metagRoot

F496507

General Info

Members	Datasets	Scaffolds	Average Seq Length
2174	656	4348	115

Family's Representative Sequence

Representative Sequence	3300046477\|Ga0495664_0305100\|Ga0495664_0305100_433_831
Length	132
Sequence	MIPIPSGVRVWLATGHTDMRKGFPSLALQVQEVLKHDPLSGHLFCFRGRRGDLLKVIWHDGQGACLFTKRLERGRFLWPSPTDGVVAISAAQMGYLLSGIDWASSPRNLASDACRVITLPLKRDGECDSPEM

Samples

	Sample ID	Description	Type	Environment
1	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	3300000531	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled	Metagenome	Rhizosphere
4	3300000532	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled	Metagenome	Rhizosphere
5	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
6	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
7	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
8	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
9	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
10	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
11	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
12	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
13	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
14	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
15	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
16	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
17	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
18	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
19	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
20	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
21	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
22	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
23	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
24	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
25	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
26	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
27	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
28	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
29	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
30	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
31	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
32	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
33	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
34	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
35	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
36	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
37	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
38	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
39	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
40	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
41	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
42	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
43	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
44	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
45	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
46	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
47	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
48	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
49	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
50	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
51	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
52	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
53	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
54	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
55	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
56	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
57	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
58	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
59	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
60	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
61	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
62	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
63	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
64	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
65	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
66	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
67	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
68	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
69	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
70	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
71	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
72	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
73	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
74	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
75	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
76	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
77	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
78	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
79	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
80	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
81	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
82	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
83	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
84	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
85	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
86	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
87	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
88	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
89	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
90	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
91	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
92	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
93	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
94	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
95	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
96	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
97	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
98	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
99	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
100	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
101	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
102	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
103	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
104	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
105	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
106	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
107	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
108	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
109	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
110	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
111	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
112	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
113	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
114	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
115	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
116	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
117	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
118	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
119	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
120	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
121	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
122	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
123	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
124	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
125	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
126	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
127	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
128	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
129	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
130	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
131	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
132	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
133	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
134	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
135	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
136	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
137	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
138	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
139	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
140	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
141	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
142	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
143	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
144	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
145	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
146	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
147	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
148	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
149	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
150	3300012495	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610	Metagenome	Rhizosphere
151	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
152	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
153	3300012505	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610	Metagenome	Rhizosphere
154	3300012507	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610	Metagenome	Rhizosphere
155	3300012510	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610	Metagenome	Rhizosphere
156	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
157	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
158	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
159	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
160	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
161	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
162	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
163	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
164	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
165	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
166	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
167	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
168	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
169	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
170	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
171	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
172	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
173	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
174	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
175	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
176	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
177	3300025223	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
179	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
181	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
183	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
184	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
185	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
186	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
255	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
256	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
257	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
260	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
261	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
265	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
266	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
267	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
268	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
269	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
270	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
271	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
272	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
273	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
274	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
275	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
276	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
277	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
278	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
279	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
280	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
281	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
282	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
283	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
284	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
285	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
286	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
287	3300031889	Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO	Metagenome	Rhizosphere
288	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
289	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
290	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
291	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
292	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
293	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
294	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
295	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
296	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
297	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
298	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
299	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
300	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
301	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
302	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
303	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
304	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
305	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
306	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
307	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
308	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
309	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
310	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
311	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
312	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
313	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
314	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
315	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
316	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
317	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
318	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
319	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
320	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
321	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
322	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
323	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
324	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
325	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
326	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
327	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
328	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
329	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
330	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
331	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
332	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
333	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
334	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
335	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
336	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
337	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
338	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
339	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
340	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
341	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
342	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
343	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
344	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
345	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
346	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
347	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
348	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
349	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
350	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
351	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
352	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
353	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
354	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
355	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
356	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
357	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
358	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
359	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
360	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
361	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
362	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
363	3300042011	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204	Metagenome	Rhizosphere
364	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
365	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
366	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
367	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
368	3300042135	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127	Metagenome	Rhizosphere
369	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
370	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
371	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
372	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
373	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
374	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
375	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
376	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
377	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
378	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
379	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
380	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
381	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
382	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
383	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
384	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
385	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
386	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
387	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
388	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
389	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
390	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
391	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
392	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
393	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
394	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
395	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
396	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
397	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
398	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
399	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
400	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
401	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
402	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
403	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
404	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
405	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
406	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
407	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
408	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
409	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
410	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
411	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
412	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
413	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
414	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
415	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
416	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
417	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
418	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
419	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
420	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
421	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
422	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
423	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
424	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
425	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
426	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
427	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
428	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
429	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
430	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
431	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
432	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
433	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
434	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
435	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
436	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
437	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
438	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
439	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
440	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
441	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
442	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
443	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
444	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
445	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
446	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
447	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
448	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
449	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
450	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
451	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
452	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
453	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
454	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
455	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
456	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
457	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
458	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
459	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
460	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
461	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
462	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
463	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
464	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
465	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
466	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
467	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
468	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
469	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
470	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
471	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
472	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
473	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
474	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
475	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
476	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
477	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
478	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
479	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
480	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
481	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
482	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
483	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
484	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
485	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
486	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
487	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
488	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
489	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
490	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
491	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
492	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
493	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
494	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
495	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
496	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
497	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
498	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
499	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
500	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
501	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
502	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
503	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
504	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
505	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
506	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
507	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
508	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
509	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
510	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
511	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
512	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
513	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
514	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
515	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
516	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
517	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
518	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
519	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
520	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
521	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
522	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
523	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
524	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
525	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
526	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
527	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
528	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
529	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
530	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
531	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
532	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
533	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
534	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
535	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
536	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
537	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
538	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
539	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
540	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
541	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
542	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
543	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
544	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
545	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
546	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
547	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
548	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
549	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
550	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
551	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
552	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
553	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
554	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
555	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
556	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
557	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
558	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
559	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
560	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
561	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
562	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
563	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
564	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
565	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
566	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
567	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
568	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
569	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
570	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
571	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
572	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
573	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
574	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
575	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
576	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
577	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
578	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
579	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
580	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
581	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
582	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
583	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
584	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
585	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
586	3300053112	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere	Metagenome	Endosphere
587	3300053115	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere	Metagenome	Endosphere
588	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
589	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
590	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
591	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
592	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
593	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
594	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
595	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
596	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
597	3300053144	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere	Metagenome	Endosphere
598	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
599	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
600	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
601	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
602	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
603	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
604	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
605	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
606	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
607	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
608	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
609	3300053724	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere	Metagenome	Endosphere
610	3300053725	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere	Metagenome	Endosphere
611	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
612	3300053728	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere	Metagenome	Endosphere
613	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
614	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
615	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
616	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
617	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
618	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
619	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
620	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
621	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
622	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
623	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
624	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
625	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
626	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
627	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
628	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
629	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
630	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
631	2856356410	Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1	Isolate	Nodule
632	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
633	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
634	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
635	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
636	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
637	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
638	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
639	2889306138	Methylobacterium sp. PvR107	Isolate	Rhizosphere
640	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
641	2904699407
642	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
643	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
644	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
645	2961127735	Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1	Isolate	Nodule
646	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
647	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
648	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
649	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
650	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
651	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
652	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
653	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
654	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
655	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
656	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	97.42
Metatranscriptomes	0.18
Isolates	2.39

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.42
Nodule	1.7
Rhizoplane	6.81
Rhizosphere	82.98
Stem	0
Stem Tuber	0
Unclassified	0.09

