F496485

General Info

Members Datasets Scaffolds Average Seq Length
2160 776 1839 761

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221569|2643858499
Length 935
Sequence SDRQAALDYHEFPTPGKISVVASKPLVNQRDLALAYSPGVAAACEEIVADPSNVYRYTARGNLVGVISNGTAVLGLGNIGALASKPVMEGKAVLFKKFAGLDVFDIEINETDPXASKPVMEGKAVLFKKFAGLDVFDIEINETDPDXLVEIIAGLEATFGGINLEDIKAPECFTVERKLRERMKIPVFHDDQHGTAITVSAAFINGLKVVGKDIKQVKVVTSGAGAAALACLDLMVDLGLPLENIWVTDIEGVVYEGRTTLMDXXXXXXXXPGPDGRSGPAAGKHLGDRHRGRGLRRPHHADGPGQGALCAKDRRPQAGRGDSRRRRVPGPVGRRRAQAGNGRRXGLASADPGAGQPHAGNPAGSGARRARRXGDGHGPFGLSEPGQQRAVLPVHLPRRAGRGRHDHHARNGXXXXXXXXXXXVMATGRSDYPNQVNNVLCFPYIFRGALDVGATTITREMEMAAVHAIADLAEEEQNEVVAAAYGTYDISFGPEYLIPKPFDPRLIVRIAPAVAKAAMEGGVATRPLADLERIAPAVAKAAMEGGVATRPLADLEAYEEQLQQXVYHSGAFMKPLFSAAKRIVRSGGKARIVFTEGEDERVLRAVQVIVDEGLARPILVGRPAVLLSRIEKFGLRLRLGEDVEVTNPEYDERFHQYWTTYWELMSRRGITKEMARVEMRRRLTLIGAMMVHLGDADGMVCGTVGAYHDHLRFVDEVIGRRPGHNVYAAMNILLLDERTVVLVDTHVNDEPTAEQIAEFTIMAAQEMARMNLAPKVALLSRSNFGSGSSASGEKMRRALELVREAAPDLEIDGEMHGDCALDEGLRMRILPSSTLKGEANLLVCPNVDSGNIAYNLLQRRGGSVPAGRQCPRAHPDQQLHRAPHHQHDGHDGARRQPHRRRLSALQPAARTARTRQCAPLLTEPARIFLGVSGQA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
17 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
18 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
19 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
20 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
21 2519103095 Burkholderia sp. KJ006 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
24 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
25 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
26 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
27 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
28 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
29 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
30 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
31 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
32 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
33 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
34 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
35 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
36 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
37 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
38 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
39 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
40 2643221556 Massilia sp. Root1485 Isolate Unclassified
41 2643221568 Rhizobium sp. Root564 Isolate Unclassified
42 2643221569 Achromobacter sp. Root565 Isolate Unclassified
43 2643221580 Devosia sp. Root635 Isolate Unclassified
44 2643221584 Caulobacter sp. Root656 Isolate Unclassified
45 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
46 2643221591 Devosia sp. Root685 Isolate Unclassified
47 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
48 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
49 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
50 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
51 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
52 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
53 2643221660 Methylibium sp. Root1272 Isolate Unclassified
54 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
55 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
56 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
57 2643221674 Devosia sp. Root436 Isolate Unclassified
58 2643221684 Massilia sp. Root133 Isolate Unclassified
59 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
60 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
61 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
62 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
63 2721755523 Delftia sp. HK171 Isolate Unclassified
64 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
65 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
66 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
67 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
68 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
69 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
70 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
71 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
72 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
73 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
74 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
75 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
76 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
77 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
78 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
79 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
80 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
81 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
82 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
83 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
84 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
85 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
86 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
87 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
88 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
89 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
90 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
91 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
92 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
93 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
94 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
95 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
96 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
97 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
98 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
99 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
100 2818991436 Collimonas arenae 515 Isolate Unclassified
101 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
102 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
103 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
104 2818991450 Burkholderia sp. 604 Isolate Unclassified
105 2818991452 Burkholderia cepacia 561 Isolate Unclassified
106 2818991467 Bosea vestrisii 3192 Isolate Unclassified
107 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
108 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
109 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
110 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
111 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
112 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
113 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
114 2842694124 Methylopila sp. R-72369 Isolate Unclassified
115 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
116 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
117 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
118 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
119 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
120 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
121 2855730933 Achromobacter sp. HZ28 Isolate Nodule
122 2855767633 Achromobacter sp. HZ34 Isolate Nodule
123 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
124 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
125 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
126 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
127 2858950400 Achromobacter sp. K91 Isolate Unclassified
128 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
129 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
130 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
131 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
132 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
133 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
134 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
135 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
136 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
137 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
138 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
139 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
140 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
141 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
142 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
143 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
144 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
145 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
146 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
147 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
148 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
149 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
150 2904564687 Burkholderia sp. 571 Isolate Unclassified
151 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
152 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
153 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
154 2904699407
155 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
156 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
157 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
158 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
159 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
160 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
161 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
162 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
163 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
164 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
165 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
166 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
167 2928163908 Burkholderia sp. 567 Isolate Unclassified
168 2928170801 Burkholderia sp. 572 Isolate Unclassified
169 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
170 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
171 2928536128 Burkholderia sola 565 Isolate Unclassified
172 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
173 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
174 2932401849 Devosia sp. 2618 Isolate Rhizosphere
175 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
176 2941479691
177 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
178 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
179 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
180 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
181 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
182 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
183 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
184 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
185 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
186 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
187 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
188 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
189 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
190 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
191 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
192 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
193 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
194 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
195 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
196 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
197 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
198 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
199 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
200 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
201 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
202 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
203 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
204 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
206 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
207 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
208 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
209 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
210 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
211 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
212 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
213 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
214 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
215 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
216 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
217 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
218 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
219 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
220 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
221 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
222 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
223 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
224 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
225 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
226 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
227 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
228 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
229 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
230 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
231 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
232 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
233 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
234 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
235 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
236 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
237 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
238 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
239 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
240 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
241 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
242 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
243 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
244 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
245 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
246 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
247 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
248 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
249 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
250 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
251 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
252 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
253 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
254 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
255 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
256 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
257 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
258 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
259 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
260 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
261 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
262 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
263 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
264 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
265 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
266 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
267 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
268 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
269 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
270 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
271 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
272 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
273 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
274 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
275 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
276 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
277 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
278 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
279 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
280 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
281 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
282 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
283 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
284 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
285 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
286 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
287 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
288 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
289 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
290 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
291 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
292 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
293 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
294 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
295 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
296 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
297 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
298 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
299 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
300 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
301 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
302 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
303 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
304 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
305 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
306 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
307 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
308 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
309 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
310 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
311 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
312 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
313 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
314 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
315 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
316 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
317 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
318 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
319 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
320 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
321 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
322 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
323 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
324 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
325 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
326 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
327 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
328 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
329 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
330 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
331 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
332 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
333 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
334 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
335 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
336 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
337 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
338 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
339 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
340 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
341 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
342 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
343 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
344 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
345 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
346 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
347 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
348 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
349 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
350 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
351 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
352 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
354 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
356 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
357 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
358 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
359 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
360 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
362 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
363 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
364 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
367 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
368 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
369 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
370 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
371 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
372 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
373 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
374 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
375 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
376 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
377 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
378 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
379 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
380 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
381 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
382 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
438 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
442 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
448 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
449 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
450 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
452 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
453 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
455 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
457 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
458 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
459 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
460 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
461 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
462 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
463 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
464 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
465 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
466 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
467 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
468 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
469 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
470 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
471 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
472 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
473 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
474 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
475 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
476 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
477 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
478 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
479 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
480 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
481 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
482 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
483 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
484 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
485 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
486 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
487 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
488 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
489 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
490 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
491 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
492 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
493 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
494 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
495 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
496 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
497 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
498 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
499 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
500 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
501 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
502 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
503 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
504 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
505 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
506 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
507 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
508 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
509 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
510 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
511 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
512 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
