 | |||
| 3772 | Ga0495600_0040708 | |||
| 3773 | Ga0495600_0048766 | |||
| 3774 | Ga0495600_0108977 | |||
| 3775 | Ga0495600_0147244 | |||
| 3776 | Ga0495600_0153516 | |||
| 3777 | Ga0495600_0290222 | |||
| 3778 | Ga0495600_0334437 | |||
| 3779 | Ga0495660_0040912 | |||
| 3780 | Ga0495660_0373796 | |||
| 3781 | Ga0495581_0044716 | |||
| 3782 | Ga0495581_0046483 | |||
| 3783 | Ga0495581_0150808 | |||
| 3784 | Ga0495581_0404522 | |||
| 3785 | Ga0495581_0477351 | |||
| 3786 | Ga0495604_0065677 | |||
| 3787 | Ga0495604_0082032 | |||
| 3788 | Ga0495604_0140151 | |||
| 3789 | Ga0495604_0156385 | |||
| 3790 | Ga0495604_0169557 | |||
| 3791 | Ga0495604_0304468 | |||
| 3792 | Ga0495604_0756387 | |||
| 3793 | Ga0495636_0025240 | |||
| 3794 | Ga0495636_0075677 | |||
| 3795 | Ga0495636_0230194 | |||
| 3796 | Ga0495674_0070814 | |||
| 3797 | Ga0495674_0082948 | |||
| 3798 | Ga0495674_0098331 | |||
| 3799 | Ga0495674_0107191 | |||
| 3800 | Ga0495674_0223786 | |||
| 3801 | Ga0495674_0271300 | |||
| 3802 | Ga0495674_0357593 | |||
| 3803 | Ga0495674_0636627 | |||
| 3804 | Ga0495674_0686008 | |||
| 3805 | Ga0495674_0845580 | |||
| 3806 | Ga0495672_0020520 | |||
| 3807 | Ga0495676_0076229 | |||
| 3808 | Ga0495676_0320470 | |||
| 3809 | Ga0495676_0394196 | |||
| 3810 | Ga0495676_0733148 | |||
| 3811 | Ga0495676_0770011 | |||
| 3812 | Ga0495680_0068759 | |||
| 3813 | Ga0495680_0084686 | |||
| 3814 | Ga0495680_0108851 | |||
| 3815 | Ga0495680_0110977 | |||
| 3816 | Ga0495680_0125317 | |||
| 3817 | Ga0495680_0271084 | |||
| 3818 | Ga0495683_0105953 | |||
| 3819 | Ga0495683_0151155 | |||
| 3820 | Ga0495683_0379029 | |||
| 3821 | Ga0495687_035270 | |||
| 3822 | Ga0495687_209566 | |||
| 3823 | Ga0495675_0030291 | |||
| 3824 | Ga0495675_0137113 | |||
| 3825 | Ga0495675_0190196 | |||
| 3826 | Ga0495675_0387461 | |||
| 3827 | Ga0495677_0030661 | |||
| 3828 | Ga0495677_0074035 | |||
| 3829 | Ga0495677_0086230 | |||
| 3830 | Ga0495677_0090202 | |||
| 3831 | Ga0495677_0349795 | |||
| 3832 | Ga0495679_016898 | |||
| 3833 | Ga0495679_123362 | |||
| 3834 | Ga0495685_016847 | |||
| 3835 | Ga0495685_040740 | |||
| 3836 | Ga0495685_083333 | |||
| 3837 | Ga0495673_0014867 | |||
| 3838 | Ga0495673_0143002 | |||
| 3839 | Ga0495673_0233448 | |||
| 3840 | Ga0495681_0120447 | |||
| 3841 | Ga0495681_0141787 | |||
| 3842 | Ga0495681_0146476 | |||
| 3843 | Ga0495684_0063483 | |||
| 3844 | Ga0495684_0190957 | |||
| 3845 | Ga0495684_0403312 | |||
| 3846 | Ga0495684_0410765 | |||
| 3847 | Ga0495686_0019899 | |||
| 3848 | Ga0495686_0036615 | |||
| 3849 | Ga0495686_0372477 | |||