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0495664_0305100	3300046477	Bacteria	961
2	SwRhRL2b_contig_1110102	2162886007	Bacteria	2135
3	CNBas_1000120	3300000531	Bacteria	2542
4	CNAas_1001029	3300000532	Bacteria	2579
5	JGI24746J21847_1003278	3300001977	Bacteria	2548
6	JGI24746J21847_1004618	3300001977	Bacteria	2169
7	JGI24747J21853_1013922	3300001978	Bacteria	833
8	JGI24739J22299_10156133	3300001989	Bacteria	674
9	JGI24737J22298_10015005	3300001990	Bacteria	2509
10	JGI24743J22301_10001477	3300001991	Bacteria	3260
11	JGI24743J22301_10004069	3300001991	Bacteria	2356
12	JGI24750J21931_1001967	3300002070	Bacteria	2510
13	JGI24750J21931_1002451	3300002070	Bacteria	2234
14	JGI24745J21846_1001121	3300002073	Bacteria	2541
15	JGI24745J21846_1013583	3300002073	Bacteria	940
16	JGI24748J21848_1000896	3300002074	Bacteria	3226
17	JGI24748J21848_1001876	3300002074	Bacteria	2340
18	JGI24738J21930_10018131	3300002075	Bacteria	1473
19	JGI24749J21850_1001481	3300002076	Bacteria	3318
20	JGI24749J21850_1003226	3300002076	Bacteria	2275
21	JGI24749J21850_1040645	3300002076	Bacteria	681
22	JGI24744J21845_10003565	3300002077	Bacteria	3205
23	JGI24744J21845_10039858	3300002077	Bacteria	880
24	JGI24034J26672_10001347	3300002239	Bacteria	3247
25	JGI24742J22300_10002290	3300002244	Bacteria	3059
26	JGI24742J22300_10014005	3300002244	Bacteria	1343
27	JGI24742J22300_10056886	3300002244	Bacteria	715
28	rootH2_10055222	3300003320	Bacteria	2146
29	JGI25404J52841_10000141	3300003659	Bacteria	7805
30	Ga0055528_1014369	3300003790	Bacteria	2932
31	JGI25405J52794_10125556	3300003911	Bacteria	580
32	Ga0065704_10003761	3300005289	Bacteria	3823
33	Ga0065712_10091158	3300005290	Bacteria	2388
34	Ga0065715_10101018	3300005293	Bacteria	3245
35	Ga0065715_10103975	3300005293	Bacteria	2995
36	Ga0065707_10004119	3300005295	Bacteria	3356
37	Ga0070658_10059578	3300005327	Bacteria	3108
38	Ga0070658_10816897	3300005327	Bacteria	810
39	Ga0070676_10141473	3300005328	Bacteria	1532
40	Ga0070676_10222000	3300005328	Bacteria	1248
41	Ga0070676_10344730	3300005328	Bacteria	1023
42	Ga0070683_100049008	3300005329	Bacteria	3905
43	Ga0070683_100237481	3300005329	Bacteria	1733
44	Ga0070683_100260545	3300005329	Bacteria	1649
45	Ga0070690_100088397	3300005330	Bacteria	2037
46	Ga0070690_100314257	3300005330	Bacteria	1127
47	Ga0070690_100326145	3300005330	Bacteria	1108
48	Ga0070670_100062702	3300005331	Bacteria	3191
49	Ga0070670_100152289	3300005331	Bacteria	2001
50	Ga0070677_10016017	3300005333	Bacteria	2664
51	Ga0070677_10025393	3300005333	Bacteria	2212
52	Ga0068869_100245657	3300005334	Bacteria	1427
53	Ga0068869_101950395	3300005334	Bacteria	527
54	Ga0070666_10035884	3300005335	Bacteria	3288
55	Ga0070666_10071735	3300005335	Bacteria	2357
56	Ga0070666_10237379	3300005335	Bacteria	1289
57	Ga0070680_100020639	3300005336	Bacteria	5230
58	Ga0070680_100308825	3300005336	Bacteria	1341
59	Ga0070680_101228241	3300005336	Bacteria	648
60	Ga0070682_100028047	3300005337	Bacteria	3384
61	Ga0070682_100116632	3300005337	Bacteria	1787
62	Ga0070682_100414061	3300005337	Bacteria	1023
63	Ga0068868_100049166	3300005338	Bacteria	3310
64	Ga0068868_100052530	3300005338	Bacteria	3208
65	Ga0068868_100354245	3300005338	Bacteria	1258
66	Ga0068868_101299379	3300005338	Bacteria	676
67	Ga0070660_100377024	3300005339	Bacteria	1171
68	Ga0070660_100381673	3300005339	Bacteria	1163
69	Ga0070660_100488134	3300005339	Bacteria	1024
70	Ga0070660_100523066	3300005339	Bacteria	988
71	Ga0070660_100603146	3300005339	Bacteria	918
72	Ga0070689_100042940	3300005340	Bacteria	3473
73	Ga0070689_100138647	3300005340	Bacteria	1955
74	Ga0070689_100369612	3300005340	Bacteria	1206
75	Ga0070691_10030971	3300005341	Bacteria	2507
76	Ga0070691_10060711	3300005341	Bacteria	1817
77	Ga0070691_10210479	3300005341	Bacteria	1026
78	Ga0070691_10525001	3300005341	Bacteria	688
79	Ga0070691_10935492	3300005341	Bacteria	537
80	Ga0070687_100016246	3300005343	Bacteria	3389
81	Ga0070687_100041965	3300005343	Bacteria	2315
82	Ga0070687_100871751	3300005343	Bacteria	643
83	Ga0070661_100102324	3300005344	Bacteria	2132
84	Ga0070661_100378666	3300005344	Bacteria	1115
85	Ga0070692_10036208	3300005345	Bacteria	2503
86	Ga0070692_10396885	3300005345	Bacteria	870
87	Ga0070668_100046001	3300005347	Bacteria	3350
88	Ga0070668_100048950	3300005347	Bacteria	3251
89	Ga0070668_100075625	3300005347	Bacteria	2629
90	Ga0070668_100114760	3300005347	Bacteria	2147
91	Ga0070668_100243294	3300005347	Bacteria	1491
92	Ga0070668_100476582	3300005347	Bacteria	1077
93	Ga0070668_100527243	3300005347	Bacteria	1025
94	Ga0070668_100537173	3300005347	Bacteria	1016
95	Ga0070668_100891865	3300005347	Bacteria	794
96	Ga0070668_101180724	3300005347	Bacteria	693
97	Ga0070668_101388732	3300005347	Bacteria	640
98	Ga0070669_100041051	3300005353	Bacteria	3364
99	Ga0070669_100051754	3300005353	Bacteria	3003
100	Ga0070669_100400299	3300005353	Bacteria	1123
101	Ga0070669_100563196	3300005353	Bacteria	951
102	Ga0070675_100044532	3300005354	Bacteria	3629
103	Ga0070675_100090999	3300005354	Bacteria	2555
104	Ga0070675_101188489	3300005354	Bacteria	702
105	Ga0070671_100051993	3300005355	Bacteria	3407
106	Ga0070671_100267379	3300005355	Bacteria	1453
107	Ga0070671_100378638	3300005355	Bacteria	1209
108	Ga0070671_100428094	3300005355	Bacteria	1134
109	Ga0070674_100048632	3300005356	Bacteria	2911
110	Ga0070674_100193244	3300005356	Bacteria	1567
111	Ga0070674_100259447	3300005356	Bacteria	1368
112	Ga0070674_100537113	3300005356	Bacteria	979
113	Ga0070674_101820662	3300005356	Bacteria	552
114	Ga0070673_100046119	3300005364	Bacteria	3383
115	Ga0070673_100046378	3300005364	Bacteria	3375
116	Ga0070673_100272177	3300005364	Bacteria	1483
117	Ga0070673_101244932	3300005364	Bacteria	698
118	Ga0070688_100025517	3300005365	Bacteria	3499
119	Ga0070688_100026473	3300005365	Bacteria	3446
120	Ga0070688_100142555	3300005365	Bacteria	1630
121	Ga0070659_100196270	3300005366	Bacteria	1660
122	Ga0070659_100300321	3300005366	Bacteria	1339
123	Ga0070659_100539515	3300005366	Bacteria	998
124	Ga0070667_100051801	3300005367	Bacteria	3461
125	Ga0070667_100273930	3300005367	Bacteria	1514
126	Ga0070667_100662985	3300005367	Bacteria	964
127	Ga0070667_100667272	3300005367	Bacteria	961
128	Ga0070703_10010510	3300005406	Bacteria	2611
129	Ga0070703_10011425	3300005406	Bacteria	2508
130	Ga0070709_10029246	3300005434	Bacteria	3294
131	Ga0070709_10029935	3300005434	Bacteria	3262
132	Ga0070709_10040883	3300005434	Bacteria	2853
133	Ga0070709_10056165	3300005434	Bacteria	2489
134	Ga0070709_10251498	3300005434	Bacteria	1273
135	Ga0070714_100048072	3300005435	Bacteria	3627
136	Ga0070714_100049300	3300005435	Bacteria	3584
137	Ga0070714_100068579	3300005435	Bacteria	3060
138	Ga0070714_100195684	3300005435	Bacteria	1847
139	Ga0070714_100343550	3300005435	Bacteria	1400
140	Ga0070714_100403320	3300005435	Bacteria	1293
141	Ga0070714_100990414	3300005435	Bacteria	818
142	Ga0070713_100016241	3300005436	Bacteria	5595
143	Ga0070713_100124786	3300005436	Bacteria	2263
144	Ga0070713_100329051	3300005436	Bacteria	1413
145	Ga0070713_100894660	3300005436	Bacteria	854
146	Ga0070713_100905407	3300005436	Bacteria	848
147	Ga0070710_10017785	3300005437	Bacteria	3646
148	Ga0070710_10115219	3300005437	Bacteria	1619
149	Ga0070710_10236399	3300005437	Bacteria	1169
150	Ga0070710_10275291	3300005437	Bacteria	1090
151	Ga0070701_10012140	3300005438	Bacteria	3876
152	Ga0070701_10048532	3300005438	Bacteria	2191
153	Ga0070701_10260551	3300005438	Bacteria	1051
154	Ga0070711_100015435	3300005439	Bacteria	4835
155	Ga0070711_100027809	3300005439	Bacteria	3716
156	Ga0070711_100053839	3300005439	Bacteria	2775
157	Ga0070711_100102323	3300005439	Bacteria	2086
158	Ga0070711_100215128	3300005439	Bacteria	1491
159	Ga0070711_100234692	3300005439	Bacteria	1431
160	Ga0070711_100690364	3300005439	Bacteria	859
161	Ga0070711_100762046	3300005439	Bacteria	819
162	Ga0070705_100011195	3300005440	Bacteria	4518
163	Ga0070705_100346044	3300005440	Bacteria	1082
164	Ga0070705_101202494	3300005440	Bacteria	624
165	Ga0070700_100027556	3300005441	Bacteria	3370
166	Ga0070700_100194371	3300005441	Bacteria	1421
167	Ga0070700_100374687	3300005441	Bacteria	1063
168	Ga0070694_100019015	3300005444	Bacteria	4365
169	Ga0070694_100048216	3300005444	Bacteria	2865
170	Ga0070694_100064730	3300005444	Bacteria	2503
171	Ga0070708_100182126	3300005445	Bacteria	1964
172	Ga0070708_100701134	3300005445	Bacteria	953
173	Ga0070708_100803969	3300005445	Bacteria	884
174	Ga0070663_100035515	3300005455	Bacteria	3459
175	Ga0070663_100036289	3300005455	Bacteria	3425
176	Ga0070663_100036982	3300005455	Bacteria	3395
177	Ga0070663_100037621	3300005455	Bacteria	3370
178	Ga0070663_100082745	3300005455	Bacteria	2362
179	Ga0070663_100092086	3300005455	Bacteria	2247
180	Ga0070663_100212616	3300005455	Bacteria	1515
181	Ga0070663_100513144	3300005455	Bacteria	997
182	Ga0070663_100561414	3300005455	Bacteria	955
183	Ga0070663_100864896	3300005455	Bacteria	779
184	Ga0070663_101274916	3300005455	Bacteria	648
185	Ga0070678_100036628	3300005456	Bacteria	3436
186	Ga0070678_100157776	3300005456	Bacteria	1835
187	Ga0070678_100347983	3300005456	Bacteria	1273
188	Ga0070678_101695823	3300005456	Bacteria	594
189	Ga0070662_100043985	3300005457	Bacteria	3198
190	Ga0070662_100074789	3300005457	Bacteria	2507
191	Ga0070662_100169000	3300005457	Bacteria	1716
192	Ga0070662_100175252	3300005457	Bacteria	1687
193	Ga0070662_100326474	3300005457	Bacteria	1252
194	Ga0070662_100347556	3300005457	Bacteria	1214
195	Ga0070662_101205465	3300005457	Bacteria	651
196	Ga0070662_101628309	3300005457	Bacteria	557
197	Ga0070681_10053152	3300005458	Bacteria	4036
198	Ga0070681_10101479	3300005458	Bacteria	2823
199	Ga0070681_10925719	3300005458	Bacteria	790
200	Ga0068867_100032454	3300005459	Bacteria	3777
201	Ga0068867_100058513	3300005459	Bacteria	2856
202	Ga0068867_100122486	3300005459	Bacteria	2011
203	Ga0068867_100152082	3300005459	Bacteria	1819
204	Ga0068867_100220332	3300005459	Bacteria	1529
205	Ga0068867_100428651	3300005459	Bacteria	1122
206	Ga0068867_100518892	3300005459	Bacteria	1027
207	Ga0070685_10023711	3300005466	Bacteria	3363
208	Ga0070685_10095214	3300005466	Bacteria	1810
209	Ga0070685_10119850	3300005466	Bacteria	1632
210	Ga0070706_100074412	3300005467	Bacteria	3144
211	Ga0070706_100143529	3300005467	Bacteria	2229
212	Ga0070707_100050232	3300005468	Bacteria	3997
213	Ga0070707_100055593	3300005468	Bacteria	3795
214	Ga0070698_100074135	3300005471	Bacteria	3409
215	Ga0070698_100144896	3300005471	Bacteria	2325
216	Ga0070698_100417014	3300005471	Bacteria	1277
217	Ga0070698_100486239	3300005471	Bacteria	1172
218	Ga0070699_100049687	3300005518	Bacteria	3630
219	Ga0070699_100053367	3300005518	Bacteria	3498
220	Ga0070699_100688009	3300005518	Bacteria	934
221	Ga0070679_100137354	3300005530	Bacteria	2426
222	Ga0070679_100259059	3300005530	Bacteria	1694
223	Ga0070679_100334615	3300005530	Bacteria	1462
224	Ga0070679_100470158	3300005530	Unclassified	1202
225	Ga0070679_101142222	3300005530	Bacteria	724
226	Ga0070679_101286477	3300005530	Bacteria	677
227	Ga0070684_100261722	3300005535	Bacteria	1582
228	Ga0070684_100369311	3300005535	Bacteria	1321
229	Ga0070684_100409197	3300005535	Bacteria	1251
230	Ga0070684_100458135	3300005535	Bacteria	1179
231	Ga0070684_101024268	3300005535	Bacteria	775
232	Ga0070697_100074790	3300005536	Bacteria	2784
233	Ga0070697_100866084	3300005536	Bacteria	801
234	Ga0070697_100893188	3300005536	Bacteria	788
235	Ga0070697_101328257	3300005536	Bacteria	642
236	Ga0068853_100078844	3300005539	Bacteria	2879
237	Ga0068853_100107208	3300005539	Bacteria	2477
238	Ga0068853_100343772	3300005539	Bacteria	1387
239	Ga0068853_100394814	3300005539	Bacteria	1294
240	Ga0070672_100036561	3300005543	Bacteria	3742
241	Ga0070672_100082892	3300005543	Bacteria	2573
242	Ga0070672_100134145	3300005543	Bacteria	2038
243	Ga0070672_100777424	3300005543	Bacteria	841
244	Ga0070686_100027360	3300005544	Bacteria	3451
245	Ga0070686_100032964	3300005544	Bacteria	3180
246	Ga0070686_100216163	3300005544	Bacteria	1383
247	Ga0070686_100658618	3300005544	Bacteria	831
248	Ga0070695_100000761	3300005545	Bacteria	17304
249	Ga0070695_100126516	3300005545	Bacteria	1756
250	Ga0070695_100529353	3300005545	Bacteria	916
251	Ga0070695_100547725	3300005545	Bacteria	901
252	Ga0070695_100603881	3300005545	Bacteria	862
253	Ga0070695_100988490	3300005545	Bacteria	684
254	Ga0070696_100009177	3300005546	Bacteria	6621
255	Ga0070696_100386587	3300005546	Bacteria	1092
256	Ga0070696_100481764	3300005546	Bacteria	984
257	Ga0070696_100714545	3300005546	Bacteria	818
258	Ga0070693_100666780	3300005547	Bacteria	758
259	Ga0070693_100840681	3300005547	Bacteria	683
260	Ga0070693_100929297	3300005547	Bacteria	654
261	Ga0070693_101041432	3300005547	Bacteria	621
262	Ga0070693_101282099	3300005547	Bacteria	566
263	Ga0070665_100047877	3300005548	Bacteria	4291
264	Ga0070665_100066764	3300005548	Bacteria	3608
265	Ga0070665_100079823	3300005548	Bacteria	3277
266	Ga0070665_100096618	3300005548	Bacteria	2959
267	Ga0070665_100704220	3300005548	Bacteria	1023
268	Ga0070665_100928444	3300005548	Bacteria	883
269	Ga0070704_100003711	3300005549	Bacteria	8798
270	Ga0070704_100253895	3300005549	Bacteria	1445
271	Ga0070704_100467806	3300005549	Bacteria	1089
272	Ga0070704_101940537	3300005549	Bacteria	546
273	Ga0068855_100087137	3300005563	Bacteria	3609
274	Ga0068855_100222649	3300005563	Bacteria	2115
275	Ga0068855_100774381	3300005563	Bacteria	1021
276	Ga0070664_100087450	3300005564	Bacteria	2694
277	Ga0070664_100100441	3300005564	Bacteria	2515
278	Ga0070664_100676753	3300005564	Bacteria	960
279	Ga0070664_101673868	3300005564	Bacteria	603
280	Ga0068857_100073259	3300005577	Bacteria	3051
281	Ga0068857_100101836	3300005577	Bacteria	2577
282	Ga0068857_102031924	3300005577	Bacteria	564
283	Ga0068854_100016323	3300005578	Bacteria	4947
284	Ga0068854_100467060	3300005578	Bacteria	1057
285	Ga0068854_100539602	3300005578	Bacteria	988
286	Ga0068856_100305891	3300005614	Bacteria	1608
287	Ga0068856_100495528	3300005614	Bacteria	1243
288	Ga0068856_100547542	3300005614	Bacteria	1178
289	Ga0068856_100677779	3300005614	Bacteria	1051
290	Ga0068856_100836036	3300005614	Bacteria	940
291	Ga0070702_100031319	3300005615	Bacteria	2908
292	Ga0070702_100038575	3300005615	Bacteria	2661
293	Ga0068852_100111021	3300005616	Bacteria	2493
294	Ga0068852_100171267	3300005616	Bacteria	2035
295	Ga0068852_100324128	3300005616	Bacteria	1497
296	Ga0068859_100011678	3300005617	Bacteria	8826
297	Ga0068859_100085071	3300005617	Bacteria	3208
298	Ga0068859_100272394	3300005617	Bacteria	1785
299	Ga0068859_100387367	3300005617	Bacteria	1493
300	Ga0068859_101649249	3300005617	Bacteria	708
301	Ga0068864_100048004	3300005618	Bacteria	3670
302	Ga0068864_100055954	3300005618	Bacteria	3408
303	Ga0068864_100069722	3300005618	Bacteria	3057
304	Ga0068864_100253904	3300005618	Bacteria	1633
305	Ga0068866_10213700	3300005718	Bacteria	1159
306	Ga0068866_10260781	3300005718	Bacteria	1065
307	Ga0068866_10370374	3300005718	Bacteria	916
308	Ga0068866_10687219	3300005718	Bacteria	700
309	Ga0068866_10798969	3300005718	Bacteria	656
310	Ga0068866_11243486	3300005718	Bacteria	539
311	Ga0068861_100044898	3300005719	Bacteria	3325
312	Ga0068861_100070508	3300005719	Bacteria	2706
313	Ga0068861_100657826	3300005719	Bacteria	969
314	Ga0068851_10014991	3300005834	Bacteria	3687
315	Ga0068851_10371046	3300005834	Bacteria	836
316	Ga0068870_10098283	3300005840	Bacteria	1649
317	Ga0068870_10102054	3300005840	Bacteria	1623
318	Ga0068870_10386400	3300005840	Bacteria	907
319	Ga0068863_100071988	3300005841	Bacteria	3271
320	Ga0068863_100094753	3300005841	Bacteria	2833
321	Ga0068863_101365437	3300005841	Bacteria	716
322	Ga0068858_100073499	3300005842	Bacteria	3173
323	Ga0068858_100075217	3300005842	Bacteria	3137
324	Ga0068858_100129472	3300005842	Bacteria	2365
325	Ga0068858_100412615	3300005842	Bacteria	1298
326	Ga0068858_100691728	3300005842	Bacteria	992
327	Ga0068860_100039418	3300005843	Bacteria	4518
328	Ga0068860_100508457	3300005843	Bacteria	1203
329	Ga0068860_100519824	3300005843	Bacteria	1190
330	Ga0068860_100787866	3300005843	Bacteria	964
331	Ga0068860_101058700	3300005843	Bacteria	830
332	Ga0068862_100030867	3300005844	Bacteria	4518
333	Ga0068862_100045888	3300005844	Bacteria	3729
334	Ga0068862_100382029	3300005844	Bacteria	1314
335	Ga0068862_100724970	3300005844	Bacteria	965
336	Ga0068862_102274705	3300005844	Bacteria	554
337	Ga0081455_10034250	3300005937	Bacteria	4553
338	Ga0081455_10035218	3300005937	Bacteria	4476
339	Ga0081455_10050401	3300005937	Bacteria	3581
340	Ga0081455_10078452	3300005937	Bacteria	2714
341	Ga0081538_10150740	3300005981	Bacteria	1053
342	Ga0081540_1001779	3300005983	Bacteria	18070
343	Ga0081540_1018312	3300005983	Bacteria	4302
344	Ga0081540_1025593	3300005983	Bacteria	3391
345	Ga0081540_1218874	3300005983	Bacteria	679
346	Ga0081539_10025774	3300005985	Bacteria	3772
347	Ga0070717_10105913	3300006028	Bacteria	2394
348	Ga0070717_10171211	3300006028	Bacteria	1889
349	Ga0070717_10341413	3300006028	Bacteria	1337
350	Ga0070717_10342952	3300006028	Bacteria	1334
351	Ga0070717_10533546	3300006028	Bacteria	1062
352	Ga0070717_10841879	3300006028	Bacteria	835
353	Ga0075365_10057535	3300006038	Bacteria	2587
354	Ga0075365_10062430	3300006038	Bacteria	2492
355	Ga0075365_10265072	3300006038	Bacteria	1208
356	Ga0075363_100049350	3300006048	Bacteria	2241
357	Ga0075363_100204548	3300006048	Bacteria	1129
358	Ga0075363_100306901	3300006048	Bacteria	922
359	Ga0075364_10069351	3300006051	Bacteria	2320
360	Ga0075364_10659798	3300006051	Bacteria	714
361	Ga0075432_10068731	3300006058	Bacteria	1270
362	Ga0075432_10193399	3300006058	Bacteria	802
363	Ga0070715_10017421	3300006163	Bacteria	2720
364	Ga0070715_10139137	3300006163	Bacteria	1177
365	Ga0070715_10203507	3300006163	Bacteria	1007
366	Ga0070715_10273988	3300006163	Bacteria	892
367	Ga0070715_10987669	3300006163	Bacteria	524
368	Ga0070716_100026033	3300006173	Bacteria	3128
369	Ga0070716_100028509	3300006173	Bacteria	3008
370	Ga0070716_100038887	3300006173	Bacteria	2637
371	Ga0070716_100042692	3300006173	Bacteria	2533
372	Ga0070716_100166173	3300006173	Bacteria	1435
373	Ga0070716_100202083	3300006173	Bacteria	1322
374	Ga0070716_100391819	3300006173	Bacteria	996
375	Ga0070712_100047152	3300006175	Bacteria	2981
376	Ga0070712_100071069	3300006175	Bacteria	2489
377	Ga0070712_100116792	3300006175	Bacteria	2001
378	Ga0070712_100164380	3300006175	Bacteria	1716
379	Ga0070712_100422736	3300006175	Bacteria	1105
380	Ga0070712_101255352	3300006175	Bacteria	645
381	Ga0075367_10019662	3300006178	Bacteria	3748
382	Ga0075367_10022674	3300006178	Bacteria	3524
383	Ga0075367_10033074	3300006178	Bacteria	2979
384	Ga0075369_10192367	3300006186	Bacteria	940
385	Ga0075366_10038579	3300006195	Bacteria	2822
386	Ga0097621_100048477	3300006237	Bacteria	3446
387	Ga0097621_100097813	3300006237	Bacteria	2465
388	Ga0097621_100887072	3300006237	Bacteria	830
389	Ga0075370_10074605	3300006353	Bacteria	1944
390	Ga0068871_100052029	3300006358	Bacteria	3316
391	Ga0068871_100490261	3300006358	Bacteria	1106
392	Ga0068871_100624947	3300006358	Bacteria	981
393	Ga0075428_100058953	3300006844	Bacteria	4204
394	Ga0075428_100145960	3300006844	Bacteria	2571
395	Ga0075428_100725120	3300006844	Bacteria	1058
396	Ga0075428_100790114	3300006844	Bacteria	1009
397	Ga0075428_101056121	3300006844	Bacteria	859
398	Ga0075428_101228393	3300006844	Bacteria	789
399	Ga0075430_100029135	3300006846	Bacteria	4686
400	Ga0075430_100060840	3300006846	Bacteria	3174
401	Ga0075430_100529851	3300006846	Bacteria	972
402	Ga0075431_100096669	3300006847	Bacteria	3049
403	Ga0075431_100132609	3300006847	Bacteria	2569
404	Ga0075431_100568870	3300006847	Bacteria	1119
405	Ga0075431_100625973	3300006847	Bacteria	1058
406	Ga0075431_100690271	3300006847	Bacteria	999
407	Ga0075431_101177461	3300006847	Bacteria	730
408	Ga0075431_102030226	3300006847	Bacteria	530
409	Ga0075433_10071440	3300006852	Bacteria	3051
410	Ga0075433_10770998	3300006852	Bacteria	841
411	Ga0075433_11823144	3300006852	Bacteria	523
412	Ga0075434_100077731	3300006871	Bacteria	3314
413	Ga0075434_100932156	3300006871	Bacteria	883
414	Ga0075434_101318390	3300006871	Bacteria	733
415	Ga0075429_100069945	3300006880	Bacteria	3055
416	Ga0075429_100135350	3300006880	Bacteria	2156
417	Ga0075429_100366215	3300006880	Bacteria	1262
418	Ga0075429_100721746	3300006880	Bacteria	873
419	Ga0068865_100029322	3300006881	Bacteria	3650
420	Ga0068865_100034960	3300006881	Bacteria	3376
421	Ga0068865_100038148	3300006881	Bacteria	3250
422	Ga0068865_100100724	3300006881	Bacteria	2114
423	Ga0068865_100291352	3300006881	Bacteria	1303
424	Ga0068865_100323542	3300006881	Bacteria	1241
425	Ga0068865_100359283	3300006881	Bacteria	1182
426	Ga0068865_100411250	3300006881	Bacteria	1110
427	Ga0075436_100610479	3300006914	Bacteria	804
428	Ga0097620_100011678	3300006931	Bacteria	8826
429	Ga0097620_100085069	3300006931	Bacteria	3208
430	Ga0097620_100272414	3300006931	Bacteria	1785
431	Ga0097620_100387352	3300006931	Bacteria	1493
432	Ga0097620_101649882	3300006931	Bacteria	708
433	Ga0099822_1039366	3300006943	Bacteria	2713
434	Ga0075435_100061941	3300007076	Bacteria	3036
435	Ga0075435_100507336	3300007076	Bacteria	1043
436	Ga0075435_100905559	3300007076	Bacteria	769
437	Ga0099794_10140625	3300007265	Bacteria	1222
438	Ga0099794_10215816	3300007265	Bacteria	985
439	Ga0099794_10569938	3300007265	Bacteria	598
440	Ga0099795_10187193	3300007788	Bacteria	867
441	Ga0105251_10083153	3300009011	Bacteria	1478
442	Ga0105244_10071717	3300009036	Bacteria	1727
443	Ga0105250_10145102	3300009092	Bacteria	985
444	Ga0105240_10000214	3300009093	Bacteria	117038
445	Ga0105240_10048136	3300009093	Bacteria	5390
446	Ga0105240_10123137	3300009093	Bacteria	3120
447	Ga0105240_10259521	3300009093	Bacteria	2005
448	Ga0105240_10564827	3300009093	Bacteria	1257
449	Ga0105240_12089436	3300009093	Bacteria	588
450	Ga0105240_12388680	3300009093	Bacteria	547
451	Ga0111539_10046008	3300009094	Bacteria	5222
452	Ga0111539_10121699	3300009094	Bacteria	3057
453	Ga0111539_10634290	3300009094	Bacteria	1244
454	Ga0111539_10744055	3300009094	Bacteria	1141
455	Ga0111539_10768976	3300009094	Bacteria	1121
456	Ga0105245_10058201	3300009098	Bacteria	3478
457	Ga0105245_10201832	3300009098	Bacteria	1910
458	Ga0105245_10260608	3300009098	Bacteria	1687
459	Ga0105245_10336940	3300009098	Bacteria	1490
460	Ga0105245_10663966	3300009098	Bacteria	1073
461	Ga0105247_10044897	3300009101	Bacteria	2711
462	Ga0105247_10058541	3300009101	Bacteria	2384
463	Ga0105247_10074819	3300009101	Bacteria	2125
464	Ga0105247_10084110	3300009101	Bacteria	2010
465	Ga0105247_10132222	3300009101	Bacteria	1627
466	Ga0105247_10308587	3300009101	Bacteria	1100
467	Ga0114129_10113312	3300009147	Bacteria	3740
468	Ga0114129_10126637	3300009147	Bacteria	3511
469	Ga0114129_10158638	3300009147	Bacteria	3093
470	Ga0114129_10395340	3300009147	Bacteria	1822
471	Ga0114129_10782585	3300009147	Bacteria	1219
472	Ga0114129_11129687	3300009147	Bacteria	979
473	Ga0114129_11803568	3300009147	Bacteria	744
474	Ga0105243_10043376	3300009148	Bacteria	3525
475	Ga0105243_10044601	3300009148	Bacteria	3479
476	Ga0105243_10230172	3300009148	Bacteria	1644
477	Ga0105243_10278244	3300009148	Bacteria	1506
478	Ga0105243_10554114	3300009148	Bacteria	1099
479	Ga0105243_10934174	3300009148	Bacteria	865
480	Ga0105241_10507221	3300009174	Bacteria	1077
481	Ga0105242_10052866	3300009176	Bacteria	3316
482	Ga0105242_10231413	3300009176	Bacteria	1656
483	Ga0105242_10318447	3300009176	Bacteria	1426
484	Ga0105242_10954539	3300009176	Bacteria	862
485	Ga0105242_11049044	3300009176	Bacteria	826
486	Ga0105248_10065986	3300009177	Bacteria	4064
487	Ga0105248_10122696	3300009177	Bacteria	2931
488	Ga0105248_10485519	3300009177	Bacteria	1392
489	Ga0105248_10534410	3300009177	Bacteria	1322
490	Ga0105248_10952725	3300009177	Bacteria	969
491	Ga0105248_11257672	3300009177	Bacteria	837
492	Ga0105248_11746359	3300009177	Bacteria	705
493	Ga0105237_10073967	3300009545	Bacteria	3399
494	Ga0105237_10102477	3300009545	Bacteria	2854
495	Ga0105237_10412752	3300009545	Bacteria	1355
496	Ga0105237_12362333	3300009545	Bacteria	542
497	Ga0105238_10387337	3300009551	Bacteria	1390
498	Ga0105238_10645527	3300009551	Bacteria	1068
499	Ga0105238_11476117	3300009551	Bacteria	708
500	Ga0105238_12641994	3300009551	Bacteria	538
501	Ga0105249_10028066	3300009553	Bacteria	5080
502	Ga0105249_10055087	3300009553	Bacteria	3637
503	Ga0105249_10087337	3300009553	Bacteria	2910
504	Ga0105249_10114680	3300009553	Bacteria	2551
505	Ga0105249_10138614	3300009553	Bacteria	2330
506	Ga0105249_10201224	3300009553	Bacteria	1949
507	Ga0105249_10273096	3300009553	Bacteria	1685
508	Ga0105249_10654618	3300009553	Bacteria	1108
509	Ga0099796_10025508	3300010159	Bacteria	1867
510	Ga0099796_10026637	3300010159	Bacteria	1838
511	Ga0099796_10071967	3300010159	Bacteria	1250
512	Ga0105239_10105018	3300010375	Bacteria	3128
513	Ga0105239_10111045	3300010375	Bacteria	3039
514	Ga0105239_10299303	3300010375	Bacteria	1811
515	Ga0105239_10357001	3300010375	Bacteria	1650
516	Ga0105239_10557915	3300010375	Bacteria	1305
517	Ga0105239_10968536	3300010375	Bacteria	978
518	Ga0105246_10031533	3300011119	Bacteria	3508
519	Ga0105246_10052543	3300011119	Bacteria	2801
520	Ga0105246_10055636	3300011119	Bacteria	2731
521	Ga0105246_10077333	3300011119	Bacteria	2360
522	Ga0105246_10201464	3300011119	Bacteria	1548
523	Ga0105246_11297140	3300011119	Bacteria	675
524	Ga0157323_1008223	3300012495	Bacteria	772
525	Ga0157323_1049526	3300012495	Bacteria	507
526	Ga0157319_1004757	3300012497	Bacteria	905
527	Ga0157319_1015828	3300012497	Bacteria	678
528	Ga0157345_1032691	3300012498	Bacteria	591
529	Ga0157339_1008392	3300012505	Bacteria	890
530	Ga0157342_1000363	3300012507	Bacteria	2647
531	Ga0157316_1026130	3300012510	Bacteria	675
532	Ga0157326_1087187	3300012513	Bacteria	520
533	Ga0157371_10618375	3300013102	Bacteria	807
534	Ga0157370_10064658	3300013104	Bacteria	3462
535	Ga0157369_10101001	3300013105	Bacteria	3075