513 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
514 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
515 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
516 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
517 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
518 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
519 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
520 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
521 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
522 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
523 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
524 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
525 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
526 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
527 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
528 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
529 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
530 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
531 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
532 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
533 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
534 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
535 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
536 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
537 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
538 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
539 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
540 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
541 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
542 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
543 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
544 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
545 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
546 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
547 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
548 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
549 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
550 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
551 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
552 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
553 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
554 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
555 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
556 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
557 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
558 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
559 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
560 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
561 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
562 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
563 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
564 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
565 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
566 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
567 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
568 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
569 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
570 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
571 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
572 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
573 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
574 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
575 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
576 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
577 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
578 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
579 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
580 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
581 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
582 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
583 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
584 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
585 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
586 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
587 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
588 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
589 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
590 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
591 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
592 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
593 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
594 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
595 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
596 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
597 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
598 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
599 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
600 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
601 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
602 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
603 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
604 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
605 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
606 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
607 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
608 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
609 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
610 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
611 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
612 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
613 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
614 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
615 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
616 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
617 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
618 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
619 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
620 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
621 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
622 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
623 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
624 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
625 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
626 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
627 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
628 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
629 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
630 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
631 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
632 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
633 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
634 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
635 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
636 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
637 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
638 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
639 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
640 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
641 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
642 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
643 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
644 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
645 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
646 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
647 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
648 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
649 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
650 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
651 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
652 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
653 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
654 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
655 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
656 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
657 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
658 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
659 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
660 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
661 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
662 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
663 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
664 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
665 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
666 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
667 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
668 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
669 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
670 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
671 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
672 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
673 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
674 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
675 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
676 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
677 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
678 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
679 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
680 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
681 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
682 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
683 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
684 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
685 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
686 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
687 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
688 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
689 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
690 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
691 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
692 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
693 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
694 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
695 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
696 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
697 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
698 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
699 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
700 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
701 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
702 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
703 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
704 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
705 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
706 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
707 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
708 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
709 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
710 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
711 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
712 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
713 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
714 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
715 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
716 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
717 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
718 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
719 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
720 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
721 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
722 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
723 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
724 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
725 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
726 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
727 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
728 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
729 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
730 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
731 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
732 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
733 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
734 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
735 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
736 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
737 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
738 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
739 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
740 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
741 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
742 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
743 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
744 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
745 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
746 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
747 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
748 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
749 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
750 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
751 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
752 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
753 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
754 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
755 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
756 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
757 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
758 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
759 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
760 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
761 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
762 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
763 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
764 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
765 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
766 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
767 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
768 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
769 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
770 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
771 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
772 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
773 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
774 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
775 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
776 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.99
Metatranscriptomes 0.19
Isolates 14.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.05
Bulb 0
Endosphere 11.25
Nodule 2.5
Rhizoplane 4.03
Rhizosphere 67.13
Stem 0
Stem Tuber 0
Unclassified 15.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000971 3300001979 Bacteria 12778
2 JGI24739J22299_10001114 3300001989 Bacteria 10007
3 JGI24739J22299_10001476 3300001989 Bacteria 8868
4 JGI24739J22299_10003286 3300001989 Bacteria 6166
5 JGI24739J22299_10007181 3300001989 Bacteria 4192
6 JGI24739J22299_10010851 3300001989 Bacteria 3372
7 JGI24737J22298_10003825 3300001990 Bacteria 5294
8 JGI24737J22298_10006390 3300001990 Bacteria 4027
9 JGI24735J21928_10000203 3300002067 Bacteria 20917
10 JGI24735J21928_10000468 3300002067 Bacteria 14207
11 JGI24735J21928_10002113 3300002067 Bacteria 6999
12 JGI24735J21928_10010076 3300002067 Bacteria 3022
13 JGI24738J21930_10000490 3300002075 Bacteria 11240
14 JGI24749J21850_1001028 3300002076 Bacteria 3964
15 JGI24751J29686_10000213 3300002459 Bacteria 24710
16 JGI24751J29686_10000330 3300002459 Bacteria 17354
17 JGI25155J39150_1000045 3300002704 Bacteria 85779
18 JGI25156J39149_1000054 3300002705 Bacteria 88728
19 JGI25156J39149_1000476 3300002705 Bacteria 24132
20 JGI25156J39149_1001733 3300002705 Bacteria 8749
21 JGI25156J39149_1001764 3300002705 Bacteria 8590
22 JGI25156J39149_1002152 3300002705 Bacteria 7414
23 JGI25156J39149_1002790 3300002705 Bacteria 6051
24 JGI25162J39368_1000052 3300002737 Bacteria 152144
25 JGI25154J39366_1000083 3300002738 Bacteria 88728
26 JGI25154J39366_1001213 3300002738 Bacteria 9760
27 JGI25157J39369_1000500 3300002741 Bacteria 24132
28 JGI25157J39369_1001737 3300002741 Bacteria 7205
29 JGI25150J39212_1000851 3300002774 Bacteria 10164
30 JGI25151J46595_10000951 3300003187 Bacteria 22273
31 JGI25151J46595_10012126 3300003187 Bacteria 3929
32 JGI25151J46595_10014888 3300003187 Bacteria 3452
33 JGI25165J46597_1000050 3300003214 Bacteria 242776
34 JGI25165J46597_1000105 3300003214 Bacteria 152144
35 JGI25165J46597_1001543 3300003214 Bacteria 11440
36 JGI25165J46597_1002345 3300003214 Bacteria 6368
37 JGI25153J46596_10000188 3300003215 Bacteria 59827
38 JGI25153J46596_10000208 3300003215 Bacteria 53467
39 JGI25153J46596_10000255 3300003215 Bacteria 43499
40 JGI25153J46596_10000792 3300003215 Bacteria 19361
41 JGI25153J46596_10003194 3300003215 Bacteria 9211
42 JGI25160J50197_1000104 3300003354 Bacteria 80721
43 JGI25160J50197_1000267 3300003354 Bacteria 39167
44 JGI25160J50197_1004594 3300003354 Bacteria 5942
45 Ga0007409J51694_1011996 3300003575 Bacteria 2715
46 Ga0032354_1017829 3300003693 Bacteria 3058
47 Ga0055538_1000043 3300003751 Bacteria 152144
48 Ga0055539_1000057 3300003752 Bacteria 152144
49 Ga0055539_1000493 3300003752 Bacteria 12633
50 Ga0055539_1001124 3300003752 Bacteria 5543
51 Ga0055533_1000016 3300003756 Bacteria 396179
52 Ga0055533_1000071 3300003756 Bacteria 152144
53 Ga0055533_1000339 3300003756 Bacteria 20510
54 Ga0055533_1000680 3300003756 Bacteria 11160
55 Ga0055533_1000760 3300003756 Bacteria 10283
56 Ga0055532_1000043 3300003758 Bacteria 195042
57 Ga0055532_1000099 3300003758 Bacteria 93811
58 Ga0055532_1000236 3300003758 Bacteria 40700
59 Ga0055532_1000239 3300003758 Bacteria 40306
60 Ga0055532_1000269 3300003758 Bacteria 33980
61 Ga0055525_1000009 3300003759 Bacteria 596899
62 Ga0055525_1000085 3300003759 Bacteria 152144
63 Ga0055525_1001460 3300003759 Bacteria 4212
64 Ga0055527_1000026 3300003760 Bacteria 192398
65 Ga0055527_1000228 3300003760 Bacteria 35654
66 Ga0055535_1000032 3300003761 Bacteria 195042
67 Ga0055535_1000288 3300003761 Bacteria 53313
68 Ga0055535_1000489 3300003761 Bacteria 35654
69 Ga0055535_1001027 3300003761 Bacteria 17706
70 Ga0055542_1000049 3300003762 Bacteria 195042
71 Ga0055542_1000258 3300003762 Bacteria 59741
72 Ga0055529_1000059 3300003763 Bacteria 195042
73 Ga0055529_1000191 3300003763 Bacteria 83946
74 Ga0055529_1000214 3300003763 Bacteria 76244
75 Ga0055529_1002100 3300003763 Bacteria 4250
76 Ga0055526_1000154 3300003771 Bacteria 60968
77 Ga0055526_1003684 3300003771 Bacteria 9582
78 Ga0055524_1000522 3300003775 Bacteria 29555
79 Ga0055536_1000860 3300003781 Bacteria 19867
80 Ga0055536_1013037 3300003781 Bacteria 3031
81 Ga0055530_10000659 3300003791 Bacteria 29515
82 Ga0055530_10003389 3300003791 Bacteria 9103
83 Ga0055530_10008159 3300003791 Bacteria 4245
84 Ga0055540_1000026 3300003792 Bacteria 189071
85 Ga0055540_1003940 3300003792 Bacteria 6937
86 Ga0055531_10000083 3300003794 Bacteria 102626
87 Ga0055531_10002397 3300003794 Bacteria 12588
88 Ga0055531_10007304 3300003794 Bacteria 6056
89 Ga0055531_10014584 3300003794 Bacteria 3529
90 Ga0055541_1000044 3300003841 Bacteria 152144
91 Ga0058692_1000001 3300003856 Bacteria 834230
92 Ga0058692_1002636 3300003856 Bacteria 5907
93 Ga0058692_1004364 3300003856 Bacteria 4204
94 Ga0065165_1000332 3300005262 Bacteria 77148
95 Ga0065165_1000606 3300005262 Bacteria 52303
96 Ga0065165_1002458 3300005262 Bacteria 15657
97 Ga0065165_1007908 3300005262 Bacteria 5100
98 Ga0065165_1009752 3300005262 Bacteria 4249
99 Ga0065703_1000513 3300005272 Bacteria 19681
100 Ga0065714_10003428 3300005288 Bacteria 8315
101 Ga0065704_10002614 3300005289 Bacteria 6466
102 Ga0065704_10005595 3300005289 Bacteria 3541
103 Ga0065704_10070157 3300005289 Bacteria 211668
104 Ga0065707_10098738 3300005295 Bacteria 3062
105 Ga0070658_10000566 3300005327 Bacteria 32179
106 Ga0070658_10000735 3300005327 Bacteria 28153
107 Ga0070658_10001161 3300005327 Bacteria 22492
108 Ga0070658_10012516 3300005327 Bacteria 6806
109 Ga0070658_10018442 3300005327 Bacteria 5586
110 Ga0070658_10076069 3300005327 Bacteria 2754
111 Ga0070676_10007686 3300005328 Bacteria 5787
112 Ga0070683_100003533 3300005329 Bacteria 12724
113 Ga0070690_100018345 3300005330 Bacteria 4225
114 Ga0070690_100037936 3300005330 Bacteria 3038
115 Ga0070670_100000024 3300005331 Bacteria 189811
116 Ga0070670_100000846 3300005331 Bacteria 23930
117 Ga0070670_100003772 3300005331 Bacteria 12620
118 Ga0070670_100003950 3300005331 Bacteria 12373
119 Ga0070670_100005989 3300005331 Bacteria 10289
120 Ga0070670_100014240 3300005331 Bacteria 6822
121 Ga0070670_100018562 3300005331 Bacteria 5963
122 Ga0070670_100027325 3300005331 Bacteria 4908
123 Ga0068869_100001073 3300005334 Bacteria 15971
124 Ga0070666_10004823 3300005335 Bacteria 8249
125 Ga0070666_10006186 3300005335 Bacteria 7363
126 Ga0070666_10017161 3300005335 Bacteria 4639
127 Ga0070666_10018126 3300005335 Bacteria 4522
128 Ga0068868_100000281 3300005338 Bacteria 34228
129 Ga0068868_100001743 3300005338 Bacteria 14916
130 Ga0068868_100002281 3300005338 Bacteria 13257
131 Ga0068868_100042366 3300005338 Bacteria 3553
132 Ga0068868_100049061 3300005338 Bacteria 3313
133 Ga0070660_100000006 3300005339 Bacteria 166714
134 Ga0070660_100000023 3300005339 Bacteria 96867
135 Ga0070660_100002602 3300005339 Bacteria 12390
136 Ga0070660_100003622 3300005339 Bacteria 10670
137 Ga0070660_100006110 3300005339 Bacteria 8329
138 Ga0070660_100021354 3300005339 Bacteria 4774
139 Ga0070660_100033708 3300005339 Bacteria 3862
140 Ga0070660_100044701 3300005339 Bacteria 3388
141 Ga0070660_100047529 3300005339 Bacteria 3293
142 Ga0070689_100001641 3300005340 Bacteria 14310
143 Ga0070689_100015185 3300005340 Bacteria 5611
144 Ga0070661_100000592 3300005344 Bacteria 27294
145 Ga0070661_100000837 3300005344 Bacteria 22128
146 Ga0070661_100018306 3300005344 Bacteria 4979
147 Ga0070661_100022042 3300005344 Bacteria 4558
148 Ga0070661_100034982 3300005344 Bacteria 3645
149 Ga0070668_100000001 3300005347 Bacteria 275905
150 Ga0070668_100000227 3300005347 Bacteria 36436
151 Ga0070668_100001203 3300005347 Bacteria 18365
152 Ga0070668_100002004 3300005347 Bacteria 14887
153 Ga0070668_100007593 3300005347 Bacteria 8049
154 Ga0070668_100077069 3300005347 Bacteria 2606
155 Ga0070669_100000031 3300005353 Bacteria 154042
156 Ga0070669_100000074 3300005353 Bacteria 99054
157 Ga0070669_100000514 3300005353 Bacteria 29157
158 Ga0070669_100003560 3300005353 Bacteria 11243
159 Ga0070675_100001529 3300005354 Bacteria 17099
160 Ga0070675_100017118 3300005354 Bacteria 5760
161 Ga0070675_100028246 3300005354 Bacteria 4515
162 Ga0070675_100057964 3300005354 Bacteria 3194
163 Ga0070671_100000067 3300005355 Bacteria 70750
164 Ga0070671_100000227 3300005355 Bacteria 37559
165 Ga0070671_100002546 3300005355 Bacteria 14125
166 Ga0070671_100006639 3300005355 Bacteria 9248
167 Ga0070671_100044759 3300005355 Bacteria 3678
168 Ga0070674_100009642 3300005356 Bacteria 5791
169 Ga0070674_100024092 3300005356 Bacteria 3948
170 Ga0070673_100000005 3300005364 Bacteria 193513
171 Ga0070673_100004435 3300005364 Bacteria 8881
172 Ga0070673_100008324 3300005364 Bacteria 6889
173 Ga0070673_100015207 3300005364 Bacteria 5396
174 Ga0070673_100015287 3300005364 Bacteria 5385
175 Ga0070659_100000116 3300005366 Bacteria 59531
176 Ga0070659_100000124 3300005366 Bacteria 58501
177 Ga0070659_100000201 3300005366 Bacteria 46212
178 Ga0070659_100001218 3300005366 Bacteria 18683
179 Ga0070659_100005141 3300005366 Bacteria 9381
180 Ga0070659_100023601 3300005366 Bacteria 4709
181 Ga0070659_100029780 3300005366 Bacteria 4220
182 Ga0070667_100000006 3300005367 Bacteria 336732
183 Ga0070667_100000058 3300005367 Bacteria 148071
184 Ga0070667_100000131 3300005367 Bacteria 94986
185 Ga0070667_100000194 3300005367 Bacteria 72751
186 Ga0070667_100000696 3300005367 Bacteria 32392
187 Ga0070667_100001024 3300005367 Bacteria 25540
188 Ga0070667_100008710 3300005367 Bacteria 8412
189 Ga0070667_100031745 3300005367 Bacteria 4403
190 Ga0070709_10000495 3300005434 Bacteria 23229
191 Ga0070709_10001252 3300005434 Bacteria 13895
192 Ga0070714_100011338 3300005435 Bacteria 7070
193 Ga0070714_100077463 3300005435 Bacteria 2888
194 Ga0070713_100000028 3300005436 Bacteria 93227
195 Ga0070713_100000199 3300005436 Bacteria 40083
196 Ga0070713_100055093 3300005436 Bacteria 3302
197 Ga0070711_100014808 3300005439 Bacteria 4924
198 Ga0070694_100043865 3300005444 Bacteria 2992
199 Ga0070708_100001610 3300005445 Bacteria 17318
200 Ga0070663_100000037 3300005455 Bacteria 62561
201 Ga0070663_100000208 3300005455 Bacteria 29470
202 Ga0070663_100000573 3300005455 Bacteria 19678