| 3850 | Ga0495593_0026520 | |||
| 3851 | Ga0495593_0029374 | |||
| 3852 | Ga0495593_0076571 | |||
| 3853 | Ga0495593_0546373 | |||
| 3854 | Ga0495602_0073723 | |||
| 3855 | Ga0495602_0087738 | |||
| 3856 | Ga0495602_0087779 | |||
| 3857 | Ga0495602_0094258 | |||
| 3858 | Ga0495602_0104315 | |||
| 3859 | Ga0495602_0133355 | |||
| 3860 | Ga0495602_0262546 | |||
| 3861 | Ga0495602_0463231 | |||
| 3862 | Ga0495602_0608660 | |||
| 3863 | Ga0495614_0021101 | |||
| 3864 | Ga0495614_0069460 | |||
| 3865 | Ga0495614_0167900 | |||
| 3866 | Ga0495615_0005371 | |||
| 3867 | Ga0495626_0078934 | |||
| 3868 | Ga0495626_0082699 | |||
| 3869 | Ga0495626_0125730 | |||
| 3870 | Ga0496100_0028776 | |||
| 3871 | Ga0496100_0031597 | |||
| 3872 | Ga0496100_0159178 | |||
| 3873 | Ga0496100_0173868 | |||
| 3874 | Ga0496100_0250894 | |||
| 3875 | Ga0496100_0395550 | |||
| 3876 | Ga0496100_0574853 | |||
| 3877 | Ga0496100_0706214 | |||
| 3878 | Ga0496100_0708531 | |||
| 3879 | Ga0496100_0741270 | |||
| 3880 | Ga0496100_0879341 | |||
| 3881 | Ga0496101_0033751 | |||
| 3882 | Ga0496101_0035887 | |||
| 3883 | Ga0496101_0038247 | |||
| 3884 | Ga0496101_0044644 | |||
| 3885 | Ga0496101_0115824 | |||
| 3886 | Ga0496101_0175211 | |||
| 3887 | Ga0496101_0209661 | |||
| 3888 | Ga0496101_0241630 | |||
| 3889 | Ga0496101_0280317 | |||
| 3890 | Ga0496101_0283747 | |||
| 3891 | Ga0496101_0460772 | |||
| 3892 | Ga0496102_0049876 | |||
| 3893 | Ga0496102_0066054 | |||
| 3894 | Ga0496102_0070976 | |||
| 3895 | Ga0496102_0092734 | |||
| 3896 | Ga0496102_0122950 | |||
| 3897 | Ga0496102_0200069 | |||
| 3898 | Ga0496102_0206161 | |||
| 3899 | Ga0496102_0244581 | |||
| 3900 | Ga0496102_0853763 | |||
| 3901 | Ga0496102_1095028 | |||
| 3902 | Ga0496102_1833519 | |||
| 3903 | Ga0496103_0002742 | |||
| 3904 | Ga0496103_0014996 | |||
| 3905 | Ga0496103_0040276 | |||
| 3906 | Ga0496103_0071615 | |||
| 3907 | Ga0496103_0284373 | |||
| 3908 | Ga0496103_0445742 | |||
| 3909 | Ga0496103_0494078 | |||
| 3910 | Ga0496103_0717327 | |||
| 3911 | Ga0496104_0045734 | |||
| 3912 | Ga0496104_0059400 | |||
| 3913 | Ga0496104_0104024 | |||
| 3914 | Ga0496104_0108983 | |||
| 3915 | Ga0496104_0111917 | |||
| 3916 | Ga0496104_0113312 | |||
| 3917 | Ga0496104_0430973 | |||
| 3918 | Ga0496104_0466879 | |||
| 3919 | Ga0496104_0588308 | |||
| 3920 | Ga0496104_0847309 | |||
| 3921 | Ga0496104_0862176 | |||
| 3922 | Ga0496105_0046657 | |||
| 3923 | Ga0496105_0107197 | |||
| 3924 | Ga0496105_0193747 | |||
| 3925 | Ga0496105_0282763 | |||
| 3926 | Ga0496105_0307149 | |||
| 3927 | Ga0496105_0803009 | |||
| 3928 | Ga0496105_1026656 | |||