536	Ga0157369_10144292	3300013105	Bacteria	2517
537	Ga0157369_10815287	3300013105	Bacteria	959
538	Ga0157369_11188084	3300013105	Bacteria	779
539	Ga0157374_10058616	3300013296	Bacteria	3598
540	Ga0157374_10076268	3300013296	Bacteria	3170
541	Ga0157374_10598273	3300013296	Bacteria	1113
542	Ga0157374_10611843	3300013296	Bacteria	1100
543	Ga0157374_11143053	3300013296	Bacteria	799
544	Ga0157378_10041017	3300013297	Bacteria	4106
545	Ga0157378_10369096	3300013297	Bacteria	1406
546	Ga0157378_10871815	3300013297	Bacteria	930
547	Ga0157378_11223202	3300013297	Bacteria	791
548	Ga0157378_11721835	3300013297	Bacteria	674
549	Ga0157378_12204585	3300013297	Bacteria	602
550	Ga0163162_10060990	3300013306	Bacteria	3809
551	Ga0163162_10064322	3300013306	Bacteria	3713
552	Ga0163162_10091115	3300013306	Bacteria	3131
553	Ga0163162_10224089	3300013306	Bacteria	2010
554	Ga0163162_10247417	3300013306	Bacteria	1914
555	Ga0163162_10511741	3300013306	Bacteria	1330
556	Ga0163162_10574284	3300013306	Bacteria	1255
557	Ga0163162_11550495	3300013306	Bacteria	755
558	Ga0157372_10190801	3300013307	Bacteria	2374
559	Ga0157372_10294740	3300013307	Bacteria	1886
560	Ga0157372_11125182	3300013307	Bacteria	908
561	Ga0157375_10054329	3300013308	Bacteria	3944
562	Ga0157375_10074384	3300013308	Bacteria	3419
563	Ga0157375_10219534	3300013308	Bacteria	2059
564	Ga0157375_11202325	3300013308	Bacteria	889
565	Ga0157375_12270665	3300013308	Bacteria	647
566	Ga0163163_10071117	3300014325	Bacteria	3466
567	Ga0163163_10072960	3300014325	Bacteria	3422
568	Ga0163163_10104982	3300014325	Bacteria	2851
569	Ga0163163_10854593	3300014325	Bacteria	973
570	Ga0163163_11299038	3300014325	Bacteria	790
571	Ga0163163_11927232	3300014325	Bacteria	651
572	Ga0163163_12516882	3300014325	Bacteria	573
573	Ga0157380_10044229	3300014326	Bacteria	3489
574	Ga0157380_10076607	3300014326	Bacteria	2723
575	Ga0157380_10400435	3300014326	Bacteria	1302
576	Ga0157380_10512190	3300014326	Bacteria	1168
577	Ga0157377_10049881	3300014745	Bacteria	2355
578	Ga0157377_10174301	3300014745	Bacteria	1347
579	Ga0157379_10063563	3300014968	Bacteria	3299
580	Ga0157379_10094922	3300014968	Bacteria	2676
581	Ga0157379_10466088	3300014968	Bacteria	1168
582	Ga0157376_10037388	3300014969	Bacteria	3940
583	Ga0157376_10975433	3300014969	Bacteria	869
584	Ga0157376_11329171	3300014969	Bacteria	749
585	Ga0157376_12002407	3300014969	Bacteria	617
586	Ga0163161_10048134	3300017792	Bacteria	3079
587	Ga0163161_10053149	3300017792	Bacteria	2937
588	Ga0163161_10106676	3300017792	Bacteria	2090
589	Ga0163161_10123130	3300017792	Bacteria	1950
590	Ga0163161_10171661	3300017792	Bacteria	1658
591	Ga0163161_10361394	3300017792	Bacteria	1156
592	Ga0163161_10399896	3300017792	Bacteria	1101
593	Ga0206356_11796761	3300020070	Bacteria	2748
594	Ga0206353_11171063	3300020082	Bacteria	1000
595	Ga0213872_10013559	3300021361	Bacteria	3816
596	Ga0213872_10022770	3300021361	Bacteria	2882
597	Ga0213872_10034001	3300021361	Bacteria	2335
598	Ga0213872_10217498	3300021361	Bacteria	814
599	Ga0213876_10032700	3300021384	Bacteria	2743
600	Ga0213876_10076761	3300021384	Bacteria	1764
601	Ga0213876_10144797	3300021384	Bacteria	1263
602	Ga0213875_10010246	3300021388	Bacteria	4702
603	Ga0213875_10309100	3300021388	Bacteria	748
604	Ga0213871_10039146	3300021441	Bacteria	1268
605	Ga0207672_1002512	3300025223	Bacteria	1101
606	Ga0209437_102087	3300025233	Bacteria	4051
607	Ga0209677_100346	3300025253	Bacteria	29099
608	Ga0209233_1000402	3300025261	Bacteria	35366
609	Ga0207666_1013324	3300025271	Bacteria	1154
610	Ga0209673_1015007	3300025273	Bacteria	2967
611	Ga0207673_1002966	3300025290	Bacteria	1967
612	Ga0209564_1010110	3300025295	Bacteria	4391
613	Ga0209758_1002437	3300025297	Bacteria	18988
614	Ga0207697_10014111	3300025315	Bacteria	3323
615	Ga0207697_10027176	3300025315	Bacteria	2340
616	Ga0207656_10020255	3300025321	Bacteria	2642
617	Ga0207656_10325523	3300025321	Bacteria	764
618	Ga0207653_10011706	3300025885	Bacteria	2736
619	Ga0207653_10085715	3300025885	Bacteria	1097
620	Ga0207682_10018078	3300025893	Bacteria	2754
621	Ga0207682_10023002	3300025893	Bacteria	2459
622	Ga0207692_10013797	3300025898	Bacteria	3514
623	Ga0207692_10234580	3300025898	Bacteria	1093
624	Ga0207692_10470230	3300025898	Bacteria	794
625	Ga0207642_10188674	3300025899	Bacteria	1129
626	Ga0207642_10281136	3300025899	Bacteria	957
627	Ga0207642_10340061	3300025899	Bacteria	882
628	Ga0207710_10098738	3300025900	Bacteria	1375
629	Ga0207710_10110612	3300025900	Bacteria	1304
630	Ga0207710_10136388	3300025900	Bacteria	1182
631	Ga0207710_10569616	3300025900	Bacteria	591
632	Ga0207688_10017957	3300025901	Bacteria	3849
633	Ga0207688_10032419	3300025901	Bacteria	2888
634	Ga0207680_10029231	3300025903	Bacteria	3094
635	Ga0207680_10057008	3300025903	Bacteria	2362
636	Ga0207680_10164083	3300025903	Bacteria	1492
637	Ga0207680_10214418	3300025903	Bacteria	1317
638	Ga0207680_10288643	3300025903	Bacteria	1141
639	Ga0207680_10514127	3300025903	Bacteria	853
640	Ga0207647_10027482	3300025904	Bacteria	3709
641	Ga0207647_10041135	3300025904	Bacteria	2908
642	Ga0207647_10201857	3300025904	Bacteria	1150
643	Ga0207647_10220174	3300025904	Bacteria	1094
644	Ga0207647_10275142	3300025904	Bacteria	962
645	Ga0207647_10341703	3300025904	Bacteria	848
646	Ga0207685_10033118	3300025905	Bacteria	1865
647	Ga0207685_10093616	3300025905	Bacteria	1271
648	Ga0207685_10112532	3300025905	Bacteria	1182
649	Ga0207685_10127574	3300025905	Bacteria	1125
650	Ga0207685_10218696	3300025905	Bacteria	905
651	Ga0207685_10271856	3300025905	Bacteria	828
652	Ga0207685_10504803	3300025905	Bacteria	637
653	Ga0207685_10651419	3300025905	Bacteria	569
654	Ga0207685_10652877	3300025905	Bacteria	569
655	Ga0207699_10021781	3300025906	Bacteria	3461
656	Ga0207699_10075229	3300025906	Bacteria	2077
657	Ga0207699_10202107	3300025906	Bacteria	1347
658	Ga0207699_10457832	3300025906	Bacteria	916
659	Ga0207645_10083525	3300025907	Bacteria	2048
660	Ga0207645_10173537	3300025907	Bacteria	1414
661	Ga0207645_10381154	3300025907	Bacteria	947
662	Ga0207643_10019057	3300025908	Bacteria	3759
663	Ga0207643_10036307	3300025908	Bacteria	2763
664	Ga0207643_10229868	3300025908	Bacteria	1137
665	Ga0207705_10037903	3300025909	Bacteria	3449
666	Ga0207705_10329417	3300025909	Bacteria	1174
667	Ga0207705_10965368	3300025909	Bacteria	659
668	Ga0207684_10057454	3300025910	Bacteria	3301
669	Ga0207684_10059245	3300025910	Bacteria	3251
670	Ga0207684_10079032	3300025910	Bacteria	2798
671	Ga0207684_10132219	3300025910	Bacteria	2142
672	Ga0207684_10648829	3300025910	Bacteria	899
673	Ga0207684_11595628	3300025910	Bacteria	528
674	Ga0207654_10260322	3300025911	Bacteria	1166
675	Ga0207707_10043465	3300025912	Bacteria	3920
676	Ga0207707_10315427	3300025912	Bacteria	1350
677	Ga0207707_10360963	3300025912	Bacteria	1251
678	Ga0207707_10520062	3300025912	Bacteria	1013
679	Ga0207695_10000373	3300025913	Bacteria	101687
680	Ga0207695_10354600	3300025913	Bacteria	1354
681	Ga0207695_10505813	3300025913	Bacteria	1090
682	Ga0207695_10599499	3300025913	Bacteria	983
683	Ga0207671_10053523	3300025914	Bacteria	2991
684	Ga0207671_10066355	3300025914	Bacteria	2686
685	Ga0207671_10090272	3300025914	Bacteria	2307
686	Ga0207671_10867702	3300025914	Bacteria	714
687	Ga0207693_10035440	3300025915	Bacteria	3934
688	Ga0207693_10113530	3300025915	Bacteria	2125
689	Ga0207693_10146311	3300025915	Bacteria	1858
690	Ga0207693_10161471	3300025915	Bacteria	1763
691	Ga0207693_10338896	3300025915	Bacteria	1177
692	Ga0207693_10384622	3300025915	Bacteria	1097
693	Ga0207693_10395674	3300025915	Bacteria	1080
694	Ga0207663_10016641	3300025916	Bacteria	4083
695	Ga0207663_10101216	3300025916	Bacteria	1935
696	Ga0207663_10209216	3300025916	Bacteria	1412
697	Ga0207663_10406352	3300025916	Bacteria	1042
698	Ga0207663_10534523	3300025916	Bacteria	915
699	Ga0207663_10534684	3300025916	Bacteria	914
700	Ga0207663_10579879	3300025916	Bacteria	879
701	Ga0207663_10721559	3300025916	Bacteria	790
702	Ga0207660_10013681	3300025917	Bacteria	5323
703	Ga0207660_10485303	3300025917	Bacteria	1002
704	Ga0207660_10628137	3300025917	Bacteria	875
705	Ga0207662_10015080	3300025918	Bacteria	4343
706	Ga0207662_10015662	3300025918	Bacteria	4268
707	Ga0207662_10353364	3300025918	Bacteria	988
708	Ga0207657_10081116	3300025919	Bacteria	2726
709	Ga0207657_10461619	3300025919	Bacteria	996
710	Ga0207657_10831295	3300025919	Bacteria	713
711	Ga0207657_11301182	3300025919	Bacteria	549
712	Ga0207649_10691393	3300025920	Bacteria	790
713	Ga0207652_10146948	3300025921	Bacteria	2110
714	Ga0207652_10196399	3300025921	Bacteria	1815
715	Ga0207652_10513533	3300025921	Bacteria	1078
716	Ga0207652_11037248	3300025921	Bacteria	719
717	Ga0207652_11613162	3300025921	Bacteria	553
718	Ga0207646_10024612	3300025922	Bacteria	5514
719	Ga0207646_10062385	3300025922	Bacteria	3327
720	Ga0207646_10323444	3300025922	Bacteria	1394
721	Ga0207681_10044241	3300025923	Bacteria	2983
722	Ga0207681_10619943	3300025923	Bacteria	895
723	Ga0207681_10884088	3300025923	Bacteria	748
724	Ga0207694_10548808	3300025924	Bacteria	970
725	Ga0207650_10042359	3300025925	Bacteria	3340
726	Ga0207650_10074168	3300025925	Bacteria	2564
727	Ga0207650_10676470	3300025925	Bacteria	871
728	Ga0207659_10040650	3300025926	Bacteria	3253
729	Ga0207659_10055283	3300025926	Bacteria	2838
730	Ga0207659_10924743	3300025926	Bacteria	750
731	Ga0207687_10108753	3300025927	Bacteria	2053
732	Ga0207687_10171529	3300025927	Bacteria	1673
733	Ga0207687_10189473	3300025927	Bacteria	1600
734	Ga0207687_10311030	3300025927	Bacteria	1272
735	Ga0207687_10446735	3300025927	Bacteria	1072
736	Ga0207687_11728663	3300025927	Bacteria	536
737	Ga0207700_10050574	3300025928	Bacteria	3097
738	Ga0207700_10266281	3300025928	Bacteria	1469
739	Ga0207700_10290412	3300025928	Bacteria	1409
740	Ga0207700_10500532	3300025928	Bacteria	1075
741	Ga0207664_10057769	3300025929	Bacteria	3085
742	Ga0207664_10072284	3300025929	Bacteria	2780
743	Ga0207664_10190231	3300025929	Bacteria	1766
744	Ga0207664_10406806	3300025929	Bacteria	1211
745	Ga0207664_10421030	3300025929	Bacteria	1190
746	Ga0207664_10528836	3300025929	Bacteria	1057
747	Ga0207644_10041840	3300025931	Bacteria	3243
748	Ga0207644_10085832	3300025931	Bacteria	2335
749	Ga0207644_10206802	3300025931	Bacteria	1550
750	Ga0207644_10314235	3300025931	Bacteria	1265
751	Ga0207690_10144873	3300025932	Bacteria	1755
752	Ga0207690_10582285	3300025932	Bacteria	912
753	Ga0207690_10654371	3300025932	Bacteria	861
754	Ga0207690_10670192	3300025932	Bacteria	851
755	Ga0207690_10996633	3300025932	Bacteria	697
756	Ga0207706_10038063	3300025933	Bacteria	4268
757	Ga0207706_10058630	3300025933	Bacteria	3391
758	Ga0207706_10063148	3300025933	Bacteria	3261
759	Ga0207706_10107655	3300025933	Bacteria	2453
760	Ga0207706_10298514	3300025933	Bacteria	1404
761	Ga0207686_10072212	3300025934	Bacteria	2223
762	Ga0207686_10240942	3300025934	Bacteria	1316
763	Ga0207686_10370266	3300025934	Bacteria	1084
764	Ga0207686_10684826	3300025934	Bacteria	814
765	Ga0207709_10049575	3300025935	Bacteria	2564
766	Ga0207709_10052277	3300025935	Bacteria	2508
767	Ga0207709_10258510	3300025935	Bacteria	1276
768	Ga0207709_10402527	3300025935	Bacteria	1047
769	Ga0207709_10479840	3300025935	Bacteria	966
770	Ga0207709_10608380	3300025935	Bacteria	866
771	Ga0207670_10041706	3300025936	Bacteria	3019
772	Ga0207670_10073740	3300025936	Bacteria	2367
773	Ga0207670_10245373	3300025936	Bacteria	1381
774	Ga0207670_10299663	3300025936	Bacteria	1258
775	Ga0207669_10020122	3300025937	Bacteria	3491
776	Ga0207669_10028158	3300025937	Bacteria	3087
777	Ga0207669_10259148	3300025937	Bacteria	1299
778	Ga0207669_10288327	3300025937	Bacteria	1242
779	Ga0207669_10779628	3300025937	Bacteria	791
780	Ga0207704_10019520	3300025938	Bacteria	3562
781	Ga0207704_10047130	3300025938	Bacteria	2574
782	Ga0207704_10155737	3300025938	Bacteria	1619
783	Ga0207704_11546685	3300025938	Bacteria	569
784	Ga0207665_10032332	3300025939	Bacteria	3464
785	Ga0207665_10063608	3300025939	Bacteria	2506
786	Ga0207665_10075494	3300025939	Bacteria	2309
787	Ga0207665_10200975	3300025939	Bacteria	1452
788	Ga0207665_10290355	3300025939	Bacteria	1220
789	Ga0207665_10359520	3300025939	Bacteria	1101
790	Ga0207665_10377588	3300025939	Bacteria	1075
791	Ga0207665_10655482	3300025939	Bacteria	823
792	Ga0207691_10046187	3300025940	Bacteria	4004
793	Ga0207691_10062282	3300025940	Bacteria	3386
794	Ga0207691_10336746	3300025940	Bacteria	1292
795	Ga0207711_10224051	3300025941	Bacteria	1721
796	Ga0207711_10241817	3300025941	Bacteria	1655
797	Ga0207711_10309986	3300025941	Bacteria	1457
798	Ga0207711_10345749	3300025941	Bacteria	1377
799	Ga0207711_10584138	3300025941	Bacteria	1042
800	Ga0207711_10712365	3300025941	Bacteria	936
801	Ga0207711_11556663	3300025941	Bacteria	604
802	Ga0207689_10059772	3300025942	Bacteria	3135
803	Ga0207689_10069587	3300025942	Bacteria	2892
804	Ga0207689_10755058	3300025942	Bacteria	821
805	Ga0207661_10103934	3300025944	Bacteria	2391
806	Ga0207661_10252382	3300025944	Bacteria	1568
807	Ga0207661_10489546	3300025944	Bacteria	1123
808	Ga0207679_10218180	3300025945	Bacteria	1604
809	Ga0207679_10290636	3300025945	Bacteria	1405
810	Ga0207679_11123884	3300025945	Bacteria	721
811	Ga0207667_10055801	3300025949	Bacteria	4151
812	Ga0207667_10103589	3300025949	Bacteria	2935
813	Ga0207667_10169711	3300025949	Bacteria	2242
814	Ga0207651_10035608	3300025960	Bacteria	3239
815	Ga0207651_10056350	3300025960	Bacteria	2704
816	Ga0207651_10202112	3300025960	Bacteria	1593
817	Ga0207712_10000585	3300025961	Bacteria	29451
818	Ga0207712_10048335	3300025961	Bacteria	2959
819	Ga0207712_10064412	3300025961	Bacteria	2614
820	Ga0207712_10077573	3300025961	Bacteria	2408
821	Ga0207712_10126146	3300025961	Bacteria	1943
822	Ga0207712_10144232	3300025961	Bacteria	1831
823	Ga0207712_10247782	3300025961	Bacteria	1438
824	Ga0207712_10637831	3300025961	Bacteria	925
825	Ga0207712_11501394	3300025961	Bacteria	604
826	Ga0207668_10061777	3300025972	Bacteria	2636
827	Ga0207668_10089892	3300025972	Bacteria	2252
828	Ga0207668_10102105	3300025972	Bacteria	2133
829	Ga0207668_10167073	3300025972	Bacteria	1721
830	Ga0207668_10258154	3300025972	Bacteria	1418
831	Ga0207668_10640428	3300025972	Bacteria	929
832	Ga0207668_10836542	3300025972	Bacteria	816
833	Ga0207668_11467762	3300025972	Bacteria	615
834	Ga0207640_10034177	3300025981	Bacteria	3170
835	Ga0207640_10371398	3300025981	Bacteria	1156
836	Ga0207640_10423834	3300025981	Bacteria	1090
837	Ga0207658_10102726	3300025986	Bacteria	2242
838	Ga0207658_10365241	3300025986	Bacteria	1260
839	Ga0207658_10410207	3300025986	Bacteria	1192
840	Ga0207658_10490358	3300025986	Bacteria	1093
841	Ga0207658_10661470	3300025986	Bacteria	942
842	Ga0207658_12187782	3300025986	Bacteria	502
843	Ga0207677_10073181	3300026023	Bacteria	2425
844	Ga0207677_10692798	3300026023	Bacteria	903
845	Ga0207677_10858439	3300026023	Bacteria	816
846	Ga0207703_10054702	3300026035	Bacteria	3246
847	Ga0207703_10071624	3300026035	Bacteria	2863
848	Ga0207703_10122142	3300026035	Bacteria	2237
849	Ga0207703_10641907	3300026035	Bacteria	1007
850	Ga0207703_11369969	3300026035	Bacteria	680
851	Ga0207639_10082447	3300026041	Bacteria	2549
852	Ga0207639_10276728	3300026041	Bacteria	1474
853	Ga0207639_10364480	3300026041	Bacteria	1294
854	Ga0207639_10459927	3300026041	Bacteria	1157
855	Ga0207639_10585532	3300026041	Bacteria	1027
856	Ga0207678_10015379	3300026067	Bacteria	6729
857	Ga0207678_10037550	3300026067	Bacteria	4213
858	Ga0207678_10062555	3300026067	Bacteria	3199
859	Ga0207678_10078969	3300026067	Bacteria	2818
860	Ga0207678_10088720	3300026067	Bacteria	2643
861	Ga0207678_10091072	3300026067	Bacteria	2606
862	Ga0207678_10282334	3300026067	Bacteria	1425
863	Ga0207678_10831716	3300026067	Bacteria	815
864	Ga0207708_10029482	3300026075	Bacteria	4160
865	Ga0207708_10066148	3300026075	Bacteria	2764
866	Ga0207708_10071628	3300026075	Bacteria	2655
867	Ga0207708_10085476	3300026075	Bacteria	2427
868	Ga0207708_10596160	3300026075	Bacteria	936
869	Ga0207702_10290190	3300026078	Bacteria	1549
870	Ga0207702_10292819	3300026078	Bacteria	1543
871	Ga0207702_10639362	3300026078	Bacteria	1046
872	Ga0207702_10641390	3300026078	Bacteria	1044
873	Ga0207702_10935740	3300026078	Bacteria	859
874	Ga0207641_10062575	3300026088	Bacteria	3176
875	Ga0207641_10088324	3300026088	Bacteria	2706
876	Ga0207641_11140882	3300026088	Bacteria	778
877	Ga0207648_10065723	3300026089	Bacteria	3162
878	Ga0207648_10076181	3300026089	Bacteria	2924
879	Ga0207648_10121289	3300026089	Bacteria	2299
880	Ga0207648_10229568	3300026089	Bacteria	1651
881	Ga0207648_10360949	3300026089	Bacteria	1311
882	Ga0207648_10511333	3300026089	Bacteria	1100
883	Ga0207676_10072021	3300026095	Bacteria	2776
884	Ga0207676_10150874	3300026095	Bacteria	2001
885	Ga0207676_10991268	3300026095	Bacteria	827
886	Ga0207676_11124931	3300026095	Bacteria	777
887	Ga0207674_10023599	3300026116	Bacteria	6586
888	Ga0207674_10343974	3300026116	Bacteria	1442
889	Ga0207674_12026797	3300026116	Bacteria	540
890	Ga0207675_100020156	3300026118	Bacteria	6217
891	Ga0207675_100024147	3300026118	Bacteria	5652
892	Ga0207675_100064100	3300026118	Bacteria	3434
893	Ga0207675_100110238	3300026118	Bacteria	2597
894	Ga0207675_100181364	3300026118	Bacteria	2016
895	Ga0207675_100687112	3300026118	Bacteria	1031
896	Ga0207683_10048793	3300026121	Bacteria	3705
897	Ga0207683_10091106	3300026121	Bacteria	2716
898	Ga0207683_10200171	3300026121	Bacteria	1815
899	Ga0207683_10265202	3300026121	Bacteria	1568
900	Ga0207683_11102760	3300026121	Bacteria	736
901	Ga0207683_11685538	3300026121	Bacteria	583
902	Ga0207698_10064868	3300026142	Bacteria	2865
903	Ga0207698_10086511	3300026142	Bacteria	2549
904	Ga0207698_10437020	3300026142	Bacteria	1260
905	Ga0207698_10726811	3300026142	Bacteria	990
906	Ga0207698_11348378	3300026142	Bacteria	728
907	Ga0209389_1052241	3300027296	Bacteria	2784
908	Ga0209589_1030082	3300027357	Bacteria	3037
909	Ga0209489_100917	3300027361	Bacteria	58978
910	Ga0209179_1056343	3300027512	Bacteria	849
911	Ga0209588_1107203	3300027671	Bacteria	898
912	Ga0209588_1212191	3300027671	Bacteria	600
913	Ga0209813_10026024	3300027866	Bacteria	1688
914	Ga0207428_10087032	3300027907	Bacteria	2431
915	Ga0207428_10150666	3300027907	Bacteria	1770
916	Ga0207428_10765185	3300027907	Bacteria	688
917	Ga0268266_10022204	3300028379	Bacteria	5409
918	Ga0268266_10096154	3300028379	Bacteria	2602
919	Ga0268266_10129863	3300028379	Bacteria	2252
920	Ga0268266_10187007	3300028379	Bacteria	1889
921	Ga0268266_10651002	3300028379	Bacteria	1014
922	Ga0268266_10747104	3300028379	Bacteria	944
923	Ga0268266_11150034	3300028379	Bacteria	751
924	Ga0268265_10005126	3300028380	Bacteria	8971
925	Ga0268265_10061359	3300028380	Bacteria	2884
926	Ga0268265_10188845	3300028380	Bacteria	1777
927	Ga0268264_10002941	3300028381	Bacteria	14794
928	Ga0268264_10241539	3300028381	Bacteria	1673
929	Ga0268264_10283213	3300028381	Bacteria	1554
930	Ga0268264_10498493	3300028381	Bacteria	1187
931	Ga0268264_10674219	3300028381	Bacteria	1025
932	Ga0268264_10938664	3300028381	Bacteria	870
933	Ga0268264_12509937	3300028381	Bacteria	521
934	Ga0307517_10275345	3300028786	Bacteria	964
935	Ga0307515_10132155	3300028794	Bacteria	2740
936	Ga0307515_10135239	3300028794	Bacteria	2685
937	Ga0265338_10111787	3300028800	Bacteria	2198
938	Ga0314311_1180298	3300030733	Bacteria	1147
939	Ga0265760_10086322	3300031090	Bacteria	977
940	Ga0265330_10015341	3300031235	Bacteria	3545
941	Ga0265332_10066572	3300031238	Bacteria	1537
942	Ga0265328_10012873	3300031239	Bacteria	3323
943	Ga0265328_10021593	3300031239	Bacteria	2454
944	Ga0265325_10081294	3300031241	Bacteria	1610
945	Ga0265329_10015870	3300031242	Bacteria	2622
946	Ga0265329_10064518	3300031242	Bacteria	1159
947	Ga0265340_10386724	3300031247	Bacteria	617
948	Ga0265339_10023122	3300031249	Bacteria	3595
949	Ga0265339_10335853	3300031249	Bacteria	714
950	Ga0265331_10249325	3300031250	Bacteria	796
951	Ga0265331_10456075	3300031250	Bacteria	574
952	Ga0265327_10064012	3300031251	Bacteria	1865
953	Ga0265316_10055809	3300031344	Bacteria	3087
954	Ga0265316_10070620	3300031344	Bacteria	2693
955	Ga0265316_10105171	3300031344	Bacteria	2142
956	Ga0265316_10217038	3300031344	Bacteria	1413
957	Ga0265316_10348004	3300031344	Bacteria	1073
958	Ga0307513_10127711	3300031456	Bacteria	2494
959	Ga0307513_10280811	3300031456	Bacteria	1442
960	Ga0307509_10133492	3300031507	Bacteria	2433
961	Ga0307509_10213794	3300031507	Bacteria	1750
962	Ga0307508_10435988	3300031616	Bacteria	902
963	Ga0265314_10038605	3300031711	Bacteria	3447
964	Ga0265314_10267978	3300031711	Bacteria	972
965	Ga0265342_10223132	3300031712	Bacteria	1015
966	Ga0265342_10289723	3300031712	Bacteria	865
967	Ga0307516_10007599	3300031730	Bacteria	12424
968	Ga0307516_10283404	3300031730	Bacteria	1338
969	Ga0307413_11761563	3300031824	Bacteria	554
970	Ga0307410_10820099	3300031852	Bacteria	792
971	Ga0326468_10000972	3300031889	Bacteria	2763
972	Ga0307412_10447903	3300031911	Bacteria	1063
973	Ga0316593_10320748	3300032168	Bacteria	589
974	Ga0307507_10316188	3300033179	Bacteria	944
975	Ga0307510_10073274	3300033180	Bacteria	3394
976	Ga0307510_10239140	3300033180	Bacteria	1312
977	Ga0373930_0050834	3300034816	Bacteria	905
978	Ga0373948_0013335	3300034817	Bacteria	1483
979	Ga0373950_0072790	3300034818	Bacteria	707
980	Ga0373950_0103580	3300034818	Bacteria	615
981	Ga0373958_0039695	3300034819	Bacteria	958
982	Ga0373926_0129624	3300035083	Bacteria	954
983	Ga0373926_0161906	3300035083	Bacteria	854
984	Ga0373928_0052617	3300035084	Bacteria	966
985	Ga0373929_0127820	3300035085	Bacteria	664
986	Ga0373934_0053150	3300035086	Bacteria	1607
987	Ga0373934_0360956	3300035086	Bacteria	605
988	Ga0373940_0129157	3300035088	Bacteria	790
989	Ga0373944_0022663	3300035089	Bacteria	1826
990	Ga0373944_0031391	3300035089	Bacteria	1598
991	Ga0373944_0185074	3300035089	Bacteria	748
992	Ga0373944_0278407	3300035089	Bacteria	623
993	Ga0373949_0054229	3300035090	Bacteria	1017
994	Ga0373949_0060088	3300035090	Bacteria	976
995	Ga0373951_0216243	3300035091	Bacteria	564
996	Ga0373952_0082468	3300035092	Bacteria	823
997	Ga0373923_0025299	3300035111	Bacteria	2351
998	Ga0373923_0050567	3300035111	Bacteria	1741
999	Ga0373923_0087226	3300035111	Bacteria	1361
1000	Ga0373923_0118740	3300035111	Bacteria	1180
1001	Ga0373923_0145989	3300035111	Bacteria	1072
1002	Ga0373923_0160180	3300035111	Bacteria	1026
1003	Ga0373923_0300089	3300035111	Bacteria	760
1004	Ga0373923_0348574	3300035111	Bacteria	707
1005	Ga0373932_0031151	3300035112	Bacteria	1484
1006	Ga0373932_0033969	3300035112	Bacteria	1435
1007	Ga0373936_0149967	3300035113	Bacteria	1010
1008	Ga0373936_0172059	3300035113	Bacteria	947
1009	Ga0373936_0211367	3300035113	Bacteria	858
1010	Ga0373936_0629493	3300035113	Bacteria	505
1011	Ga0373939_0026226	3300035114	Bacteria	1641
1012	Ga0373939_0164496	3300035114	Bacteria	817
1013	Ga0373939_0173128	3300035114	Bacteria	800
1014	Ga0373941_0040463	3300035115	Bacteria	1438
1015	Ga0373941_0304236	3300035115	Bacteria	637
1016	Ga0373945_0040015	3300035116	Bacteria	1691
1017	Ga0373945_0105413	3300035116	Bacteria	1107
1018	Ga0373945_0148942	3300035116	Bacteria	947
1019	Ga0373945_0157335	3300035116	Bacteria	924
1020	Ga0373945_0425744	3300035116	Bacteria	584
1021	Ga0373953_0015051	3300035117	Bacteria	2794
1022	Ga0373953_0050058	3300035117	Bacteria	1687
1023	Ga0373953_0074586	3300035117	Bacteria	1403
1024	Ga0373953_0480816	3300035117	Bacteria	550
1025	Ga0373953_0540871	3300035117	Bacteria	517
1026	Ga0373954_0019849	3300035118	Bacteria	3034
1027	Ga0373954_0019918	3300035118	Bacteria	3029
1028	Ga0373954_0028236	3300035118	Bacteria	2579
1029	Ga0373954_0047550	3300035118	Bacteria	2008
1030	Ga0373954_0085363	3300035118	Bacteria	1511
1031	Ga0373954_0326512	3300035118	Bacteria	757
1032	Ga0373954_0399468	3300035118	Bacteria	680
1033	Ga0373956_0030765	3300035119	Bacteria	2348
1034	Ga0373956_0114428	3300035119	Bacteria	1257
1035	Ga0373956_0487274	3300035119	Bacteria	588
1036	Ga0373957_0016532	3300035120	Bacteria	2554
1037	Ga0373957_0232347	3300035120	Bacteria	773
1038	Ga0373957_0245714	3300035120	Bacteria	752
1039	Ga0373960_0101701	3300035121	Bacteria	932
1040	Ga0373943_0080587	3300035170	Bacteria	1668
1041	Ga0373943_0109288	3300035170	Bacteria	1456
1042	Ga0373943_0114353	3300035170	Bacteria	1427
1043	Ga0373943_0124022	3300035170	Bacteria	1375
1044	Ga0373943_0270664	3300035170	Bacteria	958
1045	Ga0373943_0309456	3300035170	Bacteria	898
1046	Ga0373943_0321230	3300035170	Bacteria	882
1047	Ga0373943_0567817	3300035170	Bacteria	666
1048	Ga0373943_0572643	3300035170	Bacteria	664
1049	Ga0373943_0580769	3300035170	Bacteria	659
1050	Ga0373943_0617100	3300035170	Bacteria	639
1051	Ga0373943_0636921	3300035170	Bacteria	629
1052	Ga0373946_0006182	3300035171	Bacteria	4337
1053	Ga0373946_0018765	3300035171	Bacteria	2658
1054	Ga0373946_0078762	3300035171	Bacteria	1438
1055	Ga0373946_0082082	3300035171	Bacteria	1413
1056	Ga0373946_0186245	3300035171	Bacteria	987
1057	Ga0373946_0216407	3300035171	Bacteria	923
1058	Ga0373955_0048305	3300035172	Bacteria	2307
1059	Ga0373955_0072544	3300035172	Bacteria	1928
1060	Ga0373955_0147722	3300035172	Bacteria	1382
1061	Ga0373955_0158079	3300035172	Bacteria	1336
1062	Ga0373955_0290198	3300035172	Bacteria	985
1063	Ga0373955_0334770	3300035172	Bacteria	915
1064	Ga0373955_0342671	3300035172	Bacteria	904
1065	Ga0373942_0120640	3300035207	Bacteria	819
1066	Ga0373942_0143157	3300035207	Bacteria	763
1067	Ga0373961_0092534	3300035241	Bacteria	968
1068	Ga0373962_0011074	3300035242	Bacteria	2256
1069	Ga0373962_0108194	3300035242	Bacteria	874
1070	Ga0316574_0198250	3300035398	Bacteria	1290
1071	Ga0373924_0015840	3300035410	Bacteria	2871
1072	Ga0373924_0018409	3300035410	Bacteria	2691
1073	Ga0373924_0038098	3300035410	Bacteria	1960
1074	Ga0373924_0067477	3300035410	Bacteria	1504
1075	Ga0373924_0219718	3300035410	Bacteria	839
1076	Ga0373931_0159956	3300035691	Bacteria	1319
1077	Ga0373931_0166604	3300035691	Bacteria	1295
1078	Ga0373931_0208178	3300035691	Bacteria	1172