203 Ga0070663_100001628 3300005455 Bacteria 12395
204 Ga0070663_100003869 3300005455 Bacteria 8720
205 Ga0070678_100002072 3300005456 Bacteria 10877
206 Ga0070678_100014367 3300005456 Bacteria 4994
207 Ga0070678_100024188 3300005456 Bacteria 4061
208 Ga0070678_100036590 3300005456 Bacteria 3437
209 Ga0070678_100051267 3300005456 Bacteria 2990
210 Ga0070662_100013422 3300005457 Bacteria 5452
211 Ga0070662_100016824 3300005457 Bacteria 4916
212 Ga0070662_100040530 3300005457 Bacteria 3316
213 Ga0070681_10000372 3300005458 Bacteria 36177
214 Ga0070681_10059401 3300005458 Bacteria 3803
215 Ga0068867_100000060 3300005459 Bacteria 67750
216 Ga0068867_100008662 3300005459 Bacteria 7183
217 Ga0070685_10007836 3300005466 Bacteria 5468
218 Ga0070698_100050013 3300005471 Bacteria 4264
219 Ga0070699_100021709 3300005518 Bacteria 5535
220 Ga0070684_100027456 3300005535 Bacteria 4805
221 Ga0068853_100000191 3300005539 Bacteria 43207
222 Ga0068853_100002411 3300005539 Bacteria 13964
223 Ga0068853_100028257 3300005539 Bacteria 4716
224 Ga0070672_100001173 3300005543 Bacteria 16022
225 Ga0070672_100016431 3300005543 Bacteria 5300
226 Ga0070672_100021796 3300005543 Bacteria 4692
227 Ga0070672_100022902 3300005543 Bacteria 4597
228 Ga0070672_100037274 3300005543 Bacteria 3709
229 Ga0070695_100007483 3300005545 Bacteria 6468
230 Ga0070693_100014121 3300005547 Bacteria 4084
231 Ga0070665_100005303 3300005548 Bacteria 13314
232 Ga0070665_100025412 3300005548 Bacteria 5968
233 Ga0070665_100050632 3300005548 Bacteria 4168
234 Ga0068855_100000027 3300005563 Bacteria 173316
235 Ga0068855_100000994 3300005563 Bacteria 35284
236 Ga0068855_100003343 3300005563 Bacteria 19633
237 Ga0068855_100013427 3300005563 Bacteria 9876
238 Ga0068855_100015117 3300005563 Bacteria 9294
239 Ga0068855_100015678 3300005563 Bacteria 9118
240 Ga0068855_100026853 3300005563 Bacteria 6889
241 Ga0068855_100067159 3300005563 Bacteria 4179
242 Ga0068855_100115023 3300005563 Bacteria 3084
243 Ga0070664_100001898 3300005564 Bacteria 16789
244 Ga0070664_100002779 3300005564 Bacteria 14126
245 Ga0070664_100017230 3300005564 Bacteria 5932
246 Ga0070664_100032296 3300005564 Bacteria 4378
247 Ga0070664_100050844 3300005564 Bacteria 3508
248 Ga0068857_100050850 3300005577 Bacteria 3676
249 Ga0068854_100000235 3300005578 Bacteria 37775
250 Ga0068854_100029383 3300005578 Bacteria 3805
251 Ga0068856_100009449 3300005614 Bacteria 9469
252 Ga0068856_100012193 3300005614 Bacteria 8328
253 Ga0068856_100015097 3300005614 Bacteria 7462
254 Ga0068856_100051578 3300005614 Bacteria 4056
255 Ga0068856_100096786 3300005614 Bacteria 2940
256 Ga0070702_100008248 3300005615 Bacteria 5035
257 Ga0070702_100011674 3300005615 Bacteria 4375
258 Ga0068852_100000657 3300005616 Bacteria 22644
259 Ga0068852_100007366 3300005616 Bacteria 8027
260 Ga0068852_100009211 3300005616 Bacteria 7315
261 Ga0068859_100010558 3300005617 Bacteria 9297
262 Ga0068859_100013432 3300005617 Bacteria 8211
263 Ga0068859_100025589 3300005617 Bacteria 5920
264 Ga0068859_100057270 3300005617 Bacteria 3925
265 Ga0068864_100000036 3300005618 Bacteria 189811
266 Ga0068864_100001927 3300005618 Bacteria 17038
267 Ga0068864_100014646 3300005618 Bacteria 6514
268 Ga0068864_100043852 3300005618 Bacteria 3831
269 Ga0068866_10007452 3300005718 Bacteria 4582
270 Ga0068861_100018764 3300005719 Bacteria 4931
271 Ga0068851_10002400 3300005834 Bacteria 8222
272 Ga0068863_100000031 3300005841 Bacteria 175602
273 Ga0068863_100001101 3300005841 Bacteria 27006
274 Ga0068863_100013084 3300005841 Bacteria 8005
275 Ga0068863_100024589 3300005841 Bacteria 5744
276 Ga0068863_100036311 3300005841 Bacteria 4694
277 Ga0068863_100038522 3300005841 Bacteria 4548
278 Ga0068863_100042503 3300005841 Bacteria 4318
279 Ga0068863_100061588 3300005841 Bacteria 3548
280 Ga0068858_100000365 3300005842 Bacteria 47618
281 Ga0068858_100000473 3300005842 Bacteria 41857
282 Ga0068858_100004425 3300005842 Bacteria 13781
283 Ga0068858_100017989 3300005842 Bacteria 6619
284 Ga0068860_100000013 3300005843 Bacteria 323055
285 Ga0068860_100000258 3300005843 Bacteria 77761
286 Ga0068860_100000260 3300005843 Bacteria 77214
287 Ga0068860_100000723 3300005843 Bacteria 37579
288 Ga0068860_100010515 3300005843 Bacteria 9150
289 Ga0068860_100025866 3300005843 Bacteria 5661
290 Ga0068860_100046818 3300005843 Bacteria 4123
291 Ga0068862_100000043 3300005844 Bacteria 164356
292 Ga0068862_100001261 3300005844 Bacteria 23799
293 Ga0081455_10000307 3300005937 Bacteria 64591
294 Ga0081455_10022956 3300005937 Bacteria 5817
295 Ga0081455_10094098 3300005937 Bacteria 2421
296 Ga0081540_1000094 3300005983 Bacteria 93201
297 Ga0081540_1000987 3300005983 Bacteria 25640
298 Ga0081540_1002431 3300005983 Bacteria 15164
299 Ga0075365_10040255 3300006038 Bacteria 3047
300 Ga0075368_10000132 3300006042 Bacteria 19662
301 Ga0075368_10000888 3300006042 Bacteria 9287
302 Ga0075364_10000226 3300006051 Bacteria 26679
303 Ga0075364_10001318 3300006051 Bacteria 13361
304 Ga0075364_10007698 3300006051 Bacteria 6410
305 Ga0075364_10016097 3300006051 Bacteria 4647
306 Ga0075364_10028353 3300006051 Bacteria 3584
307 Ga0075432_10001235 3300006058 Bacteria 8235
308 Ga0075432_10003028 3300006058 Bacteria 5670
309 Ga0070716_100002827 3300006173 Bacteria 8075
310 Ga0070712_100004813 3300006175 Bacteria 8344
311 Ga0075362_10000132 3300006177 Bacteria 20486
312 Ga0075362_10005335 3300006177 Bacteria 4698
313 Ga0075362_10007202 3300006177 Bacteria 4197
314 Ga0075367_10010720 3300006178 Bacteria 4826
315 Ga0075369_10010589 3300006186 Bacteria 3610
316 Ga0075366_10000070 3300006195 Bacteria 39329
317 Ga0075366_10009735 3300006195 Bacteria 5373
318 Ga0097621_100003706 3300006237 Bacteria 10577
319 Ga0097621_100014295 3300006237 Bacteria 5936
320 Ga0075370_10000009 3300006353 Bacteria 97850
321 Ga0075370_10030519 3300006353 Bacteria 3008
322 Ga0068871_100007836 3300006358 Bacteria 7651
323 Ga0068871_100027303 3300006358 Bacteria 4464
324 Ga0075428_100002690 3300006844 Bacteria 19328
325 Ga0075428_100087642 3300006844 Bacteria 3395
326 Ga0075428_100134112 3300006844 Bacteria 2693
327 Ga0075428_100139217 3300006844 Bacteria 2638
328 Ga0075430_100003188 3300006846 Bacteria 13747
329 Ga0075430_100023804 3300006846 Bacteria 5215
330 Ga0075431_100013027 3300006847 Bacteria 8398
331 Ga0075431_100029825 3300006847 Bacteria 5617
332 Ga0075433_10006239 3300006852 Bacteria 9405
333 Ga0075433_10026503 3300006852 Bacteria 4908
334 Ga0075433_10059534 3300006852 Bacteria 3341
335 Ga0075434_100014179 3300006871 Bacteria 7615
336 Ga0075434_100044404 3300006871 Bacteria 4409
337 Ga0075434_100120654 3300006871 Bacteria 2637
338 Ga0075429_100002409 3300006880 Bacteria 15756
339 Ga0068865_100000027 3300006881 Bacteria 92272
340 Ga0075436_100001475 3300006914 Bacteria 16015
341 Ga0075436_100007361 3300006914 Bacteria 7524
342 Ga0097620_100010558 3300006931 Bacteria 9297
343 Ga0097620_100013432 3300006931 Bacteria 8211
344 Ga0097620_100025585 3300006931 Bacteria 5920
345 Ga0097620_100057274 3300006931 Bacteria 3925
346 Ga0079104_1000003 3300006946 Bacteria 468966
347 Ga0079104_1000093 3300006946 Bacteria 130633
348 Ga0075435_100008278 3300007076 Bacteria 7452
349 Ga0075435_100013166 3300007076 Bacteria 6145
350 Ga0099795_10000021 3300007788 Bacteria 58184
351 Ga0105251_10000438 3300009011 Bacteria 40380
352 Ga0105244_10035875 3300009036 Bacteria 2602
353 Ga0105250_10000007 3300009092 Bacteria 355249
354 Ga0105250_10001839 3300009092 Bacteria 11080
355 Ga0105250_10004552 3300009092 Bacteria 6357
356 Ga0105240_10000005 3300009093 Bacteria 702630
357 Ga0105240_10000561 3300009093 Bacteria 68725
358 Ga0105240_10001611 3300009093 Bacteria 38282
359 Ga0105240_10003101 3300009093 Bacteria 26140
360 Ga0105240_10005517 3300009093 Bacteria 18847
361 Ga0105240_10013623 3300009093 Bacteria 11152
362 Ga0105240_10017908 3300009093 Bacteria 9529
363 Ga0105240_10021651 3300009093 Bacteria 8547
364 Ga0105240_10043148 3300009093 Bacteria 5741
365 Ga0105240_10062533 3300009093 Bacteria 4634
366 Ga0111539_10003535 3300009094 Bacteria 20606
367 Ga0111539_10005226 3300009094 Bacteria 16818
368 Ga0111539_10008156 3300009094 Bacteria 13342
369 Ga0111539_10044630 3300009094 Bacteria 5309
370 Ga0105245_10007808 3300009098 Bacteria 9372
371 Ga0105247_10000097 3300009101 Bacteria 94693
372 Ga0105247_10011653 3300009101 Bacteria 5297
373 Ga0105247_10014838 3300009101 Bacteria 4670
374 Ga0114129_10062820 3300009147 Bacteria 5187
375 Ga0114129_10171737 3300009147 Bacteria 2955
376 Ga0105243_10000010 3300009148 Bacteria 316672
377 Ga0105243_10001080 3300009148 Bacteria 24964
378 Ga0105243_10022885 3300009148 Bacteria 4751
379 Ga0105241_10003135 3300009174 Bacteria 12296
380 Ga0105241_10009136 3300009174 Bacteria 7295
381 Ga0105241_10016328 3300009174 Bacteria 5443
382 Ga0105241_10022241 3300009174 Bacteria 4694
383 Ga0105241_10024080 3300009174 Bacteria 4521
384 Ga0105242_10001166 3300009176 Bacteria 20694
385 Ga0105242_10067120 3300009176 Bacteria 2964
386 Ga0105248_10000081 3300009177 Bacteria 111105
387 Ga0105248_10002960 3300009177 Bacteria 18821
388 Ga0105248_10009104 3300009177 Bacteria 10923
389 Ga0105248_10009634 3300009177 Bacteria 10638
390 Ga0105248_10012212 3300009177 Bacteria 9474
391 Ga0105248_10024337 3300009177 Bacteria 6733
392 Ga0105248_10031465 3300009177 Bacteria 5931
393 Ga0105248_10058266 3300009177 Bacteria 4337
394 Ga0105248_10083150 3300009177 Bacteria 3601
395 Ga0105248_10084550 3300009177 Bacteria 3569
396 Ga0105237_10000080 3300009545 Bacteria 127788
397 Ga0105237_10004913 3300009545 Bacteria 15297
398 Ga0105237_10005428 3300009545 Bacteria 14395
399 Ga0105237_10007415 3300009545 Bacteria 12012
400 Ga0105237_10010204 3300009545 Bacteria 10008
401 Ga0105237_10023002 3300009545 Bacteria 6392
402 Ga0105237_10029017 3300009545 Bacteria 5627
403 Ga0105237_10036787 3300009545 Bacteria 4952
404 Ga0105237_10037225 3300009545 Bacteria 4919
405 Ga0105237_10041119 3300009545 Bacteria 4663
406 Ga0105237_10053923 3300009545 Bacteria 4030
407 Ga0105237_10083663 3300009545 Bacteria 3182
408 Ga0105237_10090584 3300009545 Bacteria 3047
409 Ga0105238_10000711 3300009551 Bacteria 34783
410 Ga0105238_10015627 3300009551 Bacteria 7682
411 Ga0105238_10015923 3300009551 Bacteria 7607
412 Ga0105238_10024875 3300009551 Bacteria 6103
413 Ga0105238_10047712 3300009551 Bacteria 4318
414 Ga0105238_10093068 3300009551 Bacteria 3002
415 Ga0105249_10001718 3300009553 Bacteria 19154
416 Ga0105249_10008122 3300009553 Bacteria 9151
417 Ga0099796_10000016 3300010159 Bacteria 50556
418 Ga0105239_10000116 3300010375 Bacteria 112811
419 Ga0105239_10002739 3300010375 Bacteria 22132
420 Ga0105239_10005130 3300010375 Bacteria 15462
421 Ga0105239_10005717 3300010375 Bacteria 14524
422 Ga0105239_10009649 3300010375 Bacteria 10855
423 Ga0105239_10018092 3300010375 Bacteria 7794
424 Ga0105239_10102154 3300010375 Bacteria 3173
425 Ga0105239_10120415 3300010375 Bacteria 2914
426 Ga0105239_10179877 3300010375 Bacteria 2366
427 Ga0157326_1000015 3300012513 Bacteria 15346
428 Ga0157373_10000764 3300013100 Bacteria 24891
429 Ga0157373_10006481 3300013100 Bacteria 8734
430 Ga0157373_10008381 3300013100 Bacteria 7680
431 Ga0157373_10009014 3300013100 Bacteria 7382
432 Ga0157371_10000938 3300013102 Bacteria 32583
433 Ga0157371_10002702 3300013102 Bacteria 16746
434 Ga0157371_10008751 3300013102 Bacteria 8030
435 Ga0157370_10000202 3300013104 Bacteria 75313
436 Ga0157370_10000762 3300013104 Bacteria 40264
437 Ga0157370_10001194 3300013104 Bacteria 32395
438 Ga0157370_10002001 3300013104 Bacteria 25039
439 Ga0157370_10002136 3300013104 Bacteria 24141
440 Ga0157370_10003220 3300013104 Bacteria 19274
441 Ga0157370_10003668 3300013104 Bacteria 17926
442 Ga0157370_10077158 3300013104 Bacteria 3139
443 Ga0157369_10000541 3300013105 Bacteria 49930
444 Ga0157369_10001147 3300013105 Bacteria 33050
445 Ga0157369_10002708 3300013105 Bacteria 21141
446 Ga0157369_10004159 3300013105 Bacteria 17143
447 Ga0157369_10018009 3300013105 Bacteria 7925
448 Ga0157369_10020943 3300013105 Bacteria 7310
449 Ga0157369_10022041 3300013105 Bacteria 7117
450 Ga0157369_10022845 3300013105 Bacteria 6974
451 Ga0157374_10000055 3300013296 Bacteria 120079
452 Ga0157374_10000099 3300013296 Bacteria 80415
453 Ga0157374_10001196 3300013296 Bacteria 22173
454 Ga0157374_10002745 3300013296 Bacteria 14790
455 Ga0157374_10013130 3300013296 Bacteria 7225
456 Ga0157374_10023573 3300013296 Bacteria 5507
457 Ga0157378_10002695 3300013297 Bacteria 15815
458 Ga0163162_10003958 3300013306 Bacteria 14211
459 Ga0163162_10008255 3300013306 Bacteria 10165
460 Ga0163162_10013481 3300013306 Bacteria 7980
461 Ga0163162_10021329 3300013306 Bacteria 6378
462 Ga0157372_10001396 3300013307 Bacteria 26027
463 Ga0157372_10005336 3300013307 Bacteria 13652
464 Ga0157372_10103510 3300013307 Bacteria 3253
465 Ga0157375_10005452 3300013308 Bacteria 11063
466 Ga0157375_10017231 3300013308 Bacteria 6514
467 Ga0157375_10019356 3300013308 Bacteria 6190
468 Ga0157375_10069835 3300013308 Bacteria 3520
469 Ga0157375_10132738 3300013308 Bacteria 2611
470 Ga0163163_10000012 3300014325 Bacteria 257369
471 Ga0163163_10000891 3300014325 Bacteria 25414
472 Ga0163163_10036611 3300014325 Bacteria 4768
473 Ga0163163_10087157 3300014325 Bacteria 3132
474 Ga0157380_10000150 3300014326 Bacteria 39792
475 Ga0157380_10036411 3300014326 Bacteria 3807
476 Ga0182008_10010083 3300014497 Bacteria 5069
477 Ga0157377_10000006 3300014745 Bacteria 419853
478 Ga0157379_10000427 3300014968 Bacteria 33957
479 Ga0157376_10000095 3300014969 Bacteria 66245
480 Ga0157376_10023011 3300014969 Bacteria 4869
481 Ga0157376_10040632 3300014969 Bacteria 3802
482 Ga0157376_10049411 3300014969 Bacteria 3483
483 Ga0182006_1009457 3300015261 Bacteria 4367
484 Ga0182007_10002498 3300015262 Bacteria 9095
485 Ga0182007_10003675 3300015262 Bacteria 7185
486 Ga0182005_1000573 3300015265 Bacteria 18172
487 Ga0183361_10001 3300016635 Bacteria 908583
488 Ga0183361_10012 3300016635 Bacteria 203395
489 Ga0163161_10000848 3300017792 Bacteria 23837
490 Ga0163161_10005217 3300017792 Bacteria 9040
491 Ga0213872_10000009 3300021361 Bacteria 221470
492 Ga0213872_10000033 3300021361 Bacteria 135667
493 Ga0213872_10000208 3300021361 Bacteria 52289
494 Ga0213872_10002496 3300021361 Bacteria 10760
495 Ga0213872_10003351 3300021361 Bacteria 8914
496 Ga0213872_10005862 3300021361 Bacteria 6237
497 Ga0213872_10010189 3300021361 Bacteria 4481
498 Ga0213876_10015326 3300021384 Bacteria 4058
499 Ga0213875_10002861 3300021388 Bacteria 10113
500 Ga0213875_10003569 3300021388 Bacteria 8824
501 Ga0224712_10000068 3300022467 Bacteria 15870
502 Ga0209435_100034 3300025206 Bacteria 144486
503 Ga0209784_100069 3300025224 Bacteria 152424
504 Ga0209566_100083 3300025225 Bacteria 152424
505 Ga0209566_100089 3300025225 Bacteria 142951
506 Ga0209566_100343 3300025225 Bacteria 40421
507 Ga0209566_102048 3300025225 Bacteria 4216
508 Ga0209674_100017 3300025226 Bacteria 689087
509 Ga0209674_100041 3300025226 Bacteria 396231
510 Ga0209674_100106 3300025226 Bacteria 152424
511 Ga0209674_100209 3300025226 Bacteria 58880
512 Ga0209672_100001 3300025228 Bacteria 2828210
513 Ga0209672_100020 3300025228 Bacteria 429003
514 Ga0209672_100030 3300025228 Bacteria 337051
515 Ga0209672_100076 3300025228 Bacteria 158986
516 Ga0209672_100159 3300025228 Bacteria 57910
517 Ga0209672_100210 3300025228 Bacteria 45932
518 Ga0209672_100512 3300025228 Bacteria 21376
519 Ga0209147_100004 3300025229 Bacteria 1371850
520 Ga0209147_100022 3300025229 Bacteria 443906
521 Ga0209147_100024 3300025229 Bacteria 429003
522 Ga0209147_100036 3300025229 Bacteria 337052
523 Ga0209147_100103 3300025229 Bacteria 158909
524 Ga0209147_100126 3300025229 Bacteria 127018
525 Ga0209147_100150 3300025229 Bacteria 100971
526 Ga0209147_100275 3300025229 Bacteria 45934
527 Ga0209147_100348 3300025229 Bacteria 33784
528 Ga0209563_100043 3300025230 Bacteria 397271
529 Ga0209563_100100 3300025230 Bacteria 152424
530 Ga0209563_103934 3300025230 Bacteria 2939
531 Ga0207427_100279 3300025231 Bacteria 37306
532 Ga0207427_101078 3300025231 Bacteria 11211
533 Ga0207427_101162 3300025231 Bacteria 10283
534 Ga0209437_100072 3300025233 Bacteria 305152
535 Ga0209437_100156 3300025233 Bacteria 152424
536 Ga0209258_100033 3300025242 Bacteria 443845
537 Ga0209258_100056 3300025242 Bacteria 337051
538 Ga0209258_100084 3300025242 Bacteria 244783
539 Ga0209258_100270 3300025242 Bacteria 89254
540 Ga0209258_100417 3300025242 Bacteria 50597
541 Ga0209258_100435 3300025242 Bacteria 47761
542 Ga0209258_100450 3300025242 Bacteria 45636
543 Ga0209258_100550 3300025242 Bacteria 33784
544 Ga0209258_100602 3300025242 Bacteria 29385
545 Ga0207425_1000025 3300025245 Bacteria 321872
546 Ga0209646_1000118 3300025246 Bacteria 149446
547 Ga0209646_1000410 3300025246 Bacteria 24774
548 Ga0209026_1000006 3300025250 Bacteria 677225
549 Ga0209026_1000106 3300025250 Bacteria 149446
550 Ga0209026_1004956 3300025250 Bacteria 3741
551 Ga0209677_100061 3300025253 Bacteria 152424
552 Ga0209677_100098 3300025253 Bacteria 96201
553 Ga0209677_100372 3300025253 Bacteria 27449
554 Ga0209677_103277 3300025253 Bacteria 5371
555 Ga0209148_1000046 3300025254 Bacteria 443881
556 Ga0209148_1000105 3300025254 Bacteria 210795
557 Ga0209148_1000116 3300025254 Bacteria 190078
558 Ga0209148_1000747 3300025254 Bacteria 25064
559 Ga0209148_1000814 3300025254 Bacteria 22594
560 Ga0209148_1001206 3300025254 Bacteria 14695
561 Ga0209148_1001426 3300025254 Bacteria 12228
562 Ga0209148_1001838 3300025254 Bacteria 8897
563 Ga0209759_1000190 3300025256 Bacteria 97956
564 Ga0209759_1000194 3300025256 Bacteria 97047
565 Ga0209759_1000271 3300025256 Bacteria 73620
566 Ga0209759_1000535 3300025256 Bacteria 39951
567 Ga0209759_1000635 3300025256 Bacteria 32980
568 Ga0209759_1000770 3300025256 Bacteria 27111
569 Ga0209759_1001407 3300025256 Bacteria 13743
570 Ga0209759_1002308 3300025256 Bacteria 8577
571 Ga0209759_1002542 3300025256 Bacteria 7934
572 Ga0209129_1002637 3300025258 Bacteria 8528
573 Ga0209233_1000041 3300025261 Bacteria 515463
574 Ga0209233_1000050 3300025261 Bacteria 450736
575 Ga0209233_1000165 3300025261 Bacteria 152424
576 Ga0209233_1000195 3300025261 Bacteria 125863
577 Ga0209565_1000011 3300025263 Bacteria 637062
578 Ga0209455_1000038 3300025272 Bacteria 443899
579 Ga0209455_1000061 3300025272 Bacteria 337052
580 Ga0209455_1000195 3300025272 Bacteria 89254
581 Ga0209455_1000298 3300025272 Bacteria 51486
582 Ga0209455_1000328 3300025272 Bacteria 45934
583 Ga0209455_1000709 3300025272 Bacteria 19416
584 Ga0209455_1003176 3300025272 Bacteria 5960
585 Ga0209673_1000108 3300025273 Bacteria 183732
586 Ga0209673_1000650 3300025273 Bacteria 51389
587 Ga0209673_1001913 3300025273 Bacteria 16630
588 Ga0209130_1004659 3300025284 Bacteria 5095
589 Ga0209676_1000115 3300025292 Bacteria 205183
590 Ga0209676_1000807 3300025292 Bacteria 41068
591 Ga0209676_1004884 3300025292 Bacteria 7238
592 Ga0209025_1000064 3300025294 Bacteria 301309
593 Ga0209025_1000630 3300025294 Bacteria 62487
594 Ga0209025_1022057 3300025294 Bacteria 3397
595 Ga0209564_1000075 3300025295 Bacteria 285760
596 Ga0209564_1000745 3300025295 Bacteria 46163
597 Ga0209564_1007556 3300025295 Bacteria 5594
598 Ga0209564_1013997 3300025295 Bacteria 3366
599 Ga0209758_1000002 3300025297 Bacteria 1400310
600 Ga0209758_1000008 3300025297 Bacteria 1215263
601 Ga0209758_1000108 3300025297 Bacteria 216541
602 Ga0209758_1000118 3300025297 Bacteria 195889
603 Ga0209758_1000131 3300025297 Bacteria 184259
604 Ga0209758_1002838 3300025297 Bacteria 16843
605 Ga0209758_1003039 3300025297 Bacteria 15977
606 Ga0209758_1006261 3300025297 Bacteria 8662
607 Ga0209050_1000051 3300025298 Bacteria 353153
608 Ga0209050_1000267 3300025298 Bacteria 111656
609 Ga0209050_1001388 3300025298 Bacteria 26373
610 Ga0209050_1001550 3300025298 Bacteria 24072
611 Ga0209050_1001710 3300025298 Bacteria 21914
612 Ga0209050_1003368 3300025298 Bacteria 11901
613 Ga0209050_1007356 3300025298 Bacteria 6193
614 Ga0209256_1000016 3300025299 Bacteria 599092
615 Ga0209256_1000030 3300025299 Bacteria 414828
616 Ga0207426_1000007 3300025302 Bacteria 971011
617 Ga0207426_1000037 3300025302 Bacteria 442735
618 Ga0209051_1000004 3300025303 Bacteria 1155596
619 Ga0209051_1000226 3300025303 Bacteria 94990
620 Ga0209051_1001801 3300025303 Bacteria 16980
621 Ga0209257_1000028 3300025304 Bacteria 699493
622 Ga0209257_1000063 3300025304 Bacteria 359089
623 Ga0209257_1000090 3300025304 Bacteria 274746
624 Ga0209257_1000733 3300025304 Bacteria 49710
625 Ga0209257_1001243 3300025304 Bacteria 31527
626 Ga0209257_1001442 3300025304 Bacteria 28092
627 Ga0209257_1001649 3300025304 Bacteria 25426
628 Ga0207697_10004020 3300025315 Bacteria 7128
629 Ga0207656_10002699 3300025321 Bacteria 6018
630 Ga0207696_1001853 3300025711 Bacteria 10859
631 Ga0207696_1010917 3300025711 Bacteria 3303
632 Ga0207655_1000466 3300025728 Bacteria 52905
633 Ga0207655_1018301 3300025728 Bacteria 3724
634 Ga0207713_1000390 3300025735 Bacteria 47707
635 Ga0207713_1002593 3300025735 Bacteria 13038
636 Ga0207682_10000918 3300025893 Bacteria 13664
637 Ga0207682_10002618 3300025893 Bacteria 8032
638 Ga0207692_10000477 3300025898 Bacteria 14129
639 Ga0207710_10000005 3300025900 Bacteria 607066
640 Ga0207710_10007279 3300025900 Bacteria 4689
641 Ga0207688_10009508 3300025901 Bacteria 5291
642 Ga0207688_10021244 3300025901 Bacteria 3545
643 Ga0207688_10036297 3300025901 Bacteria 2732
644 Ga0207680_10002842 3300025903 Bacteria 8112
645 Ga0207680_10003312 3300025903 Bacteria 7587
646 Ga0207680_10006014 3300025903 Bacteria 5838
647 Ga0207647_10000285 3300025904 Bacteria 41445
648 Ga0207647_10000404 3300025904 Bacteria 35356
649 Ga0207647_10000645 3300025904 Bacteria 27251
650 Ga0207647_10004310 3300025904 Bacteria 10551
651 Ga0207647_10005063 3300025904 Bacteria 9719
652 Ga0207647_10005511 3300025904 Bacteria 9268
653 Ga0207647_10009702 3300025904 Bacteria 6830
654 Ga0207647_10015984 3300025904 Bacteria 5130
655 Ga0207647_10036760 3300025904 Bacteria 3109
656 Ga0207699_10000124 3300025906 Bacteria 54948
657 Ga0207699_10000658 3300025906 Bacteria 16632
658 Ga0207645_10002090 3300025907 Bacteria 15980
659 Ga0207645_10008977 3300025907 Bacteria 6942
660 Ga0207645_10010246 3300025907 Bacteria 6442
661 Ga0207645_10023453 3300025907 Bacteria 4011
662 Ga0207645_10042076 3300025907 Bacteria 2923
663 Ga0207643_10003743 3300025908 Bacteria 8168
664 Ga0207643_10015799 3300025908 Bacteria 4112
665 Ga0207643_10028473 3300025908 Bacteria 3103
666 Ga0207705_10000022 3300025909 Bacteria 302232
667 Ga0207705_10000281 3300025909 Bacteria 48548
668 Ga0207705_10000297 3300025909 Bacteria 46356
669 Ga0207705_10000780 3300025909 Bacteria 26146
670 Ga0207705_10000826 3300025909 Bacteria 25319
671 Ga0207705_10001221 3300025909 Bacteria 20793
672 Ga0207705_10006255 3300025909 Bacteria 8844
673 Ga0207705_10024032 3300025909 Bacteria 4348
674 Ga0207705_10032980 3300025909 Bacteria 3701
675 Ga0207684_10040883 3300025910 Bacteria 3931
676 Ga0207654_10009290 3300025911 Bacteria 4991
677 Ga0207707_10000590 3300025912 Bacteria 36588
678 Ga0207707_10050273 3300025912 Bacteria 3631
679 Ga0207695_10000008 3300025913 Bacteria 1058268
680 Ga0207695_10000011 3300025913 Bacteria 910221
681 Ga0207695_10000171 3300025913 Bacteria 191448
682 Ga0207695_10001454 3300025913 Bacteria 39645
683 Ga0207695_10003118 3300025913 Bacteria 23714
684 Ga0207695_10014623 3300025913 Bacteria 9282
685 Ga0207695_10021460 3300025913 Bacteria 7366
686 Ga0207695_10024107 3300025913 Bacteria 6854
687 Ga0207695_10028836 3300025913 Bacteria 6144
688 Ga0207695_10069217 3300025913 Bacteria 3612
689 Ga0207695_10099945 3300025913 Bacteria 2897
690 Ga0207671_10000804 3300025914 Bacteria 39792
691 Ga0207671_10000820 3300025914 Bacteria 39374
692 Ga0207671_10002386 3300025914 Bacteria 20172
693 Ga0207671_10003046 3300025914 Bacteria 17160
694 Ga0207671_10004434 3300025914 Bacteria 13432
695 Ga0207671_10012150 3300025914 Bacteria 6947
696 Ga0207671_10033724 3300025914 Bacteria 3807
697 Ga0207671_10043833 3300025914 Bacteria 3308
698 Ga0207693_10000213 3300025915 Bacteria 53286
699 Ga0207693_10003912 3300025915 Bacteria 12682
700 Ga0207693_10006957 3300025915 Bacteria 9346
701 Ga0207693_10037366 3300025915 Bacteria 3827
702 Ga0207663_10002238 3300025916 Bacteria 9260
703 Ga0207660_10007035 3300025917 Bacteria 7287
704 Ga0207662_10009297 3300025918 Bacteria 5401
705 Ga0207657_10000003 3300025919 Bacteria 263148
706 Ga0207657_10000016 3300025919 Bacteria 175206
707 Ga0207657_10000064 3300025919 Bacteria 99069
708 Ga0207657_10000227 3300025919 Bacteria 58998
709 Ga0207657_10000918 3300025919 Bacteria 31166
710 Ga0207657_10002781 3300025919 Bacteria 18841
711 Ga0207657_10003065 3300025919 Bacteria 17880
712 Ga0207657_10025639 3300025919 Bacteria 5432
713 Ga0207657_10028523 3300025919 Bacteria 5090
714 Ga0207657_10070551 3300025919 Bacteria 2961
715 Ga0207649_10002026 3300025920 Bacteria 11523
716 Ga0207649_10006510 3300025920 Bacteria 6346
717 Ga0207652_10012768 3300025921 Bacteria 6790
718 Ga0207652_10026141 3300025921 Bacteria 4859
719 Ga0207681_10000014 3300025923 Bacteria 353422
720 Ga0207681_10000120 3300025923 Bacteria 66235
721 Ga0207681_10000248 3300025923 Bacteria 41061
722 Ga0207681_10000864 3300025923 Bacteria 19921
723 Ga0207681_10010447 3300025923 Bacteria 5681
724 Ga0207694_10004090 3300025924 Bacteria 11471
725 Ga0207694_10036239 3300025924 Bacteria 3785
726 Ga0207650_10000015 3300025925 Bacteria 369173
727 Ga0207650_10001127 3300025925 Bacteria 19637