| 3929 | Ga0496106_0033983 | |||
| 3930 | Ga0496106_0041823 | |||
| 3931 | Ga0496106_0047349 | |||
| 3932 | Ga0496106_0063367 | |||
| 3933 | Ga0496106_0078768 | |||
| 3934 | Ga0496106_0140505 | |||
| 3935 | Ga0496106_0258857 | |||
| 3936 | Ga0496106_0303710 | |||
| 3937 | Ga0496106_0489559 | |||
| 3938 | Ga0496106_0530453 | |||
| 3939 | Ga0496106_0583970 | |||
| 3940 | Ga0496106_0620293 | |||
| 3941 | Ga0496106_0714773 | |||
| 3942 | Ga0496107_0038488 | |||
| 3943 | Ga0496107_0041834 | |||
| 3944 | Ga0496107_0046145 | |||
| 3945 | Ga0496107_0046304 | |||
| 3946 | Ga0496107_0050391 | |||
| 3947 | Ga0496107_0097275 | |||
| 3948 | Ga0496107_0165038 | |||
| 3949 | Ga0496107_0258697 | |||
| 3950 | Ga0496107_0260074 | |||
| 3951 | Ga0496107_0414938 | |||
| 3952 | Ga0496108_0049607 | |||
| 3953 | Ga0496108_0056182 | |||
| 3954 | Ga0496108_0057291 | |||
| 3955 | Ga0496108_0065118 | |||
| 3956 | Ga0496108_0104141 | |||
| 3957 | Ga0496108_0132378 | |||
| 3958 | Ga0496108_0233812 | |||
| 3959 | Ga0496108_0289327 | |||
| 3960 | Ga0496108_1449746 | |||
| 3961 | Ga0496108_1794362 | |||
| 3962 | Ga0496109_0064560 | |||
| 3963 | Ga0496109_0071023 | |||
| 3964 | Ga0496109_0099071 | |||
| 3965 | Ga0496109_0125562 | |||
| 3966 | Ga0496109_0161194 | |||
| 3967 | Ga0496109_0277168 | |||
| 3968 | Ga0496109_0312563 | |||
| 3969 | Ga0496109_0646531 | |||
| 3970 | Ga0496109_0771174 | |||
| 3971 | Ga0496109_1722258 | |||
| 3972 | Ga0496110_0029621 | |||
| 3973 | Ga0496110_0054071 | |||
| 3974 | Ga0496110_0066313 | |||
| 3975 | Ga0496110_0190197 | |||
| 3976 | Ga0496110_0317333 | |||
| 3977 | Ga0496110_0333749 | |||
| 3978 | Ga0496110_0393917 | |||
| 3979 | Ga0496110_0573283 | |||
| 3980 | Ga0496111_0043157 | |||
| 3981 | Ga0496111_0102061 | |||
| 3982 | Ga0496112_0080792 | |||
| 3983 | Ga0496112_0088190 | |||
| 3984 | Ga0496112_0157687 | |||
| 3985 | Ga0496112_0184317 | |||
| 3986 | Ga0496112_0213937 | |||
| 3987 | Ga0496112_0231503 | |||
| 3988 | Ga0496112_0277572 | |||
| 3989 | Ga0496112_0530485 | |||
| 3990 | Ga0496112_0896006 | |||
| 3991 | Ga0496113_0079818 | |||
| 3992 | Ga0496113_0245033 | |||
| 3993 | Ga0496113_0261368 | |||
| 3994 | Ga0496113_0320469 | |||
| 3995 | Ga0496113_0389117 | |||
| 3996 | Ga0496113_0570480 | |||
| 3997 | Ga0496113_0648512 | |||
| 3998 | Ga0496113_0758133 | |||
| 3999 | Ga0496114_0048749 | |||
| 4000 | Ga0496114_0055981 | |||
| 4001 | Ga0496114_0179653 | |||
| 4002 | Ga0496114_0217838 | |||
| 4003 | Ga0496114_0377381 | |||
| 4004 | Ga0496114_0469736 | |||
| 4005 | Ga0496115_0048757 | |||
| 4006 | Ga0496115_0057562 | |||