1079	Ga0373931_0357718	3300035691	Bacteria	915
1080	Ga0373935_0056141	3300035692	Bacteria	2510
1081	Ga0373935_0085775	3300035692	Bacteria	2053
1082	Ga0373935_0102093	3300035692	Bacteria	1892
1083	Ga0373935_0117294	3300035692	Bacteria	1774
1084	Ga0373935_0120671	3300035692	Bacteria	1751
1085	Ga0373935_0126546	3300035692	Bacteria	1712
1086	Ga0373935_0382960	3300035692	Bacteria	1007
1087	Ga0373935_1443899	3300035692	Bacteria	515
1088	Ga0373927_0049063	3300035695	Bacteria	2730
1089	Ga0373927_0049705	3300035695	Bacteria	2711
1090	Ga0373927_0065746	3300035695	Bacteria	2345
1091	Ga0373927_0171715	3300035695	Bacteria	1421
1092	Ga0373927_0263915	3300035695	Bacteria	1132
1093	Ga0373927_0383764	3300035695	Bacteria	926
1094	Ga0373927_0563662	3300035695	Bacteria	753
1095	Ga0373927_1090734	3300035695	Bacteria	526
1096	Ga0373933_0029830	3300035724	Bacteria	3156
1097	Ga0373933_0056507	3300035724	Bacteria	2356
1098	Ga0373933_0074087	3300035724	Bacteria	2075
1099	Ga0373933_0132843	3300035724	Bacteria	1566
1100	Ga0373933_0234409	3300035724	Bacteria	1179
1101	Ga0373933_0832656	3300035724	Bacteria	607
1102	Ga0373933_0995154	3300035724	Bacteria	552
1103	Ga0373947_0042460	3300035725	Bacteria	2714
1104	Ga0373947_0076942	3300035725	Bacteria	2057
1105	Ga0373947_0098906	3300035725	Bacteria	1830
1106	Ga0373947_0145046	3300035725	Bacteria	1525
1107	Ga0373947_0213055	3300035725	Bacteria	1268
1108	Ga0373947_0260879	3300035725	Bacteria	1148
1109	Ga0373947_0296121	3300035725	Bacteria	1078
1110	Ga0373947_0370111	3300035725	Bacteria	963
1111	Ga0373947_0537903	3300035725	Bacteria	795
1112	Ga0373947_0799024	3300035725	Bacteria	644
1113	Ga0373947_0846433	3300035725	Bacteria	624
1114	Ga0373937_0084987	3300036401	Bacteria	2928
1115	Ga0373937_0140309	3300036401	Bacteria	2261
1116	Ga0373937_0147539	3300036401	Bacteria	2202
1117	Ga0373937_0158539	3300036401	Bacteria	2121
1118	Ga0373937_0194428	3300036401	Bacteria	1906
1119	Ga0373937_0644374	3300036401	Bacteria	1005
1120	Ga0373937_1573313	3300036401	Bacteria	605
1121	Ga0373937_1624880	3300036401	Bacteria	593
1122	Ga0316582_0047627	3300036647	Bacteria	2707
1123	Ga0316582_0933269	3300036647	Bacteria	593
1124	Ga0373925_0067612	3300037068	Bacteria	2695
1125	Ga0373925_0069733	3300037068	Bacteria	2656
1126	Ga0373925_0210031	3300037068	Bacteria	1550
1127	Ga0373925_0325420	3300037068	Bacteria	1244
1128	Ga0373925_0356362	3300037068	Bacteria	1188
1129	Ga0373925_0427912	3300037068	Bacteria	1082
1130	Ga0373925_0490255	3300037068	Bacteria	1008
1131	Ga0373925_1222496	3300037068	Bacteria	617
1132	Ga0373925_1616746	3300037068	Bacteria	529
1133	Ga0395899_0021806	3300037312	Bacteria	4858
1134	Ga0395900_0006417	3300037418	Bacteria	12257
1135	Ga0395900_0118804	3300037418	Bacteria	2713
1136	Ga0395900_0163631	3300037418	Bacteria	2268
1137	Ga0395900_0169067	3300037418	Bacteria	2226
1138	Ga0395900_0222368	3300037418	Bacteria	1902
1139	Ga0395900_0676247	3300037418	Bacteria	967
1140	Ga0395900_1280666	3300037418	Bacteria	647
1141	Ga0395900_1799298	3300037418	Bacteria	523
1142	Ga0395898_0017413	3300037466	Bacteria	7340
1143	Ga0395898_0047908	3300037466	Bacteria	4192
1144	Ga0395898_0407867	3300037466	Bacteria	1295
1145	Ga0395898_0420041	3300037466	Bacteria	1274
1146	Ga0395898_0993533	3300037466	Bacteria	775
1147	Ga0395898_1010067	3300037466	Bacteria	767
1148	Ga0395905_0028981	3300037471	Bacteria	5218
1149	Ga0395905_0049044	3300037471	Bacteria	3956
1150	Ga0395905_0091869	3300037471	Bacteria	2846
1151	Ga0395905_0098054	3300037471	Bacteria	2752
1152	Ga0395905_0825347	3300037471	Bacteria	830
1153	Ga0436364_0326510	3300037853	Bacteria	2934
1154	Ga0436364_0962972	3300037853	Bacteria	3150
1155	Ga0436364_1456246	3300037853	Bacteria	548
1156	Ga0395901_0059404	3300038443	Bacteria	3978
1157	Ga0395901_0144785	3300038443	Bacteria	2498
1158	Ga0395901_0199103	3300038443	Bacteria	2099
1159	Ga0395901_0362760	3300038443	Bacteria	1494
1160	Ga0400485_04215	3300038735	Unclassified	1573
1161	Ga0400485_16768	3300038735	Bacteria	1043
1162	Ga0400488_47058	3300038741	Bacteria	1834
1163	Ga0400486_01382	3300038742	Bacteria	1505
1164	Ga0400486_07939	3300038742	Bacteria	2386
1165	Ga0400486_14467	3300038742	Bacteria	4137
1166	Ga0400486_23044	3300038742	Bacteria	1137
1167	Ga0400483_111038	3300039062	Bacteria	1837
1168	Ga0400483_212980	3300039062	Bacteria	1959
1169	Ga0400487_54562	3300039110	Bacteria	2839
1170	Ga0436365_0243347	3300039437	Bacteria	3119
1171	Ga0436365_0583808	3300039437	Bacteria	663
1172	Ga0436365_0658513	3300039437	Bacteria	3022
1173	Ga0436365_0771598	3300039437	Bacteria	1855
1174	Ga0436360_0073076	3300039438	Bacteria	3965
1175	Ga0436360_0074255	3300039438	Bacteria	515
1176	Ga0436360_0361390	3300039438	Bacteria	682
1177	Ga0436360_0645085	3300039438	Bacteria	2456
1178	Ga0436361_0060530	3300039447	Bacteria	5319
1179	Ga0436361_0085954	3300039447	Bacteria	4223
1180	Ga0436361_0376942	3300039447	Bacteria	769
1181	Ga0436361_0720791	3300039447	Bacteria	1516
1182	Ga0436361_1074467	3300039447	Bacteria	1493
1183	Ga0436363_1069702	3300039450	Bacteria	707
1184	Ga0436363_1090990	3300039450	Bacteria	1048
1185	Ga0436362_0436830	3300039453	Bacteria	1255
1186	Ga0439453_0000974	3300041408	Bacteria	3470
1187	Ga0439453_0002632	3300041408	Bacteria	2498
1188	Ga0439453_0002710	3300041408	Bacteria	2470
1189	Ga0439466_0086054	3300041411	Bacteria	988
1190	Ga0439466_0220831	3300041411	Bacteria	575
1191	Ga0439465_0047282	3300041413	Bacteria	1402
1192	Ga0451791_1072700	3300041451	Bacteria	940
1193	Ga0451793_1805825	3300041452	Bacteria	1076
1194	Ga0451833_0245952	3300041491	Bacteria	1283
1195	Ga0451839_1046304	3300041496	Bacteria	543
1196	Ga0451845_0321414	3300041501	Bacteria	1281
1197	Ga0451849_0779732	3300041505	Bacteria	599
1198	Ga0451851_0301071	3300041507	Bacteria	632
1199	Ga0451851_0384489	3300041507	Bacteria	876
1200	Ga0451853_1441035	3300041512	Bacteria	596
1201	Ga0439441_011328	3300042001	Bacteria	1511
1202	Ga0439441_017699	3300042001	Bacteria	1282
1203	Ga0439443_000643	3300042003	Bacteria	3315
1204	Ga0439443_001673	3300042003	Bacteria	2513
1205	Ga0439443_027850	3300042003	Bacteria	919
1206	Ga0439448_0087253	3300042005	Bacteria	1052
1207	Ga0439451_018834	3300042009	Bacteria	1393
1208	Ga0439451_024473	3300042009	Bacteria	1216
1209	Ga0439454_022390	3300042011	Bacteria	941
1210	Ga0439455_0071297	3300042012	Bacteria	934
1211	Ga0439456_010219	3300042013	Bacteria	1938
1212	Ga0439456_038963	3300042013	Bacteria	1028
1213	Ga0450923_011547	3300042125	Bacteria	1590
1214	Ga0450923_031299	3300042125	Bacteria	1086
1215	Ga0450894_051929	3300042131	Bacteria	605
1216	Ga0450899_012083	3300042135	Bacteria	968
1217	Ga0450905_018577	3300042142	Bacteria	1014
1218	Ga0450905_019166	3300042142	Bacteria	1000
1219	Ga0450889_000730	3300042144	Bacteria	3532
1220	Ga0439446_0086363	3300042156	Bacteria	977
1221	Ga0439458_0032965	3300042157	Bacteria	1239
1222	Ga0439434_0038583	3300042435	Bacteria	1464
1223	Ga0439435_0000915	3300042436	Bacteria	5100
1224	Ga0439435_0005323	3300042436	Bacteria	2825
1225	Ga0439435_0064266	3300042436	Bacteria	1075
1226	Ga0439444_0012859	3300042437	Bacteria	1378
1227	Ga0439444_0017794	3300042437	Bacteria	1224
1228	Ga0439444_0029522	3300042437	Bacteria	1022
1229	Ga0439464_0015957	3300042439	Bacteria	2030
1230	Ga0439464_0058586	3300042439	Bacteria	1124
1231	Ga0439464_0168107	3300042439	Bacteria	691
1232	Ga0439460_0003019	3300042461	Bacteria	4063
1233	Ga0439460_0004287	3300042461	Bacteria	3474
1234	Ga0439460_0010794	3300042461	Bacteria	2346
1235	Ga0439460_0290017	3300042461	Bacteria	571
1236	Ga0450918_004800	3300042531	Bacteria	2446
1237	Ga0439440_0006576	3300042993	Bacteria	2345
1238	Ga0439440_0007577	3300042993	Bacteria	2208
1239	Ga0439440_0054601	3300042993	Bacteria	1006
1240	Ga0439440_0066460	3300042993	Bacteria	930
1241	Ga0466969_0025434	3300044656	Bacteria	3043
1242	Ga0466969_0106421	3300044656	Bacteria	1316
1243	Ga0466969_0213760	3300044656	Bacteria	878
1244	Ga0466972_0030572	3300044658	Bacteria	2650
1245	Ga0466972_0601028	3300044658	Bacteria	520
1246	Ga0466965_0028301	3300044683	Bacteria	2722
1247	Ga0466965_0089407	3300044683	Bacteria	1565
1248	Ga0466966_0059696	3300044684	Bacteria	2408
1249	Ga0466966_0114637	3300044684	Bacteria	1659
1250	Ga0466966_0239806	3300044684	Bacteria	1093
1251	Ga0466966_0692337	3300044684	Bacteria	614
1252	Ga0466966_0728717	3300044684	Bacteria	598
1253	Ga0466961_0047623	3300044693	Bacteria	2741
1254	Ga0466961_0104863	3300044693	Bacteria	1780
1255	Ga0466961_0131493	3300044693	Bacteria	1568
1256	Ga0466964_0022238	3300044706	Bacteria	2458
1257	Ga0466964_0114626	3300044706	Bacteria	1206
1258	Ga0466964_0139074	3300044706	Bacteria	1114
1259	Ga0466971_0022392	3300044719	Bacteria	2815
1260	Ga0466971_0077053	3300044719	Bacteria	1517
1261	Ga0466968_0018946	3300044735	Bacteria	2764
1262	Ga0466968_0137700	3300044735	Bacteria	1114
1263	Ga0466970_0031500	3300044765	Bacteria	2800
1264	Ga0466970_0033311	3300044765	Bacteria	2723
1265	Ga0466957_0030133	3300044842	Bacteria	3239
1266	Ga0466957_0805755	3300044842	Bacteria	667
1267	Ga0466959_0007283	3300045049	Bacteria	7753
1268	Ga0466959_0044833	3300045049	Bacteria	3257
1269	Ga0466959_0048707	3300045049	Bacteria	3114
1270	Ga0466959_0059094	3300045049	Bacteria	2792
1271	Ga0466958_0038401	3300045836	Bacteria	2873
1272	Ga0466958_0080061	3300045836	Bacteria	2009
1273	Ga0466958_0118709	3300045836	Bacteria	1654
1274	Ga0466967_0055644	3300045976	Bacteria	3485
1275	Ga0466967_0377913	3300045976	Bacteria	1375
1276	Ga0466967_0801456	3300045976	Bacteria	935
1277	Ga0495617_011509	3300046452	Bacteria	3017
1278	Ga0495617_124154	3300046452	Bacteria	830
1279	Ga0495617_212901	3300046452	Bacteria	602
1280	Ga0495617_235163	3300046452	Bacteria	567
1281	Ga0495592_0034042	3300046454	Bacteria	3842
1282	Ga0495592_0062015	3300046454	Bacteria	2746
1283	Ga0495592_0115689	3300046454	Bacteria	1893
1284	Ga0495592_0125527	3300046454	Bacteria	1801
1285	Ga0495592_0394875	3300046454	Bacteria	877
1286	Ga0495592_0878709	3300046454	Bacteria	528
1287	Ga0495603_0028379	3300046455	Bacteria	3375
1288	Ga0495603_0043799	3300046455	Bacteria	2671
1289	Ga0495603_0084848	3300046455	Bacteria	1854
1290	Ga0495603_0333379	3300046455	Bacteria	870
1291	Ga0495603_0537240	3300046455	Bacteria	669
1292	Ga0495590_0052462	3300046457	Bacteria	1424
1293	Ga0495590_0170136	3300046457	Bacteria	794
1294	Ga0495591_040818	3300046458	Bacteria	1320
1295	Ga0495629_0009117	3300046459	Bacteria	7268
1296	Ga0495629_0070675	3300046459	Bacteria	2435
1297	Ga0495629_0124723	3300046459	Bacteria	1794
1298	Ga0495629_0176819	3300046459	Bacteria	1480
1299	Ga0495629_0309682	3300046459	Bacteria	1080
1300	Ga0495629_0430622	3300046459	Bacteria	894
1301	Ga0495629_0726952	3300046459	Bacteria	658
1302	Ga0495638_0045797	3300046460	Bacteria	2750
1303	Ga0495638_0103122	3300046460	Bacteria	1703
1304	Ga0495638_0172792	3300046460	Bacteria	1239
1305	Ga0495638_0242461	3300046460	Bacteria	997
1306	Ga0495641_0026128	3300046461	Bacteria	2854
1307	Ga0495641_0082650	3300046461	Bacteria	1438
1308	Ga0495641_0110844	3300046461	Bacteria	1224
1309	Ga0495641_0143317	3300046461	Bacteria	1067
1310	Ga0495641_0550869	3300046461	Bacteria	526
1311	Ga0495651_0061261	3300046462	Bacteria	2880
1312	Ga0495651_0070182	3300046462	Bacteria	2666
1313	Ga0495651_0107552	3300046462	Bacteria	2066
1314	Ga0495651_0152403	3300046462	Bacteria	1664
1315	Ga0495651_0202741	3300046462	Bacteria	1387
1316	Ga0495653_0056811	3300046463	Bacteria	2981
1317	Ga0495653_0060562	3300046463	Bacteria	2867
1318	Ga0495653_0157331	3300046463	Bacteria	1581
1319	Ga0495653_0261320	3300046463	Bacteria	1144
1320	Ga0495650_0065317	3300046471	Bacteria	1444
1321	Ga0495580_0089774	3300046472	Bacteria	2139
1322	Ga0495580_0315671	3300046472	Bacteria	1062
1323	Ga0495580_0463423	3300046472	Bacteria	849
1324	Ga0495580_0635017	3300046472	Bacteria	703
1325	Ga0495582_0020733	3300046473	Bacteria	3599
1326	Ga0495582_0032858	3300046473	Bacteria	2851
1327	Ga0495582_0043305	3300046473	Bacteria	2479
1328	Ga0495582_0163725	3300046473	Bacteria	1265
1329	Ga0495582_0317432	3300046473	Bacteria	896
1330	Ga0495605_0028279	3300046474	Bacteria	2895
1331	Ga0495605_0030113	3300046474	Bacteria	2785
1332	Ga0495605_0190743	3300046474	Bacteria	897
1333	Ga0495639_0049712	3300046475	Bacteria	1903
1334	Ga0495639_0394540	3300046475	Bacteria	698
1335	Ga0495662_0026586	3300046476	Bacteria	2794
1336	Ga0495662_0027992	3300046476	Bacteria	2721
1337	Ga0495662_0046409	3300046476	Bacteria	2098
1338	Ga0495662_0076352	3300046476	Bacteria	1626
1339	Ga0495662_0092732	3300046476	Bacteria	1473
1340	Ga0495662_0151838	3300046476	Bacteria	1141
1341	Ga0495662_0238744	3300046476	Bacteria	895
1342	Ga0495662_0417372	3300046476	Bacteria	659
1343	Ga0495664_0077133	3300046477	Bacteria	1995
1344	Ga0495664_0127458	3300046477	Bacteria	1540
1345	Ga0495664_0254220	3300046477	Bacteria	1062
1346	Ga0495584_0032240	3300046491	Bacteria	2653
1347	Ga0495584_0033821	3300046491	Bacteria	2586
1348	Ga0495584_0059407	3300046491	Bacteria	1923
1349	Ga0495584_0169127	3300046491	Bacteria	1111
1350	Ga0495584_0386770	3300046491	Bacteria	711
1351	Ga0495585_0060776	3300046492	Bacteria	2079
1352	Ga0495585_0068173	3300046492	Bacteria	1944
1353	Ga0495585_0079974	3300046492	Bacteria	1772
1354	Ga0495585_0093234	3300046492	Bacteria	1619
1355	Ga0495585_0153374	3300046492	Bacteria	1200
1356	Ga0495594_0117169	3300046499	Bacteria	1504
1357	Ga0495594_0202441	3300046499	Bacteria	1131
1358	Ga0495594_0293299	3300046499	Bacteria	927
1359	Ga0495594_0354465	3300046499	Bacteria	835
1360	Ga0495594_0374714	3300046499	Bacteria	810
1361	Ga0495594_0544935	3300046499	Bacteria	658
1362	Ga0495594_0673723	3300046499	Bacteria	585
1363	Ga0495594_0781265	3300046499	Bacteria	538
1364	Ga0495596_0022489	3300046500	Bacteria	2566
1365	Ga0495596_0041204	3300046500	Bacteria	1821
1366	Ga0495596_0056584	3300046500	Bacteria	1531
1367	Ga0495596_0168659	3300046500	Bacteria	851
1368	Ga0495596_0421846	3300046500	Bacteria	520
1369	Ga0495607_0044200	3300046501	Bacteria	2627
1370	Ga0495607_0063211	3300046501	Bacteria	2095
1371	Ga0495607_0191272	3300046501	Bacteria	1019
1372	Ga0495607_0209316	3300046501	Bacteria	960
1373	Ga0495607_0458032	3300046501	Bacteria	571
1374	Ga0495583_0031533	3300046506	Bacteria	2568
1375	Ga0495583_0237173	3300046506	Bacteria	734
1376	Ga0495583_0293689	3300046506	Bacteria	646
1377	Ga0495606_0051477	3300046507	Bacteria	2685
1378	Ga0495608_0063326	3300046511	Bacteria	2427
1379	Ga0495608_0066556	3300046511	Bacteria	2358
1380	Ga0495608_0084137	3300046511	Bacteria	2064
1381	Ga0495608_0089109	3300046511	Bacteria	1997
1382	Ga0495608_0264381	3300046511	Bacteria	1070
1383	Ga0495608_0315023	3300046511	Bacteria	967
1384	Ga0495608_0346439	3300046511	Bacteria	915
1385	Ga0495608_0361855	3300046511	Bacteria	891
1386	Ga0495610_0085229	3300046512	Bacteria	1442
1387	Ga0495616_0035314	3300046513	Bacteria	2588
1388	Ga0495616_0171757	3300046513	Bacteria	969
1389	Ga0495616_0339392	3300046513	Bacteria	627
1390	Ga0495618_0030788	3300046514	Bacteria	3353
1391	Ga0495618_0045946	3300046514	Bacteria	2755
1392	Ga0495618_0239771	3300046514	Bacteria	1140
1393	Ga0495618_0300502	3300046514	Bacteria	997
1394	Ga0495620_0027304	3300046515	Bacteria	2672
1395	Ga0495620_0140753	3300046515	Bacteria	943
1396	Ga0495620_0418237	3300046515	Bacteria	507
1397	Ga0495628_0064743	3300046516	Bacteria	2861
1398	Ga0495628_0071936	3300046516	Bacteria	2695
1399	Ga0495628_0073219	3300046516	Bacteria	2669
1400	Ga0495628_0077027	3300046516	Bacteria	2594
1401	Ga0495628_0147428	3300046516	Bacteria	1793
1402	Ga0495628_0340875	3300046516	Bacteria	1103
1403	Ga0495628_0343117	3300046516	Bacteria	1099
1404	Ga0495628_0769235	3300046516	Bacteria	676
1405	Ga0495630_0067618	3300046517	Bacteria	2686
1406	Ga0495630_0083785	3300046517	Bacteria	2407
1407	Ga0495630_0099150	3300046517	Bacteria	2204
1408	Ga0495630_0124283	3300046517	Bacteria	1958
1409	Ga0495630_0126766	3300046517	Bacteria	1937
1410	Ga0495630_0394297	3300046517	Bacteria	1060
1411	Ga0495630_0447945	3300046517	Bacteria	989
1412	Ga0495630_0608549	3300046517	Bacteria	837
1413	Ga0495631_0021185	3300046518	Bacteria	3028
1414	Ga0495631_0021998	3300046518	Bacteria	2966
1415	Ga0495631_0038774	3300046518	Bacteria	2117
1416	Ga0495631_0097429	3300046518	Bacteria	1266
1417	Ga0495631_0270570	3300046518	Bacteria	724
1418	Ga0495632_0042906	3300046519	Bacteria	2264
1419	Ga0495632_0140395	3300046519	Bacteria	1121
1420	Ga0495632_0396750	3300046519	Bacteria	603
1421	Ga0495632_0397598	3300046519	Bacteria	602
1422	Ga0495637_0068306	3300046520	Bacteria	1440
1423	Ga0495637_0140547	3300046520	Bacteria	916
1424	Ga0495637_0180979	3300046520	Bacteria	781
1425	Ga0495643_0043886	3300046522	Bacteria	2430
1426	Ga0495643_0159367	3300046522	Bacteria	1111
1427	Ga0495643_0166248	3300046522	Bacteria	1081
1428	Ga0495643_0310259	3300046522	Bacteria	716
1429	Ga0495644_0015161	3300046523	Bacteria	2952
1430	Ga0495644_0058722	3300046523	Bacteria	1446
1431	Ga0495644_0081101	3300046523	Bacteria	1223
1432	Ga0495644_0204042	3300046523	Bacteria	762
1433	Ga0495648_0035636	3300046524	Bacteria	3223
1434	Ga0495648_0213465	3300046524	Bacteria	957
1435	Ga0495663_0006259	3300046525	Bacteria	3286
1436	Ga0495663_0024013	3300046525	Bacteria	1770
1437	Ga0495663_0088554	3300046525	Bacteria	1006
1438	Ga0495666_0049718	3300046526	Bacteria	2017
1439	Ga0495666_0055281	3300046526	Bacteria	1902
1440	Ga0495666_0065508	3300046526	Bacteria	1732
1441	Ga0495666_0107399	3300046526	Bacteria	1312
1442	Ga0495642_0053027	3300046528	Bacteria	1670
1443	Ga0495652_0045362	3300046529	Bacteria	3779
1444	Ga0495652_0084339	3300046529	Bacteria	2613
1445	Ga0495652_0097164	3300046529	Bacteria	2396
1446	Ga0495652_0148276	3300046529	Bacteria	1836
1447	Ga0495652_0163337	3300046529	Bacteria	1726
1448	Ga0495652_0176844	3300046529	Bacteria	1642
1449	Ga0495652_0316794	3300046529	Bacteria	1128
1450	Ga0495652_0467017	3300046529	Bacteria	880
1451	Ga0495654_0027733	3300046530	Bacteria	2899
1452	Ga0495654_0164710	3300046530	Bacteria	971
1453	Ga0495665_0034337	3300046531	Bacteria	2712
1454	Ga0495665_0124543	3300046531	Bacteria	1349
1455	Ga0495665_0485708	3300046531	Bacteria	623
1456	Ga0495640_0026054	3300046533	Bacteria	4232
1457	Ga0495640_0044793	3300046533	Bacteria	3074
1458	Ga0495640_0056221	3300046533	Bacteria	2688
1459	Ga0495640_0222683	3300046533	Bacteria	1189
1460	Ga0495640_0357585	3300046533	Bacteria	900
1461	Ga0495640_0560534	3300046533	Bacteria	692
1462	Ga0495640_0660720	3300046533	Bacteria	628
1463	Ga0495586_0015600	3300046535	Bacteria	4042
1464	Ga0495586_0048376	3300046535	Bacteria	2297
1465	Ga0495586_0170467	3300046535	Bacteria	1230
1466	Ga0495587_0039574	3300046536	Bacteria	2820
1467	Ga0495587_0043246	3300046536	Bacteria	2683
1468	Ga0495587_0048454	3300046536	Bacteria	2516
1469	Ga0495587_0069942	3300046536	Bacteria	2043
1470	Ga0495587_0449867	3300046536	Bacteria	714
1471	Ga0495598_0011363	3300046537	Bacteria	2157
1472	Ga0495598_0091536	3300046537	Bacteria	992
1473	Ga0495609_0010002	3300046538	Bacteria	4567
1474	Ga0495609_0240184	3300046538	Bacteria	748
1475	Ga0495609_0308001	3300046538	Bacteria	644
1476	Ga0495609_0374734	3300046538	Bacteria	572
1477	Ga0495621_0133315	3300046539	Bacteria	968
1478	Ga0495621_0192741	3300046539	Bacteria	817
1479	Ga0495621_0237032	3300046539	Bacteria	742
1480	Ga0495597_0019065	3300046542	Bacteria	3213
1481	Ga0495597_0155503	3300046542	Bacteria	936
1482	Ga0495645_0078325	3300046543	Bacteria	2375
1483	Ga0495645_0122032	3300046543	Bacteria	1833
1484	Ga0495645_0129608	3300046543	Bacteria	1769
1485	Ga0495645_0215278	3300046543	Bacteria	1295
1486	Ga0495645_0262614	3300046543	Bacteria	1142
1487	Ga0495645_0778157	3300046543	Bacteria	576
1488	Ga0495622_0112229	3300046557	Bacteria	1248
1489	Ga0495622_0197118	3300046557	Bacteria	898
1490	Ga0495622_0407221	3300046557	Bacteria	585
1491	Ga0495633_0105180	3300046558	Bacteria	1309
1492	Ga0495633_0156527	3300046558	Bacteria	1051
1493	Ga0495633_0202617	3300046558	Bacteria	910
1494	Ga0495667_0060445	3300046559	Bacteria	2485
1495	Ga0495667_0078636	3300046559	Bacteria	2144
1496	Ga0495667_0193854	3300046559	Bacteria	1301
1497	Ga0495667_0216710	3300046559	Bacteria	1222
1498	Ga0495667_0292083	3300046559	Bacteria	1033
1499	Ga0495667_0441970	3300046559	Bacteria	817
1500	Ga0495667_0507152	3300046559	Bacteria	755
1501	Ga0495656_0017487	3300046615	Bacteria	2737
1502	Ga0495656_0031010	3300046615	Bacteria	2165
1503	Ga0495656_0088110	3300046615	Bacteria	1414
1504	Ga0495656_0091682	3300046615	Bacteria	1390
1505	Ga0495656_0102017	3300046615	Bacteria	1328
1506	Ga0495656_0106442	3300046615	Bacteria	1305
1507	Ga0495656_0242791	3300046615	Bacteria	907
1508	Ga0495668_0035060	3300046616	Bacteria	2812
1509	Ga0495668_0049863	3300046616	Bacteria	2321
1510	Ga0495668_0053952	3300046616	Bacteria	2222
1511	Ga0495668_0207318	3300046616	Bacteria	1073
1512	Ga0495668_0291816	3300046616	Bacteria	894
1513	Ga0495668_0440815	3300046616	Bacteria	716
1514	Ga0495634_0054370	3300046642	Bacteria	2680
1515	Ga0495634_0057052	3300046642	Bacteria	2607
1516	Ga0495634_0173727	3300046642	Bacteria	1353
1517	Ga0495634_0493158	3300046642	Bacteria	719
1518	Ga0495634_0524633	3300046642	Bacteria	692
1519	Ga0495634_0619093	3300046642	Bacteria	627
1520	Ga0495611_0022373	3300046648	Bacteria	2735
1521	Ga0495611_0053042	3300046648	Bacteria	1830
1522	Ga0495611_0071167	3300046648	Bacteria	1590
1523	Ga0495611_0085756	3300046648	Bacteria	1452
1524	Ga0495611_0104001	3300046648	Bacteria	1320
1525	Ga0495611_0134367	3300046648	Bacteria	1154
1526	Ga0495625_0044700	3300046660	Bacteria	3205
1527	Ga0495625_0063282	3300046660	Bacteria	2612
1528	Ga0495625_0259517	3300046660	Bacteria	1125
1529	Ga0495625_0345969	3300046660	Bacteria	941
1530	Ga0495635_0046621	3300046663	Bacteria	2989
1531	Ga0495635_0068736	3300046663	Bacteria	2429
1532	Ga0495635_0139156	3300046663	Bacteria	1654
1533	Ga0495635_0206223	3300046663	Bacteria	1332
1534	Ga0495635_0210582	3300046663	Bacteria	1316
1535	Ga0495635_0241895	3300046663	Bacteria	1217
1536	Ga0495635_0308540	3300046663	Bacteria	1060
1537	Ga0495659_0032186	3300046664	Bacteria	1834
1538	Ga0495659_0068228	3300046664	Bacteria	1328
1539	Ga0495659_0095983	3300046664	Bacteria	1143
1540	Ga0495661_0090647	3300046665	Bacteria	1739
1541	Ga0495661_0136596	3300046665	Bacteria	1338
1542	Ga0495661_0170788	3300046665	Bacteria	1160
1543	Ga0495661_0378962	3300046665	Bacteria	691
1544	Ga0495588_0162852	3300046674	Bacteria	1179
1545	Ga0495588_0201426	3300046674	Bacteria	1051
1546	Ga0495588_0209609	3300046674	Bacteria	1029
1547	Ga0495588_0213189	3300046674	Bacteria	1019
1548	Ga0495588_0588948	3300046674	Bacteria	583
1549	Ga0495657_0047293	3300046675	Bacteria	2909
1550	Ga0495657_0063438	3300046675	Bacteria	2437
1551	Ga0495657_0390353	3300046675	Bacteria	820
1552	Ga0495657_0718762	3300046675	Bacteria	573
1553	Ga0495599_0020141	3300046678	Bacteria	4155
1554	Ga0495599_0049373	3300046678	Bacteria	2637
1555	Ga0495599_0107415	3300046678	Bacteria	1739
1556	Ga0495599_0146384	3300046678	Bacteria	1464
1557	Ga0495623_0039816	3300046679	Bacteria	3002
1558	Ga0495623_0097935	3300046679	Bacteria	1791
1559	Ga0495623_0115130	3300046679	Bacteria	1625
1560	Ga0495646_0046026	3300046680	Bacteria	2662
1561	Ga0495646_0052986	3300046680	Bacteria	2448
1562	Ga0495646_0161201	3300046680	Bacteria	1241
1563	Ga0495646_0301501	3300046680	Bacteria	847
1564	Ga0495646_0657580	3300046680	Bacteria	529
1565	Ga0495647_0124910	3300046681	Bacteria	1085
1566	Ga0495647_0189260	3300046681	Bacteria	898
1567	Ga0495658_0036107	3300046683	Bacteria	2724
1568	Ga0495658_0058866	3300046683	Bacteria	2198
1569	Ga0495658_0270609	3300046683	Bacteria	1071
1570	Ga0495658_0296851	3300046683	Bacteria	1021
1571	Ga0495669_0023253	3300046684	Bacteria	2696
1572	Ga0495669_0078578	3300046684	Bacteria	1512
1573	Ga0495669_0163317	3300046684	Bacteria	1057
1574	Ga0495613_0092975	3300046689	Bacteria	2183
1575	Ga0495613_0130557	3300046689	Bacteria	1799
1576	Ga0495613_0190105	3300046689	Bacteria	1451
1577	Ga0495613_0203450	3300046689	Bacteria	1395
1578	Ga0495613_0528363	3300046689	Bacteria	792
1579	Ga0495613_0946123	3300046689	Bacteria	556
1580	Ga0495624_0074942	3300046690	Bacteria	2102
1581	Ga0495624_0269087	3300046690	Bacteria	1029
1582	Ga0495624_0307959	3300046690	Bacteria	954
1583	Ga0495624_0357985	3300046690	Bacteria	877
1584	Ga0495624_0434106	3300046690	Bacteria	787
1585	Ga0495624_0594687	3300046690	Bacteria	659
1586	Ga0495670_0102677	3300046691	Bacteria	1473
1587	Ga0495670_0287468	3300046691	Bacteria	880
1588	Ga0495670_0356454	3300046691	Bacteria	787
1589	Ga0495671_0019113	3300046692	Bacteria	3625
1590	Ga0495671_0049524	3300046692	Bacteria	2094
1591	Ga0495649_0037041	3300046694	Bacteria	2678
1592	Ga0495649_0113526	3300046694	Bacteria	1435
1593	Ga0495589_0031511	3300046794	Bacteria	2668
1594	Ga0495589_0054354	3300046794	Bacteria	1974
1595	Ga0495589_0063925	3300046794	Bacteria	1805
1596	Ga0495589_0157741	3300046794	Bacteria	1081
1597	Ga0495589_0253341	3300046794	Bacteria	822
1598	Ga0495600_0040708	3300046809	Bacteria	3027
1599	Ga0495600_0048766	3300046809	Bacteria	2762
1600	Ga0495600_0108977	3300046809	Bacteria	1803
1601	Ga0495600_0147244	3300046809	Bacteria	1526
1602	Ga0495600_0153516	3300046809	Bacteria	1490
1603	Ga0495600_0290222	3300046809	Bacteria	1034
1604	Ga0495600_0334437	3300046809	Bacteria	950
1605	Ga0495660_0040912	3300046810	Bacteria	2567
1606	Ga0495660_0373796	3300046810	Bacteria	629
1607	Ga0495581_0044716	3300047315	Bacteria	2560
1608	Ga0495581_0046483	3300047315	Bacteria	2508
1609	Ga0495581_0150808	3300047315	Bacteria	1357
1610	Ga0495581_0404522	3300047315	Bacteria	796
1611	Ga0495581_0477351	3300047315	Bacteria	725
1612	Ga0495604_0065677	3300047317	Bacteria	2761
1613	Ga0495604_0082032	3300047317	Bacteria	2412
1614	Ga0495604_0140151	3300047317	Bacteria	1728
1615	Ga0495604_0156385	3300047317	Bacteria	1614
1616	Ga0495604_0169557	3300047317	Bacteria	1536
1617	Ga0495604_0304468	3300047317	Bacteria	1069
1618	Ga0495604_0756387	3300047317	Bacteria	614
1619	Ga0495636_0025240	3300047318	Bacteria	2412
1620	Ga0495636_0075677	3300047318	Bacteria	1443
1621	Ga0495636_0230194	3300047318	Bacteria	852