728 Ga0207650_10003406 3300025925 Bacteria 10937
729 Ga0207650_10028103 3300025925 Bacteria 4030
730 Ga0207650_10036920 3300025925 Bacteria 3557
731 Ga0207659_10001180 3300025926 Bacteria 15612
732 Ga0207659_10005217 3300025926 Bacteria 7864
733 Ga0207687_10049434 3300025927 Bacteria 2924
734 Ga0207700_10000026 3300025928 Bacteria 139690
735 Ga0207700_10000338 3300025928 Bacteria 27628
736 Ga0207664_10010373 3300025929 Bacteria 6579
737 Ga0207644_10000132 3300025931 Bacteria 54023
738 Ga0207644_10001262 3300025931 Bacteria 16266
739 Ga0207644_10008443 3300025931 Bacteria 6740
740 Ga0207644_10014264 3300025931 Bacteria 5315
741 Ga0207644_10014339 3300025931 Bacteria 5301
742 Ga0207644_10020968 3300025931 Bacteria 4449
743 Ga0207690_10000007 3300025932 Bacteria 388533
744 Ga0207690_10000012 3300025932 Bacteria 269610
745 Ga0207690_10000060 3300025932 Bacteria 99148
746 Ga0207690_10004630 3300025932 Bacteria 8134
747 Ga0207690_10019150 3300025932 Bacteria 4208
748 Ga0207706_10000898 3300025933 Bacteria 30553
749 Ga0207706_10004502 3300025933 Bacteria 13087
750 Ga0207706_10004915 3300025933 Bacteria 12499
751 Ga0207706_10009151 3300025933 Bacteria 9106
752 Ga0207706_10027265 3300025933 Bacteria 5109
753 Ga0207706_10100004 3300025933 Bacteria 2552
754 Ga0207686_10000600 3300025934 Bacteria 22522
755 Ga0207709_10000001 3300025935 Bacteria 2228154
756 Ga0207709_10000032 3300025935 Bacteria 324478
757 Ga0207709_10000260 3300025935 Bacteria 62960
758 Ga0207709_10023879 3300025935 Bacteria 3485
759 Ga0207669_10005167 3300025937 Bacteria 5824
760 Ga0207704_10000064 3300025938 Bacteria 73788
761 Ga0207665_10021708 3300025939 Bacteria 4223
762 Ga0207691_10001319 3300025940 Bacteria 24755
763 Ga0207691_10001444 3300025940 Bacteria 23682
764 Ga0207691_10046360 3300025940 Bacteria 3995
765 Ga0207691_10050907 3300025940 Bacteria 3790
766 Ga0207711_10000162 3300025941 Bacteria 71805
767 Ga0207711_10001087 3300025941 Bacteria 25938
768 Ga0207711_10009325 3300025941 Bacteria 8193
769 Ga0207711_10014958 3300025941 Bacteria 6446
770 Ga0207711_10028842 3300025941 Bacteria 4675
771 Ga0207711_10033160 3300025941 Bacteria 4368
772 Ga0207711_10040931 3300025941 Bacteria 3944
773 Ga0207711_10077043 3300025941 Bacteria 2906
774 Ga0207689_10001667 3300025942 Bacteria 21080
775 Ga0207689_10012069 3300025942 Bacteria 7402
776 Ga0207689_10014493 3300025942 Bacteria 6707
777 Ga0207661_10007156 3300025944 Bacteria 7926
778 Ga0207679_10000185 3300025945 Bacteria 50612
779 Ga0207679_10001704 3300025945 Bacteria 13702
780 Ga0207679_10006785 3300025945 Bacteria 7254
781 Ga0207667_10000013 3300025949 Bacteria 435875
782 Ga0207667_10000909 3300025949 Bacteria 37685
783 Ga0207667_10003584 3300025949 Bacteria 19189
784 Ga0207667_10005375 3300025949 Bacteria 15617
785 Ga0207667_10006259 3300025949 Bacteria 14448
786 Ga0207667_10007516 3300025949 Bacteria 13080
787 Ga0207667_10008329 3300025949 Bacteria 12330
788 Ga0207667_10012268 3300025949 Bacteria 9889
789 Ga0207667_10016463 3300025949 Bacteria 8355
790 Ga0207667_10027717 3300025949 Bacteria 6162
791 Ga0207667_10033301 3300025949 Bacteria 5542
792 Ga0207651_10000010 3300025960 Bacteria 193754
793 Ga0207651_10004833 3300025960 Bacteria 6860
794 Ga0207651_10007524 3300025960 Bacteria 5807
795 Ga0207651_10023201 3300025960 Bacteria 3811
796 Ga0207712_10002152 3300025961 Bacteria 12863
797 Ga0207712_10004590 3300025961 Bacteria 8721
798 Ga0207712_10038060 3300025961 Bacteria 3287
799 Ga0207668_10000236 3300025972 Bacteria 37018
800 Ga0207668_10000535 3300025972 Bacteria 23811
801 Ga0207668_10004441 3300025972 Bacteria 8237
802 Ga0207668_10037338 3300025972 Bacteria 3250
803 Ga0207640_10000327 3300025981 Bacteria 31864
804 Ga0207658_10000010 3300025986 Bacteria 240224
805 Ga0207658_10000037 3300025986 Bacteria 148087
806 Ga0207658_10000067 3300025986 Bacteria 116584
807 Ga0207658_10000692 3300025986 Bacteria 29298
808 Ga0207658_10001017 3300025986 Bacteria 22871
809 Ga0207658_10001416 3300025986 Bacteria 18701
810 Ga0207658_10003704 3300025986 Bacteria 10770
811 Ga0207658_10011241 3300025986 Bacteria 6099
812 Ga0207677_10000601 3300026023 Bacteria 22219
813 Ga0207677_10001067 3300026023 Bacteria 14971
814 Ga0207677_10003682 3300026023 Bacteria 8140
815 Ga0207677_10009249 3300026023 Bacteria 5535
816 Ga0207703_10000540 3300026035 Bacteria 38909
817 Ga0207703_10000556 3300026035 Bacteria 38283
818 Ga0207703_10009337 3300026035 Bacteria 7709
819 Ga0207703_10014156 3300026035 Bacteria 6220
820 Ga0207703_10019103 3300026035 Bacteria 5354
821 Ga0207703_10024135 3300026035 Bacteria 4785
822 Ga0207639_10002022 3300026041 Bacteria 13668
823 Ga0207639_10008107 3300026041 Bacteria 7183
824 Ga0207639_10008563 3300026041 Bacteria 7021
825 Ga0207678_10000064 3300026067 Bacteria 83470
826 Ga0207678_10000233 3300026067 Bacteria 49821
827 Ga0207678_10000482 3300026067 Bacteria 36190
828 Ga0207678_10000900 3300026067 Bacteria 27289
829 Ga0207678_10007409 3300026067 Bacteria 9719
830 Ga0207678_10009609 3300026067 Bacteria 8506
831 Ga0207678_10009908 3300026067 Bacteria 8364
832 Ga0207678_10039831 3300026067 Bacteria 4076
833 Ga0207678_10087663 3300026067 Bacteria 2660
834 Ga0207708_10001819 3300026075 Bacteria 15745
835 Ga0207702_10000021 3300026078 Bacteria 196115
836 Ga0207702_10001360 3300026078 Bacteria 24403
837 Ga0207702_10004329 3300026078 Bacteria 12665
838 Ga0207641_10000050 3300026088 Bacteria 175954
839 Ga0207641_10000325 3300026088 Bacteria 58368
840 Ga0207641_10013869 3300026088 Bacteria 6611
841 Ga0207641_10015026 3300026088 Bacteria 6345
842 Ga0207641_10019736 3300026088 Bacteria 5533
843 Ga0207641_10036465 3300026088 Bacteria 4105
844 Ga0207648_10000162 3300026089 Bacteria 68397
845 Ga0207648_10000713 3300026089 Bacteria 37240
846 Ga0207648_10011667 3300026089 Bacteria 8270
847 Ga0207648_10015463 3300026089 Bacteria 7018
848 Ga0207648_10018615 3300026089 Bacteria 6283
849 Ga0207648_10032277 3300026089 Bacteria 4624
850 Ga0207676_10000021 3300026095 Bacteria 296572
851 Ga0207676_10001506 3300026095 Bacteria 17194
852 Ga0207676_10001650 3300026095 Bacteria 16428
853 Ga0207676_10005239 3300026095 Bacteria 9177
854 Ga0207676_10012287 3300026095 Bacteria 6130
855 Ga0207676_10033980 3300026095 Bacteria 3858
856 Ga0207676_10037014 3300026095 Bacteria 3716
857 Ga0207674_10009233 3300026116 Bacteria 11304
858 Ga0207674_10034776 3300026116 Bacteria 5264
859 Ga0207674_10039004 3300026116 Bacteria 4926
860 Ga0207674_10053618 3300026116 Bacteria 4109
861 Ga0207675_100005511 3300026118 Bacteria 12106
862 Ga0207675_100024326 3300026118 Bacteria 5632
863 Ga0207675_100071943 3300026118 Bacteria 3233
864 Ga0207683_10000838 3300026121 Bacteria 28142
865 Ga0207683_10003819 3300026121 Bacteria 13054
866 Ga0207683_10005384 3300026121 Bacteria 10970
867 Ga0207683_10019376 3300026121 Bacteria 5809
868 Ga0207683_10027968 3300026121 Bacteria 4873
869 Ga0207683_10034234 3300026121 Bacteria 4414
870 Ga0207698_10000355 3300026142 Bacteria 26972
871 Ga0207698_10001250 3300026142 Bacteria 14873
872 Ga0207698_10008698 3300026142 Bacteria 6435
873 Ga0207698_10049916 3300026142 Bacteria 3188
874 Ga0207698_10064819 3300026142 Bacteria 2866
875 Ga0209281_1000002 3300027111 Bacteria 1924012
876 Ga0209281_1000084 3300027111 Bacteria 254215
877 Ga0209371_1000008 3300027312 Bacteria 1024606
878 Ga0209371_1000103 3300027312 Bacteria 149486
879 Ga0209371_1000114 3300027312 Bacteria 139090
880 Ga0209371_1000150 3300027312 Bacteria 109925
881 Ga0209371_1000291 3300027312 Bacteria 57116
882 Ga0209179_1000102 3300027512 Bacteria 11077
883 Ga0209970_1000046 3300027614 Bacteria 16400
884 Ga0207428_10002173 3300027907 Bacteria 19685
885 Ga0207428_10019607 3300027907 Bacteria 5763
886 Ga0207428_10028464 3300027907 Bacteria 4643
887 Ga0207428_10031456 3300027907 Bacteria 4376
888 Ga0268266_10002043 3300028379 Bacteria 22400
889 Ga0268266_10014250 3300028379 Bacteria 6837
890 Ga0268266_10022299 3300028379 Bacteria 5397
891 Ga0268266_10023960 3300028379 Bacteria 5194
892 Ga0268265_10000013 3300028380 Bacteria 341536
893 Ga0268265_10000629 3300028380 Bacteria 35150
894 Ga0268265_10027435 3300028380 Bacteria 4064
895 Ga0268264_10000039 3300028381 Bacteria 376641
896 Ga0268264_10000169 3300028381 Bacteria 144978
897 Ga0268264_10000245 3300028381 Bacteria 102529
898 Ga0268264_10000435 3300028381 Bacteria 57505
899 Ga0268264_10014252 3300028381 Bacteria 6535
900 Ga0268264_10016758 3300028381 Bacteria 5996
901 Ga0268264_10021966 3300028381 Bacteria 5207
902 Ga0268264_10074954 3300028381 Bacteria 2876
903 Ga0265336_10000133 3300028666 Bacteria 53127
904 Ga0307517_10000042 3300028786 Bacteria 166943
905 Ga0307517_10009033 3300028786 Bacteria 14208
906 Ga0307515_10000089 3300028794 Bacteria 215736
907 Ga0307515_10000096 3300028794 Bacteria 206366
908 Ga0307515_10011006 3300028794 Bacteria 17234
909 Ga0307515_10017870 3300028794 Bacteria 12886
910 Ga0265338_10000118 3300028800 Bacteria 146710
911 Ga0265338_10000191 3300028800 Bacteria 115408
912 Ga0265338_10001745 3300028800 Bacteria 34379
913 Ga0265338_10040150 3300028800 Bacteria 4400
914 Ga0265324_10001688 3300029957 Bacteria 12169
915 Ga0268256_1000009 3300030500 Bacteria 1022625
916 Ga0268256_1000218 3300030500 Bacteria 63709
917 Ga0268256_1000242 3300030500 Bacteria 57643
918 Ga0268256_1000288 3300030500 Bacteria 51845
919 Ga0307511_10000011 3300030521 Bacteria 137995
920 Ga0265330_10010986 3300031235 Bacteria 4252
921 Ga0265328_10004600 3300031239 Bacteria 5977
922 Ga0265325_10000676 3300031241 Bacteria 24873
923 Ga0265325_10000914 3300031241 Bacteria 21292
924 Ga0265325_10016950 3300031241 Bacteria 4061
925 Ga0265325_10028965 3300031241 Bacteria 2979
926 Ga0265340_10000206 3300031247 Bacteria 29746
927 Ga0265340_10002811 3300031247 Bacteria 9906
928 Ga0265340_10003976 3300031247 Bacteria 8307
929 Ga0265340_10008216 3300031247 Bacteria 5640
930 Ga0265340_10022343 3300031247 Bacteria 3235
931 Ga0265339_10006859 3300031249 Bacteria 7421
932 Ga0265331_10004230 3300031250 Bacteria 8988
933 Ga0265331_10015109 3300031250 Bacteria 4088
934 Ga0265327_10000479 3300031251 Bacteria 70467
935 Ga0265316_10000026 3300031344 Bacteria 165508
936 Ga0265316_10007895 3300031344 Bacteria 9959
937 Ga0265316_10019223 3300031344 Bacteria 5850
938 Ga0307408_100001028 3300031548 Bacteria 21450
939 Ga0307408_100003302 3300031548 Bacteria 11091
940 Ga0307408_100010293 3300031548 Bacteria 6167
941 Ga0307408_100013657 3300031548 Bacteria 5393
942 Ga0307408_100055264 3300031548 Bacteria 2874
943 Ga0265313_10015527 3300031595 Bacteria 4425
944 Ga0307508_10000020 3300031616 Bacteria 188730
945 Ga0307508_10026018 3300031616 Bacteria 5304
946 Ga0307508_10047298 3300031616 Bacteria 3837
947 Ga0307514_10000339 3300031649 Bacteria 111130
948 Ga0316579_10000472 3300031691 Bacteria 13007
949 Ga0265314_10000481 3300031711 Bacteria 52341
950 Ga0265314_10000488 3300031711 Bacteria 51640
951 Ga0265314_10000918 3300031711 Bacteria 34672
952 Ga0265314_10005990 3300031711 Bacteria 10843
953 Ga0265314_10007494 3300031711 Bacteria 9461
954 Ga0265342_10008946 3300031712 Bacteria 7112
955 Ga0265342_10024914 3300031712 Bacteria 3770
956 Ga0316578_10006425 3300031728 Bacteria 5800
957 Ga0307516_10004252 3300031730 Bacteria 17809
958 Ga0307516_10021185 3300031730 Bacteria 6698
959 Ga0307405_10012089 3300031731 Bacteria 4554
960 Ga0307405_10016166 3300031731 Bacteria 4062
961 Ga0307405_10016540 3300031731 Bacteria 4024
962 Ga0307405_10037144 3300031731 Bacteria 2925
963 Ga0307405_10038880 3300031731 Bacteria 2871
964 Ga0316577_10000564 3300031733 Bacteria 15113
965 Ga0307413_10005249 3300031824 Bacteria 5754
966 Ga0307413_10015235 3300031824 Bacteria 3934
967 Ga0307413_10016232 3300031824 Bacteria 3840
968 Ga0307410_10003694 3300031852 Bacteria 7739
969 Ga0307410_10009795 3300031852 Bacteria 5394
970 Ga0307410_10014827 3300031852 Bacteria 4601
971 Ga0307410_10049161 3300031852 Bacteria 2829
972 Ga0307406_10006892 3300031901 Bacteria 6293
973 Ga0307406_10007517 3300031901 Bacteria 6046
974 Ga0307406_10020525 3300031901 Bacteria 3892
975 Ga0307407_10004761 3300031903 Bacteria 5807
976 Ga0307412_10000011 3300031911 Bacteria 405842
977 Ga0307412_10000874 3300031911 Bacteria 17340
978 Ga0307412_10000936 3300031911 Bacteria 16679
979 Ga0307412_10001079 3300031911 Bacteria 15586
980 Ga0307412_10004529 3300031911 Bacteria 7739
981 Ga0307412_10010845 3300031911 Bacteria 5261
982 Ga0307409_100004787 3300031995 Bacteria 7678
983 Ga0307409_100015836 3300031995 Bacteria 4966
984 Ga0307409_100034980 3300031995 Bacteria 3677
985 Ga0307409_100052775 3300031995 Bacteria 3119
986 Ga0307409_100087937 3300031995 Bacteria 2534
987 Ga0307409_100088617 3300031995 Bacteria 2527
988 Ga0307416_100005548 3300032002 Bacteria 7764
989 Ga0307416_100008557 3300032002 Bacteria 6615
990 Ga0307416_100020962 3300032002 Bacteria 4678
991 Ga0307416_100033553 3300032002 Bacteria 3893
992 Ga0307414_10001122 3300032004 Bacteria 13688
993 Ga0307414_10003680 3300032004 Bacteria 8215
994 Ga0307414_10005273 3300032004 Bacteria 7101
995 Ga0307414_10023428 3300032004 Bacteria 3916
996 Ga0307414_10024251 3300032004 Bacteria 3865
997 Ga0307414_10025291 3300032004 Bacteria 3800
998 Ga0307414_10037338 3300032004 Bacteria 3252
999 Ga0307414_10057331 3300032004 Bacteria 2737
1000 Ga0307414_10060793 3300032004 Bacteria 2673
1001 Ga0307411_10008573 3300032005 Bacteria 5307
1002 Ga0307411_10017035 3300032005 Bacteria 4127
1003 Ga0307411_10056291 3300032005 Bacteria 2591
1004 Ga0307415_100000806 3300032126 Bacteria 14247
1005 Ga0307415_100032471 3300032126 Bacteria 3376
1006 Ga0307415_100033101 3300032126 Bacteria 3352
1007 Ga0316583_10000398 3300032133 Bacteria 12673
1008 Ga0307507_10047429 3300033179 Bacteria 4196
1009 Ga0373923_0016410 3300035111 Bacteria 2814
1010 Ga0373943_0002953 3300035170 Bacteria 7711
1011 Ga0316574_0011052 3300035398 Bacteria 5120
1012 Ga0316574_0028379 3300035398 Bacteria 3375
1013 Ga0373924_0006144 3300035410 Bacteria 4290
1014 Ga0373931_0003797 3300035691 Bacteria 6835
1015 Ga0373931_0014245 3300035691 Bacteria 3883
1016 Ga0373935_0019906 3300035692 Bacteria 4095
1017 Ga0373935_0027468 3300035692 Bacteria 3516
1018 Ga0373927_0000245 3300035695 Bacteria 42703
1019 Ga0373927_0001140 3300035695 Bacteria 20113
1020 Ga0373927_0006018 3300035695 Bacteria 8310
1021 Ga0373927_0027764 3300035695 Bacteria 3695
1022 Ga0373933_0008918 3300035724 Bacteria 5469
1023 Ga0373947_0019053 3300035725 Bacteria 3954
1024 Ga0316582_0001241 3300036647 Bacteria 10996
1025 Ga0316582_0015492 3300036647 Bacteria 4362
1026 Ga0316584_0009354 3300036712 Bacteria 6797
1027 Ga0316584_0039466 3300036712 Bacteria 3514
1028 Ga0373925_0003713 3300037068 Bacteria 11724
1029 Ga0373925_0010853 3300037068 Bacteria 6607
1030 Ga0373925_0012885 3300037068 Bacteria 6057
1031 Ga0395899_0000093 3300037312 Bacteria 153541
1032 Ga0395899_0000193 3300037312 Bacteria 90238
1033 Ga0395899_0003665 3300037312 Bacteria 12162
1034 Ga0395899_0008019 3300037312 Bacteria 8132
1035 Ga0395899_0015407 3300037312 Bacteria 5827
1036 Ga0395899_0057491 3300037312 Bacteria 2871
1037 Ga0395899_0067005 3300037312 Bacteria 2635
1038 Ga0395900_0000219 3300037418 Bacteria 90231
1039 Ga0395900_0000267 3300037418 Bacteria 80920
1040 Ga0395900_0000380 3300037418 Bacteria 64150
1041 Ga0395900_0000496 3300037418 Bacteria 55441
1042 Ga0395900_0009047 3300037418 Bacteria 10209
1043 Ga0395900_0011484 3300037418 Bacteria 9066
1044 Ga0395900_0108459 3300037418 Bacteria 2852
1045 Ga0395898_0000469 3300037466 Bacteria 80881
1046 Ga0395898_0007123 3300037466 Bacteria 11875
1047 Ga0395898_0026373 3300037466 Bacteria 5848
1048 Ga0395898_0043685 3300037466 Bacteria 4415
1049 Ga0395898_0045992 3300037466 Bacteria 4288
1050 Ga0395898_0047579 3300037466 Bacteria 4208
1051 Ga0395905_0000002 3300037471 Bacteria 1356358
1052 Ga0395905_0000110 3300037471 Bacteria 137078
1053 Ga0395905_0000176 3300037471 Bacteria 102060
1054 Ga0395905_0000201 3300037471 Bacteria 92923
1055 Ga0395905_0001357 3300037471 Bacteria 29810
1056 Ga0395905_0003253 3300037471 Bacteria 17468
1057 Ga0395905_0021404 3300037471 Bacteria 6116
1058 Ga0436364_0563245 3300037853 Bacteria 6700
1059 Ga0436364_0972483 3300037853 Bacteria 30030
1060 Ga0436364_1027512 3300037853 Bacteria 7765
1061 Ga0395901_0000003 3300038443 Bacteria 701538
1062 Ga0395901_0000175 3300038443 Bacteria 83175
1063 Ga0395901_0000181 3300038443 Bacteria 81816
1064 Ga0395901_0000186 3300038443 Bacteria 79718
1065 Ga0395901_0000319 3300038443 Bacteria 59493
1066 Ga0395901_0000607 3300038443 Bacteria 41725
1067 Ga0395901_0023988 3300038443 Bacteria 6258
1068 Ga0395901_0051392 3300038443 Bacteria 4285
1069 Ga0395901_0055056 3300038443 Bacteria 4136
1070 Ga0400484_07051 3300038725 Bacteria 28274
1071 Ga0400484_22850 3300038725 Bacteria 14598
1072 Ga0400490_05271 3300038726 Bacteria 10796
1073 Ga0400490_05408 3300038726 Bacteria 14275
1074 Ga0400490_20208 3300038726 Bacteria 59167
1075 Ga0400490_20541 3300038726 Bacteria 11871
1076 Ga0400490_39588 3300038726 Bacteria 45273
1077 Ga0400491_08631 3300038727 Bacteria 11696
1078 Ga0400485_02459 3300038735 Bacteria 132034
1079 Ga0400485_21461 3300038735 Bacteria 12201
1080 Ga0400488_33751 3300038741 Bacteria 29765
1081 Ga0400488_37965 3300038741 Bacteria 6089
1082 Ga0400486_05345 3300038742 Bacteria 12660
1083 Ga0400486_06505 3300038742 Bacteria 21133
1084 Ga0400486_19991 3300038742 Bacteria 4071
1085 Ga0400486_23232 3300038742 Bacteria 285561
1086 Ga0400486_24750 3300038742 Bacteria 9241
1087 Ga0400483_020073 3300039062 Bacteria 5231
1088 Ga0400483_053792 3300039062 Bacteria 14058
1089 Ga0400483_117005 3300039062 Bacteria 19356
1090 Ga0400483_121983 3300039062 Bacteria 3813
1091 Ga0400483_154845 3300039062 Bacteria 6551
1092 Ga0400483_196030 3300039062 Bacteria 18065
1093 Ga0400483_227457 3300039062 Bacteria 5998
1094 Ga0400483_227762 3300039062 Bacteria 12947
1095 Ga0400483_270422 3300039062 Bacteria 2886
1096 Ga0400487_25234 3300039110 Bacteria 119747
1097 Ga0400487_32542 3300039110 Bacteria 31777
1098 Ga0400487_34970 3300039110 Bacteria 222491
1099 Ga0400487_44972 3300039110 Bacteria 34537
1100 Ga0436365_0079966 3300039437 Bacteria 4650
1101 Ga0436365_0577140 3300039437 Bacteria 27302
1102 Ga0436361_0027317 3300039447 Bacteria 79578
1103 Ga0436361_0069414 3300039447 Bacteria 14447
1104 Ga0436361_0074986 3300039447 Bacteria 19532
1105 Ga0436361_0156174 3300039447 Bacteria 11048
1106 Ga0436361_0203161 3300039447 Bacteria 31513
1107 Ga0436361_0449757 3300039447 Bacteria 2735
1108 Ga0436361_0572581 3300039447 Bacteria 116104
1109 Ga0436361_0677791 3300039447 Bacteria 5807
1110 Ga0436361_0862241 3300039447 Bacteria 5202
1111 Ga0436361_0946249 3300039447 Bacteria 3953
1112 Ga0439465_0000417 3300041413 Bacteria 12450
1113 Ga0451802_1860869 3300041460 Bacteria 2541
1114 Ga0439445_0000319 3300042004 Bacteria 9342
1115 Ga0439448_0000501 3300042005 Bacteria 9066
1116 Ga0439448_0000589 3300042005 Bacteria 8528
1117 Ga0439448_0003989 3300042005 Bacteria 4146
1118 Ga0439432_000210 3300042006 Bacteria 20816
1119 Ga0439455_0000022 3300042012 Bacteria 15158
1120 Ga0439455_0000481 3300042012 Bacteria 5509
1121 Ga0439462_0000599 3300042015 Bacteria 7189
1122 Ga0439458_0001364 3300042157 Bacteria 6160
1123 Ga0450918_000028 3300042531 Bacteria 30240
1124 Ga0451577_0000280 3300042876 Bacteria 98991
1125 Ga0451577_0000817 3300042876 Bacteria 46724
1126 Ga0451577_0002906 3300042876 Bacteria 19660
1127 Ga0451577_0014354 3300042876 Bacteria 7385
1128 Ga0451577_0033252 3300042876 Bacteria 4648
1129 Ga0451577_0044511 3300042876 Bacteria 3974
1130 Ga0451577_0045359 3300042876 Bacteria 3935
1131 Ga0466969_0000458 3300044656 Bacteria 22461
1132 Ga0466969_0001023 3300044656 Bacteria 15124
1133 Ga0466969_0006156 3300044656 Bacteria 6387
1134 Ga0466969_0006416 3300044656 Bacteria 6262
1135 Ga0466972_0023652 3300044658 Bacteria 3054
1136 Ga0466977_0001086 3300044666 Bacteria 10619
1137 Ga0466977_0008268 3300044666 Bacteria 5760
1138 Ga0453683_0000921 3300044673 Bacteria 28022
1139 Ga0466965_0000292 3300044683 Bacteria 16638
1140 Ga0466965_0005395 3300044683 Bacteria 5762
1141 Ga0466965_0037708 3300044683 Bacteria 2373
1142 Ga0466966_0000016 3300044684 Bacteria 127214
1143 Ga0466966_0000495 3300044684 Bacteria 25298
1144 Ga0466966_0010594 3300044684 Bacteria 6128
1145 Ga0466966_0012799 3300044684 Bacteria 5557
1146 Ga0466966_0012851 3300044684 Bacteria 5544
1147 Ga0466966_0065799 3300044684 Bacteria 2278
1148 Ga0466961_0000128 3300044693 Bacteria 50467
1149 Ga0466961_0000295 3300044693 Bacteria 33105
1150 Ga0466961_0000937 3300044693 Bacteria 18072
1151 Ga0466961_0001290 3300044693 Bacteria 15446
1152 Ga0466961_0002482 3300044693 Bacteria 11438
1153 Ga0466961_0008030 3300044693 Bacteria 6725
1154 Ga0466963_0001067 3300044694 Bacteria 14287
1155 Ga0466963_0011767 3300044694 Bacteria 5335
1156 Ga0466963_0013110 3300044694 Bacteria 5085
1157 Ga0466963_0046795 3300044694 Bacteria 2854
1158 Ga0453684_0000014 3300044712 Bacteria 993311
1159 Ga0453684_0000682 3300044712 Bacteria 121090
1160 Ga0453684_0001614 3300044712 Bacteria 61851
1161 Ga0453684_0001982 3300044712 Bacteria 52535
1162 Ga0453684_0002255 3300044712 Bacteria 47769
1163 Ga0453684_0003467 3300044712 Bacteria 35441
1164 Ga0453684_0005076 3300044712 Bacteria 26598
1165 Ga0453684_0007992 3300044712 Bacteria 19162
1166 Ga0453684_0008526 3300044712 Bacteria 18312
1167 Ga0453684_0013748 3300044712 Bacteria 13092
1168 Ga0453684_0015326 3300044712 Bacteria 12145
1169 Ga0453684_0050465 3300044712 Bacteria 5472
1170 Ga0453684_0083473 3300044712 Bacteria 3976
1171 Ga0453684_0090144 3300044712 Bacteria 3789
1172 Ga0466971_0000685 3300044719 Bacteria 13557
1173 Ga0466971_0001015 3300044719 Bacteria 11605
1174 Ga0466971_0015551 3300044719 Bacteria 3351
1175 Ga0466971_0019094 3300044719 Bacteria 3042
1176 Ga0466968_0010317 3300044735 Bacteria 3619
1177 Ga0466957_0000122 3300044842 Bacteria 32730
1178 Ga0466960_0003662 3300044901 Bacteria 5928
1179 Ga0466959_0003484 3300045049 Bacteria 10307
1180 Ga0466959_0014999 3300045049 Bacteria 5646
1181 Ga0451576_0001365 3300045051 Bacteria 41965
1182 Ga0451576_0003357 3300045051 Bacteria 22176
1183 Ga0451576_0004353 3300045051 Bacteria 18470
1184 Ga0451576_0034623 3300045051 Bacteria 5363
1185 Ga0451576_0051823 3300045051 Bacteria 4302
1186 Ga0451576_0051929 3300045051 Bacteria 4297
1187 Ga0466958_0014981 3300045836 Bacteria 4435
1188 Ga0466958_0035286 3300045836 Bacteria 2987
1189 Ga0495617_001005 3300046452 Bacteria 13054
1190 Ga0495617_001319 3300046452 Bacteria 11034
1191 Ga0495617_004594 3300046452 Bacteria 4999
1192 Ga0495617_017486 3300046452 Bacteria 2422
1193 Ga0495627_001389 3300046453 Bacteria 14342
1194 Ga0495592_0017464 3300046454 Bacteria 5451
1195 Ga0495603_0001748 3300046455 Bacteria 12804
1196 Ga0495603_0007618 3300046455 Bacteria 6517
1197 Ga0495603_0014725 3300046455 Bacteria 4729
1198 Ga0495603_0016108 3300046455 Bacteria 4519
1199 Ga0495590_0000061 3300046457 Bacteria 88102
1200 Ga0495590_0000527 3300046457 Bacteria 18425
1201 Ga0495590_0001900 3300046457 Bacteria 8843
1202 Ga0495590_0007733 3300046457 Bacteria 4129
1203 Ga0495590_0011791 3300046457 Bacteria 3259
1204 Ga0495590_0015826 3300046457 Bacteria 2730
1205 Ga0495591_000401 3300046458 Bacteria 36268
1206 Ga0495591_002221 3300046458 Bacteria 11078
1207 Ga0495629_0000492 3300046459 Bacteria 33050
1208 Ga0495629_0000609 3300046459 Bacteria 29116
1209 Ga0495629_0002363 3300046459 Bacteria 14521
1210 Ga0495629_0002941 3300046459 Bacteria 12981
1211 Ga0495629_0008744 3300046459 Bacteria 7445
1212 Ga0495629_0033556 3300046459 Bacteria 3630
1213 Ga0495638_0001861 3300046460 Bacteria 18270
1214 Ga0495638_0011281 3300046460 Bacteria 6159
1215 Ga0495651_0014167 3300046462 Bacteria 6163
1216 Ga0495651_0028013 3300046462 Bacteria 4391
1217 Ga0495651_0032225 3300046462 Bacteria 4088
1218 Ga0495651_0063232 3300046462 Bacteria 2829
1219 Ga0495653_0003766 3300046463 Bacteria 12267
1220 Ga0495653_0008523 3300046463 Bacteria 8407
1221 Ga0495653_0025577 3300046463 Bacteria 4739
1222 Ga0495650_0000628 3300046471 Bacteria 47433
1223 Ga0495650_0003929 3300046471 Bacteria 10475
1224 Ga0495650_0004299 3300046471 Bacteria 9832
1225 Ga0495650_0004714 3300046471 Bacteria 9190
1226 Ga0495650_0013081 3300046471 Bacteria 4415
1227 Ga0495580_0000844 3300046472 Bacteria 26546
1228 Ga0495580_0001487 3300046472 Bacteria 20578
1229 Ga0495580_0011034 3300046472 Bacteria 7003
1230 Ga0495580_0020273 3300046472 Bacteria 4924
1231 Ga0495580_0024301 3300046472 Bacteria 4439
1232 Ga0495582_0002165 3300046473 Bacteria 10995
1233 Ga0495605_0000481 3300046474 Bacteria 34712
1234 Ga0495605_0001047 3300046474 Bacteria 18478
1235 Ga0495605_0024579 3300046474 Bacteria 3151
1236 Ga0495662_0001321 3300046476 Bacteria 12280
1237 Ga0495664_0000188 3300046477 Bacteria 30394
1238 Ga0495664_0005284 3300046477 Bacteria 7078
1239 Ga0495584_0000011 3300046491 Bacteria 208322
1240 Ga0495584_0000283 3300046491 Bacteria 35778
1241 Ga0495584_0003137 3300046491 Bacteria 9183
1242 Ga0495584_0012301 3300046491 Bacteria 4370
1243 Ga0495585_0000106 3300046492 Bacteria 89096
1244 Ga0495585_0000140 3300046492 Bacteria 79324
1245 Ga0495585_0000157 3300046492 Bacteria 72416
1246 Ga0495585_0000337 3300046492 Bacteria 45680
1247 Ga0495585_0003179 3300046492 Bacteria 11242
1248 Ga0495585_0005737 3300046492 Bacteria 7791
1249 Ga0495585_0005955 3300046492 Bacteria 7629
1250 Ga0495585_0007651 3300046492 Bacteria 6593
1251 Ga0495585_0023829 3300046492 Bacteria 3511
1252 Ga0495594_0005409 3300046499 Bacteria 6561
1253 Ga0495594_0051899 3300046499 Bacteria 2257