| 4007 | Ga0496115_0094618 | |||
| 4008 | Ga0496115_0110092 | |||
| 4009 | Ga0496115_0110839 | |||
| 4010 | Ga0496115_0185200 | |||
| 4011 | Ga0496115_0192847 | |||
| 4012 | Ga0496115_0382083 | |||
| 4013 | Ga0496115_0388745 | |||
| 4014 | Ga0496115_0629148 | |||
| 4015 | Ga0496115_1102892 | |||
| 4016 | Ga0496116_0010933 | |||
| 4017 | Ga0496117_0122713 | |||
| 4018 | Ga0496118_0148601 | |||
| 4019 | Ga0496119_0005832 | |||
| 4020 | Ga0496119_0010762 | |||
| 4021 | Ga0496119_0229257 | |||
| 4022 | Ga0496120_0039244 | |||
| 4023 | Ga0496121_0017696 | |||
| 4024 | Ga0496121_0027619 | |||
| 4025 | Ga0496121_0052148 | |||
| 4026 | Ga0496121_0069941 | |||
| 4027 | Ga0496121_0102368 | |||
| 4028 | Ga0496122_0012905 | |||
| 4029 | Ga0496123_0008115 | |||
| 4030 | Ga0496124_0030225 | |||
| 4031 | Ga0496124_0071552 | |||
| 4032 | Ga0496124_0366663 | |||
| 4033 | Ga0496124_0479647 | |||
| 4034 | Ga0496125_0010509 | |||
| 4035 | Ga0496125_0121389 | |||
| 4036 | Ga0496125_0373516 | |||
| 4037 | Ga0496125_0395821 | |||
| 4038 | Ga0496126_0031342 | |||
| 4039 | Ga0496126_0077582 | |||
| 4040 | Ga0496126_0097672 | |||
| 4041 | Ga0496126_0114241 | |||
| 4042 | Ga0495678_026834 | |||
| 4043 | Ga0495678_084642 | |||
| 4044 | Ga0495682_0022664 | |||
| 4045 | Ga0495682_0088775 | |||
| 4046 | Ga0495682_0321537 | |||
| 4047 | Ga0501031_0000121 | |||
| 4048 | Ga0501031_0030516 | |||
| 4049 | Ga0501031_0287115 | |||
| 4050 | Ga0501032_0000043 | |||
| 4051 | Ga0501032_0033638 | |||
| 4052 | Ga0501032_0050389 | |||
| 4053 | Ga0501032_0099664 | |||
| 4054 | Ga0501032_0401845 | |||
| 4055 | Ga0501033_0000055 | |||
| 4056 | Ga0501033_0006672 | |||
| 4057 | Ga0501033_0040343 | |||
| 4058 | Ga0501033_0137128 | |||
| 4059 | Ga0501033_0176881 | |||
| 4060 | Ga0501033_0227836 | |||
| 4061 | Ga0501033_0446696 | |||
| 4062 | Ga0501034_0000204 | |||
| 4063 | Ga0501034_0044814 | |||
| 4064 | Ga0501034_0076963 | |||
| 4065 | Ga0501034_0088512 | |||
| 4066 | Ga0501036_0000017 | |||
| 4067 | Ga0501036_0047731 | |||
| 4068 | Ga0501036_0454043 | |||
| 4069 | Ga0501036_1053662 | |||
| 4070 | Ga0501037_0000056 | |||
| 4071 | Ga0501037_0043358 | |||
| 4072 | Ga0501037_0063378 | |||
| 4073 | Ga0501037_0242802 | |||
| 4074 | Ga0501037_0972564 | |||
| 4075 | Ga0501038_0000035 | |||
| 4076 | Ga0501038_0061132 | |||
| 4077 | Ga0501038_0976580 | |||
| 4078 | Ga0501039_0000039 | |||
| 4079 | Ga0501039_0016834 | |||
| 4080 | Ga0501039_0285457 | |||
| 4081 | Ga0501039_1368708 | |||
| 4082 | Ga0501040_0079614 | |||
| 4083 | Ga0501040_0370785 | |||
| 4084 | Ga0501041_0416158 | |||
| 4085 | Ga0501043_0050164 | |||