1622	Ga0495674_0070814	3300047319	Bacteria	3012
1623	Ga0495674_0082948	3300047319	Bacteria	2748
1624	Ga0495674_0098331	3300047319	Bacteria	2492
1625	Ga0495674_0107191	3300047319	Bacteria	2372
1626	Ga0495674_0223786	3300047319	Bacteria	1555
1627	Ga0495674_0271300	3300047319	Bacteria	1392
1628	Ga0495674_0357593	3300047319	Bacteria	1184
1629	Ga0495674_0636627	3300047319	Bacteria	842
1630	Ga0495674_0686008	3300047319	Bacteria	805
1631	Ga0495674_0845580	3300047319	Bacteria	709
1632	Ga0495672_0020520	3300047320	Bacteria	4327
1633	Ga0495676_0076229	3300047321	Bacteria	2561
1634	Ga0495676_0320470	3300047321	Bacteria	1041
1635	Ga0495676_0394196	3300047321	Bacteria	919
1636	Ga0495676_0733148	3300047321	Bacteria	638
1637	Ga0495676_0770011	3300047321	Bacteria	621
1638	Ga0495680_0068759	3300047322	Bacteria	2704
1639	Ga0495680_0084686	3300047322	Bacteria	2388
1640	Ga0495680_0108851	3300047322	Bacteria	2056
1641	Ga0495680_0110977	3300047322	Bacteria	2032
1642	Ga0495680_0125317	3300047322	Bacteria	1893
1643	Ga0495680_0271084	3300047322	Bacteria	1198
1644	Ga0495683_0105953	3300047323	Bacteria	1347
1645	Ga0495683_0151155	3300047323	Bacteria	1080
1646	Ga0495683_0379029	3300047323	Bacteria	592
1647	Ga0495687_035270	3300047443	Bacteria	2251
1648	Ga0495687_209566	3300047443	Bacteria	612
1649	Ga0495675_0030291	3300047444	Bacteria	3453
1650	Ga0495675_0137113	3300047444	Bacteria	1518
1651	Ga0495675_0190196	3300047444	Bacteria	1253
1652	Ga0495675_0387461	3300047444	Bacteria	816
1653	Ga0495677_0030661	3300047445	Bacteria	1957
1654	Ga0495677_0074035	3300047445	Bacteria	1271
1655	Ga0495677_0086230	3300047445	Bacteria	1180
1656	Ga0495677_0090202	3300047445	Bacteria	1154
1657	Ga0495677_0349795	3300047445	Bacteria	583
1658	Ga0495679_016898	3300047446	Bacteria	2626
1659	Ga0495679_123362	3300047446	Bacteria	707
1660	Ga0495685_016847	3300047447	Bacteria	2497
1661	Ga0495685_040740	3300047447	Bacteria	1588
1662	Ga0495685_083333	3300047447	Bacteria	1064
1663	Ga0495673_0014867	3300047469	Bacteria	4031
1664	Ga0495673_0143002	3300047469	Bacteria	931
1665	Ga0495673_0233448	3300047469	Bacteria	677
1666	Ga0495681_0120447	3300047470	Bacteria	1126
1667	Ga0495681_0141787	3300047470	Bacteria	1014
1668	Ga0495681_0146476	3300047470	Bacteria	994
1669	Ga0495684_0063483	3300047471	Bacteria	2807
1670	Ga0495684_0190957	3300047471	Bacteria	1514
1671	Ga0495684_0403312	3300047471	Bacteria	959
1672	Ga0495684_0410765	3300047471	Bacteria	948
1673	Ga0495686_0019899	3300047472	Bacteria	4480
1674	Ga0495686_0036615	3300047472	Bacteria	3149
1675	Ga0495686_0372477	3300047472	Bacteria	772
1676	Ga0495593_0026520	3300047673	Bacteria	3198
1677	Ga0495593_0029374	3300047673	Bacteria	3014
1678	Ga0495593_0076571	3300047673	Bacteria	1734
1679	Ga0495593_0546373	3300047673	Bacteria	581
1680	Ga0495602_0073723	3300048088	Bacteria	2904
1681	Ga0495602_0087738	3300048088	Bacteria	2592
1682	Ga0495602_0087779	3300048088	Bacteria	2591
1683	Ga0495602_0094258	3300048088	Bacteria	2474
1684	Ga0495602_0104315	3300048088	Bacteria	2320
1685	Ga0495602_0133355	3300048088	Bacteria	1977
1686	Ga0495602_0262546	3300048088	Bacteria	1280
1687	Ga0495602_0463231	3300048088	Bacteria	892
1688	Ga0495602_0608660	3300048088	Bacteria	750
1689	Ga0495614_0021101	3300048089	Bacteria	2815
1690	Ga0495614_0069460	3300048089	Bacteria	1517
1691	Ga0495614_0167900	3300048089	Bacteria	984
1692	Ga0495615_0005371	3300048090	Bacteria	2300
1693	Ga0495626_0078934	3300048091	Bacteria	1465
1694	Ga0495626_0082699	3300048091	Bacteria	1423
1695	Ga0495626_0125730	3300048091	Bacteria	1099
1696	Ga0496100_0028776	3300048903	Bacteria	3430
1697	Ga0496100_0031597	3300048903	Bacteria	3293
1698	Ga0496100_0159178	3300048903	Bacteria	1617
1699	Ga0496100_0173868	3300048903	Bacteria	1553
1700	Ga0496100_0250894	3300048903	Bacteria	1309
1701	Ga0496100_0395550	3300048903	Bacteria	1051
1702	Ga0496100_0574853	3300048903	Bacteria	873
1703	Ga0496100_0706214	3300048903	Bacteria	787
1704	Ga0496100_0708531	3300048903	Bacteria	786
1705	Ga0496100_0741270	3300048903	Bacteria	768
1706	Ga0496100_0879341	3300048903	Bacteria	703
1707	Ga0496101_0033751	3300048904	Bacteria	3611
1708	Ga0496101_0035887	3300048904	Bacteria	3508
1709	Ga0496101_0038247	3300048904	Bacteria	3407
1710	Ga0496101_0044644	3300048904	Bacteria	3171
1711	Ga0496101_0115824	3300048904	Bacteria	2022
1712	Ga0496101_0175211	3300048904	Bacteria	1649
1713	Ga0496101_0209661	3300048904	Bacteria	1509
1714	Ga0496101_0241630	3300048904	Bacteria	1405
1715	Ga0496101_0280317	3300048904	Bacteria	1303
1716	Ga0496101_0283747	3300048904	Bacteria	1295
1717	Ga0496101_0460772	3300048904	Bacteria	1003
1718	Ga0496102_0049876	3300048905	Bacteria	3809
1719	Ga0496102_0066054	3300048905	Bacteria	3315
1720	Ga0496102_0070976	3300048905	Bacteria	3198
1721	Ga0496102_0092734	3300048905	Bacteria	2797
1722	Ga0496102_0122950	3300048905	Bacteria	2425
1723	Ga0496102_0200069	3300048905	Bacteria	1883
1724	Ga0496102_0206161	3300048905	Bacteria	1853
1725	Ga0496102_0244581	3300048905	Bacteria	1692
1726	Ga0496102_0853763	3300048905	Bacteria	832
1727	Ga0496102_1095028	3300048905	Bacteria	716
1728	Ga0496102_1833519	3300048905	Bacteria	523
1729	Ga0496103_0002742	3300048906	Bacteria	10994
1730	Ga0496103_0014996	3300048906	Bacteria	4607
1731	Ga0496103_0040276	3300048906	Bacteria	2871
1732	Ga0496103_0071615	3300048906	Bacteria	2170
1733	Ga0496103_0284373	3300048906	Bacteria	1064
1734	Ga0496103_0445742	3300048906	Bacteria	830
1735	Ga0496103_0494078	3300048906	Bacteria	783
1736	Ga0496103_0717327	3300048906	Bacteria	633
1737	Ga0496104_0045734	3300048907	Bacteria	4118
1738	Ga0496104_0059400	3300048907	Bacteria	3620
1739	Ga0496104_0104024	3300048907	Bacteria	2720
1740	Ga0496104_0108983	3300048907	Bacteria	2654
1741	Ga0496104_0111917	3300048907	Bacteria	2618
1742	Ga0496104_0113312	3300048907	Bacteria	2600
1743	Ga0496104_0430973	3300048907	Bacteria	1230
1744	Ga0496104_0466879	3300048907	Bacteria	1174
1745	Ga0496104_0588308	3300048907	Bacteria	1023
1746	Ga0496104_0847309	3300048907	Bacteria	819
1747	Ga0496104_0862176	3300048907	Bacteria	811
1748	Ga0496105_0046657	3300048908	Bacteria	3575
1749	Ga0496105_0107197	3300048908	Bacteria	2306
1750	Ga0496105_0193747	3300048908	Bacteria	1661
1751	Ga0496105_0282763	3300048908	Bacteria	1337
1752	Ga0496105_0307149	3300048908	Bacteria	1274
1753	Ga0496105_0803009	3300048908	Bacteria	715
1754	Ga0496105_1026656	3300048908	Bacteria	615
1755	Ga0496106_0033983	3300048909	Bacteria	3807
1756	Ga0496106_0041823	3300048909	Bacteria	3435
1757	Ga0496106_0047349	3300048909	Bacteria	3235
1758	Ga0496106_0063367	3300048909	Bacteria	2809
1759	Ga0496106_0078768	3300048909	Bacteria	2529
1760	Ga0496106_0140505	3300048909	Bacteria	1899
1761	Ga0496106_0258857	3300048909	Bacteria	1392
1762	Ga0496106_0303710	3300048909	Bacteria	1280
1763	Ga0496106_0489559	3300048909	Bacteria	988
1764	Ga0496106_0530453	3300048909	Bacteria	945
1765	Ga0496106_0583970	3300048909	Bacteria	895
1766	Ga0496106_0620293	3300048909	Bacteria	865
1767	Ga0496106_0714773	3300048909	Bacteria	798
1768	Ga0496107_0038488	3300048910	Bacteria	3430
1769	Ga0496107_0041834	3300048910	Bacteria	3291
1770	Ga0496107_0046145	3300048910	Bacteria	3135
1771	Ga0496107_0046304	3300048910	Bacteria	3130
1772	Ga0496107_0050391	3300048910	Bacteria	3001
1773	Ga0496107_0097275	3300048910	Bacteria	2155
1774	Ga0496107_0165038	3300048910	Bacteria	1642
1775	Ga0496107_0258697	3300048910	Bacteria	1295
1776	Ga0496107_0260074	3300048910	Bacteria	1291
1777	Ga0496107_0414938	3300048910	Bacteria	1001
1778	Ga0496108_0049607	3300048911	Bacteria	3511
1779	Ga0496108_0056182	3300048911	Bacteria	3306
1780	Ga0496108_0057291	3300048911	Bacteria	3274
1781	Ga0496108_0065118	3300048911	Bacteria	3072
1782	Ga0496108_0104141	3300048911	Bacteria	2422
1783	Ga0496108_0132378	3300048911	Bacteria	2143
1784	Ga0496108_0233812	3300048911	Bacteria	1598
1785	Ga0496108_0289327	3300048911	Bacteria	1426
1786	Ga0496108_1449746	3300048911	Bacteria	573
1787	Ga0496108_1794362	3300048911	Bacteria	502
1788	Ga0496109_0064560	3300048912	Bacteria	3350
1789	Ga0496109_0071023	3300048912	Bacteria	3195
1790	Ga0496109_0099071	3300048912	Bacteria	2703
1791	Ga0496109_0125562	3300048912	Bacteria	2392
1792	Ga0496109_0161194	3300048912	Bacteria	2101
1793	Ga0496109_0277168	3300048912	Bacteria	1580
1794	Ga0496109_0312563	3300048912	Bacteria	1482
1795	Ga0496109_0646531	3300048912	Bacteria	994
1796	Ga0496109_0771174	3300048912	Bacteria	900
1797	Ga0496109_1722258	3300048912	Bacteria	560
1798	Ga0496110_0029621	3300048913	Bacteria	4713
1799	Ga0496110_0054071	3300048913	Bacteria	3531
1800	Ga0496110_0066313	3300048913	Bacteria	3192
1801	Ga0496110_0190197	3300048913	Bacteria	1864
1802	Ga0496110_0317333	3300048913	Bacteria	1419
1803	Ga0496110_0333749	3300048913	Bacteria	1381
1804	Ga0496110_0393917	3300048913	Bacteria	1263
1805	Ga0496110_0573283	3300048913	Bacteria	1025
1806	Ga0496111_0043157	3300048914	Bacteria	3240
1807	Ga0496111_0102061	3300048914	Bacteria	2108
1808	Ga0496112_0080792	3300048915	Bacteria	3215
1809	Ga0496112_0088190	3300048915	Bacteria	3070
1810	Ga0496112_0157687	3300048915	Bacteria	2236
1811	Ga0496112_0184317	3300048915	Bacteria	2051
1812	Ga0496112_0213937	3300048915	Bacteria	1884
1813	Ga0496112_0231503	3300048915	Bacteria	1802
1814	Ga0496112_0277572	3300048915	Bacteria	1623
1815	Ga0496112_0530485	3300048915	Bacteria	1111
1816	Ga0496112_0896006	3300048915	Bacteria	809
1817	Ga0496113_0079818	3300048916	Bacteria	2505
1818	Ga0496113_0245033	3300048916	Bacteria	1430
1819	Ga0496113_0261368	3300048916	Bacteria	1383
1820	Ga0496113_0320469	3300048916	Bacteria	1242
1821	Ga0496113_0389117	3300048916	Bacteria	1119
1822	Ga0496113_0570480	3300048916	Bacteria	907
1823	Ga0496113_0648512	3300048916	Bacteria	844
1824	Ga0496113_0758133	3300048916	Bacteria	772
1825	Ga0496114_0048749	3300048917	Bacteria	3523
1826	Ga0496114_0055981	3300048917	Bacteria	3289
1827	Ga0496114_0179653	3300048917	Bacteria	1847
1828	Ga0496114_0217838	3300048917	Bacteria	1675
1829	Ga0496114_0377381	3300048917	Bacteria	1255
1830	Ga0496114_0469736	3300048917	Bacteria	1113
1831	Ga0496115_0048757	3300048918	Bacteria	3388
1832	Ga0496115_0057562	3300048918	Bacteria	3126
1833	Ga0496115_0094618	3300048918	Bacteria	2444
1834	Ga0496115_0110092	3300048918	Bacteria	2262
1835	Ga0496115_0110839	3300048918	Bacteria	2254
1836	Ga0496115_0185200	3300048918	Bacteria	1720
1837	Ga0496115_0192847	3300048918	Bacteria	1683
1838	Ga0496115_0382083	3300048918	Bacteria	1145
1839	Ga0496115_0388745	3300048918	Bacteria	1133
1840	Ga0496115_0629148	3300048918	Bacteria	850
1841	Ga0496115_1102892	3300048918	Bacteria	601
1842	Ga0496116_0010933	3300048919	Bacteria	7562
1843	Ga0496117_0122713	3300048920	Bacteria	1592
1844	Ga0496118_0148601	3300048921	Bacteria	1470
1845	Ga0496119_0005832	3300048922	Bacteria	11641
1846	Ga0496119_0010762	3300048922	Bacteria	7660
1847	Ga0496119_0229257	3300048922	Bacteria	946
1848	Ga0496120_0039244	3300048923	Bacteria	2795
1849	Ga0496121_0017696	3300048924	Bacteria	7255
1850	Ga0496121_0027619	3300048924	Bacteria	5306
1851	Ga0496121_0052148	3300048924	Bacteria	3439
1852	Ga0496121_0069941	3300048924	Bacteria	2829
1853	Ga0496121_0102368	3300048924	Bacteria	2206
1854	Ga0496122_0012905	3300048925	Bacteria	8250
1855	Ga0496123_0008115	3300048926	Bacteria	9706
1856	Ga0496124_0030225	3300048927	Bacteria	4811
1857	Ga0496124_0071552	3300048927	Bacteria	2874
1858	Ga0496124_0366663	3300048927	Bacteria	1013
1859	Ga0496124_0479647	3300048927	Bacteria	840
1860	Ga0496125_0010509	3300048928	Bacteria	9361
1861	Ga0496125_0121389	3300048928	Bacteria	1863
1862	Ga0496125_0373516	3300048928	Bacteria	843
1863	Ga0496125_0395821	3300048928	Bacteria	809
1864	Ga0496126_0031342	3300048929	Bacteria	5025
1865	Ga0496126_0077582	3300048929	Bacteria	2945
1866	Ga0496126_0097672	3300048929	Bacteria	2574
1867	Ga0496126_0114241	3300048929	Bacteria	2349
1868	Ga0495678_026834	3300049459	Bacteria	2451
1869	Ga0495678_084642	3300049459	Bacteria	1130
1870	Ga0495682_0022664	3300049460	Bacteria	2348
1871	Ga0495682_0088775	3300049460	Bacteria	1111
1872	Ga0495682_0321537	3300049460	Bacteria	545
1873	Ga0501031_0000121	3300049568	Bacteria	42902
1874	Ga0501031_0030516	3300049568	Bacteria	3516
1875	Ga0501031_0287115	3300049568	Bacteria	1067
1876	Ga0501032_0000043	3300049569	Bacteria	111758
1877	Ga0501032_0033638	3300049569	Bacteria	3511
1878	Ga0501032_0050389	3300049569	Bacteria	2808
1879	Ga0501032_0099664	3300049569	Bacteria	1925
1880	Ga0501032_0401845	3300049569	Bacteria	880
1881	Ga0501033_0000055	3300049570	Bacteria	107959
1882	Ga0501033_0006672	3300049570	Bacteria	9021
1883	Ga0501033_0040343	3300049570	Bacteria	3485
1884	Ga0501033_0137128	3300049570	Bacteria	1770
1885	Ga0501033_0176881	3300049570	Bacteria	1531
1886	Ga0501033_0227836	3300049570	Bacteria	1325
1887	Ga0501033_0446696	3300049570	Bacteria	898
1888	Ga0501034_0000204	3300049571	Bacteria	112606
1889	Ga0501034_0044814	3300049571	Bacteria	4471
1890	Ga0501034_0076963	3300049571	Bacteria	3343
1891	Ga0501034_0088512	3300049571	Bacteria	3095
1892	Ga0501036_0000017	3300049572	Bacteria	125802
1893	Ga0501036_0047731	3300049572	Bacteria	3625
1894	Ga0501036_0454043	3300049572	Bacteria	1068
1895	Ga0501036_1053662	3300049572	Bacteria	665
1896	Ga0501037_0000056	3300049573	Bacteria	108436
1897	Ga0501037_0043358	3300049573	Bacteria	3306
1898	Ga0501037_0063378	3300049573	Bacteria	2695
1899	Ga0501037_0242802	3300049573	Bacteria	1262
1900	Ga0501037_0972564	3300049573	Bacteria	554
1901	Ga0501038_0000035	3300049574	Bacteria	125802
1902	Ga0501038_0061132	3300049574	Bacteria	3222
1903	Ga0501038_0976580	3300049574	Bacteria	623
1904	Ga0501039_0000039	3300049575	Bacteria	117306
1905	Ga0501039_0016834	3300049575	Bacteria	5603
1906	Ga0501039_0285457	3300049575	Bacteria	1297
1907	Ga0501039_1368708	3300049575	Bacteria	545
1908	Ga0501040_0079614	3300049576	Bacteria	2268
1909	Ga0501040_0370785	3300049576	Bacteria	1027
1910	Ga0501041_0416158	3300049577	Bacteria	852
1911	Ga0501043_0050164	3300049579	Bacteria	3280
1912	Ga0501043_0085061	3300049579	Bacteria	2485
1913	Ga0501043_0202238	3300049579	Bacteria	1541
1914	Ga0501043_0332785	3300049579	Bacteria	1156
1915	Ga0501046_0104481	3300049580	Bacteria	2171
1916	Ga0501046_0173954	3300049580	Bacteria	1614
1917	Ga0501046_0563386	3300049580	Bacteria	811
1918	Ga0501046_0876218	3300049580	Bacteria	627
1919	Ga0501047_0055416	3300049581	Bacteria	3834
1920	Ga0501047_0067633	3300049581	Bacteria	3442
1921	Ga0501047_0096060	3300049581	Bacteria	2842
1922	Ga0501047_0249367	3300049581	Bacteria	1624
1923	Ga0501047_0426757	3300049581	Bacteria	1157
1924	Ga0501048_0546056	3300049582	Bacteria	831
1925	Ga0501048_0968523	3300049582	Bacteria	612
1926	Ga0501067_0288868	3300049583	Bacteria	913
1927	Ga0501068_0161890	3300049584	Bacteria	1410
1928	Ga0501068_0467328	3300049584	Bacteria	817
1929	Ga0501068_0622293	3300049584	Bacteria	704
1930	Ga0501069_0008003	3300049585	Bacteria	5551
1931	Ga0501069_0053938	3300049585	Bacteria	2239
1932	Ga0501069_0521051	3300049585	Bacteria	710
1933	Ga0501070_0040455	3300049586	Bacteria	3886
1934	Ga0501070_0428230	3300049586	Bacteria	1068
1935	Ga0501070_0452209	3300049586	Bacteria	1035
1936	Ga0501070_0480594	3300049586	Bacteria	999
1937	Ga0501070_1529106	3300049586	Bacteria	504
1938	Ga0501071_0075148	3300049587	Bacteria	2466
1939	Ga0501071_0479139	3300049587	Bacteria	954
1940	Ga0501071_0567749	3300049587	Bacteria	872
1941	Ga0501071_0953018	3300049587	Bacteria	662
1942	Ga0501072_0096401	3300049588	Bacteria	2350
1943	Ga0501072_0399882	3300049588	Bacteria	1090
1944	Ga0501072_0614770	3300049588	Bacteria	856
1945	Ga0501073_0128194	3300049589	Bacteria	1759
1946	Ga0501074_0201422	3300049590	Bacteria	1419
1947	Ga0501074_0687484	3300049590	Bacteria	722
1948	Ga0501076_0096833	3300049592	Bacteria	2377
1949	Ga0501076_0545433	3300049592	Bacteria	956
1950	Ga0501077_0038870	3300049593	Bacteria	3030
1951	Ga0501077_0050816	3300049593	Bacteria	2635
1952	Ga0501077_0131435	3300049593	Bacteria	1587
1953	Ga0501079_0040332	3300049741	Bacteria	3600
1954	Ga0501079_0655722	3300049741	Bacteria	826
1955	Ga0501079_1461604	3300049741	Bacteria	538
1956	Ga0501079_1675325	3300049741	Bacteria	500
1957	Ga0501080_0084195	3300049742	Bacteria	2955
1958	Ga0501080_0124938	3300049742	Bacteria	2383
1959	Ga0501080_0542401	3300049742	Bacteria	1036
1960	Ga0501081_0144195	3300049743	Bacteria	1708
1961	Ga0501081_0389630	3300049743	Bacteria	1030
1962	Ga0501083_0391724	3300049744	Bacteria	904
1963	Ga0501241_000822	3300049758	Bacteria	6596
1964	Ga0501035_0000528	3300049822	Bacteria	42921
1965	Ga0501035_0001874	3300049822	Bacteria	21176
1966	Ga0501035_0012296	3300049822	Bacteria	7913
1967	Ga0501044_0000097	3300049823	Bacteria	107976
1968	Ga0501044_0064812	3300049823	Bacteria	3728
1969	Ga0501044_0082577	3300049823	Bacteria	3251
1970	Ga0501044_0085227	3300049823	Bacteria	3192
1971	Ga0501044_0146076	3300049823	Bacteria	2350
1972	Ga0501044_0232967	3300049823	Bacteria	1788
1973	Ga0501044_0417781	3300049823	Bacteria	1252
1974	Ga0501044_0575365	3300049823	Bacteria	1021
1975	Ga0501045_0134009	3300049824	Bacteria	1842
1976	Ga0501045_1164075	3300049824	Bacteria	563
1977	Ga0501045_1270796	3300049824	Bacteria	536
1978	nmdc:mga03n38_20962_c1	3300050490	Bacteria	2623
1979	nmdc:mga03n38_60482_c1	3300050490	Bacteria	1722
1980	nmdc:mga00v17_1091400_c1	3300050491	Bacteria	500
1981	nmdc:mga00v17_576289_c1	3300050491	Bacteria	727
1982	nmdc:mga00v17_59260_c1	3300050491	Bacteria	2348
1983	nmdc:mga0yw44_238574_c1	3300050492	Bacteria	1208
1984	nmdc:mga0yw44_77967_c1	3300050492	Bacteria	2071
1985	nmdc:mga0k408_34398_c1	3300050493	Bacteria	2901
1986	nmdc:mga06z11_11382_c2	3300050494	Bacteria	3344
1987	nmdc:mga06z11_117535_c1	3300050494	Bacteria	1480
1988	nmdc:mga06z11_119173_c1	3300050494	Bacteria	1471
1989	nmdc:mga06z11_21192_c1	3300050494	Bacteria	3017
1990	nmdc:mga06z11_385687_c1	3300050494	Bacteria	842
1991	nmdc:mga07m45_85194_c1	3300050496	Bacteria	1807
1992	nmdc:mga05p37_108064_c1	3300050507	Bacteria	3422
1993	nmdc:mga05p37_154109_c1	3300050507	Bacteria	2809
1994	nmdc:mga05p37_172319_c1	3300050507	Bacteria	2639
1995	nmdc:mga05p37_258511_c1	3300050507	Bacteria	2085
1996	nmdc:mga05p37_695868_c1	3300050507	Bacteria	1130
1997	nmdc:mga05p37_866554_c1	3300050507	Bacteria	979
1998	nmdc:mga09592_512626_c1	3300050508	Bacteria	1032
1999	nmdc:mga09592_53603_c1	3300050508	Bacteria	3406
2000	nmdc:mga0qj67_123544_c1	3300050509	Bacteria	2094
2001	nmdc:mga0qj67_48399_c1	3300050509	Bacteria	3359
2002	nmdc:mga0qj67_62505_c1	3300050509	Bacteria	2959
2003	nmdc:mga06r32_110446_c1	3300050510	Bacteria	2705
2004	nmdc:mga06r32_122152_c1	3300050510	Bacteria	2570
2005	nmdc:mga06r32_425563_c1	3300050510	Bacteria	1309
2006	nmdc:mga06r32_541591_c1	3300050510	Bacteria	1138
2007	nmdc:mga06r32_772374_c1	3300050510	Bacteria	923
2008	nmdc:mga08y16_117930_c1	3300050511	Bacteria	2763
2009	nmdc:mga08y16_362117_c1	3300050511	Bacteria	1489
2010	nmdc:mga08y16_40443_c2	3300050511	Bacteria	4328
2011	nmdc:mga08y16_558759_c1	3300050511	Bacteria	1157
2012	nmdc:mga08y16_561824_c1	3300050511	Bacteria	1154
2013	nmdc:mga0n895_113370_c1	3300050512	Bacteria	2729
2014	nmdc:mga0n895_422580_c1	3300050512	Bacteria	1347
2015	nmdc:mga0n895_786326_c1	3300050512	Bacteria	943
2016	nmdc:mga0n895_803744_c1	3300050512	Bacteria	931
2017	nmdc:mga0rr50_159802_c1	3300050513	Bacteria	1828
2018	nmdc:mga0rr50_275473_c1	3300050513	Bacteria	1403
2019	nmdc:mga0rr50_55934_c1	3300050513	Bacteria	2946
2020	nmdc:mga0a205_50288_c1	3300050515	Bacteria	4024
2021	nmdc:mga0a205_822344_c1	3300050515	Bacteria	776
2022	Ga0495601_0043237	3300053077	Bacteria	2829
2023	Ga0495601_0055886	3300053077	Bacteria	2499
2024	Ga0495601_0076190	3300053077	Bacteria	2147
2025	Ga0495601_0076892	3300053077	Bacteria	2137
2026	Ga0495601_0271392	3300053077	Bacteria	1106
2027	Ga0495601_0306949	3300053077	Bacteria	1033
2028	Ga0495601_0313617	3300053077	Bacteria	1021
2029	Ga0495601_0750320	3300053077	Bacteria	621
2030	Ga0495612_0029881	3300053078	Bacteria	2195
2031	Ga0495612_0032701	3300053078	Bacteria	2102
2032	Ga0495612_0154268	3300053078	Bacteria	1001
2033	Ga0495612_0176723	3300053078	Bacteria	936
2034	Ga0495612_0193189	3300053078	Bacteria	896
2035	Ga0495612_0203814	3300053078	Bacteria	873
2036	Ga0495655_0005141	3300053083	Bacteria	2292
2037	Ga0495655_0025384	3300053083	Bacteria	1386
2038	Ga0495655_0072031	3300053083	Bacteria	968
2039	Ga0495655_0253875	3300053083	Bacteria	592
2040	Ga0495595_0019132	3300053084	Bacteria	2968
2041	Ga0495595_0039211	3300053084	Bacteria	2160
2042	Ga0495595_0050715	3300053084	Bacteria	1922
2043	Ga0495595_0065464	3300053084	Bacteria	1709
2044	Ga0495595_0253624	3300053084	Bacteria	881
2045	Ga0495619_0017984	3300053085	Bacteria	4482
2046	Ga0495619_0061773	3300053085	Bacteria	2493
2047	Ga0495619_0063374	3300053085	Bacteria	2462
2048	Ga0495619_0065800	3300053085	Bacteria	2418
2049	Ga0495619_0080349	3300053085	Bacteria	2194
2050	Ga0495619_0254368	3300053085	Bacteria	1217
2051	Ga0495619_0256217	3300053085	Bacteria	1212
2052	Ga0495619_0449299	3300053085	Bacteria	888
2053	Ga0495619_0498479	3300053085	Bacteria	838
2054	Ga0500578_0001652	3300053086	Bacteria	21484
2055	Ga0500644_0161303	3300053088	Bacteria	906
2056	Ga0500646_0004647	3300053090	Bacteria	3470
2057	Ga0500646_0040337	3300053090	Bacteria	1312
2058	Ga0500647_0069287	3300053091	Bacteria	1696
2059	Ga0500583_0021044	3300053092	Bacteria	2705
2060	Ga0500583_0223778	3300053092	Bacteria	932
2061	Ga0500651_0039291	3300053093	Bacteria	2980
2062	Ga0500651_0141259	3300053093	Bacteria	1451
2063	Ga0500651_0317839	3300053093	Bacteria	890
2064	Ga0500566_0001583	3300053094	Bacteria	13393
2065	Ga0500566_0118345	3300053094	Bacteria	1431
2066	Ga0500566_0335759	3300053094	Bacteria	698
2067	Ga0500566_0470106	3300053094	Bacteria	547
2068	Ga0500640_018467	3300053095	Bacteria	2974
2069	Ga0500640_079371	3300053095	Bacteria	1394
2070	Ga0500641_0013667	3300053096	Bacteria	2984
2071	Ga0500641_0042220	3300053096	Bacteria	1847
2072	Ga0500554_275472	3300053102	Bacteria	549
2073	Ga0500555_154582	3300053103	Bacteria	561
2074	Ga0500556_0031626	3300053104	Bacteria	1802
2075	Ga0500562_008561	3300053108	Bacteria	2584
2076	Ga0500572_001474	3300053111	Bacteria	6379
2077	Ga0500575_072918	3300053112	Bacteria	1274
2078	Ga0500591_048720	3300053115	Bacteria	1991
2079	Ga0500591_138100	3300053115	Bacteria	968
2080	Ga0500593_111199	3300053117	Bacteria	1126
2081	Ga0500608_006036	3300053122	Bacteria	4885
2082	Ga0500614_001887	3300053123	Bacteria	4825
2083	Ga0500618_019149	3300053125	Bacteria	1686
2084	Ga0500642_0018777	3300053130	Bacteria	2682
2085	Ga0500652_077698	3300053131	Bacteria	1380
2086	Ga0500655_058730	3300053133	Bacteria	773
2087	Ga0500559_0019248	3300053136	Bacteria	2885
2088	Ga0500559_0051481	3300053136	Bacteria	1818
2089	Ga0500577_0278165	3300053142	Bacteria	729
2090	Ga0500585_132815	3300053144	Bacteria	881
2091	Ga0500585_223604	3300053144	Bacteria	614
2092	Ga0500589_023249	3300053147	Bacteria	2856
2093	Ga0500590_018670	3300053148	Bacteria	3590
2094	Ga0500603_002379	3300053150	Bacteria	4126
2095	Ga0500616_0030592	3300053153	Bacteria	2955
2096	Ga0500624_001967	3300053157	Bacteria	2931
2097	Ga0500627_0083571	3300053158	Bacteria	1425
2098	Ga0500627_0350843	3300053158	Bacteria	636
2099	Ga0500630_001264	3300053159	Bacteria	11915
2100	Ga0500633_0210962	3300053160	Bacteria	726
2101	Ga0500638_008813	3300053162	Bacteria	4323
2102	Ga0500639_002503	3300053163	Bacteria	9190
2103	Ga0500639_028090	3300053163	Bacteria	2972
2104	Ga0500639_096985	3300053163	Bacteria	1458
2105	Ga0500636_0224274	3300053177	Bacteria	977
2106	Ga0500636_0238451	3300053177	Bacteria	936
2107	Ga0500570_086394	3300053724	Bacteria	1387
2108	Ga0500576_027874	3300053725	Bacteria	2574
2109	Ga0500611_075707	3300053727	Bacteria	830
2110	Ga0500657_031862	3300053728	Bacteria	2479
2111	Ga0500645_010662	3300053730	Bacteria	3027
2112	Ga0500596_002137	3300053735	Bacteria	3928
2113	Ga0500601_001931	3300053737	Bacteria	2229
2114	Ga0501084_0270777	3300054114	Bacteria	1434
2115	Ga0501084_1098731	3300054114	Bacteria	668
2116	Ga0590074_090061	3300059423	Bacteria	592
2117	Ga0590075_031488	3300059424	Bacteria	1345
2118	Ga0501082_1921878	3300060353	Bacteria	516
2119	Ga0466962_0020422	3300061719	Bacteria	3182
2120	Ga0530510_0060430	3300061734	Bacteria	2742
2121	Ga0530510_0253426	3300061734	Bacteria	1312
2122	2507511625	2507262055	Bacteria	8048963
2123	2508540367	2508501009	Bacteria	7784016
2124	2513706296	2513237102	Bacteria	7703324
2125	2517407523	2517287029	Bacteria	6905599
2126	2517411700	2517287029	Bacteria	6905599
2127	2524542669	2524023228	Bacteria	10118060
2128	2524542685	2524023228	Bacteria	10118060
2129	2617379845	2617270741	Bacteria	8201522
2130	2617379905	2617270741	Bacteria	8201522
2131	2617382528	2617270742	Bacteria	6808054
2132	2805917807	2802429603	Bacteria	8777136
2133	2824780971	2824773399	Bacteria	8360218
2134	2856357377	2856356410	Bacteria	6297484
2135	2857515281	2857509624	Bacteria	7472071
2136	2857537751	2857531043	Bacteria	6754041
2137	2881369056	2881364244	Bacteria	7710352
2138	2881666703	2881665667	Bacteria	8175609
2139	2881666706	2881665667	Bacteria	8175609
2140	2885370908	2885366525	Bacteria	8326213
2141	2885414184	2885409591	Bacteria	9235467
2142	2889041514	2889033259	Bacteria	9099371
2143	2889310342	2889306138	Bacteria	6358934
2144	2904693887	2904690495	Bacteria	9412302
2145	2904707725
2146	2932800207	2932794094	Bacteria	7915132
2147	2935683943	2935675223	Bacteria	9928132
2148	2941546410	2941538514	Bacteria	9402094
2149	2961130649	2961127735	Bacteria	7196641
2150	8005316270	8005314921	Bacteria	7072929
2151	8006933869	8006933436	Bacteria	10410654
2152	8006936266	8006933436	Bacteria	10410654
2153	8006936763	8006933436	Bacteria	10410654
2154	8006937849	8006933436	Bacteria	10410654
2155	8006938564	8006933436	Bacteria	10410654
2156	8006939934	8006933436	Bacteria	10410654
2157	8006943413	8006933436	Bacteria	10410654
2158	8006943431	8006933436	Bacteria	10410654
2159	8006971383	8006964411	Bacteria	8966052
2160	8006974034	8006973647	Bacteria	10679141
2161	8006976232	8006973647	Bacteria	10679141
2162	8006977955	8006973647	Bacteria	10679141