1254 Ga0495596_0000071 3300046500 Bacteria 75017
1255 Ga0495596_0000198 3300046500 Bacteria 41305
1256 Ga0495596_0000431 3300046500 Bacteria 26861
1257 Ga0495596_0001674 3300046500 Bacteria 12556
1258 Ga0495596_0005802 3300046500 Bacteria 5780
1259 Ga0495607_0000026 3300046501 Bacteria 158900
1260 Ga0495607_0000592 3300046501 Bacteria 35309
1261 Ga0495607_0001793 3300046501 Bacteria 18327
1262 Ga0495607_0003737 3300046501 Bacteria 11518
1263 Ga0495607_0012525 3300046501 Bacteria 5593
1264 Ga0495583_0000177 3300046506 Bacteria 108704
1265 Ga0495583_0000204 3300046506 Bacteria 99749
1266 Ga0495583_0000214 3300046506 Bacteria 97639
1267 Ga0495583_0000328 3300046506 Bacteria 75213
1268 Ga0495583_0000882 3300046506 Bacteria 36164
1269 Ga0495583_0000943 3300046506 Bacteria 33839
1270 Ga0495583_0001291 3300046506 Bacteria 26128
1271 Ga0495583_0001650 3300046506 Bacteria 21668
1272 Ga0495583_0002391 3300046506 Bacteria 16158
1273 Ga0495583_0005525 3300046506 Bacteria 8559
1274 Ga0495606_0003352 3300046507 Bacteria 17078
1275 Ga0495606_0003707 3300046507 Bacteria 15960
1276 Ga0495606_0005160 3300046507 Bacteria 12637
1277 Ga0495606_0007566 3300046507 Bacteria 9678
1278 Ga0495606_0022708 3300046507 Bacteria 4561
1279 Ga0495608_0004347 3300046511 Bacteria 10152
1280 Ga0495608_0025134 3300046511 Bacteria 4066
1281 Ga0495608_0038607 3300046511 Bacteria 3205
1282 Ga0495610_0000067 3300046512 Bacteria 123466
1283 Ga0495610_0000303 3300046512 Bacteria 51903
1284 Ga0495610_0002976 3300046512 Bacteria 13669
1285 Ga0495610_0006826 3300046512 Bacteria 7740
1286 Ga0495610_0009179 3300046512 Bacteria 6282
1287 Ga0495616_0000236 3300046513 Bacteria 44963
1288 Ga0495616_0000658 3300046513 Bacteria 25633
1289 Ga0495616_0001746 3300046513 Bacteria 14803
1290 Ga0495616_0008942 3300046513 Bacteria 5885
1291 Ga0495618_0001351 3300046514 Bacteria 16490
1292 Ga0495618_0006888 3300046514 Bacteria 6890
1293 Ga0495618_0037468 3300046514 Bacteria 3045
1294 Ga0495620_0008985 3300046515 Bacteria 5337
1295 Ga0495628_0000137 3300046516 Bacteria 62400
1296 Ga0495628_0002801 3300046516 Bacteria 15649
1297 Ga0495628_0006104 3300046516 Bacteria 10536
1298 Ga0495628_0021125 3300046516 Bacteria 5360
1299 Ga0495628_0063567 3300046516 Bacteria 2891
1300 Ga0495630_0010541 3300046517 Bacteria 6678
1301 Ga0495630_0014114 3300046517 Bacteria 5815
1302 Ga0495630_0023682 3300046517 Bacteria 4539
1303 Ga0495632_0000236 3300046519 Bacteria 55200
1304 Ga0495632_0001093 3300046519 Bacteria 23220
1305 Ga0495632_0007541 3300046519 Bacteria 6815
1306 Ga0495637_0000006 3300046520 Bacteria 435763
1307 Ga0495643_0000256 3300046522 Bacteria 78412
1308 Ga0495643_0000341 3300046522 Bacteria 63337
1309 Ga0495643_0000400 3300046522 Bacteria 56861
1310 Ga0495643_0002459 3300046522 Bacteria 14660
1311 Ga0495643_0006131 3300046522 Bacteria 7988
1312 Ga0495643_0016605 3300046522 Bacteria 4323
1313 Ga0495643_0017003 3300046522 Bacteria 4262
1314 Ga0495644_0000073 3300046523 Bacteria 49382
1315 Ga0495644_0000257 3300046523 Bacteria 24344
1316 Ga0495648_0000003 3300046524 Bacteria 386817
1317 Ga0495648_0000410 3300046524 Bacteria 47244
1318 Ga0495648_0002104 3300046524 Bacteria 18767
1319 Ga0495648_0011226 3300046524 Bacteria 6763
1320 Ga0495648_0016879 3300046524 Bacteria 5246
1321 Ga0495666_0000207 3300046526 Bacteria 25106
1322 Ga0495666_0000335 3300046526 Bacteria 20557
1323 Ga0495666_0001150 3300046526 Bacteria 12686
1324 Ga0495666_0028157 3300046526 Bacteria 2765
1325 Ga0495642_0001735 3300046528 Bacteria 9394
1326 Ga0495642_0002633 3300046528 Bacteria 7232
1327 Ga0495642_0003987 3300046528 Bacteria 5769
1328 Ga0495642_0021028 3300046528 Bacteria 2565
1329 Ga0495652_0004075 3300046529 Bacteria 14117
1330 Ga0495652_0006686 3300046529 Bacteria 10705
1331 Ga0495652_0021384 3300046529 Bacteria 5752
1332 Ga0495652_0031836 3300046529 Bacteria 4616
1333 Ga0495665_0000823 3300046531 Bacteria 16288
1334 Ga0495665_0002423 3300046531 Bacteria 10080
1335 Ga0495640_0002342 3300046533 Bacteria 15204
1336 Ga0495640_0002769 3300046533 Bacteria 14103
1337 Ga0495640_0042568 3300046533 Bacteria 3166
1338 Ga0495586_0000456 3300046535 Bacteria 24555
1339 Ga0495586_0000616 3300046535 Bacteria 20577
1340 Ga0495586_0005092 3300046535 Bacteria 7033
1341 Ga0495586_0011201 3300046535 Bacteria 4767
1342 Ga0495587_0005545 3300046536 Bacteria 8234
1343 Ga0495587_0006160 3300046536 Bacteria 7827
1344 Ga0495609_0000234 3300046538 Bacteria 52809
1345 Ga0495609_0001625 3300046538 Bacteria 14655
1346 Ga0495609_0006028 3300046538 Bacteria 6248
1347 Ga0495609_0009118 3300046538 Bacteria 4815
1348 Ga0495621_0000447 3300046539 Bacteria 10144
1349 Ga0495597_0000024 3300046542 Bacteria 143948
1350 Ga0495597_0001999 3300046542 Bacteria 13684
1351 Ga0495645_0001667 3300046543 Bacteria 15085
1352 Ga0495645_0016143 3300046543 Bacteria 5323
1353 Ga0495645_0055656 3300046543 Bacteria 2872
1354 Ga0495622_0007410 3300046557 Bacteria 5090
1355 Ga0495633_0000801 3300046558 Bacteria 28059
1356 Ga0495633_0002060 3300046558 Bacteria 14494
1357 Ga0495633_0003237 3300046558 Bacteria 10984
1358 Ga0495633_0025592 3300046558 Bacteria 2904
1359 Ga0495633_0035742 3300046558 Bacteria 2385
1360 Ga0495656_0002105 3300046615 Bacteria 6573
1361 Ga0495656_0019002 3300046615 Bacteria 2646
1362 Ga0495668_0000008 3300046616 Bacteria 498364
1363 Ga0495668_0000136 3300046616 Bacteria 111262
1364 Ga0495668_0000707 3300046616 Bacteria 40246
1365 Ga0495668_0009919 3300046616 Bacteria 5806
1366 Ga0495668_0029985 3300046616 Bacteria 3073
1367 Ga0495634_0002106 3300046642 Bacteria 16806
1368 Ga0495634_0003611 3300046642 Bacteria 12356
1369 Ga0495634_0006200 3300046642 Bacteria 9112
1370 Ga0495634_0019706 3300046642 Bacteria 4790
1371 Ga0495634_0020395 3300046642 Bacteria 4700
1372 Ga0495611_0000123 3300046648 Bacteria 54632
1373 Ga0495611_0000240 3300046648 Bacteria 37890
1374 Ga0495611_0001717 3300046648 Bacteria 10622
1375 Ga0495611_0002117 3300046648 Bacteria 9307
1376 Ga0495611_0004434 3300046648 Bacteria 6073
1377 Ga0495611_0006212 3300046648 Bacteria 5097
1378 Ga0495625_0000336 3300046660 Bacteria 71606
1379 Ga0495625_0001112 3300046660 Bacteria 34873
1380 Ga0495625_0003729 3300046660 Bacteria 14846
1381 Ga0495625_0003952 3300046660 Bacteria 14245
1382 Ga0495625_0005705 3300046660 Bacteria 11266
1383 Ga0495625_0021357 3300046660 Bacteria 4986
1384 Ga0495635_0008481 3300046663 Bacteria 7178
1385 Ga0495661_0000252 3300046665 Bacteria 61493
1386 Ga0495661_0000421 3300046665 Bacteria 44752
1387 Ga0495661_0001079 3300046665 Bacteria 24009
1388 Ga0495661_0001659 3300046665 Bacteria 18142
1389 Ga0495661_0012258 3300046665 Bacteria 5790
1390 Ga0495661_0026576 3300046665 Bacteria 3727
1391 Ga0495661_0039830 3300046665 Bacteria 2917
1392 Ga0495661_0046012 3300046665 Bacteria 2666
1393 Ga0495588_0000070 3300046674 Bacteria 227611
1394 Ga0495588_0005538 3300046674 Bacteria 5624
1395 Ga0495599_0001260 3300046678 Bacteria 14364
1396 Ga0495599_0005345 3300046678 Bacteria 7665
1397 Ga0495623_0002007 3300046679 Bacteria 13665
1398 Ga0495623_0002932 3300046679 Bacteria 11221
1399 Ga0495623_0004896 3300046679 Bacteria 8778
1400 Ga0495623_0019220 3300046679 Bacteria 4417
1401 Ga0495646_0000375 3300046680 Bacteria 23285
1402 Ga0495646_0001418 3300046680 Bacteria 14248
1403 Ga0495646_0002095 3300046680 Bacteria 12086
1404 Ga0495646_0005299 3300046680 Bacteria 8141
1405 Ga0495646_0006489 3300046680 Bacteria 7419
1406 Ga0495669_0000554 3300046684 Bacteria 16597
1407 Ga0495669_0000762 3300046684 Bacteria 13801
1408 Ga0495669_0015511 3300046684 Bacteria 3264
1409 Ga0495613_0002909 3300046689 Bacteria 12825
1410 Ga0495613_0005078 3300046689 Bacteria 9865
1411 Ga0495613_0023865 3300046689 Bacteria 4558
1412 Ga0495624_0003671 3300046690 Bacteria 11345
1413 Ga0495624_0007815 3300046690 Bacteria 7504
1414 Ga0495624_0034571 3300046690 Bacteria 3268
1415 Ga0495624_0039433 3300046690 Bacteria 3028
1416 Ga0495670_0001773 3300046691 Bacteria 10603
1417 Ga0495670_0002028 3300046691 Bacteria 9980
1418 Ga0495649_0000048 3300046694 Bacteria 118180
1419 Ga0495649_0000150 3300046694 Bacteria 60827
1420 Ga0495649_0003754 3300046694 Bacteria 10086
1421 Ga0495649_0012052 3300046694 Bacteria 5046
1422 Ga0495649_0022509 3300046694 Bacteria 3526
1423 Ga0495589_0000036 3300046794 Bacteria 153299
1424 Ga0495589_0000175 3300046794 Bacteria 57368
1425 Ga0495589_0008630 3300046794 Bacteria 5314
1426 Ga0495589_0010655 3300046794 Bacteria 4782
1427 Ga0495600_0005612 3300046809 Bacteria 7574
1428 Ga0495600_0012542 3300046809 Bacteria 5302
1429 Ga0495600_0019446 3300046809 Bacteria 4337
1430 Ga0495660_0000113 3300046810 Bacteria 86593
1431 Ga0495581_0000183 3300047315 Bacteria 28887
1432 Ga0495581_0026119 3300047315 Bacteria 3387
1433 Ga0495604_0002010 3300047317 Bacteria 16396
1434 Ga0495604_0009554 3300047317 Bacteria 7671
1435 Ga0495604_0055848 3300047317 Bacteria 3042
1436 Ga0495604_0062546 3300047317 Bacteria 2842
1437 Ga0495636_0000347 3300047318 Bacteria 17674
1438 Ga0495674_0005804 3300047319 Bacteria 11834
1439 Ga0495674_0016705 3300047319 Bacteria 6847
1440 Ga0495674_0026986 3300047319 Bacteria 5252
1441 Ga0495672_0000389 3300047320 Bacteria 54063
1442 Ga0495672_0000510 3300047320 Bacteria 44816
1443 Ga0495672_0001846 3300047320 Bacteria 20194
1444 Ga0495672_0002343 3300047320 Bacteria 17511
1445 Ga0495672_0006574 3300047320 Bacteria 8957
1446 Ga0495676_0000349 3300047321 Bacteria 37663
1447 Ga0495676_0001635 3300047321 Bacteria 19509
1448 Ga0495676_0006349 3300047321 Bacteria 10887
1449 Ga0495680_0001822 3300047322 Bacteria 22500
1450 Ga0495680_0003491 3300047322 Bacteria 15436
1451 Ga0495680_0012420 3300047322 Bacteria 7495
1452 Ga0495680_0019390 3300047322 Bacteria 5740
1453 Ga0495680_0021410 3300047322 Bacteria 5413
1454 Ga0495680_0029726 3300047322 Bacteria 4471
1455 Ga0495683_0000088 3300047323 Bacteria 92118
1456 Ga0495683_0000415 3300047323 Bacteria 34114
1457 Ga0495683_0001111 3300047323 Bacteria 18578
1458 Ga0495683_0005598 3300047323 Bacteria 6961
1459 Ga0495683_0007201 3300047323 Bacteria 6038
1460 Ga0495683_0007204 3300047323 Bacteria 6037
1461 Ga0495683_0010252 3300047323 Bacteria 4961
1462 Ga0495683_0014117 3300047323 Bacteria 4162
1463 Ga0495683_0015023 3300047323 Bacteria 4032
1464 Ga0495683_0019256 3300047323 Bacteria 3523
1465 Ga0495687_000074 3300047443 Bacteria 153464
1466 Ga0495687_000256 3300047443 Bacteria 71778
1467 Ga0495687_000751 3300047443 Bacteria 35120
1468 Ga0495687_002463 3300047443 Bacteria 14800
1469 Ga0495675_0001414 3300047444 Bacteria 14538
1470 Ga0495675_0004099 3300047444 Bacteria 8828
1471 Ga0495675_0017141 3300047444 Bacteria 4585
1472 Ga0495675_0022922 3300047444 Bacteria 3980
1473 Ga0495677_0000042 3300047445 Bacteria 75189
1474 Ga0495679_000139 3300047446 Bacteria 65340
1475 Ga0495679_000825 3300047446 Bacteria 19712
1476 Ga0495679_001321 3300047446 Bacteria 14389
1477 Ga0495679_002878 3300047446 Bacteria 8527
1478 Ga0495685_000012 3300047447 Bacteria 80496
1479 Ga0495681_0000221 3300047470 Bacteria 47433
1480 Ga0495681_0013062 3300047470 Bacteria 4844
1481 Ga0495681_0014450 3300047470 Bacteria 4523
1482 Ga0495686_0000067 3300047472 Bacteria 218601
1483 Ga0495686_0000119 3300047472 Bacteria 165244
1484 Ga0495686_0000817 3300047472 Bacteria 40177
1485 Ga0495686_0001294 3300047472 Bacteria 28201
1486 Ga0495686_0046269 3300047472 Bacteria 2751
1487 Ga0495686_0053430 3300047472 Bacteria 2532
1488 Ga0495593_0003322 3300047673 Bacteria 9645
1489 Ga0495593_0009182 3300047673 Bacteria 5731
1490 Ga0495593_0010366 3300047673 Bacteria 5388
1491 Ga0495593_0025904 3300047673 Bacteria 3244
1492 Ga0495602_0001984 3300048088 Bacteria 20519
1493 Ga0495602_0003463 3300048088 Bacteria 16321
1494 Ga0495602_0005930 3300048088 Bacteria 12818
1495 Ga0495602_0063413 3300048088 Bacteria 3202
1496 Ga0495614_0000420 3300048089 Bacteria 17434
1497 Ga0495614_0000712 3300048089 Bacteria 14018
1498 Ga0495614_0005320 3300048089 Bacteria 5805
1499 Ga0495626_0000006 3300048091 Bacteria 284977
1500 Ga0495626_0000255 3300048091 Bacteria 61151
1501 Ga0495626_0000855 3300048091 Bacteria 27104
1502 Ga0495626_0002374 3300048091 Bacteria 13153
1503 Ga0495626_0007886 3300048091 Bacteria 5894
1504 Ga0495626_0008465 3300048091 Bacteria 5637
1505 Ga0496100_0013848 3300048903 Bacteria 4665
1506 Ga0496100_0015993 3300048903 Bacteria 4394
1507 Ga0496100_0043157 3300048903 Bacteria 2883
1508 Ga0496101_0001746 3300048904 Bacteria 13018
1509 Ga0496101_0010062 3300048904 Bacteria 6234
1510 Ga0496101_0030459 3300048904 Bacteria 3783
1511 Ga0496102_0000010 3300048905 Bacteria 324617
1512 Ga0496102_0000107 3300048905 Bacteria 118250
1513 Ga0496102_0001256 3300048905 Bacteria 22850
1514 Ga0496102_0002022 3300048905 Bacteria 17516
1515 Ga0496102_0018238 3300048905 Bacteria 6163
1516 Ga0496102_0030526 3300048905 Bacteria 4825
1517 Ga0496102_0110025 3300048905 Bacteria 2568
1518 Ga0496103_0000029 3300048906 Bacteria 213326
1519 Ga0496103_0001718 3300048906 Bacteria 14310
1520 Ga0496104_0001677 3300048907 Bacteria 19132
1521 Ga0496104_0004147 3300048907 Bacteria 12582
1522 Ga0496104_0007391 3300048907 Bacteria 9707
1523 Ga0496104_0009623 3300048907 Bacteria 8608
1524 Ga0496104_0009639 3300048907 Bacteria 8599
1525 Ga0496104_0010052 3300048907 Bacteria 8444
1526 Ga0496104_0067461 3300048907 Bacteria 3398
1527 Ga0496105_0000423 3300048908 Bacteria 27810
1528 Ga0496105_0002735 3300048908 Bacteria 12865
1529 Ga0496105_0005575 3300048908 Bacteria 9560
1530 Ga0496105_0024976 3300048908 Bacteria 4857
1531 Ga0496105_0034874 3300048908 Bacteria 4140
1532 Ga0496105_0085560 3300048908 Bacteria 2605
1533 Ga0496106_0000001 3300048909 Bacteria 497458
1534 Ga0496106_0000152 3300048909 Bacteria 51253
1535 Ga0496106_0002957 3300048909 Bacteria 12638
1536 Ga0496106_0003131 3300048909 Bacteria 12346
1537 Ga0496106_0005518 3300048909 Bacteria 9359
1538 Ga0496106_0009781 3300048909 Bacteria 7084
1539 Ga0496106_0030397 3300048909 Bacteria 4029
1540 Ga0496107_0004080 3300048910 Bacteria 9837
1541 Ga0496107_0034522 3300048910 Bacteria 3623
1542 Ga0496107_0036979 3300048910 Bacteria 3503
1543 Ga0496108_0000373 3300048911 Bacteria 37319
1544 Ga0496108_0001803 3300048911 Bacteria 17073
1545 Ga0496108_0011360 3300048911 Bacteria 7239
1546 Ga0496108_0016326 3300048911 Bacteria 6057
1547 Ga0496109_0001220 3300048912 Bacteria 21354
1548 Ga0496109_0024792 3300048912 Bacteria 5336
1549 Ga0496110_0000073 3300048913 Bacteria 51301
1550 Ga0496110_0004858 3300048913 Bacteria 10483
1551 Ga0496110_0007314 3300048913 Bacteria 8810
1552 Ga0496110_0033439 3300048913 Bacteria 4447
1553 Ga0496110_0036872 3300048913 Bacteria 4248
1554 Ga0496110_0055643 3300048913 Bacteria 3481
1555 Ga0496111_0000701 3300048914 Bacteria 17721
1556 Ga0496111_0000784 3300048914 Bacteria 16954
1557 Ga0496111_0016266 3300048914 Bacteria 5124
1558 Ga0496111_0018401 3300048914 Bacteria 4840
1559 Ga0496111_0047692 3300048914 Bacteria 3085
1560 Ga0496112_0000798 3300048915 Bacteria 22239
1561 Ga0496112_0004378 3300048915 Bacteria 11951
1562 Ga0496112_0068977 3300048915 Bacteria 3492
1563 Ga0496113_0000607 3300048916 Bacteria 17884
1564 Ga0496113_0000807 3300048916 Bacteria 16247
1565 Ga0496113_0010522 3300048916 Bacteria 6118
1566 Ga0496113_0033105 3300048916 Bacteria 3761
1567 Ga0496114_0007398 3300048917 Bacteria 8677
1568 Ga0496114_0010920 3300048917 Bacteria 7239
1569 Ga0496114_0018009 3300048917 Bacteria 5707
1570 Ga0496114_0038375 3300048917 Bacteria 3963
1571 Ga0496115_0001706 3300048918 Bacteria 15751
1572 Ga0496115_0002646 3300048918 Bacteria 12860
1573 Ga0496115_0005174 3300048918 Bacteria 9484
1574 Ga0496116_0000045 3300048919 Bacteria 324307
1575 Ga0496116_0000942 3300048919 Bacteria 35835
1576 Ga0496116_0013075 3300048919 Bacteria 6726
1577 Ga0496116_0052649 3300048919 Bacteria 2695
1578 Ga0496117_0000037 3300048920 Bacteria 324960
1579 Ga0496117_0000426 3300048920 Bacteria 70784
1580 Ga0496117_0005076 3300048920 Bacteria 14096
1581 Ga0496117_0011082 3300048920 Bacteria 8111
1582 Ga0496118_0000034 3300048921 Bacteria 322764
1583 Ga0496118_0003961 3300048921 Bacteria 18087
1584 Ga0496118_0004065 3300048921 Bacteria 17737
1585 Ga0496118_0004357 3300048921 Bacteria 16842
1586 Ga0496118_0004955 3300048921 Bacteria 15421
1587 Ga0496118_0007256 3300048921 Bacteria 11820
1588 Ga0496118_0007827 3300048921 Bacteria 11207
1589 Ga0496118_0020975 3300048921 Bacteria 5771
1590 Ga0496118_0028526 3300048921 Bacteria 4698
1591 Ga0496118_0031810 3300048921 Bacteria 4364
1592 Ga0496118_0037334 3300048921 Bacteria 3912
1593 Ga0496119_0002073 3300048922 Bacteria 22665
1594 Ga0496120_0003202 3300048923 Bacteria 15219
1595 Ga0496120_0013678 3300048923 Bacteria 5450
1596 Ga0496120_0017668 3300048923 Bacteria 4613
1597 Ga0496121_0000141 3300048924 Bacteria 161556
1598 Ga0496121_0000164 3300048924 Bacteria 145421
1599 Ga0496121_0000187 3300048924 Bacteria 138361
1600 Ga0496121_0000757 3300048924 Bacteria 59348
1601 Ga0496121_0001113 3300048924 Bacteria 47411
1602 Ga0496121_0001701 3300048924 Bacteria 36111
1603 Ga0496121_0002388 3300048924 Bacteria 28810
1604 Ga0496121_0002599 3300048924 Bacteria 27274
1605 Ga0496121_0003355 3300048924 Bacteria 22973
1606 Ga0496121_0006761 3300048924 Bacteria 14071
1607 Ga0496121_0006957 3300048924 Bacteria 13772
1608 Ga0496121_0013329 3300048924 Bacteria 8846
1609 Ga0496121_0013364 3300048924 Bacteria 8831
1610 Ga0496122_0000047 3300048925 Bacteria 274226
1611 Ga0496122_0000121 3300048925 Bacteria 181589
1612 Ga0496122_0000227 3300048925 Bacteria 125743
1613 Ga0496122_0001022 3300048925 Bacteria 49494
1614 Ga0496122_0001177 3300048925 Bacteria 44728
1615 Ga0496122_0003948 3300048925 Bacteria 18957
1616 Ga0496122_0004408 3300048925 Bacteria 17518
1617 Ga0496122_0008682 3300048925 Bacteria 10894
1618 Ga0496122_0013654 3300048925 Bacteria 7928
1619 Ga0496122_0031883 3300048925 Bacteria 4372
1620 Ga0496122_0035830 3300048925 Bacteria 4028
1621 Ga0496122_0036230 3300048925 Bacteria 3995
1622 Ga0496123_0000040 3300048926 Bacteria 258569
1623 Ga0496123_0000077 3300048926 Bacteria 192607
1624 Ga0496123_0000754 3300048926 Bacteria 52403
1625 Ga0496123_0001919 3300048926 Bacteria 27137
1626 Ga0496123_0002689 3300048926 Bacteria 21404
1627 Ga0496123_0003066 3300048926 Bacteria 19202
1628 Ga0496123_0003280 3300048926 Bacteria 18335
1629 Ga0496123_0004376 3300048926 Bacteria 14910
1630 Ga0496123_0017759 3300048926 Bacteria 5702
1631 Ga0496124_0000007 3300048927 Bacteria 883534
1632 Ga0496124_0000033 3300048927 Bacteria 330586
1633 Ga0496124_0000104 3300048927 Bacteria 177382
1634 Ga0496124_0002656 3300048927 Bacteria 22944
1635 Ga0496124_0005268 3300048927 Bacteria 14635
1636 Ga0496124_0007035 3300048927 Bacteria 12051
1637 Ga0496124_0023714 3300048927 Bacteria 5595
1638 Ga0496124_0027518 3300048927 Bacteria 5102
1639 Ga0496125_0000204 3300048928 Bacteria 125062
1640 Ga0496125_0000241 3300048928 Bacteria 112044
1641 Ga0496125_0000989 3300048928 Bacteria 44313
1642 Ga0496125_0001146 3300048928 Bacteria 40202
1643 Ga0496125_0009351 3300048928 Bacteria 10096
1644 Ga0496125_0014738 3300048928 Bacteria 7594
1645 Ga0496125_0016006 3300048928 Bacteria 7221
1646 Ga0496126_0000032 3300048929 Bacteria 372456
1647 Ga0496126_0000365 3300048929 Bacteria 93461
1648 Ga0496126_0000483 3300048929 Bacteria 78885
1649 Ga0496126_0000623 3300048929 Bacteria 66610
1650 Ga0496126_0000645 3300048929 Bacteria 64753
1651 Ga0496126_0000646 3300048929 Bacteria 64595
1652 Ga0496126_0001006 3300048929 Bacteria 48036
1653 Ga0496126_0001830 3300048929 Bacteria 31034
1654 Ga0496126_0002866 3300048929 Bacteria 22515
1655 Ga0496126_0003623 3300048929 Bacteria 19312
1656 Ga0496126_0003628 3300048929 Bacteria 19298
1657 Ga0496126_0022980 3300048929 Bacteria 6050
1658 Ga0496126_0070527 3300048929 Bacteria 3113
1659 Ga0496126_0076099 3300048929 Bacteria 2978
1660 Ga0495678_001030 3300049459 Bacteria 23650
1661 Ga0495678_001618 3300049459 Bacteria 17180
1662 Ga0495682_0000216 3300049460 Bacteria 45881
1663 Ga0495682_0001700 3300049460 Bacteria 11192
1664 Ga0501031_0004271 3300049568 Bacteria 9235
1665 Ga0501031_0010719 3300049568 Bacteria 5972
1666 Ga0501032_0001403 3300049569 Bacteria 19162
1667 Ga0501032_0005217 3300049569 Bacteria 9669
1668 Ga0501032_0043419 3300049569 Bacteria 3045
1669 Ga0501032_0054326 3300049569 Bacteria 2696
1670 Ga0501033_0001070 3300049570 Bacteria 24898
1671 Ga0501033_0001527 3300049570 Bacteria 20453
1672 Ga0501033_0052053 3300049570 Bacteria 3035
1673 Ga0501034_0001979 3300049571 Bacteria 25958
1674 Ga0501034_0002124 3300049571 Bacteria 24631
1675 Ga0501034_0023261 3300049571 Bacteria 6314
1676 Ga0501034_0035880 3300049571 Bacteria 5027
1677 Ga0501034_0046518 3300049571 Bacteria 4383
1678 Ga0501034_0067978 3300049571 Bacteria 3574
1679 Ga0501034_0109451 3300049571 Bacteria 2754
1680 Ga0501036_0000060 3300049572 Bacteria 72151
1681 Ga0501036_0012375 3300049572 Bacteria 7067
1682 Ga0501036_0074982 3300049572 Bacteria 2861
1683 Ga0501037_0002003 3300049573 Bacteria 14761
1684 Ga0501037_0003436 3300049573 Bacteria 11512
1685 Ga0501037_0005405 3300049573 Bacteria 9304
1686 Ga0501037_0010245 3300049573 Bacteria 6879
1687 Ga0501037_0020469 3300049573 Bacteria 4885
1688 Ga0501038_0002769 3300049574 Bacteria 16313
1689 Ga0501038_0006438 3300049574 Bacteria 10869
1690 Ga0501038_0008096 3300049574 Bacteria 9673
1691 Ga0501039_0003971 3300049575 Bacteria 11113
1692 Ga0501039_0005420 3300049575 Bacteria 9644
1693 Ga0501039_0007946 3300049575 Bacteria 8078
1694 Ga0501040_0034487 3300049576 Bacteria 3428
1695 Ga0501042_0004749 3300049578 Bacteria 8676
1696 Ga0501042_0013715 3300049578 Bacteria 5519
1697 Ga0501043_0000018 3300049579 Bacteria 161101
1698 Ga0501043_0002136 3300049579 Bacteria 16874
1699 Ga0501043_0006187 3300049579 Bacteria 9616
1700 Ga0501043_0011238 3300049579 Bacteria 7014
1701 Ga0501046_0000042 3300049580 Bacteria 151850
1702 Ga0501046_0003351 3300049580 Bacteria 14710
1703 Ga0501046_0004252 3300049580 Bacteria 13031
1704 Ga0501046_0019846 3300049580 Bacteria 5566
1705 Ga0501047_0000052 3300049581 Bacteria 153448
1706 Ga0501047_0000888 3300049581 Bacteria 30514
1707 Ga0501047_0003715 3300049581 Bacteria 14372
1708 Ga0501047_0009262 3300049581 Bacteria 9300
1709 Ga0501047_0010324 3300049581 Bacteria 8830
1710 Ga0501048_0016931 3300049582 Bacteria 5373
1711 Ga0501067_0005114 3300049583 Bacteria 7287
1712 Ga0501068_0004506 3300049584 Bacteria 7581
1713 Ga0501069_0003376 3300049585 Bacteria 8196
1714 Ga0501070_0001537 3300049586 Bacteria 20513
1715 Ga0501070_0003782 3300049586 Bacteria 13078
1716 Ga0501070_0125260 3300049586 Bacteria 2123
1717 Ga0501072_0002091 3300049588 Bacteria 14871
1718 Ga0501073_0000690 3300049589 Bacteria 23740
1719 Ga0501073_0006811 3300049589 Bacteria 8497
1720 Ga0501073_0052765 3300049589 Bacteria 2847
1721 Ga0501074_0008203 3300049590 Bacteria 7569
1722 Ga0501074_0066894 3300049590 Bacteria 2584
1723 Ga0501075_0001438 3300049591 Bacteria 15475
1724 Ga0501076_0020462 3300049592 Bacteria 5066
1725 Ga0501077_0013081 3300049593 Bacteria 5201
1726 Ga0501198_000023 3300049649 Bacteria 69100
1727 Ga0501222_000031 3300049662 Bacteria 56867
1728 Ga0501223_000641 3300049663 Bacteria 8393
1729 Ga0501224_000030 3300049664 Bacteria 45775
1730 Ga0501249_000109 3300049679 Bacteria 25443
1731 Ga0501249_001756 3300049679 Bacteria 4419
1732 Ga0501257_000010 3300049686 Bacteria 53242
1733 Ga0501225_0000009 3300049705 Bacteria 90065
1734 Ga0501079_0021530 3300049741 Bacteria 4931
1735 Ga0501080_0000579 3300049742 Bacteria 28988
1736 Ga0501080_0002387 3300049742 Bacteria 16386
1737 Ga0501080_0020081 3300049742 Bacteria 6183
1738 Ga0501081_0000068 3300049743 Bacteria 39631
1739 Ga0501081_0016753 3300049743 Bacteria 4845
1740 Ga0501083_0005480 3300049744 Bacteria 8988
1741 Ga0501083_0011935 3300049744 Bacteria 6087
1742 Ga0501083_0012389 3300049744 Bacteria 5967
1743 Ga0501035_0001027 3300049822 Bacteria 29312
1744 Ga0501035_0005534 3300049822 Bacteria 11938
1745 Ga0501035_0007411 3300049822 Bacteria 10250
1746 Ga0501035_0008540 3300049822 Bacteria 9535
1747 Ga0501035_0010097 3300049822 Bacteria 8764
1748 Ga0501035_0036959 3300049822 Bacteria 4424
1749 Ga0501035_0062687 3300049822 Bacteria 3308
1750 Ga0501044_0000124 3300049823 Bacteria 92998
1751 Ga0501044_0001652 3300049823 Bacteria 26175
1752 Ga0501044_0004791 3300049823 Bacteria 15136
1753 Ga0501044_0009078 3300049823 Bacteria 10866
1754 Ga0501044_0010049 3300049823 Bacteria 10283
1755 Ga0501044_0015775 3300049823 Bacteria 8134
1756 Ga0501044_0038369 3300049823 Bacteria 5002
1757 Ga0501044_0042482 3300049823 Bacteria 4728
1758 Ga0501044_0051062 3300049823 Bacteria 4265
1759 Ga0501044_0090847 3300049823 Bacteria 3080
1760 Ga0501226_000054 3300049853 Bacteria 39689
1761 nmdc:mga03683_51_c1 3300050489 Bacteria 50013
1762 nmdc:mga03n38_10371_c1 3300050490 Bacteria 3423
1763 nmdc:mga03n38_1096_c1 3300050490 Bacteria 7473
1764 nmdc:mga00v17_26210_c1 3300050491 Bacteria 3395
1765 nmdc:mga00v17_3284_c1 3300050491 Bacteria 8334
1766 nmdc:mga00v17_4140_c1 3300050491 Bacteria 7507
1767 nmdc:mga00v17_4641_c2 3300050491 Bacteria 6185
1768 nmdc:mga0yw44_1947_c1 3300050492 Bacteria 8553
1769 nmdc:mga0yw44_3238_c1 3300050492 Bacteria 6299
1770 nmdc:mga0k408_2030_c1 3300050493 Bacteria 10833
1771 nmdc:mga0k408_3_c1 3300050493 Bacteria 243777
1772 nmdc:mga0k408_9979_c1 3300050493 Bacteria 5126
1773 nmdc:mga07m45_6782_c1 3300050496 Bacteria 5817
1774 nmdc:mga07m45_6_c1 3300050496 Bacteria 260521
1775 nmdc:mga05p37_141792_c1 3300050507 Bacteria 2944
1776 nmdc:mga05p37_14521_c1 3300050507 Bacteria 9458
1777 nmdc:mga09592_6057_c1 3300050508 Bacteria 9861