| 4086 | Ga0501043_0085061 | |||
| 4087 | Ga0501043_0202238 | |||
| 4088 | Ga0501043_0332785 | |||
| 4089 | Ga0501046_0104481 | |||
| 4090 | Ga0501046_0173954 | |||
| 4091 | Ga0501046_0563386 | |||
| 4092 | Ga0501046_0876218 | |||
| 4093 | Ga0501047_0055416 | |||
| 4094 | Ga0501047_0067633 | |||
| 4095 | Ga0501047_0096060 | |||
| 4096 | Ga0501047_0249367 | |||
| 4097 | Ga0501047_0426757 | |||
| 4098 | Ga0501048_0546056 | |||
| 4099 | Ga0501048_0968523 | |||
| 4100 | Ga0501067_0288868 | |||
| 4101 | Ga0501068_0161890 | |||
| 4102 | Ga0501068_0467328 | |||
| 4103 | Ga0501068_0622293 | |||
| 4104 | Ga0501069_0008003 | |||
| 4105 | Ga0501069_0053938 | |||
| 4106 | Ga0501069_0521051 | |||
| 4107 | Ga0501070_0040455 | |||
| 4108 | Ga0501070_0428230 | |||
| 4109 | Ga0501070_0452209 | |||
| 4110 | Ga0501070_0480594 | |||
| 4111 | Ga0501070_1529106 | |||
| 4112 | Ga0501071_0075148 | |||
| 4113 | Ga0501071_0479139 | |||
| 4114 | Ga0501071_0567749 | |||
| 4115 | Ga0501071_0953018 | |||
| 4116 | Ga0501072_0096401 | |||
| 4117 | Ga0501072_0399882 | |||
| 4118 | Ga0501072_0614770 | |||
| 4119 | Ga0501073_0128194 | |||
| 4120 | Ga0501074_0201422 | |||
| 4121 | Ga0501074_0687484 | |||
| 4122 | Ga0501076_0096833 | |||
| 4123 | Ga0501076_0545433 | |||
| 4124 | Ga0501077_0038870 | |||
| 4125 | Ga0501077_0050816 | |||
| 4126 | Ga0501077_0131435 | |||
| 4127 | Ga0501079_0040332 | |||
| 4128 | Ga0501079_0655722 | |||
| 4129 | Ga0501079_1461604 | |||
| 4130 | Ga0501079_1675325 | |||
| 4131 | Ga0501080_0084195 | |||
| 4132 | Ga0501080_0124938 | |||
| 4133 | Ga0501080_0542401 | |||
| 4134 | Ga0501081_0144195 | |||
| 4135 | Ga0501081_0389630 | |||
| 4136 | Ga0501083_0391724 | |||
| 4137 | Ga0501241_000822 | |||
| 4138 | Ga0501035_0000528 | |||
| 4139 | Ga0501035_0001874 | |||
| 4140 | Ga0501035_0012296 | |||
| 4141 | Ga0501044_0000097 | |||
| 4142 | Ga0501044_0064812 | |||
| 4143 | Ga0501044_0082577 | |||
| 4144 | Ga0501044_0085227 | |||
| 4145 | Ga0501044_0146076 | |||
| 4146 | Ga0501044_0232967 | |||
| 4147 | Ga0501044_0417781 | |||
| 4148 | Ga0501044_0575365 | |||
| 4149 | Ga0501045_0134009 | |||
| 4150 | Ga0501045_1164075 | |||
| 4151 | Ga0501045_1270796 | |||
| 4152 | nmdc:mga03n38_20962_c1 | |||
| 4153 | nmdc:mga03n38_60482_c1 | |||
| 4154 | nmdc:mga00v17_1091400_c1 | |||
| 4155 | nmdc:mga00v17_576289_c1 | |||
| 4156 | nmdc:mga00v17_59260_c1 | |||
| 4157 | nmdc:mga0yw44_238574_c1 | |||
| 4158 | nmdc:mga0yw44_77967_c1 | |||
| 4159 | nmdc:mga0k408_34398_c1 | |||
| 4160 | nmdc:mga06z11_11382_c2 | |||
| 4161 | nmdc:mga06z11_117535_c1 | |||
| 4162 | nmdc:mga06z11_119173_c1 | |||