2163	8006981616	8006973647	Bacteria	10679141
2164	8006983542	8006973647	Bacteria	10679141
2165	8006983666	8006973647	Bacteria	10679141
2166	8006983686	8006973647	Bacteria	10679141
2167	8016617201	8016613128	Bacteria	8794220
2168	8018130346	8018127388	Bacteria	7351159
2169	8019585402	8019576017	Bacteria	10049540
2170	8019598089	8019597564	Bacteria	10041141
2171	8019610293	8019608314	Bacteria	10042931
2172	8019648864	8019648815	Bacteria	10014479
2173	8019653918	8019648815	Bacteria	10014479
2174	8056683043	8056681323	Bacteria	8472857
2175	Ga0495664_0305100
2176	SwRhRL2b_contig_1110102
2177	CNBas_1000120
2178	CNAas_1001029
2179	JGI24746J21847_1003278
2180	JGI24746J21847_1004618
2181	JGI24747J21853_1013922
2182	JGI24739J22299_10156133
2183	JGI24737J22298_10015005
2184	JGI24743J22301_10001477
2185	JGI24743J22301_10004069
2186	JGI24750J21931_1001967
2187	JGI24750J21931_1002451
2188	JGI24745J21846_1001121
2189	JGI24745J21846_1013583
2190	JGI24748J21848_1000896
2191	JGI24748J21848_1001876
2192	JGI24738J21930_10018131
2193	JGI24749J21850_1001481
2194	JGI24749J21850_1003226
2195	JGI24749J21850_1040645
2196	JGI24744J21845_10003565
2197	JGI24744J21845_10039858
2198	JGI24034J26672_10001347
2199	JGI24742J22300_10002290
2200	JGI24742J22300_10014005
2201	JGI24742J22300_10056886
2202	rootH2_10055222
2203	JGI25404J52841_10000141
2204	Ga0055528_1014369
2205	JGI25405J52794_10125556
2206	Ga0065704_10003761
2207	Ga0065712_10091158
2208	Ga0065715_10101018
2209	Ga0065715_10103975
2210	Ga0065707_10004119
2211	Ga0070658_10059578
2212	Ga0070658_10816897
2213	Ga0070676_10141473
2214	Ga0070676_10222000
2215	Ga0070676_10344730
2216	Ga0070683_100049008
2217	Ga0070683_100237481
2218	Ga0070683_100260545
2219	Ga0070690_100088397
2220	Ga0070690_100314257
2221	Ga0070690_100326145
2222	Ga0070670_100062702
2223	Ga0070670_100152289
2224	Ga0070677_10016017
2225	Ga0070677_10025393
2226	Ga0068869_100245657
2227	Ga0068869_101950395
2228	Ga0070666_10035884
2229	Ga0070666_10071735
2230	Ga0070666_10237379
2231	Ga0070680_100020639
2232	Ga0070680_100308825
2233	Ga0070680_101228241
2234	Ga0070682_100028047
2235	Ga0070682_100116632
2236	Ga0070682_100414061
2237	Ga0068868_100049166
2238	Ga0068868_100052530
2239	Ga0068868_100354245
2240	Ga0068868_101299379
2241	Ga0070660_100377024
2242	Ga0070660_100381673
2243	Ga0070660_100488134
2244	Ga0070660_100523066
2245	Ga0070660_100603146
2246	Ga0070689_100042940
2247	Ga0070689_100138647
2248	Ga0070689_100369612
2249	Ga0070691_10030971
2250	Ga0070691_10060711
2251	Ga0070691_10210479
2252	Ga0070691_10525001
2253	Ga0070691_10935492
2254	Ga0070687_100016246
2255	Ga0070687_100041965
2256	Ga0070687_100871751
2257	Ga0070661_100102324
2258	Ga0070661_100378666
2259	Ga0070692_10036208
2260	Ga0070692_10396885
2261	Ga0070668_100046001
2262	Ga0070668_100048950
2263	Ga0070668_100075625
2264	Ga0070668_100114760
2265	Ga0070668_100243294
2266	Ga0070668_100476582
2267	Ga0070668_100527243
2268	Ga0070668_100537173
2269	Ga0070668_100891865
2270	Ga0070668_101180724
2271	Ga0070668_101388732
2272	Ga0070669_100041051
2273	Ga0070669_100051754
2274	Ga0070669_100400299
2275	Ga0070669_100563196
2276	Ga0070675_100044532
2277	Ga0070675_100090999
2278	Ga0070675_101188489
2279	Ga0070671_100051993
2280	Ga0070671_100267379
2281	Ga0070671_100378638
2282	Ga0070671_100428094
2283	Ga0070674_100048632
2284	Ga0070674_100193244
2285	Ga0070674_100259447
2286	Ga0070674_100537113
2287	Ga0070674_101820662
2288	Ga0070673_100046119
2289	Ga0070673_100046378
2290	Ga0070673_100272177
2291	Ga0070673_101244932
2292	Ga0070688_100025517
2293	Ga0070688_100026473
2294	Ga0070688_100142555
2295	Ga0070659_100196270
2296	Ga0070659_100300321
2297	Ga0070659_100539515
2298	Ga0070667_100051801
2299	Ga0070667_100273930
2300	Ga0070667_100662985
2301	Ga0070667_100667272
2302	Ga0070703_10010510
2303	Ga0070703_10011425
2304	Ga0070709_10029246
2305	Ga0070709_10029935
2306	Ga0070709_10040883
2307	Ga0070709_10056165
2308	Ga0070709_10251498
2309	Ga0070714_100048072
2310	Ga0070714_100049300
2311	Ga0070714_100068579
2312	Ga0070714_100195684
2313	Ga0070714_100343550
2314	Ga0070714_100403320
2315	Ga0070714_100990414
2316	Ga0070713_100016241
2317	Ga0070713_100124786
2318	Ga0070713_100329051
2319	Ga0070713_100894660
2320	Ga0070713_100905407
2321	Ga0070710_10017785
2322	Ga0070710_10115219
2323	Ga0070710_10236399
2324	Ga0070710_10275291
2325	Ga0070701_10012140
2326	Ga0070701_10048532
2327	Ga0070701_10260551
2328	Ga0070711_100015435
2329	Ga0070711_100027809
2330	Ga0070711_100053839
2331	Ga0070711_100102323
2332	Ga0070711_100215128
2333	Ga0070711_100234692
2334	Ga0070711_100690364
2335	Ga0070711_100762046
2336	Ga0070705_100011195
2337	Ga0070705_100346044
2338	Ga0070705_101202494
2339	Ga0070700_100027556
2340	Ga0070700_100194371
2341	Ga0070700_100374687
2342	Ga0070694_100019015
2343	Ga0070694_100048216
2344	Ga0070694_100064730
2345	Ga0070708_100182126
2346	Ga0070708_100701134
2347	Ga0070708_100803969
2348	Ga0070663_100035515
2349	Ga0070663_100036289
2350	Ga0070663_100036982
2351	Ga0070663_100037621
2352	Ga0070663_100082745
2353	Ga0070663_100092086
2354	Ga0070663_100212616
2355	Ga0070663_100513144
2356	Ga0070663_100561414
2357	Ga0070663_100864896
2358	Ga0070663_101274916
2359	Ga0070678_100036628
2360	Ga0070678_100157776
2361	Ga0070678_100347983
2362	Ga0070678_101695823
2363	Ga0070662_100043985
2364	Ga0070662_100074789
2365	Ga0070662_100169000
2366	Ga0070662_100175252
2367	Ga0070662_100326474
2368	Ga0070662_100347556
2369	Ga0070662_101205465
2370	Ga0070662_101628309
2371	Ga0070681_10053152
2372	Ga0070681_10101479
2373	Ga0070681_10925719
2374	Ga0068867_100032454
2375	Ga0068867_100058513
2376	Ga0068867_100122486
2377	Ga0068867_100152082
2378	Ga0068867_100220332
2379	Ga0068867_100428651
2380	Ga0068867_100518892
2381	Ga0070685_10023711
2382	Ga0070685_10095214
2383	Ga0070685_10119850
2384	Ga0070706_100074412
2385	Ga0070706_100143529
2386	Ga0070707_100050232
2387	Ga0070707_100055593
2388	Ga0070698_100074135
2389	Ga0070698_100144896
2390	Ga0070698_100417014
2391	Ga0070698_100486239
2392	Ga0070699_100049687
2393	Ga0070699_100053367
2394	Ga0070699_100688009
2395	Ga0070679_100137354
2396	Ga0070679_100259059
2397	Ga0070679_100334615
2398	Ga0070679_100470158
2399	Ga0070679_101142222
2400	Ga0070679_101286477
2401	Ga0070684_100261722
2402	Ga0070684_100369311
2403	Ga0070684_100409197
2404	Ga0070684_100458135
2405	Ga0070684_101024268
2406	Ga0070697_100074790
2407	Ga0070697_100866084
2408	Ga0070697_100893188
2409	Ga0070697_101328257
2410	Ga0068853_100078844
2411	Ga0068853_100107208
2412	Ga0068853_100343772
2413	Ga0068853_100394814
2414	Ga0070672_100036561
2415	Ga0070672_100082892
2416	Ga0070672_100134145
2417	Ga0070672_100777424
2418	Ga0070686_100027360
2419	Ga0070686_100032964
2420	Ga0070686_100216163
2421	Ga0070686_100658618
2422	Ga0070695_100000761
2423	Ga0070695_100126516
2424	Ga0070695_100529353
2425	Ga0070695_100547725
2426	Ga0070695_100603881
2427	Ga0070695_100988490
2428	Ga0070696_100009177
2429	Ga0070696_100386587
2430	Ga0070696_100481764
2431	Ga0070696_100714545
2432	Ga0070693_100666780
2433	Ga0070693_100840681
2434	Ga0070693_100929297
2435	Ga0070693_101041432
2436	Ga0070693_101282099
2437	Ga0070665_100047877
2438	Ga0070665_100066764
2439	Ga0070665_100079823
2440	Ga0070665_100096618
2441	Ga0070665_100704220
2442	Ga0070665_100928444
2443	Ga0070704_100003711
2444	Ga0070704_100253895
2445	Ga0070704_100467806
2446	Ga0070704_101940537
2447	Ga0068855_100087137
2448	Ga0068855_100222649
2449	Ga0068855_100774381
2450	Ga0070664_100087450
2451	Ga0070664_100100441
2452	Ga0070664_100676753
2453	Ga0070664_101673868
2454	Ga0068857_100073259
2455	Ga0068857_100101836
2456	Ga0068857_102031924
2457	Ga0068854_100016323
2458	Ga0068854_100467060
2459	Ga0068854_100539602
2460	Ga0068856_100305891
2461	Ga0068856_100495528
2462	Ga0068856_100547542
2463	Ga0068856_100677779
2464	Ga0068856_100836036
2465	Ga0070702_100031319
2466	Ga0070702_100038575
2467	Ga0068852_100111021
2468	Ga0068852_100171267
2469	Ga0068852_100324128
2470	Ga0068859_100011678
2471	Ga0068859_100085071
2472	Ga0068859_100272394
2473	Ga0068859_100387367
2474	Ga0068859_101649249
2475	Ga0068864_100048004
2476	Ga0068864_100055954
2477	Ga0068864_100069722
2478	Ga0068864_100253904
2479	Ga0068866_10213700
2480	Ga0068866_10260781
2481	Ga0068866_10370374
2482	Ga0068866_10687219
2483	Ga0068866_10798969
2484	Ga0068866_11243486
2485	Ga0068861_100044898
2486	Ga0068861_100070508
2487	Ga0068861_100657826
2488	Ga0068851_10014991
2489	Ga0068851_10371046
2490	Ga0068870_10098283
2491	Ga0068870_10102054
2492	Ga0068870_10386400
2493	Ga0068863_100071988
2494	Ga0068863_100094753
2495	Ga0068863_101365437
2496	Ga0068858_100073499
2497	Ga0068858_100075217
2498	Ga0068858_100129472
2499	Ga0068858_100412615
2500	Ga0068858_100691728
2501	Ga0068860_100039418
2502	Ga0068860_100508457
2503	Ga0068860_100519824
2504	Ga0068860_100787866
2505	Ga0068860_101058700
2506	Ga0068862_100030867
2507	Ga0068862_100045888
2508	Ga0068862_100382029
2509	Ga0068862_100724970
2510	Ga0068862_102274705
2511	Ga0081455_10034250
2512	Ga0081455_10035218
2513	Ga0081455_10050401
2514	Ga0081455_10078452
2515	Ga0081538_10150740
2516	Ga0081540_1001779
2517	Ga0081540_1018312
2518	Ga0081540_1025593
2519	Ga0081540_1218874
2520	Ga0081539_10025774
2521	Ga0070717_10105913
2522	Ga0070717_10171211
2523	Ga0070717_10341413
2524	Ga0070717_10342952
2525	Ga0070717_10533546
2526	Ga0070717_10841879
2527	Ga0075365_10057535
2528	Ga0075365_10062430
2529	Ga0075365_10265072
2530	Ga0075363_100049350
2531	Ga0075363_100204548
2532	Ga0075363_100306901
2533	Ga0075364_10069351
2534	Ga0075364_10659798
2535	Ga0075432_10068731
2536	Ga0075432_10193399
2537	Ga0070715_10017421
2538	Ga0070715_10139137
2539	Ga0070715_10203507
2540	Ga0070715_10273988
2541	Ga0070715_10987669
2542	Ga0070716_100026033
2543	Ga0070716_100028509
2544	Ga0070716_100038887
2545	Ga0070716_100042692
2546	Ga0070716_100166173
2547	Ga0070716_100202083
2548	Ga0070716_100391819
2549	Ga0070712_100047152
2550	Ga0070712_100071069
2551	Ga0070712_100116792
2552	Ga0070712_100164380
2553	Ga0070712_100422736
2554	Ga0070712_101255352
2555	Ga0075367_10019662
2556	Ga0075367_10022674
2557	Ga0075367_10033074
2558	Ga0075369_10192367
2559	Ga0075366_10038579
2560	Ga0097621_100048477
2561	Ga0097621_100097813
2562	Ga0097621_100887072
2563	Ga0075370_10074605
2564	Ga0068871_100052029
2565	Ga0068871_100490261
2566	Ga0068871_100624947
2567	Ga0075428_100058953
2568	Ga0075428_100145960
2569	Ga0075428_100725120
2570	Ga0075428_100790114
2571	Ga0075428_101056121
2572	Ga0075428_101228393
2573	Ga0075430_100029135
2574	Ga0075430_100060840
2575	Ga0075430_100529851
2576	Ga0075431_100096669
2577	Ga0075431_100132609
2578	Ga0075431_100568870
2579	Ga0075431_100625973
2580	Ga0075431_100690271
2581	Ga0075431_101177461
2582	Ga0075431_102030226
2583	Ga0075433_10071440
2584	Ga0075433_10770998
2585	Ga0075433_11823144
2586	Ga0075434_100077731
2587	Ga0075434_100932156
2588	Ga0075434_101318390
2589	Ga0075429_100069945
2590	Ga0075429_100135350
2591	Ga0075429_100366215
2592	Ga0075429_100721746
2593	Ga0068865_100029322
2594	Ga0068865_100034960
2595	Ga0068865_100038148
2596	Ga0068865_100100724
2597	Ga0068865_100291352
2598	Ga0068865_100323542
2599	Ga0068865_100359283
2600	Ga0068865_100411250
2601	Ga0075436_100610479
2602	Ga0097620_100011678
2603	Ga0097620_100085069
2604	Ga0097620_100272414
2605	Ga0097620_100387352
2606	Ga0097620_101649882
2607	Ga0099822_1039366
2608	Ga0075435_100061941
2609	Ga0075435_100507336
2610	Ga0075435_100905559
2611	Ga0099794_10140625
2612	Ga0099794_10215816
2613	Ga0099794_10569938
2614	Ga0099795_10187193
2615	Ga0105251_10083153
2616	Ga0105244_10071717
2617	Ga0105250_10145102
2618	Ga0105240_10000214
2619	Ga0105240_10048136
2620	Ga0105240_10123137
2621	Ga0105240_10259521
2622	Ga0105240_10564827
2623	Ga0105240_12089436
2624	Ga0105240_12388680
2625	Ga0111539_10046008
2626	Ga0111539_10121699
2627	Ga0111539_10634290
2628	Ga0111539_10744055
2629	Ga0111539_10768976
2630	Ga0105245_10058201
2631	Ga0105245_10201832
2632	Ga0105245_10260608
2633	Ga0105245_10336940
2634	Ga0105245_10663966
2635	Ga0105247_10044897
2636	Ga0105247_10058541
2637	Ga0105247_10074819
2638	Ga0105247_10084110
2639	Ga0105247_10132222
2640	Ga0105247_10308587
2641	Ga0114129_10113312
2642	Ga0114129_10126637
2643	Ga0114129_10158638
2644	Ga0114129_10395340
2645	Ga0114129_10782585
2646	Ga0114129_11129687
2647	Ga0114129_11803568
2648	Ga0105243_10043376
2649	Ga0105243_10044601
2650	Ga0105243_10230172
2651	Ga0105243_10278244
2652	Ga0105243_10554114
2653	Ga0105243_10934174
2654	Ga0105241_10507221
2655	Ga0105242_10052866
2656	Ga0105242_10231413
2657	Ga0105242_10318447
2658	Ga0105242_10954539
2659	Ga0105242_11049044
2660	Ga0105248_10065986
2661	Ga0105248_10122696
2662	Ga0105248_10485519
2663	Ga0105248_10534410
2664	Ga0105248_10952725
2665	Ga0105248_11257672
2666	Ga0105248_11746359
2667	Ga0105237_10073967
2668	Ga0105237_10102477
2669	Ga0105237_10412752
2670	Ga0105237_12362333
2671	Ga0105238_10387337
2672	Ga0105238_10645527
2673	Ga0105238_11476117
2674	Ga0105238_12641994
2675	Ga0105249_10028066
2676	Ga0105249_10055087
2677	Ga0105249_10087337
2678	Ga0105249_10114680
2679	Ga0105249_10138614
2680	Ga0105249_10201224
2681	Ga0105249_10273096
2682	Ga0105249_10654618
2683	Ga0099796_10025508
2684	Ga0099796_10026637
2685	Ga0099796_10071967
2686	Ga0105239_10105018
2687	Ga0105239_10111045
2688	Ga0105239_10299303
2689	Ga0105239_10357001
2690	Ga0105239_10557915
2691	Ga0105239_10968536
2692	Ga0105246_10031533
2693	Ga0105246_10052543
2694	Ga0105246_10055636
2695	Ga0105246_10077333
2696	Ga0105246_10201464
2697	Ga0105246_11297140
2698	Ga0157323_1008223
2699	Ga0157323_1049526
2700	Ga0157319_1004757
2701	Ga0157319_1015828
2702	Ga0157345_1032691
2703	Ga0157339_1008392
2704	Ga0157342_1000363
2705	Ga0157316_1026130
2706	Ga0157326_1087187
2707	Ga0157371_10618375
2708	Ga0157370_10064658
2709	Ga0157369_10101001
2710	Ga0157369_10144292
2711	Ga0157369_10815287
2712	Ga0157369_11188084
2713	Ga0157374_10058616
2714	Ga0157374_10076268
2715	Ga0157374_10598273
2716	Ga0157374_10611843
2717	Ga0157374_11143053
2718	Ga0157378_10041017
2719	Ga0157378_10369096
2720	Ga0157378_10871815
2721	Ga0157378_11223202
2722	Ga0157378_11721835
2723	Ga0157378_12204585
2724	Ga0163162_10060990
2725	Ga0163162_10064322
2726	Ga0163162_10091115
2727	Ga0163162_10224089
2728	Ga0163162_10247417
2729	Ga0163162_10511741
2730	Ga0163162_10574284
2731	Ga0163162_11550495
2732	Ga0157372_10190801
2733	Ga0157372_10294740
2734	Ga0157372_11125182
2735	Ga0157375_10054329
2736	Ga0157375_10074384
2737	Ga0157375_10219534
2738	Ga0157375_11202325
2739	Ga0157375_12270665
2740	Ga0163163_10071117
2741	Ga0163163_10072960
2742	Ga0163163_10104982
2743	Ga0163163_10854593
2744	Ga0163163_11299038
2745	Ga0163163_11927232
2746	Ga0163163_12516882
2747	Ga0157380_10044229
2748	Ga0157380_10076607
2749	Ga0157380_10400435
2750	Ga0157380_10512190
2751	Ga0157377_10049881
2752	Ga0157377_10174301
2753	Ga0157379_10063563
2754	Ga0157379_10094922
2755	Ga0157379_10466088
2756	Ga0157376_10037388
2757	Ga0157376_10975433
2758	Ga0157376_11329171
2759	Ga0157376_12002407
2760	Ga0163161_10048134
2761	Ga0163161_10053149
2762	Ga0163161_10106676
2763	Ga0163161_10123130
2764	Ga0163161_10171661
2765	Ga0163161_10361394
2766	Ga0163161_10399896
2767	Ga0206356_11796761
2768	Ga0206353_11171063
2769	Ga0213872_10013559
2770	Ga0213872_10022770
2771	Ga0213872_10034001
2772	Ga0213872_10217498
2773	Ga0213876_10032700
2774	Ga0213876_10076761
2775	Ga0213876_10144797
2776	Ga0213875_10010246
2777	Ga0213875_10309100
2778	Ga0213871_10039146
2779	Ga0207672_1002512
2780	Ga0209437_102087
2781	Ga0209677_100346
2782	Ga0209233_1000402
2783	Ga0207666_1013324
2784	Ga0209673_1015007
2785	Ga0207673_1002966
2786	Ga0209564_1010110
2787	Ga0209758_1002437
2788	Ga0207697_10014111
2789	Ga0207697_10027176
2790	Ga0207656_10020255
2791	Ga0207656_10325523
2792	Ga0207653_10011706
2793	Ga0207653_10085715
2794	Ga0207682_10018078
2795	Ga0207682_10023002
2796	Ga0207692_10013797
2797	Ga0207692_10234580
2798	Ga0207692_10470230
2799	Ga0207642_10188674
2800	Ga0207642_10281136
2801	Ga0207642_10340061
2802	Ga0207710_10098738
2803	Ga0207710_10110612
2804	Ga0207710_10136388
2805	Ga0207710_10569616
2806	Ga0207688_10017957
2807	Ga0207688_10032419
2808	Ga0207680_10029231
2809	Ga0207680_10057008
2810	Ga0207680_10164083
2811	Ga0207680_10214418
2812	Ga0207680_10288643
2813	Ga0207680_10514127
2814	Ga0207647_10027482
2815	Ga0207647_10041135
2816	Ga0207647_10201857
2817	Ga0207647_10220174
2818	Ga0207647_10275142
2819	Ga0207647_10341703
2820	Ga0207685_10033118
2821	Ga0207685_10093616
2822	Ga0207685_10112532
2823	Ga0207685_10127574
2824	Ga0207685_10218696
2825	Ga0207685_10271856
2826	Ga0207685_10504803
2827	Ga0207685_10651419
2828	Ga0207685_10652877
2829	Ga0207699_10021781
2830	Ga0207699_10075229
2831	Ga0207699_10202107
2832	Ga0207699_10457832
2833	Ga0207645_10083525
2834	Ga0207645_10173537
2835	Ga0207645_10381154
2836	Ga0207643_10019057
2837	Ga0207643_10036307
2838	Ga0207643_10229868
2839	Ga0207705_10037903
2840	Ga0207705_10329417
2841	Ga0207705_10965368
2842	Ga0207684_10057454
2843	Ga0207684_10059245
2844	Ga0207684_10079032
2845	Ga0207684_10132219
2846	Ga0207684_10648829
2847	Ga0207684_11595628
2848	Ga0207654_10260322
2849	Ga0207707_10043465
2850	Ga0207707_10315427
2851	Ga0207707_10360963
2852	Ga0207707_10520062
2853	Ga0207695_10000373
2854	Ga0207695_10354600
2855	Ga0207695_10505813
2856	Ga0207695_10599499
2857	Ga0207671_10053523
2858	Ga0207671_10066355
2859	Ga0207671_10090272
2860	Ga0207671_10867702
2861	Ga0207693_10035440
2862	Ga0207693_10113530
2863	Ga0207693_10146311
2864	Ga0207693_10161471
2865	Ga0207693_10338896
2866	Ga0207693_10384622
2867	Ga0207693_10395674
2868	Ga0207663_10016641
2869	Ga0207663_10101216
2870	Ga0207663_10209216
2871	Ga0207663_10406352
2872	Ga0207663_10534523
2873	Ga0207663_10534684
2874	Ga0207663_10579879
2875	Ga0207663_10721559
2876	Ga0207660_10013681
2877	Ga0207660_10485303
2878	Ga0207660_10628137
2879	Ga0207662_10015080
2880	Ga0207662_10015662
2881	Ga0207662_10353364
2882	Ga0207657_10081116
2883	Ga0207657_10461619
2884	Ga0207657_10831295
2885	Ga0207657_11301182
2886	Ga0207649_10691393
2887	Ga0207652_10146948
2888	Ga0207652_10196399
2889	Ga0207652_10513533
2890	Ga0207652_11037248
2891	Ga0207652_11613162
2892	Ga0207646_10024612
2893	Ga0207646_10062385
2894	Ga0207646_10323444
2895	Ga0207681_10044241
2896	Ga0207681_10619943
2897	Ga0207681_10884088
2898	Ga0207694_10548808
2899	Ga0207650_10042359
2900	Ga0207650_10074168
2901	Ga0207650_10676470
2902	Ga0207659_10040650
2903	Ga0207659_10055283
2904	Ga0207659_10924743
2905	Ga0207687_10108753
2906	Ga0207687_10171529
2907	Ga0207687_10189473
2908	Ga0207687_10311030
2909	Ga0207687_10446735
2910	Ga0207687_11728663
2911	Ga0207700_10050574
2912	Ga0207700_10266281
2913	Ga0207700_10290412
2914	Ga0207700_10500532
2915	Ga0207664_10057769
2916	Ga0207664_10072284
2917	Ga0207664_10190231
2918	Ga0207664_10406806
2919	Ga0207664_10421030
2920	Ga0207664_10528836
2921	Ga0207644_10041840
2922	Ga0207644_10085832
2923	Ga0207644_10206802
2924	Ga0207644_10314235
2925	Ga0207690_10144873
2926	Ga0207690_10582285
2927	Ga0207690_10654371
2928	Ga0207690_10670192
2929	Ga0207690_10996633
2930	Ga0207706_10038063
2931	Ga0207706_10058630
2932	Ga0207706_10063148
2933	Ga0207706_10107655
2934	Ga0207706_10298514
2935	Ga0207686_10072212
2936	Ga0207686_10240942
2937	Ga0207686_10370266
2938	Ga0207686_10684826
2939	Ga0207709_10049575
2940	Ga0207709_10052277
2941	Ga0207709_10258510
2942	Ga0207709_10402527
2943	Ga0207709_10479840
2944	Ga0207709_10608380
2945	Ga0207670_10041706
2946	Ga0207670_10073740
2947	Ga0207670_10245373
2948	Ga0207670_10299663
2949	Ga0207669_10020122
2950	Ga0207669_10028158
2951	Ga0207669_10259148
2952	Ga0207669_10288327
2953	Ga0207669_10779628
2954	Ga0207704_10019520
2955	Ga0207704_10047130
2956	Ga0207704_10155737
2957	Ga0207704_11546685
2958	Ga0207665_10032332
2959	Ga0207665_10063608
2960	Ga0207665_10075494
2961	Ga0207665_10200975
2962	Ga0207665_10290355
2963	Ga0207665_10359520
2964	Ga0207665_10377588
2965	Ga0207665_10655482
2966	Ga0207691_10046187
2967	Ga0207691_10062282
2968	Ga0207691_10336746
2969	Ga0207711_10224051
2970	Ga0207711_10241817
2971	Ga0207711_10309986
2972	Ga0207711_10345749
2973	Ga0207711_10584138
2974	Ga0207711_10712365
2975	Ga0207711_11556663
2976	Ga0207689_10059772
2977	Ga0207689_10069587
2978	Ga0207689_10755058
2979	Ga0207661_10103934
2980	Ga0207661_10252382
2981	Ga0207661_10489546
2982	Ga0207679_10218180
2983	Ga0207679_10290636
2984	Ga0207679_11123884
2985	Ga0207667_10055801
2986	Ga0207667_10103589
2987	Ga0207667_10169711
2988	Ga0207651_10035608
2989	Ga0207651_10056350
2990	Ga0207651_10202112
2991	Ga0207712_10000585
2992	Ga0207712_10048335
2993	Ga0207712_10064412
2994	Ga0207712_10077573
2995	Ga0207712_10126146
2996	Ga0207712_10144232
2997	Ga0207712_10247782
2998	Ga0207712_10637831
2999	Ga0207712_11501394
3000	Ga0207668_10061777
3001	Ga0207668_10089892
3002	Ga0207668_10102105
3003	Ga0207668_10167073
3004	Ga0207668_10258154
3005	Ga0207668_10640428
3006	Ga0207668_10836542
3007	Ga0207668_11467762
3008	Ga0207640_10034177
3009	Ga0207640_10371398
3010	Ga0207640_10423834
3011	Ga0207658_10102726
3012	Ga0207658_10365241
3013	Ga0207658_10410207
3014	Ga0207658_10490358
3015	Ga0207658_10661470
3016	Ga0207658_12187782
3017	Ga0207677_10073181
3018	Ga0207677_10692798
3019	Ga0207677_10858439
3020	Ga0207703_10054702
3021	Ga0207703_10071624
3022	Ga0207703_10122142
3023	Ga0207703_10641907
3024	Ga0207703_11369969
3025	Ga0207639_10082447
3026	Ga0207639_10276728
3027	Ga0207639_10364480
3028	Ga0207639_10459927
3029	Ga0207639_10585532
3030	Ga0207678_10015379
3031	Ga0207678_10037550
3032	Ga0207678_10062555
3033	Ga0207678_10078969
3034	Ga0207678_10088720
3035	Ga0207678_10091072
3036	Ga0207678_10282334
3037	Ga0207678_10831716
3038	Ga0207708_10029482
3039	Ga0207708_10066148
3040	Ga0207708_10071628
3041	Ga0207708_10085476
3042	Ga0207708_10596160
3043	Ga0207702_10290190
3044	Ga0207702_10292819
3045	Ga0207702_10639362
3046	Ga0207702_10641390
3047	Ga0207702_10935740
3048	Ga0207641_10062575
3049	Ga0207641_10088324
3050	Ga0207641_11140882
3051	Ga0207648_10065723
3052	Ga0207648_10076181
3053	Ga0207648_10121289
3054	Ga0207648_10229568
3055	Ga0207648_10360949
3056	Ga0207648_10511333
3057	Ga0207676_10072021
3058	Ga0207676_10150874
3059	Ga0207676_10991268
3060	Ga0207676_11124931
3061	Ga0207674_10023599
3062	Ga0207674_10343974
3063	Ga0207674_12026797
3064	Ga0207675_100020156
3065	Ga0207675_100024147
3066	Ga0207675_100064100
3067	Ga0207675_100110238
3068	Ga0207675_100181364
3069	Ga0207675_100687112
3070	Ga0207683_10048793
3071	Ga0207683_10091106
3072	Ga0207683_10200171
3073	Ga0207683_10265202
3074	Ga0207683_11102760
3075	Ga0207683_11685538
3076	Ga0207698_10064868
3077	Ga0207698_10086511
3078	Ga0207698_10437020
3079	Ga0207698_10726811
3080	Ga0207698_11348378
3081	Ga0209389_1052241
3082	Ga0209589_1030082
3083	Ga0209489_100917
3084	Ga0209179_1056343
3085	Ga0209588_1107203
3086	Ga0209588_1212191
3087	Ga0209813_10026024
3088	Ga0207428_10087032
3089	Ga0207428_10150666
3090	Ga0207428_10765185
3091	Ga0268266_10022204
3092	Ga0268266_10096154
3093	Ga0268266_10129863
3094	Ga0268266_10187007
3095	Ga0268266_10651002
3096	Ga0268266_10747104
3097	Ga0268266_11150034
3098	Ga0268265_10005126
3099	Ga0268265_10061359
3100	Ga0268265_10188845
3101	Ga0268264_10002941
3102	Ga0268264_10241539
3103	Ga0268264_10283213
3104	Ga0268264_10498493
3105	Ga0268264_10674219
3106	Ga0268264_10938664
3107	Ga0268264_12509937
3108	Ga0307517_10275345
3109	Ga0307515_10132155
3110	Ga0307515_10135239
3111	Ga0265338_10111787
3112	Ga0314311_1180298
3113	Ga0265760_10086322
3114	Ga0265330_10015341
3115	Ga0265332_10066572
3116	Ga0265328_10012873
3117	Ga0265328_10021593
3118	Ga0265325_10081294
3119	Ga0265329_10015870
3120	Ga0265329_10064518
3121	Ga0265340_10386724
3122	Ga0265339_10023122
3123	Ga0265339_10335853
3124	Ga0265331_10249325
3125	Ga0265331_10456075
3126	Ga0265327_10064012
3127	Ga0265316_10055809
3128	Ga0265316_10070620
3129	Ga0265316_10105171
3130	Ga0265316_10217038
3131	Ga0265316_10348004
3132	Ga0307513_10127711
3133	Ga0307513_10280811
3134	Ga0307509_10133492
3135	Ga0307509_10213794
3136	Ga0307508_10435988
3137	Ga0265314_10038605
3138	Ga0265314_10267978
3139	Ga0265342_10223132
3140	Ga0265342_10289723
3141	Ga0307516_10007599
3142	Ga0307516_10283404
3143	Ga0307413_11761563
3144	Ga0307410_10820099
3145	Ga0326468_10000972
3146	Ga0307412_10447903
3147	Ga0316593_10320748
3148	Ga0307507_10316188
3149	Ga0307510_10073274
3150	Ga0307510_10239140
3151	Ga0373930_0050834
3152	Ga0373948_0013335
3153	Ga0373950_0072790
3154	Ga0373950_0103580
3155	Ga0373958_0039695
3156	Ga0373926_0129624
3157	Ga0373926_0161906
3158	Ga0373928_0052617
3159	Ga0373929_0127820
3160	Ga0373934_0053150
3161	Ga0373934_0360956
3162	Ga0373940_0129157
3163	Ga0373944_0022663
3164	Ga0373944_0031391
3165	Ga0373944_0185074
3166	Ga0373944_0278407
3167	Ga0373949_0054229
3168	Ga0373949_0060088
3169	Ga0373951_0216243
3170	Ga0373952_0082468
3171	Ga0373923_0025299
3172	Ga0373923_0050567
3173	Ga0373923_0087226
3174	Ga0373923_0118740
3175	Ga0373923_0145989
3176	Ga0373923_0160180
3177	Ga0373923_0300089
3178	Ga0373923_0348574
3179	Ga0373932_0031151
3180	Ga0373932_0033969
3181	Ga0373936_0149967
3182	Ga0373936_0172059
3183	Ga0373936_0211367
3184	Ga0373936_0629493
3185	Ga0373939_0026226
3186	Ga0373939_0164496
3187	Ga0373939_0173128
3188	Ga0373941_0040463
3189	Ga0373941_0304236
3190	Ga0373945_0040015
3191	Ga0373945_0105413
3192	Ga0373945_0148942
3193	Ga0373945_0157335
3194	Ga0373945_0425744
3195	Ga0373953_0015051
3196	Ga0373953_0050058
3197	Ga0373953_0074586
3198	Ga0373953_0480816
3199	Ga0373953_0540871
3200	Ga0373954_0019849
3201	Ga0373954_0019918
3202	Ga0373954_0028236
3203	Ga0373954_0047550
3204	Ga0373954_0085363
3205	Ga0373954_0326512
3206	Ga0373954_0399468
3207	Ga0373956_0030765
3208	Ga0373956_0114428
3209	Ga0373956_0487274
3210	Ga0373957_0016532
3211	Ga0373957_0232347
3212	Ga0373957_0245714
3213	Ga0373960_0101701
3214	Ga0373943_0080587
3215	Ga0373943_0109288
3216	Ga0373943_0114353