1778 nmdc:mga0qj67_1028_c1 3300050509 Bacteria 19293
1779 nmdc:mga0qj67_57248_c1 3300050509 Bacteria 3090
1780 nmdc:mga06r32_3631_c1 3300050510 Bacteria 13773
1781 nmdc:mga06r32_7686_c1 3300050510 Bacteria 9698
1782 nmdc:mga08y16_27923_c1 3300050511 Bacteria 5950
1783 nmdc:mga08y16_3456_c1 3300050511 Bacteria 16392
1784 nmdc:mga08y16_6769_c1 3300050511 Bacteria 12024
1785 nmdc:mga0n895_16310_c1 3300050512 Bacteria 6813
1786 nmdc:mga0n895_7662_c1 3300050512 Bacteria 9283
1787 nmdc:mga0rr50_20425_c1 3300050513 Bacteria 4498
1788 nmdc:mga08x19_37_c1 3300050514 Bacteria 163624
1789 nmdc:mga08x19_8308_c2 3300050514 Bacteria 5360
1790 nmdc:mga0a205_35391_c1 3300050515 Bacteria 4795
1791 nmdc:mga0sz30_6523_c1 3300050516 Bacteria 4335
1792 Ga0495601_0020846 3300053077 Bacteria 4007
1793 Ga0500610_0001684 3300053079 Bacteria 7715
1794 Ga0500635_0000219 3300053080 Bacteria 26686
1795 Ga0495619_0029766 3300053085 Bacteria 3530
1796 Ga0495619_0030108 3300053085 Bacteria 3512
1797 Ga0500643_000017 3300053087 Bacteria 305781
1798 Ga0500643_000039 3300053087 Bacteria 169629
1799 Ga0500643_000190 3300053087 Bacteria 58677
1800 Ga0500644_0005925 3300053088 Bacteria 3107
1801 Ga0500651_0003445 3300053093 Bacteria 8650
1802 Ga0500566_0002853 3300053094 Bacteria 10293
1803 Ga0500555_000240 3300053103 Bacteria 24396
1804 Ga0500592_000146 3300053116 Bacteria 14471
1805 Ga0500593_010279 3300053117 Bacteria 3920
1806 Ga0500595_000291 3300053119 Bacteria 32971
1807 Ga0500607_000132 3300053121 Bacteria 61625
1808 Ga0500608_003164 3300053122 Bacteria 6120
1809 Ga0500618_000844 3300053125 Bacteria 16595
1810 Ga0500618_002688 3300053125 Bacteria 6499
1811 Ga0500618_004709 3300053125 Bacteria 4285
1812 Ga0500658_0002200 3300053134 Bacteria 7570
1813 Ga0500568_0012899 3300053139 Bacteria 3826
1814 Ga0500573_0000055 3300053140 Bacteria 82259
1815 Ga0500573_0010174 3300053140 Bacteria 5243
1816 Ga0500590_000468 3300053148 Bacteria 13790
1817 Ga0500590_007035 3300053148 Bacteria 5526
1818 Ga0500600_0014439 3300053149 Bacteria 4803
1819 Ga0500616_0000267 3300053153 Bacteria 78217
1820 Ga0500616_0002529 3300053153 Bacteria 15116
1821 Ga0500622_0000166 3300053156 Bacteria 70429
1822 Ga0500622_0015599 3300053156 Bacteria 4067
1823 Ga0500627_0000232 3300053158 Bacteria 15858
1824 Ga0500634_0000006 3300053161 Bacteria 171639
1825 Ga0500634_0005072 3300053161 Bacteria 6202
1826 Ga0500636_0000001 3300053177 Bacteria 324086
1827 Ga0500625_000026 3300053729 Bacteria 60801
1828 Ga0501084_0046504 3300054114 Bacteria 3636
1829 Ga0501084_0086224 3300054114 Bacteria 2636
1830 Ga0500661_001784 3300055283 Bacteria 4057
1831 Ga0587068_000804 3300059641 Bacteria 3170
1832 Ga0501082_0001515 3300060353 Bacteria 20458
1833 Ga0501082_0008182 3300060353 Bacteria 9025
1834 Ga0501082_0023107 3300060353 Bacteria 5362
1835 Ga0466962_0001534 3300061719 Bacteria 10793
1836 Ga0466962_0007435 3300061719 Bacteria 5257
1837 Ga0466962_0008092 3300061719 Bacteria 5041
1838 Ga0466962_0010609 3300061719 Bacteria 4431
1839 Ga0466962_0016040 3300061719 Bacteria 3614

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2881412998 2881413246 631
2 iso_pu_bacteria 2881412998 2881412998 632
3 3300026035 Ga0207703_10019103 Ga0207703_100191033 641
4 3300044656 Ga0466969_0006156 Ga0466969_0006156_4353_6353 643
5 3300044684 Ga0466966_0065799 Ga0466966_0065799_231_2243 653
6 3300046522 Ga0495643_0016605 Ga0495643_0016605_2284_4296 653
7 3300049580 Ga0501046_0019846 Ga0501046_0019846_3548_5554 653
8 3300049586 Ga0501070_0125260 Ga0501070_0125260_32_2053 658
9 3300037312 Ga0395899_0067005 Ga0395899_0067005_609_2624 662
10 3300035111 Ga0373923_0016410 Ga0373923_0016410_17_2032 663
11 3300047323 Ga0495683_0010252 Ga0495683_0010252_17_2041 663
12 3300053093 Ga0500651_0003445 Ga0500651_0003445_6582_8627 666
13 3300046452 Ga0495617_001319 Ga0495617_001319_13_2058 667
14 iso_pu_bacteria 2921643360 2921651637 672
15 3300046499 Ga0495594_0051899 Ga0495594_0051899_142_2211 676
16 3300053117 Ga0500593_010279 Ga0500593_010279_1853_3910 677
17 iso_pu_bacteria 2639762793 2640735049 680
18 3300046558 Ga0495633_0035742 Ga0495633_0035742_298_2370 681
19 3300009177 Ga0105248_10084550 Ga0105248_100845502 701
20 3300046452 Ga0495617_017486 Ga0495617_017486_236_2368 703
21 3300046472 Ga0495580_0020273 Ga0495580_0020273_16_2145 709
22 3300046694 Ga0495649_0003754 Ga0495649_0003754_7918_10068 710
23 3300046809 Ga0495600_0019446 Ga0495600_0019446_2165_4306 713
24 3300053125 Ga0500618_000844 Ga0500618_000844_14300_16567 717
25 iso_pu_bacteria 2738541281 2738744852 721
26 iso_pu_bacteria 2738543032 2739354082 721
27 3300046457 Ga0495590_0001900 Ga0495590_0001900_4249_6438 722
28 3300046615 Ga0495656_0019002 Ga0495656_0019002_403_2592 722
29 3300050516 nmdc:mga0sz30_6523_c1 nmdc:mga0sz30_6523_c1_2086_4278 722
30 3300006042 Ga0075368_10000888 Ga0075368_100008886 723
31 3300006178 Ga0075367_10010720 Ga0075367_100107202 723
32 3300006186 Ga0075369_10010589 Ga0075369_100105892 723
33 3300006195 Ga0075366_10009735 Ga0075366_100097353 723
34 3300014325 Ga0163163_10000012 Ga0163163_1000001228 723
35 3300050493 nmdc:mga0k408_9979_c1 nmdc:mga0k408_9979_c1_1467_3752 723
36 iso_pu_bacteria 2902682994 2902686076 724
37 3300030521 Ga0307511_10000011 Ga0307511_10000011116 725
38 3300048905 Ga0496102_0110025 Ga0496102_0110025_340_2550 727
39 3300049679 Ga0501249_000109 Ga0501249_000109_16832_19030 727
40 3300049588 Ga0501072_0002091 Ga0501072_0002091_5849_8158 728
41 3300025298 Ga0209050_1000267 Ga0209050_100026743 729
42 3300046459 Ga0495629_0033556 Ga0495629_0033556_12_2231 729
43 3300046529 Ga0495652_0006686 Ga0495652_0006686_8426_10645 729
44 3300046542 Ga0495597_0000024 Ga0495597_0000024_591_2891 729
45 3300046679 Ga0495623_0004896 Ga0495623_0004896_376_2595 729
46 3300048919 Ga0496116_0000045 Ga0496116_0000045_53807_56068 729
47 3300048921 Ga0496118_0028526 Ga0496118_0028526_714_2975 729
48 3300048924 Ga0496121_0013329 Ga0496121_0013329_1543_3804 729
49 3300048925 Ga0496122_0003948 Ga0496122_0003948_1153_3414 729
50 3300048926 Ga0496123_0003066 Ga0496123_0003066_1398_3659 729
51 3300048927 Ga0496124_0002656 Ga0496124_0002656_15724_17985 729
52 3300048927 Ga0496124_0005268 Ga0496124_0005268_7349_9610 729
53 3300048929 Ga0496126_0001006 Ga0496126_0001006_6221_8482 729
54 3300025941 Ga0207711_10001087 Ga0207711_100010873 730
55 3300028800 Ga0265338_10000118 Ga0265338_10000118119 730
56 3300048918 Ga0496115_0002646 Ga0496115_0002646_6020_8275 730
57 3300048925 Ga0496122_0004408 Ga0496122_0004408_11562_13826 730
58 3300048926 Ga0496123_0004376 Ga0496123_0004376_2810_5074 730
59 3300003214 JGI25165J46597_1002345 JGI25165J46597_10023452 731
60 3300005563 Ga0068855_100015117 Ga0068855_1000151175 731
61 3300009093 Ga0105240_10000005 Ga0105240_10000005625 731
62 3300009545 Ga0105237_10005428 Ga0105237_100054284 731
63 3300013104 Ga0157370_10001194 Ga0157370_1000119413 731
64 3300014497 Ga0182008_10010083 Ga0182008_100100833 731
65 3300015262 Ga0182007_10003675 Ga0182007_100036755 731
66 3300025253 Ga0209677_103277 Ga0209677_1032773 731
67 3300025261 Ga0209233_1000195 Ga0209233_100019542 731
68 3300025913 Ga0207695_10000011 Ga0207695_10000011293 731
69 3300025914 Ga0207671_10000804 Ga0207671_1000080420 731
70 3300037471 Ga0395905_0000002 Ga0395905_0000002_920293_922695 731
71 3300039062 Ga0400483_227762 Ga0400483_227762_6849_9125 731
72 3300048923 Ga0496120_0013678 Ga0496120_0013678_923_3238 731
73 3300048924 Ga0496121_0003355 Ga0496121_0003355_9122_11437 731
74 3300048929 Ga0496126_0022980 Ga0496126_0022980_124_2439 731
75 3300053087 Ga0500643_000190 Ga0500643_000190_24204_26468 731
76 3300016635 Ga0183361_10012 Ga0183361_10012130 733
77 3300032004 Ga0307414_10003680 Ga0307414_100036808 733
78 3300049571 Ga0501034_0001979 Ga0501034_0001979_4603_6924 733
79 3300049586 Ga0501070_0003782 Ga0501070_0003782_7190_9478 733
80 3300049822 Ga0501035_0008540 Ga0501035_0008540_3080_5368 733
81 3300049823 Ga0501044_0015775 Ga0501044_0015775_637_2925 733
82 3300005347 Ga0070668_100007593 Ga0070668_1000075936 734
83 3300005843 Ga0068860_100000260 Ga0068860_10000026012 734
84 3300028380 Ga0268265_10027435 Ga0268265_100274352 734
85 3300028381 Ga0268264_10000169 Ga0268264_1000016972 734
86 3300046457 Ga0495590_0000527 Ga0495590_0000527_4092_6419 734
87 3300046616 Ga0495668_0000008 Ga0495668_0000008_172288_174621 734
88 3300031711 Ga0265314_10005990 Ga0265314_100059903 735
89 3300046463 Ga0495653_0025577 Ga0495653_0025577_1268_3580 735
90 3300047322 Ga0495680_0029726 Ga0495680_0029726_564_2876 735
91 3300047444 Ga0495675_0001414 Ga0495675_0001414_7834_10146 735
92 3300049569 Ga0501032_0043419 Ga0501032_0043419_447_2771 735
93 iso_pu_bacteria 2599185354 2600203056 735
94 iso_pu_bacteria 2643221622 2644127884 735
95 iso_pu_bacteria 2751185897 2753766634 735
96 3300005983 Ga0081540_1000094 Ga0081540_10000943 736
97 3300044656 Ga0466969_0000458 Ga0466969_0000458_4763_7036 736
98 3300044683 Ga0466965_0000292 Ga0466965_0000292_10457_12730 736
99 3300044684 Ga0466966_0012799 Ga0466966_0012799_2371_4644 736
100 3300044693 Ga0466961_0000295 Ga0466961_0000295_6261_8534 736
101 3300044694 Ga0466963_0011767 Ga0466963_0011767_492_2765 736
102 3300044719 Ga0466971_0001015 Ga0466971_0001015_3197_5470 736
103 3300046491 Ga0495584_0012301 Ga0495584_0012301_466_2778 736
104 3300046492 Ga0495585_0005737 Ga0495585_0005737_4605_6917 736
105 3300046507 Ga0495606_0007566 Ga0495606_0007566_4352_6664 736
106 3300046648 Ga0495611_0002117 Ga0495611_0002117_3939_6251 736
107 3300049568 Ga0501031_0004271 Ga0501031_0004271_5304_7601 736
108 iso_pu_bacteria 2643221588 2643951429 736
109 iso_pu_bacteria 2738541275 2738710391 736
110 iso_pu_bacteria 2738541301 2738848816 736
111 iso_pu_bacteria 2738541304 2738864545 736
112 iso_pu_bacteria 2738543022 2739297063 736
113 iso_pu_bacteria 2738543033 2739358741 736
114 iso_pu_bacteria 2818991438 2819551179 736
115 iso_pu_bacteria 2895880812 2895882223 736
116 iso_pu_bacteria 2896253425 2896256020 736
117 iso_pu_bacteria 2928100450 2928100489 736
118 iso_pu_bacteria 2928959182 2928960553 736
119 iso_pu_bacteria 8054302542 8054306687 736
120 3300002774 JGI25150J39212_1000851 JGI25150J39212_10008519 737
121 3300003187 JGI25151J46595_10012126 JGI25151J46595_100121262 737
122 3300003215 JGI25153J46596_10000208 JGI25153J46596_1000020846 737
123 3300003771 Ga0055526_1003684 Ga0055526_10036842 737
124 3300003781 Ga0055536_1013037 Ga0055536_10130371 737
125 3300003792 Ga0055540_1003940 Ga0055540_10039404 737
126 3300005272 Ga0065703_1000513 Ga0065703_10005135 737
127 3300006358 Ga0068871_100027303 Ga0068871_1000273034 737
128 3300025245 Ga0207425_1000025 Ga0207425_10000259 737
129 3300025258 Ga0209129_1002637 Ga0209129_10026374 737
130 3300025294 Ga0209025_1000630 Ga0209025_100063034 737
131 3300025295 Ga0209564_1000745 Ga0209564_100074517 737
132 3300025297 Ga0209758_1000002 Ga0209758_100000293 737
133 3300025297 Ga0209758_1000108 Ga0209758_1000108124 737
134 3300025297 Ga0209758_1006261 Ga0209758_10062618 737
135 3300025298 Ga0209050_1007356 Ga0209050_10073562 737
136 3300025303 Ga0209051_1000226 Ga0209051_100022692 737
137 3300025304 Ga0209257_1001243 Ga0209257_100124318 737
138 3300025304 Ga0209257_1001442 Ga0209257_100144215 737
139 3300046457 Ga0495590_0000061 Ga0495590_0000061_23931_26243 737
140 3300046457 Ga0495590_0015826 Ga0495590_0015826_378_2690 737
141 3300046458 Ga0495591_000401 Ga0495591_000401_4981_7293 737
142 3300046491 Ga0495584_0000283 Ga0495584_0000283_9585_11897 737
143 3300046492 Ga0495585_0003179 Ga0495585_0003179_2525_4837 737
144 3300046506 Ga0495583_0000882 Ga0495583_0000882_28923_31235 737
145 3300046512 Ga0495610_0002976 Ga0495610_0002976_8072_10384 737
146 3300046520 Ga0495637_0000006 Ga0495637_0000006_19457_21769 737
147 3300046522 Ga0495643_0017003 Ga0495643_0017003_1846_4158 737
148 3300046526 Ga0495666_0001150 Ga0495666_0001150_6238_8550 737
149 3300046528 Ga0495642_0003987 Ga0495642_0003987_2232_4544 737
150 3300046616 Ga0495668_0000707 Ga0495668_0000707_1958_4270 737
151 3300046648 Ga0495611_0000123 Ga0495611_0000123_44990_47302 737
152 3300046694 Ga0495649_0000150 Ga0495649_0000150_23946_26258 737
153 3300047320 Ga0495672_0000389 Ga0495672_0000389_42181_44493 737
154 3300047321 Ga0495676_0000349 Ga0495676_0000349_15404_17716 737
155 3300047323 Ga0495683_0000415 Ga0495683_0000415_18308_20620 737
156 3300047443 Ga0495687_000256 Ga0495687_000256_7954_10266 737
157 3300047443 Ga0495687_002463 Ga0495687_002463_8494_10806 737
158 3300048091 Ga0495626_0002374 Ga0495626_0002374_7231_9543 737
159 3300048913 Ga0496110_0000073 Ga0496110_0000073_36736_39048 737
160 iso_pu_bacteria 2510917021 2511130961 737
161 iso_pu_bacteria 2582581305 2585261376 737
162 iso_pu_bacteria 2643221541 2643726828 737
163 iso_pu_bacteria 2643221606 2644046131 737
164 iso_pu_bacteria 2643221671 2644393058 737
165 iso_pu_bacteria 2739367664 2739651119 737
166 iso_pu_bacteria 2739367865 2740029592 737
167 iso_pu_bacteria 2848297114 2848298684 737
168 iso_pu_bacteria 2882806704 2882809524 737
169 3300003215 JGI25153J46596_10003194 JGI25153J46596_100031947 738
170 3300003791 Ga0055530_10000659 Ga0055530_1000065925 738
171 3300003791 Ga0055530_10003389 Ga0055530_100033894 738
172 3300003794 Ga0055531_10000083 Ga0055531_100000832 738
173 3300003794 Ga0055531_10002397 Ga0055531_100023973 738
174 3300005262 Ga0065165_1002458 Ga0065165_10024588 738
175 3300005262 Ga0065165_1007908 Ga0065165_10079084 738
176 3300005262 Ga0065165_1009752 Ga0065165_10097522 738
177 3300005434 Ga0070709_10001252 Ga0070709_100012523 738
178 3300005435 Ga0070714_100011338 Ga0070714_1000113382 738
179 3300005436 Ga0070713_100000199 Ga0070713_10000019915 738
180 3300005614 Ga0068856_100009449 Ga0068856_1000094493 738
181 3300006871 Ga0075434_100014179 Ga0075434_1000141793 738
182 3300006914 Ga0075436_100001475 Ga0075436_10000147511 738
183 3300025263 Ga0209565_1000011 Ga0209565_1000011304 738
184 3300025297 Ga0209758_1003039 Ga0209758_10030398 738
185 3300025298 Ga0209050_1000051 Ga0209050_1000051263 738
186 3300025298 Ga0209050_1001710 Ga0209050_100171010 738
187 3300025299 Ga0209256_1000016 Ga0209256_1000016295 738
188 3300025304 Ga0209257_1000028 Ga0209257_1000028105 738
189 3300025304 Ga0209257_1001649 Ga0209257_100164911 738
190 3300025906 Ga0207699_10000124 Ga0207699_100001247 738
191 3300025915 Ga0207693_10000213 Ga0207693_1000021313 738
192 3300025928 Ga0207700_10000026 Ga0207700_10000026147 738
193 3300025929 Ga0207664_10010373 Ga0207664_100103733 738
194 3300026078 Ga0207702_10000021 Ga0207702_10000021100 738
195 3300028800 Ga0265338_10040150 Ga0265338_100401502 738
196 3300031247 Ga0265340_10003976 Ga0265340_100039766 738
197 3300035724 Ga0373933_0008918 Ga0373933_0008918_861_3113 738
198 3300041413 Ga0439465_0000417 Ga0439465_0000417_8592_10850 738
199 3300042006 Ga0439432_000210 Ga0439432_000210_10790_13048 738
200 3300048929 Ga0496126_0003628 Ga0496126_0003628_9587_11839 738
201 3300050513 nmdc:mga0rr50_20425_c1 nmdc:mga0rr50_20425_c1_1637_3889 738
202 3300050514 nmdc:mga08x19_37_c1 nmdc:mga08x19_37_c1_148962_151214 738
203 3300053094 Ga0500566_0002853 Ga0500566_0002853_5564_7822 738
204 3300053134 Ga0500658_0002200 Ga0500658_0002200_1448_3706 738
205 3300002459 JGI24751J29686_10000330 JGI24751J29686_1000033014 739
206 3300003215 JGI25153J46596_10000792 JGI25153J46596_1000079211 739
207 3300005262 Ga0065165_1000606 Ga0065165_100060627 739
208 3300005289 Ga0065704_10002614 Ga0065704_100026142 739
209 3300005289 Ga0065704_10005595 Ga0065704_100055952 739
210 3300005289 Ga0065704_10070157 Ga0065704_10070157128 739
211 3300005330 Ga0070690_100037936 Ga0070690_1000379362 739
212 3300005339 Ga0070660_100006110 Ga0070660_1000061102 739
213 3300005344 Ga0070661_100000592 Ga0070661_10000059224 739
214 3300005344 Ga0070661_100000837 Ga0070661_10000083721 739
215 3300005347 Ga0070668_100002004 Ga0070668_1000020046 739
216 3300005353 Ga0070669_100000074 Ga0070669_10000007412 739
217 3300005353 Ga0070669_100000514 Ga0070669_1000005146 739
218 3300005355 Ga0070671_100000067 Ga0070671_10000006733 739
219 3300005355 Ga0070671_100002546 Ga0070671_1000025463 739
220 3300005355 Ga0070671_100044759 Ga0070671_1000447592 739
221 3300005364 Ga0070673_100015207 Ga0070673_1000152072 739
222 3300005366 Ga0070659_100023601 Ga0070659_1000236012 739
223 3300005367 Ga0070667_100000194 Ga0070667_10000019421 739
224 3300005367 Ga0070667_100000696 Ga0070667_10000069618 739
225 3300005457 Ga0070662_100040530 Ga0070662_1000405302 739
226 3300005539 Ga0068853_100000191 Ga0068853_10000019124 739
227 3300005548 Ga0070665_100005303 Ga0070665_10000530313 739
228 3300005548 Ga0070665_100050632 Ga0070665_1000506322 739
229 3300005563 Ga0068855_100000994 Ga0068855_1000009949 739
230 3300005563 Ga0068855_100026853 Ga0068855_1000268532 739
231 3300005563 Ga0068855_100115023 Ga0068855_1001150232 739
232 3300005564 Ga0070664_100002779 Ga0070664_1000027794 739
233 3300005564 Ga0070664_100017230 Ga0070664_1000172304 739
234 3300005564 Ga0070664_100050844 Ga0070664_1000508443 739
235 3300005578 Ga0068854_100029383 Ga0068854_1000293832 739
236 3300005614 Ga0068856_100012193 Ga0068856_1000121932 739
237 3300005616 Ga0068852_100007366 Ga0068852_1000073665 739
238 3300005841 Ga0068863_100013084 Ga0068863_1000130848 739
239 3300005843 Ga0068860_100025866 Ga0068860_1000258662 739
240 3300006042 Ga0075368_10000132 Ga0075368_1000013212 739
241 3300006051 Ga0075364_10007698 Ga0075364_100076983 739
242 3300006058 Ga0075432_10001235 Ga0075432_100012355 739
243 3300006177 Ga0075362_10000132 Ga0075362_1000013217 739
244 3300006195 Ga0075366_10000070 Ga0075366_1000007026 739
245 3300006353 Ga0075370_10000009 Ga0075370_1000000941 739
246 3300006946 Ga0079104_1000003 Ga0079104_1000003117 739
247 3300009092 Ga0105250_10001839 Ga0105250_100018397 739
248 3300009148 Ga0105243_10022885 Ga0105243_100228852 739
249 3300009174 Ga0105241_10016328 Ga0105241_100163284 739
250 3300009177 Ga0105248_10009104 Ga0105248_100091042 739
251 3300009177 Ga0105248_10083150 Ga0105248_100831502 739
252 3300013100 Ga0157373_10006481 Ga0157373_100064815 739
253 3300013102 Ga0157371_10000938 Ga0157371_1000093826 739
254 3300013102 Ga0157371_10008751 Ga0157371_100087515 739
255 3300013104 Ga0157370_10000762 Ga0157370_1000076223 739
256 3300013307 Ga0157372_10001396 Ga0157372_1000139630 739
257 3300017792 Ga0163161_10000848 Ga0163161_1000084810 739
258 3300021361 Ga0213872_10000009 Ga0213872_1000000993 739
259 3300021361 Ga0213872_10000208 Ga0213872_1000020837 739
260 3300021388 Ga0213875_10002861 Ga0213875_100028616 739
261 3300025297 Ga0209758_1000008 Ga0209758_1000008406 739
262 3300025711 Ga0207696_1001853 Ga0207696_10018534 739
263 3300025908 Ga0207643_10015799 Ga0207643_100157992 739
264 3300025909 Ga0207705_10001221 Ga0207705_100012212 739
265 3300025912 Ga0207707_10050273 Ga0207707_100502732 739
266 3300025917 Ga0207660_10007035 Ga0207660_100070352 739
267 3300025919 Ga0207657_10000227 Ga0207657_100002272 739
268 3300025920 Ga0207649_10006510 Ga0207649_100065103 739
269 3300025921 Ga0207652_10012768 Ga0207652_100127682 739
270 3300025921 Ga0207652_10026141 Ga0207652_100261412 739
271 3300025923 Ga0207681_10000120 Ga0207681_1000012048 739
272 3300025923 Ga0207681_10000248 Ga0207681_1000024829 739
273 3300025931 Ga0207644_10014339 Ga0207644_100143392 739
274 3300025932 Ga0207690_10004630 Ga0207690_100046307 739
275 3300025933 Ga0207706_10000898 Ga0207706_1000089829 739
276 3300025933 Ga0207706_10100004 Ga0207706_101000042 739
277 3300025935 Ga0207709_10000032 Ga0207709_100000327 739
278 3300025935 Ga0207709_10023879 Ga0207709_100238792 739
279 3300025941 Ga0207711_10033160 Ga0207711_100331602 739
280 3300025942 Ga0207689_10012069 Ga0207689_100120695 739
281 3300025945 Ga0207679_10000185 Ga0207679_1000018517 739
282 3300025945 Ga0207679_10006785 Ga0207679_100067852 739
283 3300025972 Ga0207668_10004441 Ga0207668_100044416 739
284 3300025986 Ga0207658_10001017 Ga0207658_100010176 739
285 3300025986 Ga0207658_10011241 Ga0207658_100112411 739
286 3300026035 Ga0207703_10024135 Ga0207703_100241352 739
287 3300026041 Ga0207639_10008107 Ga0207639_100081076 739
288 3300026067 Ga0207678_10039831 Ga0207678_100398312 739
289 3300026088 Ga0207641_10013869 Ga0207641_100138694 739
290 3300026121 Ga0207683_10019376 Ga0207683_100193762 739
291 3300026142 Ga0207698_10049916 Ga0207698_100499162 739
292 3300027111 Ga0209281_1000002 Ga0209281_10000021333 739
293 3300028379 Ga0268266_10014250 Ga0268266_100142504 739
294 3300031235 Ga0265330_10010986 Ga0265330_100109862 739
295 3300031241 Ga0265325_10000914 Ga0265325_1000091413 739
296 3300031247 Ga0265340_10000206 Ga0265340_1000020626 739
297 3300031247 Ga0265340_10008216 Ga0265340_100082162 739
298 3300031247 Ga0265340_10022343 Ga0265340_100223432 739
299 3300031249 Ga0265339_10006859 Ga0265339_100068595 739
300 3300031250 Ga0265331_10015109 Ga0265331_100151092 739
301 3300031344 Ga0265316_10019223 Ga0265316_100192233 739
302 3300031711 Ga0265314_10000918 Ga0265314_100009189 739
303 3300031712 Ga0265342_10008946 Ga0265342_100089463 739
304 3300031901 Ga0307406_10006892 Ga0307406_100068928 739
305 3300032005 Ga0307411_10056291 Ga0307411_100562911 739
306 3300032133 Ga0316583_10000398 Ga0316583_1000039810 739
307 3300037466 Ga0395898_0043685 Ga0395898_0043685_484_2790 739
308 3300037853 Ga0436364_0972483 Ga0436364_0972483_26814_29117 739
309 3300039447 Ga0436361_0074986 Ga0436361_0074986_6025_8316 739
310 3300039447 Ga0436361_0572581 Ga0436361_0572581_109083_111374 739
311 3300042015 Ga0439462_0000599 Ga0439462_0000599_4650_6911 739
312 3300044684 Ga0466966_0000495 Ga0466966_0000495_19627_21939 739
313 3300044693 Ga0466961_0000937 Ga0466961_0000937_8329_10641 739
314 3300045049 Ga0466959_0003484 Ga0466959_0003484_7337_9649 739
315 3300046499 Ga0495594_0005409 Ga0495594_0005409_3199_5511 739
316 3300046500 Ga0495596_0000431 Ga0495596_0000431_4653_6914 739
317 3300046506 Ga0495583_0000943 Ga0495583_0000943_1349_3610 739
318 3300046512 Ga0495610_0009179 Ga0495610_0009179_3310_5571 739
319 3300046519 Ga0495632_0000236 Ga0495632_0000236_39309_41621 739
320 3300046684 Ga0495669_0000762 Ga0495669_0000762_11262_13574 739
321 3300047472 Ga0495686_0000119 Ga0495686_0000119_70513_72774 739
322 3300047472 Ga0495686_0001294 Ga0495686_0001294_3933_6245 739
323 3300048091 Ga0495626_0000255 Ga0495626_0000255_54789_57050 739
324 3300048903 Ga0496100_0043157 Ga0496100_0043157_167_2428 739
325 3300048904 Ga0496101_0030459 Ga0496101_0030459_1383_3644 739
326 3300048905 Ga0496102_0002022 Ga0496102_0002022_298_2562 739
327 3300048907 Ga0496104_0001677 Ga0496104_0001677_6961_9225 739
328 3300048916 Ga0496113_0000807 Ga0496113_0000807_8265_10526 739
329 3300048924 Ga0496121_0000187 Ga0496121_0000187_120164_122428 739
330 3300048927 Ga0496124_0027518 Ga0496124_0027518_2141_4405 739
331 3300048929 Ga0496126_0000365 Ga0496126_0000365_81195_83459 739
332 3300048929 Ga0496126_0000483 Ga0496126_0000483_35751_38012 739
333 3300049569 Ga0501032_0054326 Ga0501032_0054326_261_2522 739
334 3300049573 Ga0501037_0020469 Ga0501037_0020469_2057_4354 739
335 3300049581 Ga0501047_0000888 Ga0501047_0000888_16473_18734 739
336 3300049679 Ga0501249_001756 Ga0501249_001756_53_2314 739
337 3300049822 Ga0501035_0062687 Ga0501035_0062687_631_2943 739
338 3300049823 Ga0501044_0001652 Ga0501044_0001652_11_2272 739
339 3300050489 nmdc:mga03683_51_c1 nmdc:mga03683_51_c1_28996_31260 739
340 3300050490 nmdc:mga03n38_1096_c1 nmdc:mga03n38_1096_c1_4976_7240 739
341 3300050493 nmdc:mga0k408_3_c1 nmdc:mga0k408_3_c1_29047_31311 739
342 3300050496 nmdc:mga07m45_6_c1 nmdc:mga07m45_6_c1_218155_220419 739
343 3300053087 Ga0500643_000017 Ga0500643_000017_45459_47714 739
344 3300053087 Ga0500643_000039 Ga0500643_000039_143339_145600 739
345 3300053103 Ga0500555_000240 Ga0500555_000240_129_2390 739
346 3300053121 Ga0500607_000132 Ga0500607_000132_49187_51448 739
347 3300053125 Ga0500618_004709 Ga0500618_004709_1093_3354 739
348 3300053140 Ga0500573_0000055 Ga0500573_0000055_63954_66209 739
349 3300053148 Ga0500590_000468 Ga0500590_000468_6603_8864 739
350 3300053148 Ga0500590_007035 Ga0500590_007035_106_2376 739
351 3300053156 Ga0500622_0000166 Ga0500622_0000166_6068_8329 739
352 3300053156 Ga0500622_0015599 Ga0500622_0015599_1216_3477 739
353 iso_pu_bacteria 2919138771 2919143153 739
354 3300001989 JGI24739J22299_10003286 JGI24739J22299_100032863 740
355 3300001990 JGI24737J22298_10003825 JGI24737J22298_100038251 740
356 3300001990 JGI24737J22298_10006390 JGI24737J22298_100063901 740
357 3300002067 JGI24735J21928_10002113 JGI24735J21928_100021136 740
358 3300002075 JGI24738J21930_10000490 JGI24738J21930_100004904 740
359 3300002076 JGI24749J21850_1001028 JGI24749J21850_10010283 740
360 3300002459 JGI24751J29686_10000213 JGI24751J29686_100002132 740
361 3300003214 JGI25165J46597_1000050 JGI25165J46597_1000050201 740
362 3300005295 Ga0065707_10098738 Ga0065707_100987382 740
363 3300005327 Ga0070658_10000566 Ga0070658_1000056620 740
364 3300005327 Ga0070658_10000735 Ga0070658_1000073510 740
365 3300005331 Ga0070670_100000024 Ga0070670_100000024171 740
366 3300005331 Ga0070670_100014240 Ga0070670_1000142402 740
367 3300005334 Ga0068869_100001073 Ga0068869_10000107314 740
368 3300005335 Ga0070666_10017161 Ga0070666_100171614 740
369 3300005338 Ga0068868_100000281 Ga0068868_1000002812 740
370 3300005339 Ga0070660_100003622 Ga0070660_10000362210 740
371 3300005339 Ga0070660_100033708 Ga0070660_1000337084 740
372 3300005339 Ga0070660_100044701 Ga0070660_1000447012 740