| 4163 | nmdc:mga06z11_21192_c1 | |||
| 4164 | nmdc:mga06z11_385687_c1 | |||
| 4165 | nmdc:mga07m45_85194_c1 | |||
| 4166 | nmdc:mga05p37_108064_c1 | |||
| 4167 | nmdc:mga05p37_154109_c1 | |||
| 4168 | nmdc:mga05p37_172319_c1 | |||
| 4169 | nmdc:mga05p37_258511_c1 | |||
| 4170 | nmdc:mga05p37_695868_c1 | |||
| 4171 | nmdc:mga05p37_866554_c1 | |||
| 4172 | nmdc:mga09592_512626_c1 | |||
| 4173 | nmdc:mga09592_53603_c1 | |||
| 4174 | nmdc:mga0qj67_123544_c1 | |||
| 4175 | nmdc:mga0qj67_48399_c1 | |||
| 4176 | nmdc:mga0qj67_62505_c1 | |||
| 4177 | nmdc:mga06r32_110446_c1 | |||
| 4178 | nmdc:mga06r32_122152_c1 | |||
| 4179 | nmdc:mga06r32_425563_c1 | |||
| 4180 | nmdc:mga06r32_541591_c1 | |||
| 4181 | nmdc:mga06r32_772374_c1 | |||
| 4182 | nmdc:mga08y16_117930_c1 | |||
| 4183 | nmdc:mga08y16_362117_c1 | |||
| 4184 | nmdc:mga08y16_40443_c2 | |||
| 4185 | nmdc:mga08y16_558759_c1 | |||
| 4186 | nmdc:mga08y16_561824_c1 | |||
| 4187 | nmdc:mga0n895_113370_c1 | |||
| 4188 | nmdc:mga0n895_422580_c1 | |||
| 4189 | nmdc:mga0n895_786326_c1 | |||
| 4190 | nmdc:mga0n895_803744_c1 | |||
| 4191 | nmdc:mga0rr50_159802_c1 | |||
| 4192 | nmdc:mga0rr50_275473_c1 | |||
| 4193 | nmdc:mga0rr50_55934_c1 | |||
| 4194 | nmdc:mga0a205_50288_c1 | |||
| 4195 | nmdc:mga0a205_822344_c1 | |||
| 4196 | Ga0495601_0043237 | |||
| 4197 | Ga0495601_0055886 | |||
| 4198 | Ga0495601_0076190 | |||
| 4199 | Ga0495601_0076892 | |||
| 4200 | Ga0495601_0271392 | |||
| 4201 | Ga0495601_0306949 | |||
| 4202 | Ga0495601_0313617 | |||
| 4203 | Ga0495601_0750320 | |||
| 4204 | Ga0495612_0029881 | |||
| 4205 | Ga0495612_0032701 | |||
| 4206 | Ga0495612_0154268 | |||
| 4207 | Ga0495612_0176723 | |||
| 4208 | Ga0495612_0193189 | |||
| 4209 | Ga0495612_0203814 | |||
| 4210 | Ga0495655_0005141 | |||
| 4211 | Ga0495655_0025384 | |||
| 4212 | Ga0495655_0072031 | |||
| 4213 | Ga0495655_0253875 | |||
| 4214 | Ga0495595_0019132 | |||
| 4215 | Ga0495595_0039211 | |||
| 4216 | Ga0495595_0050715 | |||
| 4217 | Ga0495595_0065464 | |||
| 4218 | Ga0495595_0253624 | |||
| 4219 | Ga0495619_0017984 | |||
| 4220 | Ga0495619_0061773 | |||
| 4221 | Ga0495619_0063374 | |||
| 4222 | Ga0495619_0065800 | |||
| 4223 | Ga0495619_0080349 | |||
| 4224 | Ga0495619_0254368 | |||
| 4225 | Ga0495619_0256217 | |||
| 4226 | Ga0495619_0449299 | |||
| 4227 | Ga0495619_0498479 | |||
| 4228 | Ga0500578_0001652 | |||
| 4229 | Ga0500644_0161303 | |||
| 4230 | Ga0500646_0004647 | |||
| 4231 | Ga0500646_0040337 | |||
| 4232 | Ga0500647_0069287 | |||
| 4233 | Ga0500583_0021044 | |||
| 4234 | Ga0500583_0223778 | |||