3217	Ga0373943_0124022
3218	Ga0373943_0270664
3219	Ga0373943_0309456
3220	Ga0373943_0321230
3221	Ga0373943_0567817
3222	Ga0373943_0572643
3223	Ga0373943_0580769
3224	Ga0373943_0617100
3225	Ga0373943_0636921
3226	Ga0373946_0006182
3227	Ga0373946_0018765
3228	Ga0373946_0078762
3229	Ga0373946_0082082
3230	Ga0373946_0186245
3231	Ga0373946_0216407
3232	Ga0373955_0048305
3233	Ga0373955_0072544
3234	Ga0373955_0147722
3235	Ga0373955_0158079
3236	Ga0373955_0290198
3237	Ga0373955_0334770
3238	Ga0373955_0342671
3239	Ga0373942_0120640
3240	Ga0373942_0143157
3241	Ga0373961_0092534
3242	Ga0373962_0011074
3243	Ga0373962_0108194
3244	Ga0316574_0198250
3245	Ga0373924_0015840
3246	Ga0373924_0018409
3247	Ga0373924_0038098
3248	Ga0373924_0067477
3249	Ga0373924_0219718
3250	Ga0373931_0159956
3251	Ga0373931_0166604
3252	Ga0373931_0208178
3253	Ga0373931_0357718
3254	Ga0373935_0056141
3255	Ga0373935_0085775
3256	Ga0373935_0102093
3257	Ga0373935_0117294
3258	Ga0373935_0120671
3259	Ga0373935_0126546
3260	Ga0373935_0382960
3261	Ga0373935_1443899
3262	Ga0373927_0049063
3263	Ga0373927_0049705
3264	Ga0373927_0065746
3265	Ga0373927_0171715
3266	Ga0373927_0263915
3267	Ga0373927_0383764
3268	Ga0373927_0563662
3269	Ga0373927_1090734
3270	Ga0373933_0029830
3271	Ga0373933_0056507
3272	Ga0373933_0074087
3273	Ga0373933_0132843
3274	Ga0373933_0234409
3275	Ga0373933_0832656
3276	Ga0373933_0995154
3277	Ga0373947_0042460
3278	Ga0373947_0076942
3279	Ga0373947_0098906
3280	Ga0373947_0145046
3281	Ga0373947_0213055
3282	Ga0373947_0260879
3283	Ga0373947_0296121
3284	Ga0373947_0370111
3285	Ga0373947_0537903
3286	Ga0373947_0799024
3287	Ga0373947_0846433
3288	Ga0373937_0084987
3289	Ga0373937_0140309
3290	Ga0373937_0147539
3291	Ga0373937_0158539
3292	Ga0373937_0194428
3293	Ga0373937_0644374
3294	Ga0373937_1573313
3295	Ga0373937_1624880
3296	Ga0316582_0047627
3297	Ga0316582_0933269
3298	Ga0373925_0067612
3299	Ga0373925_0069733
3300	Ga0373925_0210031
3301	Ga0373925_0325420
3302	Ga0373925_0356362
3303	Ga0373925_0427912
3304	Ga0373925_0490255
3305	Ga0373925_1222496
3306	Ga0373925_1616746
3307	Ga0395899_0021806
3308	Ga0395900_0006417
3309	Ga0395900_0118804
3310	Ga0395900_0163631
3311	Ga0395900_0169067
3312	Ga0395900_0222368
3313	Ga0395900_0676247
3314	Ga0395900_1280666
3315	Ga0395900_1799298
3316	Ga0395898_0017413
3317	Ga0395898_0047908
3318	Ga0395898_0407867
3319	Ga0395898_0420041
3320	Ga0395898_0993533
3321	Ga0395898_1010067
3322	Ga0395905_0028981
3323	Ga0395905_0049044
3324	Ga0395905_0091869
3325	Ga0395905_0098054
3326	Ga0395905_0825347
3327	Ga0436364_0326510
3328	Ga0436364_0962972
3329	Ga0436364_1456246
3330	Ga0395901_0059404
3331	Ga0395901_0144785
3332	Ga0395901_0199103
3333	Ga0395901_0362760
3334	Ga0400485_04215
3335	Ga0400485_16768
3336	Ga0400488_47058
3337	Ga0400486_01382
3338	Ga0400486_07939
3339	Ga0400486_14467
3340	Ga0400486_23044
3341	Ga0400483_111038
3342	Ga0400483_212980
3343	Ga0400487_54562
3344	Ga0436365_0243347
3345	Ga0436365_0583808
3346	Ga0436365_0658513
3347	Ga0436365_0771598
3348	Ga0436360_0073076
3349	Ga0436360_0074255
3350	Ga0436360_0361390
3351	Ga0436360_0645085
3352	Ga0436361_0060530
3353	Ga0436361_0085954
3354	Ga0436361_0376942
3355	Ga0436361_0720791
3356	Ga0436361_1074467
3357	Ga0436363_1069702
3358	Ga0436363_1090990
3359	Ga0436362_0436830
3360	Ga0439453_0000974
3361	Ga0439453_0002632
3362	Ga0439453_0002710
3363	Ga0439466_0086054
3364	Ga0439466_0220831
3365	Ga0439465_0047282
3366	Ga0451791_1072700
3367	Ga0451793_1805825
3368	Ga0451833_0245952
3369	Ga0451839_1046304
3370	Ga0451845_0321414
3371	Ga0451849_0779732
3372	Ga0451851_0301071
3373	Ga0451851_0384489
3374	Ga0451853_1441035
3375	Ga0439441_011328
3376	Ga0439441_017699
3377	Ga0439443_000643
3378	Ga0439443_001673
3379	Ga0439443_027850
3380	Ga0439448_0087253
3381	Ga0439451_018834
3382	Ga0439451_024473
3383	Ga0439454_022390
3384	Ga0439455_0071297
3385	Ga0439456_010219
3386	Ga0439456_038963
3387	Ga0450923_011547
3388	Ga0450923_031299
3389	Ga0450894_051929
3390	Ga0450899_012083
3391	Ga0450905_018577
3392	Ga0450905_019166
3393	Ga0450889_000730
3394	Ga0439446_0086363
3395	Ga0439458_0032965
3396	Ga0439434_0038583
3397	Ga0439435_0000915
3398	Ga0439435_0005323
3399	Ga0439435_0064266
3400	Ga0439444_0012859
3401	Ga0439444_0017794
3402	Ga0439444_0029522
3403	Ga0439464_0015957
3404	Ga0439464_0058586
3405	Ga0439464_0168107
3406	Ga0439460_0003019
3407	Ga0439460_0004287
3408	Ga0439460_0010794
3409	Ga0439460_0290017
3410	Ga0450918_004800
3411	Ga0439440_0006576
3412	Ga0439440_0007577
3413	Ga0439440_0054601
3414	Ga0439440_0066460
3415	Ga0466969_0025434
3416	Ga0466969_0106421
3417	Ga0466969_0213760
3418	Ga0466972_0030572
3419	Ga0466972_0601028
3420	Ga0466965_0028301
3421	Ga0466965_0089407
3422	Ga0466966_0059696
3423	Ga0466966_0114637
3424	Ga0466966_0239806
3425	Ga0466966_0692337
3426	Ga0466966_0728717
3427	Ga0466961_0047623
3428	Ga0466961_0104863
3429	Ga0466961_0131493
3430	Ga0466964_0022238
3431	Ga0466964_0114626
3432	Ga0466964_0139074
3433	Ga0466971_0022392
3434	Ga0466971_0077053
3435	Ga0466968_0018946
3436	Ga0466968_0137700
3437	Ga0466970_0031500
3438	Ga0466970_0033311
3439	Ga0466957_0030133
3440	Ga0466957_0805755
3441	Ga0466959_0007283
3442	Ga0466959_0044833
3443	Ga0466959_0048707
3444	Ga0466959_0059094
3445	Ga0466958_0038401
3446	Ga0466958_0080061
3447	Ga0466958_0118709
3448	Ga0466967_0055644
3449	Ga0466967_0377913
3450	Ga0466967_0801456
3451	Ga0495617_011509
3452	Ga0495617_124154
3453	Ga0495617_212901
3454	Ga0495617_235163
3455	Ga0495592_0034042
3456	Ga0495592_0062015
3457	Ga0495592_0115689
3458	Ga0495592_0125527
3459	Ga0495592_0394875
3460	Ga0495592_0878709
3461	Ga0495603_0028379
3462	Ga0495603_0043799
3463	Ga0495603_0084848
3464	Ga0495603_0333379
3465	Ga0495603_0537240
3466	Ga0495590_0052462
3467	Ga0495590_0170136
3468	Ga0495591_040818
3469	Ga0495629_0009117
3470	Ga0495629_0070675
3471	Ga0495629_0124723
3472	Ga0495629_0176819
3473	Ga0495629_0309682
3474	Ga0495629_0430622
3475	Ga0495629_0726952
3476	Ga0495638_0045797
3477	Ga0495638_0103122
3478	Ga0495638_0172792
3479	Ga0495638_0242461
3480	Ga0495641_0026128
3481	Ga0495641_0082650
3482	Ga0495641_0110844
3483	Ga0495641_0143317
3484	Ga0495641_0550869
3485	Ga0495651_0061261
3486	Ga0495651_0070182
3487	Ga0495651_0107552
3488	Ga0495651_0152403
3489	Ga0495651_0202741
3490	Ga0495653_0056811
3491	Ga0495653_0060562
3492	Ga0495653_0157331
3493	Ga0495653_0261320
3494	Ga0495650_0065317
3495	Ga0495580_0089774
3496	Ga0495580_0315671
3497	Ga0495580_0463423
3498	Ga0495580_0635017
3499	Ga0495582_0020733
3500	Ga0495582_0032858
3501	Ga0495582_0043305
3502	Ga0495582_0163725
3503	Ga0495582_0317432
3504	Ga0495605_0028279
3505	Ga0495605_0030113
3506	Ga0495605_0190743
3507	Ga0495639_0049712
3508	Ga0495639_0394540
3509	Ga0495662_0026586
3510	Ga0495662_0027992
3511	Ga0495662_0046409
3512	Ga0495662_0076352
3513	Ga0495662_0092732
3514	Ga0495662_0151838
3515	Ga0495662_0238744
3516	Ga0495662_0417372
3517	Ga0495664_0077133
3518	Ga0495664_0127458
3519	Ga0495664_0254220
3520	Ga0495584_0032240
3521	Ga0495584_0033821
3522	Ga0495584_0059407
3523	Ga0495584_0169127
3524	Ga0495584_0386770
3525	Ga0495585_0060776
3526	Ga0495585_0068173
3527	Ga0495585_0079974
3528	Ga0495585_0093234
3529	Ga0495585_0153374
3530	Ga0495594_0117169
3531	Ga0495594_0202441
3532	Ga0495594_0293299
3533	Ga0495594_0354465
3534	Ga0495594_0374714
3535	Ga0495594_0544935
3536	Ga0495594_0673723
3537	Ga0495594_0781265
3538	Ga0495596_0022489
3539	Ga0495596_0041204
3540	Ga0495596_0056584
3541	Ga0495596_0168659
3542	Ga0495596_0421846
3543	Ga0495607_0044200
3544	Ga0495607_0063211
3545	Ga0495607_0191272
3546	Ga0495607_0209316
3547	Ga0495607_0458032
3548	Ga0495583_0031533
3549	Ga0495583_0237173
3550	Ga0495583_0293689
3551	Ga0495606_0051477
3552	Ga0495608_0063326
3553	Ga0495608_0066556
3554	Ga0495608_0084137
3555	Ga0495608_0089109
3556	Ga0495608_0264381
3557	Ga0495608_0315023
3558	Ga0495608_0346439
3559	Ga0495608_0361855
3560	Ga0495610_0085229
3561	Ga0495616_0035314
3562	Ga0495616_0171757
3563	Ga0495616_0339392
3564	Ga0495618_0030788
3565	Ga0495618_0045946
3566	Ga0495618_0239771
3567	Ga0495618_0300502
3568	Ga0495620_0027304
3569	Ga0495620_0140753
3570	Ga0495620_0418237
3571	Ga0495628_0064743
3572	Ga0495628_0071936
3573	Ga0495628_0073219
3574	Ga0495628_0077027
3575	Ga0495628_0147428
3576	Ga0495628_0340875
3577	Ga0495628_0343117
3578	Ga0495628_0769235
3579	Ga0495630_0067618
3580	Ga0495630_0083785
3581	Ga0495630_0099150
3582	Ga0495630_0124283
3583	Ga0495630_0126766
3584	Ga0495630_0394297
3585	Ga0495630_0447945
3586	Ga0495630_0608549
3587	Ga0495631_0021185
3588	Ga0495631_0021998
3589	Ga0495631_0038774
3590	Ga0495631_0097429
3591	Ga0495631_0270570
3592	Ga0495632_0042906
3593	Ga0495632_0140395
3594	Ga0495632_0396750
3595	Ga0495632_0397598
3596	Ga0495637_0068306
3597	Ga0495637_0140547
3598	Ga0495637_0180979
3599	Ga0495643_0043886
3600	Ga0495643_0159367
3601	Ga0495643_0166248
3602	Ga0495643_0310259
3603	Ga0495644_0015161
3604	Ga0495644_0058722
3605	Ga0495644_0081101
3606	Ga0495644_0204042
3607	Ga0495648_0035636
3608	Ga0495648_0213465
3609	Ga0495663_0006259
3610	Ga0495663_0024013
3611	Ga0495663_0088554
3612	Ga0495666_0049718
3613	Ga0495666_0055281
3614	Ga0495666_0065508
3615	Ga0495666_0107399
3616	Ga0495642_0053027
3617	Ga0495652_0045362
3618	Ga0495652_0084339
3619	Ga0495652_0097164
3620	Ga0495652_0148276
3621	Ga0495652_0163337
3622	Ga0495652_0176844
3623	Ga0495652_0316794
3624	Ga0495652_0467017
3625	Ga0495654_0027733
3626	Ga0495654_0164710
3627	Ga0495665_0034337
3628	Ga0495665_0124543
3629	Ga0495665_0485708
3630	Ga0495640_0026054
3631	Ga0495640_0044793
3632	Ga0495640_0056221
3633	Ga0495640_0222683
3634	Ga0495640_0357585
3635	Ga0495640_0560534
3636	Ga0495640_0660720
3637	Ga0495586_0015600
3638	Ga0495586_0048376
3639	Ga0495586_0170467
3640	Ga0495587_0039574
3641	Ga0495587_0043246
3642	Ga0495587_0048454
3643	Ga0495587_0069942
3644	Ga0495587_0449867
3645	Ga0495598_0011363
3646	Ga0495598_0091536
3647	Ga0495609_0010002
3648	Ga0495609_0240184
3649	Ga0495609_0308001
3650	Ga0495609_0374734
3651	Ga0495621_0133315
3652	Ga0495621_0192741
3653	Ga0495621_0237032
3654	Ga0495597_0019065
3655	Ga0495597_0155503
3656	Ga0495645_0078325
3657	Ga0495645_0122032
3658	Ga0495645_0129608
3659	Ga0495645_0215278
3660	Ga0495645_0262614
3661	Ga0495645_0778157
3662	Ga0495622_0112229
3663	Ga0495622_0197118
3664	Ga0495622_0407221
3665	Ga0495633_0105180
3666	Ga0495633_0156527
3667	Ga0495633_0202617
3668	Ga0495667_0060445
3669	Ga0495667_0078636
3670	Ga0495667_0193854
3671	Ga0495667_0216710
3672	Ga0495667_0292083
3673	Ga0495667_0441970
3674	Ga0495667_0507152
3675	Ga0495656_0017487
3676	Ga0495656_0031010
3677	Ga0495656_0088110
3678	Ga0495656_0091682
3679	Ga0495656_0102017
3680	Ga0495656_0106442
3681	Ga0495656_0242791
3682	Ga0495668_0035060
3683	Ga0495668_0049863
3684	Ga0495668_0053952
3685	Ga0495668_0207318
3686	Ga0495668_0291816
3687	Ga0495668_0440815
3688	Ga0495634_0054370
3689	Ga0495634_0057052
3690	Ga0495634_0173727
3691	Ga0495634_0493158
3692	Ga0495634_0524633
3693	Ga0495634_0619093
3694	Ga0495611_0022373
3695	Ga0495611_0053042
3696	Ga0495611_0071167
3697	Ga0495611_0085756
3698	Ga0495611_0104001
3699	Ga0495611_0134367
3700	Ga0495625_0044700
3701	Ga0495625_0063282
3702	Ga0495625_0259517
3703	Ga0495625_0345969
3704	Ga0495635_0046621
3705	Ga0495635_0068736
3706	Ga0495635_0139156
3707	Ga0495635_0206223
3708	Ga0495635_0210582
3709	Ga0495635_0241895
3710	Ga0495635_0308540
3711	Ga0495659_0032186
3712	Ga0495659_0068228
3713	Ga0495659_0095983
3714	Ga0495661_0090647
3715	Ga0495661_0136596
3716	Ga0495661_0170788
3717	Ga0495661_0378962
3718	Ga0495588_0162852
3719	Ga0495588_0201426
3720	Ga0495588_0209609
3721	Ga0495588_0213189
3722	Ga0495588_0588948
3723	Ga0495657_0047293
3724	Ga0495657_0063438
3725	Ga0495657_0390353
3726	Ga0495657_0718762
3727	Ga0495599_0020141
3728	Ga0495599_0049373
3729	Ga0495599_0107415
3730	Ga0495599_0146384
3731	Ga0495623_0039816
3732	Ga0495623_0097935
3733	Ga0495623_0115130
3734	Ga0495646_0046026
3735	Ga0495646_0052986
3736	Ga0495646_0161201
3737	Ga0495646_0301501
3738	Ga0495646_0657580
3739	Ga0495647_0124910
3740	Ga0495647_0189260
3741	Ga0495658_0036107
3742	Ga0495658_0058866
3743	Ga0495658_0270609
3744	Ga0495658_0296851
3745	Ga0495669_0023253
3746	Ga0495669_0078578
3747	Ga0495669_0163317
3748	Ga0495613_0092975
3749	Ga0495613_0130557
3750	Ga0495613_0190105
3751	Ga0495613_0203450
3752	Ga0495613_0528363
3753	Ga0495613_0946123
3754	Ga0495624_0074942
3755	Ga0495624_0269087
3756	Ga0495624_0307959
3757	Ga0495624_0357985
3758	Ga0495624_0434106
3759	Ga0495624_0594687
3760	Ga0495670_0102677
3761	Ga0495670_0287468
3762	Ga0495670_0356454
3763	Ga0495671_0019113
3764	Ga0495671_0049524
3765	Ga0495649_0037041
3766	Ga0495649_0113526
3767	Ga0495589_0031511
3768	Ga0495589_0054354
3769	Ga0495589_0063925
3770	Ga0495589_0157741
3771	Ga0495589_0253341
3772	Ga0495600_0040708
3773	Ga0495600_0048766
3774	Ga0495600_0108977
3775	Ga0495600_0147244
3776	Ga0495600_0153516
3777	Ga0495600_0290222
3778	Ga0495600_0334437
3779	Ga0495660_0040912
3780	Ga0495660_0373796
3781	Ga0495581_0044716
3782	Ga0495581_0046483
3783	Ga0495581_0150808
3784	Ga0495581_0404522
3785	Ga0495581_0477351
3786	Ga0495604_0065677
3787	Ga0495604_0082032
3788	Ga0495604_0140151
3789	Ga0495604_0156385
3790	Ga0495604_0169557
3791	Ga0495604_0304468
3792	Ga0495604_0756387
3793	Ga0495636_0025240
3794	Ga0495636_0075677
3795	Ga0495636_0230194
3796	Ga0495674_0070814
3797	Ga0495674_0082948
3798	Ga0495674_0098331
3799	Ga0495674_0107191
3800	Ga0495674_0223786
3801	Ga0495674_0271300
3802	Ga0495674_0357593
3803	Ga0495674_0636627
3804	Ga0495674_0686008
3805	Ga0495674_0845580
3806	Ga0495672_0020520
3807	Ga0495676_0076229
3808	Ga0495676_0320470
3809	Ga0495676_0394196
3810	Ga0495676_0733148
3811	Ga0495676_0770011
3812	Ga0495680_0068759
3813	Ga0495680_0084686
3814	Ga0495680_0108851
3815	Ga0495680_0110977
3816	Ga0495680_0125317
3817	Ga0495680_0271084
3818	Ga0495683_0105953
3819	Ga0495683_0151155
3820	Ga0495683_0379029
3821	Ga0495687_035270
3822	Ga0495687_209566
3823	Ga0495675_0030291
3824	Ga0495675_0137113
3825	Ga0495675_0190196
3826	Ga0495675_0387461
3827	Ga0495677_0030661
3828	Ga0495677_0074035
3829	Ga0495677_0086230
3830	Ga0495677_0090202
3831	Ga0495677_0349795
3832	Ga0495679_016898
3833	Ga0495679_123362
3834	Ga0495685_016847
3835	Ga0495685_040740
3836	Ga0495685_083333
3837	Ga0495673_0014867
3838	Ga0495673_0143002
3839	Ga0495673_0233448
3840	Ga0495681_0120447
3841	Ga0495681_0141787
3842	Ga0495681_0146476
3843	Ga0495684_0063483
3844	Ga0495684_0190957
3845	Ga0495684_0403312
3846	Ga0495684_0410765
3847	Ga0495686_0019899
3848	Ga0495686_0036615
3849	Ga0495686_0372477
3850	Ga0495593_0026520
3851	Ga0495593_0029374
3852	Ga0495593_0076571
3853	Ga0495593_0546373
3854	Ga0495602_0073723
3855	Ga0495602_0087738
3856	Ga0495602_0087779
3857	Ga0495602_0094258
3858	Ga0495602_0104315
3859	Ga0495602_0133355
3860	Ga0495602_0262546
3861	Ga0495602_0463231
3862	Ga0495602_0608660
3863	Ga0495614_0021101
3864	Ga0495614_0069460
3865	Ga0495614_0167900
3866	Ga0495615_0005371
3867	Ga0495626_0078934
3868	Ga0495626_0082699
3869	Ga0495626_0125730
3870	Ga0496100_0028776
3871	Ga0496100_0031597
3872	Ga0496100_0159178
3873	Ga0496100_0173868
3874	Ga0496100_0250894
3875	Ga0496100_0395550
3876	Ga0496100_0574853
3877	Ga0496100_0706214
3878	Ga0496100_0708531
3879	Ga0496100_0741270
3880	Ga0496100_0879341
3881	Ga0496101_0033751
3882	Ga0496101_0035887
3883	Ga0496101_0038247
3884	Ga0496101_0044644
3885	Ga0496101_0115824
3886	Ga0496101_0175211
3887	Ga0496101_0209661
3888	Ga0496101_0241630
3889	Ga0496101_0280317
3890	Ga0496101_0283747
3891	Ga0496101_0460772
3892	Ga0496102_0049876
3893	Ga0496102_0066054
3894	Ga0496102_0070976
3895	Ga0496102_0092734
3896	Ga0496102_0122950
3897	Ga0496102_0200069
3898	Ga0496102_0206161
3899	Ga0496102_0244581
3900	Ga0496102_0853763
3901	Ga0496102_1095028
3902	Ga0496102_1833519
3903	Ga0496103_0002742
3904	Ga0496103_0014996
3905	Ga0496103_0040276
3906	Ga0496103_0071615
3907	Ga0496103_0284373
3908	Ga0496103_0445742
3909	Ga0496103_0494078
3910	Ga0496103_0717327
3911	Ga0496104_0045734
3912	Ga0496104_0059400
3913	Ga0496104_0104024
3914	Ga0496104_0108983
3915	Ga0496104_0111917
3916	Ga0496104_0113312
3917	Ga0496104_0430973
3918	Ga0496104_0466879
3919	Ga0496104_0588308
3920	Ga0496104_0847309
3921	Ga0496104_0862176
3922	Ga0496105_0046657
3923	Ga0496105_0107197
3924	Ga0496105_0193747
3925	Ga0496105_0282763
3926	Ga0496105_0307149
3927	Ga0496105_0803009
3928	Ga0496105_1026656
3929	Ga0496106_0033983
3930	Ga0496106_0041823
3931	Ga0496106_0047349
3932	Ga0496106_0063367
3933	Ga0496106_0078768
3934	Ga0496106_0140505
3935	Ga0496106_0258857
3936	Ga0496106_0303710
3937	Ga0496106_0489559
3938	Ga0496106_0530453
3939	Ga0496106_0583970
3940	Ga0496106_0620293
3941	Ga0496106_0714773
3942	Ga0496107_0038488
3943	Ga0496107_0041834
3944	Ga0496107_0046145
3945	Ga0496107_0046304
3946	Ga0496107_0050391
3947	Ga0496107_0097275
3948	Ga0496107_0165038
3949	Ga0496107_0258697
3950	Ga0496107_0260074
3951	Ga0496107_0414938
3952	Ga0496108_0049607
3953	Ga0496108_0056182
3954	Ga0496108_0057291
3955	Ga0496108_0065118
3956	Ga0496108_0104141
3957	Ga0496108_0132378
3958	Ga0496108_0233812
3959	Ga0496108_0289327
3960	Ga0496108_1449746
3961	Ga0496108_1794362
3962	Ga0496109_0064560
3963	Ga0496109_0071023
3964	Ga0496109_0099071
3965	Ga0496109_0125562
3966	Ga0496109_0161194
3967	Ga0496109_0277168
3968	Ga0496109_0312563
3969	Ga0496109_0646531
3970	Ga0496109_0771174
3971	Ga0496109_1722258
3972	Ga0496110_0029621
3973	Ga0496110_0054071
3974	Ga0496110_0066313
3975	Ga0496110_0190197
3976	Ga0496110_0317333
3977	Ga0496110_0333749
3978	Ga0496110_0393917
3979	Ga0496110_0573283
3980	Ga0496111_0043157
3981	Ga0496111_0102061
3982	Ga0496112_0080792
3983	Ga0496112_0088190
3984	Ga0496112_0157687
3985	Ga0496112_0184317
3986	Ga0496112_0213937
3987	Ga0496112_0231503
3988	Ga0496112_0277572
3989	Ga0496112_0530485
3990	Ga0496112_0896006
3991	Ga0496113_0079818
3992	Ga0496113_0245033
3993	Ga0496113_0261368
3994	Ga0496113_0320469
3995	Ga0496113_0389117
3996	Ga0496113_0570480
3997	Ga0496113_0648512
3998	Ga0496113_0758133
3999	Ga0496114_0048749
4000	Ga0496114_0055981
4001	Ga0496114_0179653
4002	Ga0496114_0217838
4003	Ga0496114_0377381
4004	Ga0496114_0469736
4005	Ga0496115_0048757
4006	Ga0496115_0057562
4007	Ga0496115_0094618
4008	Ga0496115_0110092
4009	Ga0496115_0110839
4010	Ga0496115_0185200
4011	Ga0496115_0192847
4012	Ga0496115_0382083
4013	Ga0496115_0388745
4014	Ga0496115_0629148
4015	Ga0496115_1102892
4016	Ga0496116_0010933
4017	Ga0496117_0122713
4018	Ga0496118_0148601
4019	Ga0496119_0005832
4020	Ga0496119_0010762
4021	Ga0496119_0229257
4022	Ga0496120_0039244
4023	Ga0496121_0017696
4024	Ga0496121_0027619
4025	Ga0496121_0052148
4026	Ga0496121_0069941
4027	Ga0496121_0102368
4028	Ga0496122_0012905
4029	Ga0496123_0008115
4030	Ga0496124_0030225
4031	Ga0496124_0071552
4032	Ga0496124_0366663
4033	Ga0496124_0479647
4034	Ga0496125_0010509
4035	Ga0496125_0121389
4036	Ga0496125_0373516
4037	Ga0496125_0395821
4038	Ga0496126_0031342
4039	Ga0496126_0077582
4040	Ga0496126_0097672
4041	Ga0496126_0114241
4042	Ga0495678_026834
4043	Ga0495678_084642
4044	Ga0495682_0022664
4045	Ga0495682_0088775
4046	Ga0495682_0321537
4047	Ga0501031_0000121
4048	Ga0501031_0030516
4049	Ga0501031_0287115
4050	Ga0501032_0000043
4051	Ga0501032_0033638
4052	Ga0501032_0050389
4053	Ga0501032_0099664
4054	Ga0501032_0401845
4055	Ga0501033_0000055
4056	Ga0501033_0006672
4057	Ga0501033_0040343
4058	Ga0501033_0137128
4059	Ga0501033_0176881
4060	Ga0501033_0227836
4061	Ga0501033_0446696
4062	Ga0501034_0000204
4063	Ga0501034_0044814
4064	Ga0501034_0076963
4065	Ga0501034_0088512
4066	Ga0501036_0000017
4067	Ga0501036_0047731
4068	Ga0501036_0454043
4069	Ga0501036_1053662
4070	Ga0501037_0000056
4071	Ga0501037_0043358
4072	Ga0501037_0063378
4073	Ga0501037_0242802
4074	Ga0501037_0972564
4075	Ga0501038_0000035
4076	Ga0501038_0061132
4077	Ga0501038_0976580
4078	Ga0501039_0000039
4079	Ga0501039_0016834
4080	Ga0501039_0285457
4081	Ga0501039_1368708
4082	Ga0501040_0079614
4083	Ga0501040_0370785
4084	Ga0501041_0416158
4085	Ga0501043_0050164
4086	Ga0501043_0085061
4087	Ga0501043_0202238
4088	Ga0501043_0332785
4089	Ga0501046_0104481
4090	Ga0501046_0173954
4091	Ga0501046_0563386
4092	Ga0501046_0876218
4093	Ga0501047_0055416
4094	Ga0501047_0067633
4095	Ga0501047_0096060
4096	Ga0501047_0249367
4097	Ga0501047_0426757
4098	Ga0501048_0546056
4099	Ga0501048_0968523
4100	Ga0501067_0288868
4101	Ga0501068_0161890
4102	Ga0501068_0467328
4103	Ga0501068_0622293
4104	Ga0501069_0008003
4105	Ga0501069_0053938
4106	Ga0501069_0521051
4107	Ga0501070_0040455
4108	Ga0501070_0428230
4109	Ga0501070_0452209
4110	Ga0501070_0480594
4111	Ga0501070_1529106
4112	Ga0501071_0075148
4113	Ga0501071_0479139
4114	Ga0501071_0567749
4115	Ga0501071_0953018
4116	Ga0501072_0096401
4117	Ga0501072_0399882
4118	Ga0501072_0614770
4119	Ga0501073_0128194
4120	Ga0501074_0201422
4121	Ga0501074_0687484
4122	Ga0501076_0096833
4123	Ga0501076_0545433
4124	Ga0501077_0038870
4125	Ga0501077_0050816
4126	Ga0501077_0131435
4127	Ga0501079_0040332
4128	Ga0501079_0655722
4129	Ga0501079_1461604
4130	Ga0501079_1675325
4131	Ga0501080_0084195
4132	Ga0501080_0124938
4133	Ga0501080_0542401
4134	Ga0501081_0144195
4135	Ga0501081_0389630
4136	Ga0501083_0391724
4137	Ga0501241_000822
4138	Ga0501035_0000528
4139	Ga0501035_0001874
4140	Ga0501035_0012296
4141	Ga0501044_0000097
4142	Ga0501044_0064812
4143	Ga0501044_0082577
4144	Ga0501044_0085227
4145	Ga0501044_0146076
4146	Ga0501044_0232967
4147	Ga0501044_0417781
4148	Ga0501044_0575365
4149	Ga0501045_0134009
4150	Ga0501045_1164075
4151	Ga0501045_1270796
4152	nmdc:mga03n38_20962_c1
4153	nmdc:mga03n38_60482_c1
4154	nmdc:mga00v17_1091400_c1
4155	nmdc:mga00v17_576289_c1
4156	nmdc:mga00v17_59260_c1
4157	nmdc:mga0yw44_238574_c1
4158	nmdc:mga0yw44_77967_c1
4159	nmdc:mga0k408_34398_c1
4160	nmdc:mga06z11_11382_c2
4161	nmdc:mga06z11_117535_c1
4162	nmdc:mga06z11_119173_c1
4163	nmdc:mga06z11_21192_c1
4164	nmdc:mga06z11_385687_c1
4165	nmdc:mga07m45_85194_c1
4166	nmdc:mga05p37_108064_c1
4167	nmdc:mga05p37_154109_c1
4168	nmdc:mga05p37_172319_c1
4169	nmdc:mga05p37_258511_c1
4170	nmdc:mga05p37_695868_c1
4171	nmdc:mga05p37_866554_c1
4172	nmdc:mga09592_512626_c1
4173	nmdc:mga09592_53603_c1
4174	nmdc:mga0qj67_123544_c1
4175	nmdc:mga0qj67_48399_c1
4176	nmdc:mga0qj67_62505_c1
4177	nmdc:mga06r32_110446_c1
4178	nmdc:mga06r32_122152_c1
4179	nmdc:mga06r32_425563_c1
4180	nmdc:mga06r32_541591_c1
4181	nmdc:mga06r32_772374_c1
4182	nmdc:mga08y16_117930_c1
4183	nmdc:mga08y16_362117_c1
4184	nmdc:mga08y16_40443_c2
4185	nmdc:mga08y16_558759_c1
4186	nmdc:mga08y16_561824_c1
4187	nmdc:mga0n895_113370_c1
4188	nmdc:mga0n895_422580_c1
4189	nmdc:mga0n895_786326_c1
4190	nmdc:mga0n895_803744_c1
4191	nmdc:mga0rr50_159802_c1
4192	nmdc:mga0rr50_275473_c1
4193	nmdc:mga0rr50_55934_c1
4194	nmdc:mga0a205_50288_c1
4195	nmdc:mga0a205_822344_c1
4196	Ga0495601_0043237
4197	Ga0495601_0055886
4198	Ga0495601_0076190
4199	Ga0495601_0076892
4200	Ga0495601_0271392
4201	Ga0495601_0306949
4202	Ga0495601_0313617
4203	Ga0495601_0750320
4204	Ga0495612_0029881
4205	Ga0495612_0032701
4206	Ga0495612_0154268
4207	Ga0495612_0176723
4208	Ga0495612_0193189
4209	Ga0495612_0203814
4210	Ga0495655_0005141
4211	Ga0495655_0025384
4212	Ga0495655_0072031
4213	Ga0495655_0253875
4214	Ga0495595_0019132
4215	Ga0495595_0039211
4216	Ga0495595_0050715
4217	Ga0495595_0065464
4218	Ga0495595_0253624
4219	Ga0495619_0017984
4220	Ga0495619_0061773
4221	Ga0495619_0063374
4222	Ga0495619_0065800
4223	Ga0495619_0080349
4224	Ga0495619_0254368
4225	Ga0495619_0256217
4226	Ga0495619_0449299
4227	Ga0495619_0498479
4228	Ga0500578_0001652
4229	Ga0500644_0161303
4230	Ga0500646_0004647
4231	Ga0500646_0040337
4232	Ga0500647_0069287
4233	Ga0500583_0021044
4234	Ga0500583_0223778
4235	Ga0500651_0039291
4236	Ga0500651_0141259
4237	Ga0500651_0317839
4238	Ga0500566_0001583
4239	Ga0500566_0118345
4240	Ga0500566_0335759
4241	Ga0500566_0470106
4242	Ga0500640_018467
4243	Ga0500640_079371
4244	Ga0500641_0013667
4245	Ga0500641_0042220
4246	Ga0500554_275472
4247	Ga0500555_154582
4248	Ga0500556_0031626
4249	Ga0500562_008561
4250	Ga0500572_001474
4251	Ga0500575_072918
4252	Ga0500591_048720
4253	Ga0500591_138100
4254	Ga0500593_111199
4255	Ga0500608_006036
4256	Ga0500614_001887
4257	Ga0500618_019149
4258	Ga0500642_0018777
4259	Ga0500652_077698
4260	Ga0500655_058730
4261	Ga0500559_0019248
4262	Ga0500559_0051481
4263	Ga0500577_0278165
4264	Ga0500585_132815
4265	Ga0500585_223604
4266	Ga0500589_023249
4267	Ga0500590_018670
4268	Ga0500603_002379
4269	Ga0500616_0030592
4270	Ga0500624_001967
4271	Ga0500627_0083571
4272	Ga0500627_0350843
4273	Ga0500630_001264
4274	Ga0500633_0210962
4275	Ga0500638_008813
4276	Ga0500639_002503
4277	Ga0500639_028090
4278	Ga0500639_096985
4279	Ga0500636_0224274
4280	Ga0500636_0238451
4281	Ga0500570_086394
4282	Ga0500576_027874
4283	Ga0500611_075707
4284	Ga0500657_031862
4285	Ga0500645_010662
4286	Ga0500596_002137
4287	Ga0500601_001931
4288	Ga0501084_0270777
4289	Ga0501084_1098731
4290	Ga0590074_090061
4291	Ga0590075_031488
4292	Ga0501082_1921878
4293	Ga0466962_0020422
4294	Ga0530510_0060430
4295	Ga0530510_0253426
4296	2507511625
4297	2508540367
4298	2513706296
4299	2517407523
4300	2517411700
4301	2524542669
4302	2524542685
4303	2617379845
4304	2617379905
4305	2617382528
4306	2805917807
4307	2824780971
4308	2856357377
4309	2857515281
4310	2857537751
4311	2881369056
4312	2881666703
4313	2881666706
4314	2885370908
4315	2885414184
4316	2889041514
4317	2889310342
4318	2904693887
4319	2904707725
4320	2932800207
4321	2935683943
4322	2941546410
4323	2961130649
4324	8005316270
4325	8006933869
4326	8006936266
4327	8006936763
4328	8006937849
4329	8006938564
4330	8006939934
4331	8006943413
4332	8006943431
4333	8006971383
4334	8006974034
4335	8006976232
4336	8006977955
4337	8006981616
4338	8006983542
4339	8006983666
4340	8006983686
4341	8016617201
4342	8018130346
4343	8019585402
4344	8019598089
4345	8019610293
4346	8019648864
4347	8019653918
4348	8056683043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05717