373 3300005347 Ga0070668_100000001 Ga0070668_100000001264 740
374 3300005353 Ga0070669_100000031 Ga0070669_10000003152 740
375 3300005355 Ga0070671_100000227 Ga0070671_1000002273 740
376 3300005364 Ga0070673_100000005 Ga0070673_100000005186 740
377 3300005367 Ga0070667_100000006 Ga0070667_10000000631 740
378 3300005367 Ga0070667_100000131 Ga0070667_10000013161 740
379 3300005367 Ga0070667_100008710 Ga0070667_1000087103 740
380 3300005455 Ga0070663_100001628 Ga0070663_1000016289 740
381 3300005457 Ga0070662_100013422 Ga0070662_1000134221 740
382 3300005459 Ga0068867_100000060 Ga0068867_1000000608 740
383 3300005539 Ga0068853_100028257 Ga0068853_1000282574 740
384 3300005563 Ga0068855_100000027 Ga0068855_10000002741 740
385 3300005577 Ga0068857_100050850 Ga0068857_1000508503 740
386 3300005578 Ga0068854_100000235 Ga0068854_10000023520 740
387 3300005614 Ga0068856_100051578 Ga0068856_1000515782 740
388 3300005617 Ga0068859_100010558 Ga0068859_1000105584 740
389 3300005617 Ga0068859_100013432 Ga0068859_1000134322 740
390 3300005618 Ga0068864_100000036 Ga0068864_100000036172 740
391 3300005841 Ga0068863_100001101 Ga0068863_10000110119 740
392 3300005841 Ga0068863_100024589 Ga0068863_1000245893 740
393 3300005841 Ga0068863_100036311 Ga0068863_1000363112 740
394 3300005842 Ga0068858_100000365 Ga0068858_1000003659 740
395 3300005843 Ga0068860_100000013 Ga0068860_10000001358 740
396 3300005843 Ga0068860_100000723 Ga0068860_1000007233 740
397 3300005844 Ga0068862_100000043 Ga0068862_10000004369 740
398 3300005844 Ga0068862_100001261 Ga0068862_1000012612 740
399 3300006237 Ga0097621_100014295 Ga0097621_1000142953 740
400 3300006881 Ga0068865_100000027 Ga0068865_10000002782 740
401 3300006931 Ga0097620_100010558 Ga0097620_1000105584 740
402 3300006931 Ga0097620_100013432 Ga0097620_1000134322 740
403 3300009098 Ga0105245_10007808 Ga0105245_100078088 740
404 3300009148 Ga0105243_10001080 Ga0105243_1000108017 740
405 3300009176 Ga0105242_10001166 Ga0105242_1000116615 740
406 3300009177 Ga0105248_10000081 Ga0105248_1000008163 740
407 3300009545 Ga0105237_10023002 Ga0105237_100230028 740
408 3300009551 Ga0105238_10015627 Ga0105238_100156274 740
409 3300009553 Ga0105249_10008122 Ga0105249_100081225 740
410 3300012513 Ga0157326_1000015 Ga0157326_100001510 740
411 3300013104 Ga0157370_10000202 Ga0157370_1000020262 740
412 3300013105 Ga0157369_10018009 Ga0157369_100180098 740
413 3300013296 Ga0157374_10001196 Ga0157374_1000119615 740
414 3300013297 Ga0157378_10002695 Ga0157378_1000269514 740
415 3300014325 Ga0163163_10087157 Ga0163163_100871572 740
416 3300014326 Ga0157380_10000150 Ga0157380_1000015016 740
417 3300014969 Ga0157376_10000095 Ga0157376_100000957 740
418 3300021384 Ga0213876_10015326 Ga0213876_100153262 740
419 3300025250 Ga0209026_1004956 Ga0209026_10049562 740
420 3300025254 Ga0209148_1000116 Ga0209148_1000116139 740
421 3300025254 Ga0209148_1000747 Ga0209148_10007475 740
422 3300025261 Ga0209233_1000041 Ga0209233_1000041377 740
423 3300025272 Ga0209455_1000709 Ga0209455_100070914 740
424 3300025292 Ga0209676_1000807 Ga0209676_100080732 740
425 3300025903 Ga0207680_10002842 Ga0207680_100028427 740
426 3300025904 Ga0207647_10000285 Ga0207647_100002858 740
427 3300025904 Ga0207647_10009702 Ga0207647_100097024 740
428 3300025907 Ga0207645_10002090 Ga0207645_100020907 740
429 3300025909 Ga0207705_10000022 Ga0207705_10000022181 740
430 3300025909 Ga0207705_10000281 Ga0207705_1000028120 740
431 3300025909 Ga0207705_10024032 Ga0207705_100240323 740
432 3300025919 Ga0207657_10003065 Ga0207657_1000306514 740
433 3300025919 Ga0207657_10025639 Ga0207657_100256394 740
434 3300025919 Ga0207657_10028523 Ga0207657_100285234 740
435 3300025923 Ga0207681_10000014 Ga0207681_10000014257 740
436 3300025925 Ga0207650_10000015 Ga0207650_10000015272 740
437 3300025925 Ga0207650_10003406 Ga0207650_100034062 740
438 3300025931 Ga0207644_10000132 Ga0207644_1000013226 740
439 3300025931 Ga0207644_10014264 Ga0207644_100142643 740
440 3300025933 Ga0207706_10004502 Ga0207706_100045027 740
441 3300025934 Ga0207686_10000600 Ga0207686_1000060015 740
442 3300025935 Ga0207709_10000260 Ga0207709_100002603 740
443 3300025938 Ga0207704_10000064 Ga0207704_100000647 740
444 3300025940 Ga0207691_10050907 Ga0207691_100509073 740
445 3300025941 Ga0207711_10000162 Ga0207711_1000016237 740
446 3300025942 Ga0207689_10001667 Ga0207689_1000166714 740
447 3300025949 Ga0207667_10000013 Ga0207667_10000013267 740
448 3300025960 Ga0207651_10000010 Ga0207651_10000010183 740
449 3300025961 Ga0207712_10004590 Ga0207712_100045907 740
450 3300025972 Ga0207668_10000236 Ga0207668_1000023630 740
451 3300025981 Ga0207640_10000327 Ga0207640_1000032720 740
452 3300025986 Ga0207658_10000010 Ga0207658_1000001030 740
453 3300025986 Ga0207658_10000067 Ga0207658_1000006761 740
454 3300025986 Ga0207658_10003704 Ga0207658_100037043 740
455 3300026023 Ga0207677_10001067 Ga0207677_100010677 740
456 3300026035 Ga0207703_10000540 Ga0207703_1000054019 740
457 3300026067 Ga0207678_10000482 Ga0207678_1000048220 740
458 3300026078 Ga0207702_10004329 Ga0207702_100043298 740
459 3300026088 Ga0207641_10000325 Ga0207641_1000032527 740
460 3300026088 Ga0207641_10019736 Ga0207641_100197362 740
461 3300026089 Ga0207648_10000162 Ga0207648_1000016256 740
462 3300026095 Ga0207676_10000021 Ga0207676_10000021130 740
463 3300026095 Ga0207676_10001506 Ga0207676_100015062 740
464 3300026118 Ga0207675_100024326 Ga0207675_1000243262 740
465 3300026142 Ga0207698_10000355 Ga0207698_1000035523 740
466 3300028380 Ga0268265_10000013 Ga0268265_10000013101 740
467 3300028380 Ga0268265_10000629 Ga0268265_1000062928 740
468 3300028381 Ga0268264_10000039 Ga0268264_1000003960 740
469 3300028381 Ga0268264_10000435 Ga0268264_1000043521 740
470 3300028381 Ga0268264_10016758 Ga0268264_100167582 740
471 3300031548 Ga0307408_100013657 Ga0307408_1000136576 740
472 3300031595 Ga0265313_10015527 Ga0265313_100155272 740
473 3300031711 Ga0265314_10007494 Ga0265314_100074946 740
474 3300031911 Ga0307412_10000874 Ga0307412_100008743 740
475 3300031911 Ga0307412_10001079 Ga0307412_1000107913 740
476 3300032004 Ga0307414_10024251 Ga0307414_100242511 740
477 3300037312 Ga0395899_0003665 Ga0395899_0003665_597_2861 740
478 3300037418 Ga0395900_0108459 Ga0395900_0108459_199_2463 740
479 3300039437 Ga0436365_0079966 Ga0436365_0079966_210_2477 740
480 3300039437 Ga0436365_0577140 Ga0436365_0577140_10626_12884 740
481 3300042005 Ga0439448_0000501 Ga0439448_0000501_1828_4104 740
482 3300042012 Ga0439455_0000022 Ga0439455_0000022_7637_9913 740
483 3300042012 Ga0439455_0000481 Ga0439455_0000481_1112_3394 740
484 3300042157 Ga0439458_0001364 Ga0439458_0001364_3803_6079 740
485 3300044694 Ga0466963_0013110 Ga0466963_0013110_936_3200 740
486 3300044901 Ga0466960_0003662 Ga0466960_0003662_1300_3564 740
487 3300045836 Ga0466958_0035286 Ga0466958_0035286_89_2353 740
488 3300046453 Ga0495627_001389 Ga0495627_001389_11842_14106 740
489 3300046471 Ga0495650_0000628 Ga0495650_0000628_238_2502 740
490 3300046500 Ga0495596_0000071 Ga0495596_0000071_72503_74767 740
491 3300046501 Ga0495607_0012525 Ga0495607_0012525_1120_3384 740
492 3300046512 Ga0495610_0000067 Ga0495610_0000067_65572_67836 740
493 3300046512 Ga0495610_0000303 Ga0495610_0000303_16402_18666 740
494 3300046519 Ga0495632_0001093 Ga0495632_0001093_13111_15375 740
495 3300046522 Ga0495643_0000341 Ga0495643_0000341_38894_41158 740
496 3300046522 Ga0495643_0002459 Ga0495643_0002459_11862_14126 740
497 3300046522 Ga0495643_0006131 Ga0495643_0006131_4284_6548 740
498 3300046538 Ga0495609_0001625 Ga0495609_0001625_7257_9521 740
499 3300046616 Ga0495668_0009919 Ga0495668_0009919_2998_5361 740
500 3300047470 Ga0495681_0000221 Ga0495681_0000221_44934_47198 740
501 3300048905 Ga0496102_0000010 Ga0496102_0000010_219210_221474 740
502 3300048906 Ga0496103_0000029 Ga0496103_0000029_107919_110183 740
503 3300048919 Ga0496116_0000942 Ga0496116_0000942_15513_17777 740
504 3300048920 Ga0496117_0000037 Ga0496117_0000037_219812_222076 740
505 3300048920 Ga0496117_0005076 Ga0496117_0005076_9609_11873 740
506 3300048921 Ga0496118_0000034 Ga0496118_0000034_217616_219880 740
507 3300048921 Ga0496118_0037334 Ga0496118_0037334_15_2279 740
508 3300048923 Ga0496120_0017668 Ga0496120_0017668_907_3171 740
509 3300048925 Ga0496122_0001177 Ga0496122_0001177_16370_18634 740
510 3300048925 Ga0496122_0013654 Ga0496122_0013654_11_2275 740
511 3300048926 Ga0496123_0000754 Ga0496123_0000754_23997_26261 740
512 3300048926 Ga0496123_0017759 Ga0496123_0017759_2225_4489 740
513 3300048927 Ga0496124_0000033 Ga0496124_0000033_217616_219880 740
514 3300048928 Ga0496125_0009351 Ga0496125_0009351_5444_7708 740
515 3300049571 Ga0501034_0023261 Ga0501034_0023261_60_2324 740
516 3300049663 Ga0501223_000641 Ga0501223_000641_5915_8179 740
517 3300049664 Ga0501224_000030 Ga0501224_000030_37502_39766 740
518 3300049686 Ga0501257_000010 Ga0501257_000010_48219_50486 740
519 3300049705 Ga0501225_0000009 Ga0501225_0000009_2837_5101 740
520 3300049853 Ga0501226_000054 Ga0501226_000054_31431_33695 740
521 3300053116 Ga0500592_000146 Ga0500592_000146_3430_5694 740
522 3300053122 Ga0500608_003164 Ga0500608_003164_1228_3495 740
523 3300053153 Ga0500616_0000267 Ga0500616_0000267_57195_59462 740
524 3300053158 Ga0500627_0000232 Ga0500627_0000232_11435_13699 740
525 3300053729 Ga0500625_000026 Ga0500625_000026_13777_16044 740
526 iso_pu_bacteria 2643221605 2644040337 740
527 3300005983 Ga0081540_1002431 Ga0081540_10024316 741
528 3300006914 Ga0075436_100007361 Ga0075436_1000073617 741
529 3300031691 Ga0316579_10000472 Ga0316579_100004722 741
530 3300035695 Ga0373927_0000245 Ga0373927_0000245_32166_34469 741
531 3300036647 Ga0316582_0001241 Ga0316582_0001241_8155_10449 741
532 3300037068 Ga0373925_0003713 Ga0373925_0003713_5050_7353 741
533 3300039062 Ga0400483_270422 Ga0400483_270422_178_2451 741
534 3300046517 Ga0495630_0014114 Ga0495630_0014114_1067_3394 741
535 3300046642 Ga0495634_0002106 Ga0495634_0002106_4908_7235 741
536 3300046691 Ga0495670_0002028 Ga0495670_0002028_2375_4684 741
537 3300047444 Ga0495675_0017141 Ga0495675_0017141_435_2762 741
538 3300048914 Ga0496111_0000701 Ga0496111_0000701_8546_10873 741
539 3300050514 nmdc:mga08x19_8308_c2 nmdc:mga08x19_8308_c2_1666_3954 741
540 iso_pu_bacteria 2919166419 2919168614 741
541 iso_pu_bacteria 8054460903 8054465269 741
542 3300003575 Ga0007409J51694_1011996 Ga0007409J51694_10119962 742
543 3300003693 Ga0032354_1017829 Ga0032354_10178292 742
544 3300003856 Ga0058692_1004364 Ga0058692_10043642 742
545 3300007788 Ga0099795_10000021 Ga0099795_1000002144 742
546 3300010159 Ga0099796_10000016 Ga0099796_1000001622 742
547 3300025254 Ga0209148_1001838 Ga0209148_10018387 742
548 3300025909 Ga0207705_10006255 Ga0207705_100062554 742
549 3300027512 Ga0209179_1000102 Ga0209179_10001028 742
550 3300031995 Ga0307409_100088617 Ga0307409_1000886171 742
551 3300037418 Ga0395900_0000267 Ga0395900_0000267_11339_13651 742
552 3300037418 Ga0395900_0011484 Ga0395900_0011484_2586_4898 742
553 3300038742 Ga0400486_19991 Ga0400486_19991_641_3025 742
554 3300044842 Ga0466957_0000122 Ga0466957_0000122_6745_9057 742
555 3300046474 Ga0495605_0000481 Ga0495605_0000481_15158_17470 742
556 3300046500 Ga0495596_0000198 Ga0495596_0000198_22257_24569 742
557 3300046500 Ga0495596_0001674 Ga0495596_0001674_5523_7826 742
558 3300046506 Ga0495583_0000204 Ga0495583_0000204_24816_27128 742
559 3300046506 Ga0495583_0002391 Ga0495583_0002391_9511_11823 742
560 3300046507 Ga0495606_0003352 Ga0495606_0003352_12449_14737 742
561 3300046660 Ga0495625_0003729 Ga0495625_0003729_6180_8492 742
562 3300046665 Ga0495661_0000252 Ga0495661_0000252_7898_10210 742
563 3300046684 Ga0495669_0000554 Ga0495669_0000554_13976_16288 742
564 3300046794 Ga0495589_0000175 Ga0495589_0000175_12620_14932 742
565 3300046810 Ga0495660_0000113 Ga0495660_0000113_15676_17988 742
566 3300047320 Ga0495672_0000510 Ga0495672_0000510_19116_21428 742
567 3300047323 Ga0495683_0000088 Ga0495683_0000088_20807_23119 742
568 3300047470 Ga0495681_0014450 Ga0495681_0014450_1811_4123 742
569 3300047673 Ga0495593_0025904 Ga0495593_0025904_201_2513 742
570 3300048091 Ga0495626_0000006 Ga0495626_0000006_15876_18188 742
571 3300048903 Ga0496100_0013848 Ga0496100_0013848_1799_4111 742
572 3300048918 Ga0496115_0001706 Ga0496115_0001706_1146_3422 742
573 3300048925 Ga0496122_0001022 Ga0496122_0001022_20330_22642 742
574 3300048925 Ga0496122_0008682 Ga0496122_0008682_6839_9334 742
575 3300048926 Ga0496123_0002689 Ga0496123_0002689_990_3302 742
576 3300048928 Ga0496125_0001146 Ga0496125_0001146_5618_7930 742
577 3300049459 Ga0495678_001030 Ga0495678_001030_21300_23612 742
578 3300049570 Ga0501033_0052053 Ga0501033_0052053_731_3013 742
579 3300049573 Ga0501037_0005405 Ga0501037_0005405_1443_3725 742
580 3300049575 Ga0501039_0005420 Ga0501039_0005420_1227_3509 742
581 3300049578 Ga0501042_0013715 Ga0501042_0013715_598_2880 742
582 3300049579 Ga0501043_0011238 Ga0501043_0011238_2986_5268 742
583 3300049589 Ga0501073_0052765 Ga0501073_0052765_94_2376 742
584 3300059641 Ga0587068_000804 Ga0587068_000804_803_3115 742
585 iso_pu_bacteria 2643221568 2643854227 742
586 3300014326 Ga0157380_10036411 Ga0157380_100364112 743
587 3300021388 Ga0213875_10003569 Ga0213875_100035695 743
588 3300025294 Ga0209025_1022057 Ga0209025_10220571 743
589 3300037853 Ga0436364_1027512 Ga0436364_1027512_2868_5141 743
590 3300046506 Ga0495583_0001291 Ga0495583_0001291_13732_16044 743
591 3300046522 Ga0495643_0000400 Ga0495643_0000400_21907_24219 743
592 3300047472 Ga0495686_0046269 Ga0495686_0046269_221_2530 743
593 3300049574 Ga0501038_0006438 Ga0501038_0006438_610_2910 743
594 3300049590 Ga0501074_0066894 Ga0501074_0066894_127_2511 743
595 3300053177 Ga0500636_0000001 Ga0500636_0000001_101176_103467 743
596 iso_pu_bacteria 2643221663 2644351474 743
597 iso_pu_bacteria 2941485952 2941488137 743
598 iso_pu_bacteria 8054563764 8054567693 743
599 3300005344 Ga0070661_100034982 Ga0070661_1000349822 744
600 3300005614 Ga0068856_100096786 Ga0068856_1000967861 744
601 3300009093 Ga0105240_10003101 Ga0105240_100031017 744
602 3300009093 Ga0105240_10062533 Ga0105240_100625333 744
603 3300009545 Ga0105237_10000080 Ga0105237_1000008026 744
604 3300009551 Ga0105238_10000711 Ga0105238_1000071125 744
605 3300010375 Ga0105239_10000116 Ga0105239_1000011681 744
606 3300013308 Ga0157375_10069835 Ga0157375_100698352 744
607 3300025909 Ga0207705_10032980 Ga0207705_100329802 744
608 3300025913 Ga0207695_10003118 Ga0207695_1000311822 744
609 3300025914 Ga0207671_10002386 Ga0207671_1000238617 744
610 3300025924 Ga0207694_10004090 Ga0207694_1000409012 744
611 3300025949 Ga0207667_10005375 Ga0207667_1000537512 744
612 3300039062 Ga0400483_121983 Ga0400483_121983_1442_3721 744
613 3300046694 Ga0495649_0000048 Ga0495649_0000048_77833_80112 744
614 3300048928 Ga0496125_0000989 Ga0496125_0000989_23135_25432 744
615 iso_pu_bacteria 2547132103 2547375425 744
616 iso_pu_bacteria 2643221591 2643963369 744
617 3300013306 Ga0163162_10021329 Ga0163162_100213292 745
618 3300013308 Ga0157375_10019356 Ga0157375_100193563 745
619 3300025940 Ga0207691_10046360 Ga0207691_100463602 745
620 3300026095 Ga0207676_10037014 Ga0207676_100370142 745
621 3300031241 Ga0265325_10000676 Ga0265325_1000067619 745
622 3300031247 Ga0265340_10002811 Ga0265340_100028117 745
623 3300031548 Ga0307408_100010293 Ga0307408_1000102932 745
624 3300031731 Ga0307405_10038880 Ga0307405_100388802 745
625 3300031852 Ga0307410_10003694 Ga0307410_100036943 745
626 3300031903 Ga0307407_10004761 Ga0307407_100047612 745
627 3300032004 Ga0307414_10005273 Ga0307414_100052732 745
628 3300032004 Ga0307414_10060793 Ga0307414_100607931 745
629 3300032126 Ga0307415_100032471 Ga0307415_1000324712 745
630 3300048917 Ga0496114_0007398 Ga0496114_0007398_3278_5563 745
631 3300053161 Ga0500634_0000006 Ga0500634_0000006_158390_160708 745
632 iso_pu_bacteria 2551306352 2552746710 745
633 iso_pu_bacteria 2643221580 2643910690 745
634 iso_pu_bacteria 2643221665 2644362696 745
635 iso_pu_bacteria 2643221674 2644410523 745
636 iso_pu_bacteria 2675903507 2678231945 745
637 iso_pu_bacteria 2773857761 2774389685 745
638 iso_pu_bacteria 2773857770 2774436642 745
639 iso_pu_bacteria 2775506902 2776272927 745
640 iso_pu_bacteria 2916699645 2916702648 745
641 iso_pu_bacteria 2919182534 2919183134 745
642 iso_pu_bacteria 2919506607 2919508057 745
643 iso_pu_bacteria 2928515477 2928515907 745
644 iso_pu_bacteria 2932401849 2932403364 745
645 iso_pu_bacteria 2984568884 2984570091 745
646 iso_pu_bacteria 8033232454 8033233004 745
647 3300003781 Ga0055536_1000860 Ga0055536_10008603 746
648 3300005331 Ga0070670_100003772 Ga0070670_1000037728 746
649 3300005339 Ga0070660_100047529 Ga0070660_1000475293 746
650 3300005367 Ga0070667_100031745 Ga0070667_1000317451 746
651 3300006847 Ga0075431_100013027 Ga0075431_1000130271 746
652 3300025292 Ga0209676_1000115 Ga0209676_100011536 746
653 3300025298 Ga0209050_1003368 Ga0209050_10033687 746
654 3300025304 Ga0209257_1000090 Ga0209257_100009018 746
655 3300025909 Ga0207705_10000826 Ga0207705_1000082624 746
656 3300025919 Ga0207657_10070551 Ga0207657_100705512 746
657 3300025923 Ga0207681_10010447 Ga0207681_100104473 746
658 3300025949 Ga0207667_10012268 Ga0207667_100122682 746
659 3300028786 Ga0307517_10000042 Ga0307517_10000042117 746
660 3300028794 Ga0307515_10017870 Ga0307515_100178708 746
661 3300031616 Ga0307508_10026018 Ga0307508_100260183 746
662 3300031731 Ga0307405_10016166 Ga0307405_100161662 746
663 3300031824 Ga0307413_10015235 Ga0307413_100152351 746
664 3300031852 Ga0307410_10049161 Ga0307410_100491612 746
665 3300031901 Ga0307406_10007517 Ga0307406_100075172 746
666 3300031901 Ga0307406_10020525 Ga0307406_100205253 746
667 3300031911 Ga0307412_10004529 Ga0307412_100045293 746
668 3300032004 Ga0307414_10001122 Ga0307414_100011229 746
669 3300032004 Ga0307414_10057331 Ga0307414_100573312 746
670 3300032005 Ga0307411_10008573 Ga0307411_100085733 746
671 3300037418 Ga0395900_0000380 Ga0395900_0000380_17681_19969 746
672 3300037471 Ga0395905_0001357 Ga0395905_0001357_27453_29741 746
673 3300038443 Ga0395901_0000181 Ga0395901_0000181_60973_63261 746
674 3300039110 Ga0400487_34970 Ga0400487_34970_146741_149020 746
675 3300042004 Ga0439445_0000319 Ga0439445_0000319_4655_6943 746
676 3300046455 Ga0495603_0001748 Ga0495603_0001748_7195_9474 746
677 3300046455 Ga0495603_0007618 Ga0495603_0007618_1982_4255 746
678 3300046507 Ga0495606_0022708 Ga0495606_0022708_655_2928 746
679 3300046519 Ga0495632_0007541 Ga0495632_0007541_2114_4387 746
680 3300046528 Ga0495642_0002633 Ga0495642_0002633_1740_4034 746
681 3300046538 Ga0495609_0009118 Ga0495609_0009118_1232_3505 746
682 3300046539 Ga0495621_0000447 Ga0495621_0000447_7642_9930 746
683 3300046557 Ga0495622_0007410 Ga0495622_0007410_691_2970 746
684 3300046558 Ga0495633_0025592 Ga0495633_0025592_397_2670 746
685 3300046665 Ga0495661_0046012 Ga0495661_0046012_300_2573 746
686 3300047323 Ga0495683_0007201 Ga0495683_0007201_1447_3720 746
687 3300049571 Ga0501034_0035880 Ga0501034_0035880_2460_4748 746
688 3300049823 Ga0501044_0042482 Ga0501044_0042482_924_3212 746
689 3300050510 nmdc:mga06r32_7686_c1 nmdc:mga06r32_7686_c1_5940_8234 746
690 3300053088 Ga0500644_0005925 Ga0500644_0005925_293_2572 746
691 iso_pu_bacteria 2501025501 2501072360 746
692 iso_pu_bacteria 2501025502 2501080004 746
693 iso_pu_bacteria 2501025504 2501412370 746
694 iso_pu_bacteria 2510917013 2511087890 746
695 iso_pu_bacteria 2510917014 2511101494 746
696 iso_pu_bacteria 2510917015 2511107903 746
697 iso_pu_bacteria 2513237082 2513553016 746
698 iso_pu_bacteria 2513237083 2513559876 746
699 iso_pu_bacteria 2513237095 2513645336 746
700 iso_pu_bacteria 2513237102 2513702816 746
701 iso_pu_bacteria 2513237139 2513873251 746
702 iso_pu_bacteria 2515154122 2515681474 746
703 iso_pu_bacteria 2515154189 2516018186 746
704 iso_pu_bacteria 2524023228 2524539482 746
705 iso_pu_bacteria 2643221569 2643858499 746
706 iso_pu_bacteria 2671180139 2671695318 746
707 iso_pu_bacteria 2721755755 2723846775 746
708 iso_pu_bacteria 2802429603 2805914761 746
709 iso_pu_bacteria 2808606384 2808969168 746
710 iso_pu_bacteria 2808606390 2809003999 746
711 iso_pu_bacteria 2808606391 2809012718 746
712 iso_pu_bacteria 2816332527 2818239574 746
713 iso_pu_bacteria 2824679649 2824681077 746
714 iso_pu_bacteria 2824696289 2824700333 746
715 iso_pu_bacteria 2843690924 2843691461 746
716 iso_pu_bacteria 2847939898 2847947153 746
717 iso_pu_bacteria 2856287931 2856289885 746
718 iso_pu_bacteria 2857357740 2857363076 746
719 iso_pu_bacteria 2874612657 2874617488 746
720 iso_pu_bacteria 2883087390 2883090405 746
721 iso_pu_bacteria 2885366525 2885368010 746
722 iso_pu_bacteria 2888378607 2888384585 746
723 iso_pu_bacteria 2889033259 2889037093 746
724 iso_pu_bacteria 2904434214 2904434682 746
725 iso_pu_bacteria 2904690495 2904695474 746
726 iso_pu_bacteria 2904699407 2904706968 746
727 iso_pu_bacteria 2908756301 2908757480 746
728 iso_pu_bacteria 2928972540 2928974524 746
729 iso_pu_bacteria 2939669807 2939670681 746
730 iso_pu_bacteria 2977240413 2977243447 746
731 iso_pu_bacteria 8002392321 8002393175 746
732 iso_pu_bacteria 8003955200 8003956277 746
733 iso_pu_bacteria 8006984368 8006987690 746
734 iso_pu_bacteria 8016583857 8016587452 746
735 3300005366 Ga0070659_100005141 Ga0070659_1000051412 747
736 3300010375 Ga0105239_10002739 Ga0105239_1000273914 747
737 3300025292 Ga0209676_1004884 Ga0209676_10048844 747
738 3300025914 Ga0207671_10000820 Ga0207671_1000082015 747
739 3300026041 Ga0207639_10008563 Ga0207639_100085633 747
740 3300028379 Ga0268266_10002043 Ga0268266_1000204315 747
741 3300028794 Ga0307515_10000096 Ga0307515_10000096100 747
742 3300035691 Ga0373931_0014245 Ga0373931_0014245_1505_3829 747
743 3300047673 Ga0495593_0010366 Ga0495593_0010366_2939_5239 747
744 3300049572 Ga0501036_0074982 Ga0501036_0074982_239_2542 747
745 3300049581 Ga0501047_0009262 Ga0501047_0009262_1774_4077 747
746 3300049823 Ga0501044_0051062 Ga0501044_0051062_1733_4036 747
747 3300050493 nmdc:mga0k408_2030_c1 nmdc:mga0k408_2030_c1_5582_7900 747
748 iso_pu_bacteria 2501025501 2501070885 747
749 iso_pu_bacteria 2501025502 2501084883 747
750 iso_pu_bacteria 2501025504 2501413713 747
751 iso_pu_bacteria 2510917013 2511089607 747
752 iso_pu_bacteria 2510917014 2511095016 747
753 iso_pu_bacteria 2510917015 2511104672 747
754 iso_pu_bacteria 2513237082 2513551463 747
755 iso_pu_bacteria 2513237166 2514046179 747
756 iso_pu_bacteria 2548876994 2550694599 747
757 iso_pu_bacteria 2562617112 2563061795 747
758 iso_pu_bacteria 2582581311 2585294534 747
759 iso_pu_bacteria 2599185239 2599736900 747
760 iso_pu_bacteria 2599185240 2599742981 747
761 iso_pu_bacteria 2599185355 2600205099 747
762 iso_pu_bacteria 2643221556 2643797616 747
763 iso_pu_bacteria 2643221684 2644470602 747
764 iso_pu_bacteria 2675903129 2676742088 747
765 iso_pu_bacteria 2711768613 2713478371 747
766 iso_pu_bacteria 2808606384 2808971689 747
767 iso_pu_bacteria 2808606390 2809006518 747
768 iso_pu_bacteria 2808606391 2809013564 747
769 iso_pu_bacteria 2816332253 2817259966 747
770 iso_pu_bacteria 2816332256 2817277629 747
771 iso_pu_bacteria 2818991445 2819593633 747
772 iso_pu_bacteria 2818991452 2819632401 747
773 iso_pu_bacteria 2842324504 2842325425 747
774 iso_pu_bacteria 2842348783 2842349704 747
775 iso_pu_bacteria 2842454564 2842455060 747
776 iso_pu_bacteria 2856287931 2856289268 747
777 iso_pu_bacteria 2857357740 2857366542 747
778 iso_pu_bacteria 2870068957 2870069128 747
779 iso_pu_bacteria 2883087390 2883094630 747
780 iso_pu_bacteria 2884836552 2884839491 747
781 iso_pu_bacteria 2884852848 2884856699 747
782 iso_pu_bacteria 2896154374 2896158045 747
783 iso_pu_bacteria 2902682994 2902691221 747
784 iso_pu_bacteria 2904564687 2904565626 747
785 iso_pu_bacteria 2904571731 2904572669 747
786 iso_pu_bacteria 2928157003 2928159966 747
787 iso_pu_bacteria 2928163908 2928163993 747
788 iso_pu_bacteria 2928170801 2928177151 747
789 iso_pu_bacteria 2928536128 2928538808 747
790 iso_pu_bacteria 642555112 642594393 747
791 iso_pu_bacteria 8003955200 8003957378 747
792 iso_pu_bacteria 8018845410 8018849535 747
793 iso_pu_bacteria 8020807995 8020809918 747
794 iso_pu_bacteria 8020945358 8020947577 747
795 iso_pu_bacteria 8021120328 8021126858 747
796 iso_pu_bacteria 8039098773 8039099859 747
797 iso_pu_bacteria 8040167225 8040170889 747
798 iso_pu_bacteria 8040173305 8040175198 747
799 iso_pu_bacteria 8047673197 8047678912 747
800 3300003856 Ga0058692_1000001 Ga0058692_1000001529 748
801 3300005347 Ga0070668_100077069 Ga0070668_1000770691 748
802 3300005444 Ga0070694_100043865 Ga0070694_1000438652 748
803 3300005545 Ga0070695_100007483 Ga0070695_1000074835 748
804 3300005937 Ga0081455_10000307 Ga0081455_1000030773 748
805 3300005983 Ga0081540_1000987 Ga0081540_100098717 748
806 3300006051 Ga0075364_10016097 Ga0075364_100160973 748
807 3300006177 Ga0075362_10007202 Ga0075362_100072023 748
808 3300006844 Ga0075428_100087642 Ga0075428_1000876421 748
809 3300006871 Ga0075434_100120654 Ga0075434_1001206541 748
810 3300009036 Ga0105244_10035875 Ga0105244_100358751 748
811 3300009093 Ga0105240_10000561 Ga0105240_1000056132 748
812 3300009094 Ga0111539_10044630 Ga0111539_100446302 748
813 3300009101 Ga0105247_10000097 Ga0105247_10000097101 748
814 3300009147 Ga0114129_10171737 Ga0114129_101717371 748
815 3300009148 Ga0105243_10000010 Ga0105243_1000001036 748
816 3300009174 Ga0105241_10009136 Ga0105241_100091365 748
817 3300009174 Ga0105241_10022241 Ga0105241_100222414 748