| 4235 | Ga0500651_0039291 | |||
| 4236 | Ga0500651_0141259 | |||
| 4237 | Ga0500651_0317839 | |||
| 4238 | Ga0500566_0001583 | |||
| 4239 | Ga0500566_0118345 | |||
| 4240 | Ga0500566_0335759 | |||
| 4241 | Ga0500566_0470106 | |||
| 4242 | Ga0500640_018467 | |||
| 4243 | Ga0500640_079371 | |||
| 4244 | Ga0500641_0013667 | |||
| 4245 | Ga0500641_0042220 | |||
| 4246 | Ga0500554_275472 | |||
| 4247 | Ga0500555_154582 | |||
| 4248 | Ga0500556_0031626 | |||
| 4249 | Ga0500562_008561 | |||
| 4250 | Ga0500572_001474 | |||
| 4251 | Ga0500575_072918 | |||
| 4252 | Ga0500591_048720 | |||
| 4253 | Ga0500591_138100 | |||
| 4254 | Ga0500593_111199 | |||
| 4255 | Ga0500608_006036 | |||
| 4256 | Ga0500614_001887 | |||
| 4257 | Ga0500618_019149 | |||
| 4258 | Ga0500642_0018777 | |||
| 4259 | Ga0500652_077698 | |||
| 4260 | Ga0500655_058730 | |||
| 4261 | Ga0500559_0019248 | |||
| 4262 | Ga0500559_0051481 | |||
| 4263 | Ga0500577_0278165 | |||
| 4264 | Ga0500585_132815 | |||
| 4265 | Ga0500585_223604 | |||
| 4266 | Ga0500589_023249 | |||
| 4267 | Ga0500590_018670 | |||
| 4268 | Ga0500603_002379 | |||
| 4269 | Ga0500616_0030592 | |||
| 4270 | Ga0500624_001967 | |||
| 4271 | Ga0500627_0083571 | |||
| 4272 | Ga0500627_0350843 | |||
| 4273 | Ga0500630_001264 | |||
| 4274 | Ga0500633_0210962 | |||
| 4275 | Ga0500638_008813 | |||
| 4276 | Ga0500639_002503 | |||
| 4277 | Ga0500639_028090 | |||
| 4278 | Ga0500639_096985 | |||
| 4279 | Ga0500636_0224274 | |||
| 4280 | Ga0500636_0238451 | |||
| 4281 | Ga0500570_086394 | |||
| 4282 | Ga0500576_027874 | |||
| 4283 | Ga0500611_075707 | |||
| 4284 | Ga0500657_031862 | |||
| 4285 | Ga0500645_010662 | |||
| 4286 | Ga0500596_002137 | |||
| 4287 | Ga0500601_001931 | |||
| 4288 | Ga0501084_0270777 | |||
| 4289 | Ga0501084_1098731 | |||
| 4290 | Ga0590074_090061 | |||
| 4291 | Ga0590075_031488 | |||
| 4292 | Ga0501082_1921878 | |||
| 4293 | Ga0466962_0020422 | |||
| 4294 | Ga0530510_0060430 | |||
| 4295 | Ga0530510_0253426 | |||
| 4296 | 2507511625 | |||
| 4297 | 2508540367 | |||
| 4298 | 2513706296 | |||
| 4299 | 2517407523 | |||
| 4300 | 2517411700 | |||
| 4301 | 2524542669 | |||
| 4302 | 2524542685 | |||
| 4303 | 2617379845 | |||
| 4304 | 2617379905 | |||
| 4305 | 2617382528 | |||
| 4306 | 2805917807 | |||
| 4307 | 2824780971 | |||
| 4308 | 2856357377 | |||
| 4309 | 2857515281 | |||
| 4310 | 2857537751 | |||
| 4311 | 2881369056 | |||
| 4312 | 2881666703 | |||
| 4313 | 2881666706 | |||
| 4314 | 2885370908 | |||
| 4315 | 2885414184 | |||
| 4316 | 2889041514 | |||
| 4317 | 2889310342 | |||
| 4318 | 2904693887 | |||
| 4319 | 2904707725 | |||