TnpB_IS66

IS66 Orf2 like protein

8

107

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7d5s-assembly1.cif.gz_A5	cryo-em structure of 90s preribosome with inactive utp24 (state a2)	0.7529	45	73
1s4u-assembly1.cif.gz_X	crystal structure analysis of the beta-propeller protein ski8p	0.7301	40	72
7bup-assembly1.cif.gz_A	crystal structure of pcna from pathogenic yeast candida albicans	0.66	45	78
2w8b-assembly1.cif.gz_A	crystal structure of processed tolb in complex with pal	0.6494	45	74
6f92-assembly2.cif.gz_C	structure of the family gh92 alpha-mannosidase bt3965 from bacteroides thetaiotaomicron in complex with mannoimidazole (mani)	0.6462	41	68

ID	Description	Score	Start	End	Superfamily
af_A0A0P0XJ39_39_298_2.120.10.80	Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller	0.8037	42	68	2.120.10.80
af_Q4D9F6_1150_1429_2.130.10.10	Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase	0.7872	43	70	2.130.10.10
af_Q9P7E9_125_559_2.140.10.30	Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Dipeptidylpeptidase IV, N-terminal domain	0.7836	43	75	2.140.10.30
af_I1LCJ2_2_276_2.130.10.10	Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase	0.7345	45	70	2.130.10.10
af_Q24314_1_310_2.130.10.10	Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase	0.7288	43	75	2.130.10.10

ID	Description	Score	Start	End	GO Terms
AF-A0A4U9INZ4-F1-model_v4	Probable siderophore transport system ATP-binding protein YusV	0.7849	1	115	GO:0005524 GO:0006826 GO:0016887
AF-A0A4U9INZ4-F1-model_v4	Probable siderophore transport system ATP-binding protein YusV	0.779	1	115	GO:0005524 GO:0006826 GO:0016887
AF-A0A0W1APD7-F1-model_v4	IS66 Orf2 like protein	0.7765	8	75	GO:0016020
AF-A0A1I0C348-F1-model_v4	Transposase	0.7611	9	103
AF-A0A0K1EDD8-F1-model_v4	Transposase	0.7552	5	74

F496507

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF05717

TnpB_IS66

IS66 Orf2 like protein

8

107

0.97

Structural Annotation

Top 5 Hits

Map