| 4320 | 2932800207 | |||
| 4321 | 2935683943 | |||
| 4322 | 2941546410 | |||
| 4323 | 2961130649 | |||
| 4324 | 8005316270 | |||
| 4325 | 8006933869 | |||
| 4326 | 8006936266 | |||
| 4327 | 8006936763 | |||
| 4328 | 8006937849 | |||
| 4329 | 8006938564 | |||
| 4330 | 8006939934 | |||
| 4331 | 8006943413 | |||
| 4332 | 8006943431 | |||
| 4333 | 8006971383 | |||
| 4334 | 8006974034 | |||
| 4335 | 8006976232 | |||
| 4336 | 8006977955 | |||
| 4337 | 8006981616 | |||
| 4338 | 8006983542 | |||
| 4339 | 8006983666 | |||
| 4340 | 8006983686 | |||
| 4341 | 8016617201 | |||
| 4342 | 8018130346 | |||
| 4343 | 8019585402 | |||
| 4344 | 8019598089 | |||
| 4345 | 8019610293 | |||
| 4346 | 8019648864 | |||
| 4347 | 8019653918 | |||
| 4348 | 8056683043 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7d5s-assembly1.cif.gz_A5 | cryo-em structure of 90s preribosome with inactive utp24 (state a2) | 0.7529 | 45 | 73 |
| 1s4u-assembly1.cif.gz_X | crystal structure analysis of the beta-propeller protein ski8p | 0.7301 | 40 | 72 |
| 7bup-assembly1.cif.gz_A | crystal structure of pcna from pathogenic yeast candida albicans | 0.66 | 45 | 78 |
| 2w8b-assembly1.cif.gz_A | crystal structure of processed tolb in complex with pal | 0.6494 | 45 | 74 |
| 6f92-assembly2.cif.gz_C | structure of the family gh92 alpha-mannosidase bt3965 from bacteroides thetaiotaomicron in complex with mannoimidazole (mani) | 0.6462 | 41 | 68 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0XJ39_39_298_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.8037 | 42 | 68 | 2.120.10.80 |
| af_Q4D9F6_1150_1429_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7872 | 43 | 70 | 2.130.10.10 |
| af_Q9P7E9_125_559_2.140.10.30 | Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Dipeptidylpeptidase IV, N-terminal domain | 0.7836 | 43 | 75 | 2.140.10.30 |
| af_I1LCJ2_2_276_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7345 | 45 | 70 | 2.130.10.10 |
| af_Q24314_1_310_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7288 | 43 | 75 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U9INZ4-F1-model_v4 | Probable siderophore transport system ATP-binding protein YusV | 0.7849 | 1 | 115 |
GO:0005524
GO:0006826 GO:0016887 |
| AF-A0A4U9INZ4-F1-model_v4 | Probable siderophore transport system ATP-binding protein YusV | 0.779 | 1 | 115 |
GO:0005524
GO:0006826 GO:0016887 |
| AF-A0A0W1APD7-F1-model_v4 | IS66 Orf2 like protein | 0.7765 | 8 | 75 |
GO:0016020
|
| AF-A0A1I0C348-F1-model_v4 | Transposase | 0.7611 | 9 | 103 |
|
| AF-A0A0K1EDD8-F1-model_v4 | Transposase | 0.7552 | 5 | 74 |
|