818 3300009545 Ga0105237_10004913 Ga0105237_100049135 748
819 3300009553 Ga0105249_10001718 Ga0105249_100017185 748
820 3300010375 Ga0105239_10102154 Ga0105239_101021542 748
821 3300010375 Ga0105239_10120415 Ga0105239_101204152 748
822 3300013102 Ga0157371_10002702 Ga0157371_1000270213 748
823 3300025728 Ga0207655_1000466 Ga0207655_10004664 748
824 3300025728 Ga0207655_1018301 Ga0207655_10183011 748
825 3300025735 Ga0207713_1002593 Ga0207713_10025934 748
826 3300025900 Ga0207710_10000005 Ga0207710_10000005339 748
827 3300025913 Ga0207695_10000008 Ga0207695_10000008430 748
828 3300025913 Ga0207695_10099945 Ga0207695_100999451 748
829 3300025914 Ga0207671_10003046 Ga0207671_1000304610 748
830 3300025935 Ga0207709_10000001 Ga0207709_10000001294 748
831 3300025961 Ga0207712_10002152 Ga0207712_100021525 748
832 3300027312 Ga0209371_1000008 Ga0209371_1000008653 748
833 3300027907 Ga0207428_10028464 Ga0207428_100284643 748
834 3300028786 Ga0307517_10009033 Ga0307517_100090334 748
835 3300028800 Ga0265338_10000191 Ga0265338_1000019179 748
836 3300030500 Ga0268256_1000009 Ga0268256_1000009653 748
837 3300031241 Ga0265325_10016950 Ga0265325_100169502 748
838 3300031712 Ga0265342_10024914 Ga0265342_100249141 748
839 3300031728 Ga0316578_10006425 Ga0316578_100064252 748
840 3300031733 Ga0316577_10000564 Ga0316577_100005646 748
841 3300035398 Ga0316574_0011052 Ga0316574_0011052_1402_3669 748
842 3300036647 Ga0316582_0015492 Ga0316582_0015492_1847_4114 748
843 3300036712 Ga0316584_0009354 Ga0316584_0009354_3990_6257 748
844 3300036712 Ga0316584_0039466 Ga0316584_0039466_216_2477 748
845 3300041460 Ga0451802_1860869 Ga0451802_1860869_52_2379 748
846 3300046616 Ga0495668_0029985 Ga0495668_0029985_111_2390 748
847 3300048907 Ga0496104_0009623 Ga0496104_0009623_1606_3951 748
848 3300048907 Ga0496104_0009639 Ga0496104_0009639_4121_6394 748
849 3300048908 Ga0496105_0000423 Ga0496105_0000423_3002_5275 748
850 3300050507 nmdc:mga05p37_141792_c1 nmdc:mga05p37_141792_c1_313_2589 748
851 iso_pu_bacteria 2513237083 2513560113 748
852 iso_pu_bacteria 2513237104 2513718629 748
853 iso_pu_bacteria 2524023205 2524437421 748
854 iso_pu_bacteria 2599185292 2599903830 748
855 iso_pu_bacteria 2643221628 2644158944 748
856 iso_pu_bacteria 2643221660 2644338884 748
857 iso_pu_bacteria 2721755523 2722885202 748
858 iso_pu_bacteria 2744054633 2745076588 748
859 iso_pu_bacteria 2744054655 2745161919 748
860 iso_pu_bacteria 2808606395 2809034710 748
861 iso_pu_bacteria 2818991448 2819612767 748
862 iso_pu_bacteria 2834641062 2834643157 748
863 iso_pu_bacteria 2839138175 2839141816 748
864 iso_pu_bacteria 2857542790 2857546355 748
865 iso_pu_bacteria 2858950400 2858952973 748
866 iso_pu_bacteria 2881927736 2881931153 748
867 iso_pu_bacteria 2885409591 2885411429 748
868 iso_pu_bacteria 2941479691 2941480449 748
869 iso_pu_bacteria 2945972063 2945972093 748
870 iso_pu_bacteria 2946787523 2946790864 748
871 iso_pu_bacteria 3003930520 3003933685 748
872 iso_pu_bacteria 8048746797 8048749093 748
873 3300003187 JGI25151J46595_10014888 JGI25151J46595_100148882 749
874 3300003215 JGI25153J46596_10000188 JGI25153J46596_1000018855 749
875 3300003771 Ga0055526_1000154 Ga0055526_10001544 749
876 3300005330 Ga0070690_100018345 Ga0070690_1000183451 749
877 3300005331 Ga0070670_100018562 Ga0070670_1000185622 749
878 3300005338 Ga0068868_100001743 Ga0068868_1000017435 749
879 3300005340 Ga0070689_100001641 Ga0070689_1000016418 749
880 3300005347 Ga0070668_100001203 Ga0070668_10000120313 749
881 3300005354 Ga0070675_100001529 Ga0070675_1000015296 749
882 3300005356 Ga0070674_100024092 Ga0070674_1000240923 749
883 3300005364 Ga0070673_100008324 Ga0070673_1000083246 749
884 3300005434 Ga0070709_10000495 Ga0070709_1000049513 749
885 3300005439 Ga0070711_100014808 Ga0070711_1000148084 749
886 3300005456 Ga0070678_100014367 Ga0070678_1000143676 749
887 3300005456 Ga0070678_100024188 Ga0070678_1000241882 749
888 3300005456 Ga0070678_100036590 Ga0070678_1000365902 749
889 3300005543 Ga0070672_100021796 Ga0070672_1000217963 749
890 3300005543 Ga0070672_100022902 Ga0070672_1000229025 749
891 3300005617 Ga0068859_100025589 Ga0068859_1000255893 749
892 3300005617 Ga0068859_100057270 Ga0068859_1000572703 749
893 3300005618 Ga0068864_100001927 Ga0068864_1000019274 749
894 3300005618 Ga0068864_100043852 Ga0068864_1000438521 749
895 3300005842 Ga0068858_100000473 Ga0068858_10000047314 749
896 3300005843 Ga0068860_100000258 Ga0068860_1000002587 749
897 3300005843 Ga0068860_100046818 Ga0068860_1000468182 749
898 3300005937 Ga0081455_10022956 Ga0081455_100229561 749
899 3300005937 Ga0081455_10094098 Ga0081455_100940981 749
900 3300006173 Ga0070716_100002827 Ga0070716_1000028272 749
901 3300006844 Ga0075428_100134112 Ga0075428_1001341122 749
902 3300006931 Ga0097620_100025585 Ga0097620_1000255853 749
903 3300006931 Ga0097620_100057274 Ga0097620_1000572742 749
904 3300009101 Ga0105247_10014838 Ga0105247_100148382 749
905 3300009176 Ga0105242_10067120 Ga0105242_100671202 749
906 3300009177 Ga0105248_10009634 Ga0105248_100096345 749
907 3300009177 Ga0105248_10012212 Ga0105248_100122124 749
908 3300009545 Ga0105237_10090584 Ga0105237_100905842 749
909 3300009551 Ga0105238_10047712 Ga0105238_100477121 749
910 3300013105 Ga0157369_10022041 Ga0157369_100220415 749
911 3300013296 Ga0157374_10002745 Ga0157374_100027453 749
912 3300013306 Ga0163162_10003958 Ga0163162_1000395812 749
913 3300013308 Ga0157375_10005452 Ga0157375_100054525 749
914 3300014325 Ga0163163_10000891 Ga0163163_100008918 749
915 3300014968 Ga0157379_10000427 Ga0157379_1000042712 749
916 3300021361 Ga0213872_10000033 Ga0213872_1000003333 749
917 3300025295 Ga0209564_1000075 Ga0209564_1000075228 749
918 3300025297 Ga0209758_1000131 Ga0209758_100013197 749
919 3300025297 Ga0209758_1002838 Ga0209758_100283813 749
920 3300025893 Ga0207682_10002618 Ga0207682_100026182 749
921 3300025898 Ga0207692_10000477 Ga0207692_100004775 749
922 3300025901 Ga0207688_10036297 Ga0207688_100362971 749
923 3300025906 Ga0207699_10000658 Ga0207699_100006583 749
924 3300025916 Ga0207663_10002238 Ga0207663_100022382 749
925 3300025925 Ga0207650_10036920 Ga0207650_100369202 749
926 3300025926 Ga0207659_10001180 Ga0207659_100011805 749
927 3300025931 Ga0207644_10001262 Ga0207644_100012627 749
928 3300025939 Ga0207665_10021708 Ga0207665_100217082 749
929 3300025940 Ga0207691_10001319 Ga0207691_1000131928 749
930 3300025941 Ga0207711_10009325 Ga0207711_100093255 749
931 3300025941 Ga0207711_10014958 Ga0207711_100149585 749
932 3300025960 Ga0207651_10007524 Ga0207651_100075245 749
933 3300025961 Ga0207712_10038060 Ga0207712_100380602 749
934 3300025972 Ga0207668_10037338 Ga0207668_100373382 749
935 3300025986 Ga0207658_10001416 Ga0207658_100014165 749
936 3300026023 Ga0207677_10000601 Ga0207677_100006019 749
937 3300026035 Ga0207703_10000556 Ga0207703_1000055626 749
938 3300026088 Ga0207641_10036465 Ga0207641_100364652 749
939 3300026089 Ga0207648_10032277 Ga0207648_100322773 749
940 3300026095 Ga0207676_10001650 Ga0207676_100016504 749
941 3300026095 Ga0207676_10033980 Ga0207676_100339801 749
942 3300026118 Ga0207675_100071943 Ga0207675_1000719432 749
943 3300026121 Ga0207683_10003819 Ga0207683_100038199 749
944 3300026121 Ga0207683_10034234 Ga0207683_100342341 749
945 3300028379 Ga0268266_10022299 Ga0268266_100222994 749
946 3300028381 Ga0268264_10000245 Ga0268264_1000024520 749
947 3300031344 Ga0265316_10007895 Ga0265316_100078957 749
948 3300031616 Ga0307508_10000020 Ga0307508_1000002069 749
949 3300031616 Ga0307508_10047298 Ga0307508_100472982 749
950 3300031730 Ga0307516_10021185 Ga0307516_100211853 749
951 3300035410 Ga0373924_0006144 Ga0373924_0006144_1004_3274 749
952 3300035692 Ga0373935_0027468 Ga0373935_0027468_1164_3440 749
953 3300035695 Ga0373927_0027764 Ga0373927_0027764_464_2740 749
954 3300037068 Ga0373925_0010853 Ga0373925_0010853_3593_5908 749
955 3300037471 Ga0395905_0003253 Ga0395905_0003253_8776_11052 749
956 3300039447 Ga0436361_0027317 Ga0436361_0027317_13496_15808 749
957 3300044666 Ga0466977_0001086 Ga0466977_0001086_535_2823 749
958 3300044712 Ga0453684_0003467 Ga0453684_0003467_13231_15507 749
959 3300044712 Ga0453684_0007992 Ga0453684_0007992_14090_16366 749
960 3300045051 Ga0451576_0034623 Ga0451576_0034623_1534_3810 749
961 3300046501 Ga0495607_0000026 Ga0495607_0000026_17849_20146 749
962 3300046522 Ga0495643_0000256 Ga0495643_0000256_53958_56237 749
963 3300046558 Ga0495633_0002060 Ga0495633_0002060_6052_8382 749
964 3300048907 Ga0496104_0004147 Ga0496104_0004147_4385_6700 749
965 3300048909 Ga0496106_0003131 Ga0496106_0003131_5459_7735 749
966 3300048921 Ga0496118_0004955 Ga0496118_0004955_6459_8735 749
967 3300048924 Ga0496121_0000757 Ga0496121_0000757_2042_4318 749
968 3300048925 Ga0496122_0031883 Ga0496122_0031883_992_3289 749
969 3300048925 Ga0496122_0035830 Ga0496122_0035830_596_2926 749
970 3300048926 Ga0496123_0003280 Ga0496123_0003280_13143_15473 749
971 3300048927 Ga0496124_0007035 Ga0496124_0007035_2226_4502 749
972 3300049743 Ga0501081_0016753 Ga0501081_0016753_260_2530 749
973 3300050490 nmdc:mga03n38_10371_c1 nmdc:mga03n38_10371_c1_553_2829 749
974 3300050491 nmdc:mga00v17_3284_c1 nmdc:mga00v17_3284_c1_50_2326 749
975 3300050492 nmdc:mga0yw44_1947_c1 nmdc:mga0yw44_1947_c1_3656_5932 749
976 3300053140 Ga0500573_0010174 Ga0500573_0010174_114_2390 749
977 iso_pu_bacteria 2515154123 2515691772 749
978 iso_pu_bacteria 2519103095 2519457456 749
979 iso_pu_bacteria 2519103095 2519460299 749
980 iso_pu_bacteria 2582581311 2585291987 749
981 iso_pu_bacteria 2599185156 2599334279 749
982 iso_pu_bacteria 2599185239 2599735886 749
983 iso_pu_bacteria 2599185239 2599738609 749
984 iso_pu_bacteria 2599185240 2599743756 749
985 iso_pu_bacteria 2599185240 2599747783 749
986 iso_pu_bacteria 2599185355 2600207176 749
987 iso_pu_bacteria 2599185355 2600209866 749
988 iso_pu_bacteria 2675903129 2676742457 749
989 iso_pu_bacteria 2675903129 2676746042 749
990 iso_pu_bacteria 2739367655 2739611735 749
991 iso_pu_bacteria 2816332253 2817257904 749
992 iso_pu_bacteria 2816332253 2817259648 749
993 iso_pu_bacteria 2816332256 2817277315 749
994 iso_pu_bacteria 2816332256 2817281705 749
995 iso_pu_bacteria 2816332286 2817452287 749
996 iso_pu_bacteria 2816332286 2817456040 749
997 iso_pu_bacteria 2818991452 2819630066 749
998 iso_pu_bacteria 2818991452 2819634559 749
999 iso_pu_bacteria 2818991467 2819717201 749
1000 iso_pu_bacteria 2842922631 2842925439 749
1001 iso_pu_bacteria 2846033681 2846037299 749
1002 iso_pu_bacteria 2846037992 2846040748 749
1003 iso_pu_bacteria 2857576091 2857577391 749
1004 iso_pu_bacteria 2863421361 2863423366 749
1005 iso_pu_bacteria 2863421361 2863425239 749
1006 iso_pu_bacteria 2870068957 2870069459 749
1007 iso_pu_bacteria 2887375801 2887377624 749
1008 iso_pu_bacteria 2904564687 2904570788 749
1009 iso_pu_bacteria 2904564687 2904571446 749
1010 iso_pu_bacteria 2904571731 2904577966 749
1011 iso_pu_bacteria 2904571731 2904578579 749
1012 iso_pu_bacteria 2928157003 2928158409 749
1013 iso_pu_bacteria 2928157003 2928163354 749
1014 iso_pu_bacteria 2928163908 2928167379 749
1015 iso_pu_bacteria 2928163908 2928170236 749
1016 iso_pu_bacteria 2928170801 2928173964 749
1017 iso_pu_bacteria 2928170801 2928175690 749
1018 iso_pu_bacteria 2928536128 2928536858 749
1019 iso_pu_bacteria 2928536128 2928541290 749
1020 iso_pu_bacteria 2981990288 2981991875 749
1021 iso_pu_bacteria 2981990288 2981995915 749
1022 iso_pu_bacteria 641736154 642414175 749
1023 iso_pu_bacteria 641736154 642417190 749
1024 iso_pu_bacteria 643348564 643600060 749
1025 iso_pu_bacteria 8002392321 8002393052 749
1026 iso_pu_bacteria 8006933436 8006934755 749
1027 iso_pu_bacteria 8006973647 8006974722 749
1028 iso_pu_bacteria 8018845410 8018848380 749
1029 iso_pu_bacteria 8018845410 8018851045 749
1030 iso_pu_bacteria 8020807995 8020812198 749
1031 iso_pu_bacteria 8020807995 8020813451 749
1032 iso_pu_bacteria 8020938398 8020942384 749
1033 iso_pu_bacteria 8020938398 8020943113 749
1034 iso_pu_bacteria 8020945358 8020952118 749
1035 iso_pu_bacteria 8020945358 8020953111 749
1036 iso_pu_bacteria 8020953355 8020954164 749
1037 iso_pu_bacteria 8020953355 8020957216 749
1038 iso_pu_bacteria 8021120328 8021126216 749
1039 iso_pu_bacteria 8021120328 8021127873 749
1040 iso_pu_bacteria 8039098773 8039101611 749
1041 iso_pu_bacteria 8040167225 8040172534 749
1042 iso_pu_bacteria 8040173305 8040176921 749
1043 iso_pu_bacteria 8040173305 8040177057 749
1044 3300001989 JGI24739J22299_10007181 JGI24739J22299_100071811 750
1045 3300002704 JGI25155J39150_1000045 JGI25155J39150_10000452 750
1046 3300002705 JGI25156J39149_1000054 JGI25156J39149_100005479 750
1047 3300002738 JGI25154J39366_1000083 JGI25154J39366_100008379 750
1048 3300002741 JGI25157J39369_1001737 JGI25157J39369_10017375 750
1049 3300003354 JGI25160J50197_1000267 JGI25160J50197_100026731 750
1050 3300003758 Ga0055532_1000099 Ga0055532_100009986 750
1051 3300003759 Ga0055525_1000009 Ga0055525_1000009488 750
1052 3300005327 Ga0070658_10076069 Ga0070658_100760691 750
1053 3300005335 Ga0070666_10004823 Ga0070666_100048234 750
1054 3300005339 Ga0070660_100002602 Ga0070660_1000026028 750
1055 3300005347 Ga0070668_100000227 Ga0070668_1000002278 750
1056 3300005353 Ga0070669_100003560 Ga0070669_1000035606 750
1057 3300005356 Ga0070674_100009642 Ga0070674_1000096424 750
1058 3300005366 Ga0070659_100000124 Ga0070659_10000012457 750
1059 3300005366 Ga0070659_100029780 Ga0070659_1000297802 750
1060 3300005367 Ga0070667_100000058 Ga0070667_10000005820 750
1061 3300005455 Ga0070663_100000037 Ga0070663_10000003755 750
1062 3300005458 Ga0070681_10059401 Ga0070681_100594012 750
1063 3300005539 Ga0068853_100002411 Ga0068853_1000024112 750
1064 3300005563 Ga0068855_100013427 Ga0068855_1000134276 750
1065 3300005564 Ga0070664_100032296 Ga0070664_1000322963 750
1066 3300005841 Ga0068863_100000031 Ga0068863_10000003120 750
1067 3300009093 Ga0105240_10001611 Ga0105240_1000161121 750
1068 3300009093 Ga0105240_10013623 Ga0105240_100136235 750
1069 3300009093 Ga0105240_10021651 Ga0105240_100216517 750
1070 3300009094 Ga0111539_10003535 Ga0111539_100035353 750
1071 3300009174 Ga0105241_10003135 Ga0105241_100031357 750
1072 3300009174 Ga0105241_10024080 Ga0105241_100240802 750
1073 3300009177 Ga0105248_10024337 Ga0105248_100243373 750
1074 3300009545 Ga0105237_10010204 Ga0105237_100102048 750
1075 3300009545 Ga0105237_10029017 Ga0105237_100290173 750
1076 3300009551 Ga0105238_10015923 Ga0105238_100159233 750
1077 3300010375 Ga0105239_10005717 Ga0105239_100057179 750
1078 3300010375 Ga0105239_10018092 Ga0105239_100180925 750
1079 3300010375 Ga0105239_10179877 Ga0105239_101798771 750
1080 3300013100 Ga0157373_10008381 Ga0157373_100083818 750
1081 3300013104 Ga0157370_10002001 Ga0157370_1000200118 750
1082 3300013105 Ga0157369_10002708 Ga0157369_100027086 750
1083 3300013296 Ga0157374_10000055 Ga0157374_1000005588 750
1084 3300013306 Ga0163162_10008255 Ga0163162_100082557 750
1085 3300013307 Ga0157372_10005336 Ga0157372_100053365 750
1086 3300021361 Ga0213872_10010189 Ga0213872_100101892 750
1087 3300025206 Ga0209435_100034 Ga0209435_10003462 750
1088 3300025225 Ga0209566_100343 Ga0209566_10034320 750
1089 3300025228 Ga0209672_100159 Ga0209672_1001599 750
1090 3300025229 Ga0209147_100004 Ga0209147_100004103 750
1091 3300025229 Ga0209147_100348 Ga0209147_10034826 750
1092 3300025233 Ga0209437_100072 Ga0209437_100072118 750
1093 3300025242 Ga0209258_100417 Ga0209258_1004173 750
1094 3300025242 Ga0209258_100550 Ga0209258_1005509 750
1095 3300025246 Ga0209646_1000118 Ga0209646_100011862 750
1096 3300025250 Ga0209026_1000106 Ga0209026_100010662 750
1097 3300025254 Ga0209148_1001426 Ga0209148_10014267 750
1098 3300025256 Ga0209759_1000190 Ga0209759_100019079 750
1099 3300025295 Ga0209564_1013997 Ga0209564_10139972 750
1100 3300025302 Ga0207426_1000037 Ga0207426_100003787 750
1101 3300025304 Ga0209257_1000733 Ga0209257_100073330 750
1102 3300025903 Ga0207680_10003312 Ga0207680_100033123 750
1103 3300025904 Ga0207647_10000645 Ga0207647_100006458 750
1104 3300025904 Ga0207647_10015984 Ga0207647_100159844 750
1105 3300025911 Ga0207654_10009290 Ga0207654_100092902 750
1106 3300025913 Ga0207695_10001454 Ga0207695_1000145421 750
1107 3300025913 Ga0207695_10014623 Ga0207695_100146235 750
1108 3300025913 Ga0207695_10021460 Ga0207695_100214606 750
1109 3300025914 Ga0207671_10004434 Ga0207671_100044343 750
1110 3300025914 Ga0207671_10012150 Ga0207671_100121505 750
1111 3300025919 Ga0207657_10000064 Ga0207657_100000648 750
1112 3300025919 Ga0207657_10000918 Ga0207657_1000091826 750
1113 3300025923 Ga0207681_10000864 Ga0207681_100008649 750
1114 3300025932 Ga0207690_10000060 Ga0207690_100000609 750
1115 3300025932 Ga0207690_10019150 Ga0207690_100191503 750
1116 3300025949 Ga0207667_10008329 Ga0207667_100083295 750
1117 3300025949 Ga0207667_10016463 Ga0207667_100164636 750
1118 3300025949 Ga0207667_10033301 Ga0207667_100333014 750
1119 3300025972 Ga0207668_10000535 Ga0207668_1000053512 750
1120 3300025986 Ga0207658_10000037 Ga0207658_1000003720 750
1121 3300026041 Ga0207639_10002022 Ga0207639_1000202217 750
1122 3300026067 Ga0207678_10000233 Ga0207678_1000023341 750
1123 3300026088 Ga0207641_10000050 Ga0207641_10000050109 750
1124 3300026089 Ga0207648_10015463 Ga0207648_100154631 750
1125 3300027312 Ga0209371_1000114 Ga0209371_100011483 750
1126 3300027614 Ga0209970_1000046 Ga0209970_100004614 750
1127 3300027907 Ga0207428_10031456 Ga0207428_100314562 750
1128 3300028381 Ga0268264_10014252 Ga0268264_100142523 750
1129 3300030500 Ga0268256_1000218 Ga0268256_100021848 750
1130 3300031241 Ga0265325_10028965 Ga0265325_100289652 750
1131 3300031711 Ga0265314_10000481 Ga0265314_1000048123 750
1132 3300031852 Ga0307410_10014827 Ga0307410_100148271 750
1133 3300031995 Ga0307409_100015836 Ga0307409_1000158362 750
1134 3300032002 Ga0307416_100008557 Ga0307416_1000085578 750
1135 3300033179 Ga0307507_10047429 Ga0307507_100474292 750
1136 3300035398 Ga0316574_0028379 Ga0316574_0028379_172_2448 750
1137 3300037312 Ga0395899_0000093 Ga0395899_0000093_38757_41069 750
1138 3300037312 Ga0395899_0008019 Ga0395899_0008019_272_2584 750
1139 3300037471 Ga0395905_0000201 Ga0395905_0000201_25062_27356 750
1140 3300037471 Ga0395905_0021404 Ga0395905_0021404_2176_4494 750
1141 3300038726 Ga0400490_05271 Ga0400490_05271_4061_6337 750
1142 3300038741 Ga0400488_33751 Ga0400488_33751_2343_4619 750
1143 3300039110 Ga0400487_32542 Ga0400487_32542_12017_14293 750
1144 3300039447 Ga0436361_0862241 Ga0436361_0862241_2605_4899 750
1145 3300042005 Ga0439448_0003989 Ga0439448_0003989_482_2779 750
1146 3300044673 Ga0453683_0000921 Ga0453683_0000921_19177_21483 750
1147 3300046452 Ga0495617_001005 Ga0495617_001005_1863_4175 750
1148 3300046452 Ga0495617_004594 Ga0495617_004594_299_2587 750
1149 3300046459 Ga0495629_0002941 Ga0495629_0002941_3427_5739 750
1150 3300046460 Ga0495638_0011281 Ga0495638_0011281_2376_4688 750
1151 3300046471 Ga0495650_0003929 Ga0495650_0003929_274_2547 750
1152 3300046474 Ga0495605_0024579 Ga0495605_0024579_209_2521 750
1153 3300046491 Ga0495584_0000011 Ga0495584_0000011_135051_137363 750
1154 3300046491 Ga0495584_0003137 Ga0495584_0003137_4511_6823 750
1155 3300046492 Ga0495585_0000106 Ga0495585_0000106_60902_63214 750
1156 3300046492 Ga0495585_0000140 Ga0495585_0000140_67234_69546 750
1157 3300046492 Ga0495585_0000157 Ga0495585_0000157_56656_58944 750
1158 3300046492 Ga0495585_0000337 Ga0495585_0000337_39354_41666 750
1159 3300046492 Ga0495585_0005955 Ga0495585_0005955_4385_6697 750
1160 3300046501 Ga0495607_0000592 Ga0495607_0000592_14293_16605 750
1161 3300046506 Ga0495583_0000214 Ga0495583_0000214_12859_15171 750
1162 3300046506 Ga0495583_0005525 Ga0495583_0005525_6136_8448 750
1163 3300046513 Ga0495616_0000236 Ga0495616_0000236_13117_15405 750
1164 3300046513 Ga0495616_0000658 Ga0495616_0000658_4039_6351 750
1165 3300046513 Ga0495616_0008942 Ga0495616_0008942_1501_3813 750
1166 3300046524 Ga0495648_0000003 Ga0495648_0000003_255177_257465 750
1167 3300046524 Ga0495648_0000410 Ga0495648_0000410_25623_27935 750
1168 3300046524 Ga0495648_0011226 Ga0495648_0011226_1821_4133 750
1169 3300046528 Ga0495642_0001735 Ga0495642_0001735_3877_6189 750
1170 3300046535 Ga0495586_0005092 Ga0495586_0005092_605_2917 750
1171 3300046538 Ga0495609_0000234 Ga0495609_0000234_28825_31137 750
1172 3300046538 Ga0495609_0006028 Ga0495609_0006028_1822_4134 750
1173 3300046542 Ga0495597_0001999 Ga0495597_0001999_6835_9147 750
1174 3300046558 Ga0495633_0003237 Ga0495633_0003237_4468_6780 750
1175 3300046648 Ga0495611_0004434 Ga0495611_0004434_3410_5722 750
1176 3300046648 Ga0495611_0006212 Ga0495611_0006212_1028_3340 750
1177 3300046660 Ga0495625_0000336 Ga0495625_0000336_45846_48134 750
1178 3300046665 Ga0495661_0000421 Ga0495661_0000421_20793_23105 750
1179 3300046665 Ga0495661_0012258 Ga0495661_0012258_1222_3534 750
1180 3300046674 Ga0495588_0000070 Ga0495588_0000070_173405_175717 750
1181 3300046679 Ga0495623_0019220 Ga0495623_0019220_807_3101 750
1182 3300046794 Ga0495589_0000036 Ga0495589_0000036_130193_132505 750
1183 3300047315 Ga0495581_0026119 Ga0495581_0026119_630_2942 750
1184 3300047319 Ga0495674_0026986 Ga0495674_0026986_2588_4882 750
1185 3300047323 Ga0495683_0015023 Ga0495683_0015023_509_2803 750
1186 3300047443 Ga0495687_000074 Ga0495687_000074_130332_132644 750
1187 3300047445 Ga0495677_0000042 Ga0495677_0000042_21257_23569 750
1188 3300047470 Ga0495681_0013062 Ga0495681_0013062_225_2537 750
1189 3300048088 Ga0495602_0063413 Ga0495602_0063413_317_2629 750
1190 3300048091 Ga0495626_0000855 Ga0495626_0000855_9766_12078 750
1191 3300048091 Ga0495626_0008465 Ga0495626_0008465_1909_4221 750
1192 3300048904 Ga0496101_0001746 Ga0496101_0001746_9430_11724 750
1193 3300048905 Ga0496102_0000107 Ga0496102_0000107_56575_58884 750
1194 3300048905 Ga0496102_0018238 Ga0496102_0018238_2812_5124 750
1195 3300048907 Ga0496104_0010052 Ga0496104_0010052_4844_7150 750
1196 3300048908 Ga0496105_0024976 Ga0496105_0024976_2414_4720 750
1197 3300048909 Ga0496106_0000152 Ga0496106_0000152_26745_29039 750
1198 3300048913 Ga0496110_0036872 Ga0496110_0036872_1471_3777 750
1199 3300048914 Ga0496111_0018401 Ga0496111_0018401_230_2536 750
1200 3300048915 Ga0496112_0068977 Ga0496112_0068977_218_2524 750
1201 3300048916 Ga0496113_0033105 Ga0496113_0033105_113_2425 750
1202 3300048919 Ga0496116_0052649 Ga0496116_0052649_384_2678 750
1203 3300048924 Ga0496121_0002388 Ga0496121_0002388_22665_24959 750
1204 3300048924 Ga0496121_0002599 Ga0496121_0002599_12275_14569 750
1205 3300048924 Ga0496121_0006957 Ga0496121_0006957_9227_11515 750
1206 3300048925 Ga0496122_0000121 Ga0496122_0000121_146177_148465 750
1207 3300048926 Ga0496123_0000040 Ga0496123_0000040_146477_148765 750
1208 3300048928 Ga0496125_0000204 Ga0496125_0000204_105676_107964 750
1209 3300049571 Ga0501034_0109451 Ga0501034_0109451_113_2401 750
1210 3300049822 Ga0501035_0007411 Ga0501035_0007411_4331_6619 750
1211 3300049823 Ga0501044_0004791 Ga0501044_0004791_10825_13113 750
1212 3300050511 nmdc:mga08y16_27923_c1 nmdc:mga08y16_27923_c1_1917_4193 750
1213 iso_pu_bacteria 2515154189 2516016870 750
1214 iso_pu_bacteria 2599185292 2599905288 750
1215 iso_pu_bacteria 2643221584 2643928371 750
1216 iso_pu_bacteria 2643221644 2644245870 750
1217 iso_pu_bacteria 2808606395 2809034560 750
1218 iso_pu_bacteria 2818991436 2819544264 750
1219 iso_pu_bacteria 2842694124 2842696237 750
1220 iso_pu_bacteria 2855730933 2855736149 750
1221 iso_pu_bacteria 2855767633 2855773086 750
1222 iso_pu_bacteria 2856287931 2856292904 750
1223 iso_pu_bacteria 2857357740 2857366367 750
1224 iso_pu_bacteria 2858950400 2858954864 750
1225 iso_pu_bacteria 2904434214 2904438462 750
1226 iso_pu_bacteria 2941479691 2941480296 750
1227 iso_pu_bacteria 641736154 642418056 750
1228 iso_pu_bacteria 8048746797 8048746957 750
1229 3300003791 Ga0055530_10008159 Ga0055530_100081592 751
1230 3300003792 Ga0055540_1000026 Ga0055540_100002686 751
1231 3300003794 Ga0055531_10007304 Ga0055531_100073044 751
1232 3300005288 Ga0065714_10003428 Ga0065714_100034283 751
1233 3300005366 Ga0070659_100001218 Ga0070659_10000121820 751
1234 3300006353 Ga0075370_10030519 Ga0075370_100305192 751
1235 3300006946 Ga0079104_1000093 Ga0079104_100009312 751
1236 3300009092 Ga0105250_10000007 Ga0105250_10000007323 751
1237 3300009093 Ga0105240_10017908 Ga0105240_100179086 751
1238 3300009177 Ga0105248_10031465 Ga0105248_100314654 751
1239 3300013100 Ga0157373_10000764 Ga0157373_1000076410 751
1240 3300015261 Ga0182006_1009457 Ga0182006_10094573 751
1241 3300017792 Ga0163161_10005217 Ga0163161_100052173 751
1242 3300021361 Ga0213872_10003351 Ga0213872_100033512 751
1243 3300025273 Ga0209673_1001913 Ga0209673_10019138 751
1244 3300025298 Ga0209050_1001550 Ga0209050_100155016 751
1245 3300025303 Ga0209051_1000004 Ga0209051_1000004565 751
1246 3300025304 Ga0209257_1000063 Ga0209257_100006351 751
1247 3300025915 Ga0207693_10006957 Ga0207693_100069576 751
1248 3300026067 Ga0207678_10087663 Ga0207678_100876631 751
1249 3300027111 Ga0209281_1000084 Ga0209281_1000084120 751
1250 3300031548 Ga0307408_100003302 Ga0307408_1000033022 751
1251 3300031824 Ga0307413_10005249 Ga0307413_100052494 751
1252 3300031852 Ga0307410_10009795 Ga0307410_100097954 751
1253 3300032004 Ga0307414_10023428 Ga0307414_100234282 751
1254 3300032004 Ga0307414_10037338 Ga0307414_100373381 751
1255 3300038725 Ga0400484_07051 Ga0400484_07051_17132_19411 751
1256 3300038725 Ga0400484_22850 Ga0400484_22850_452_2731 751
1257 3300038726 Ga0400490_05408 Ga0400490_05408_1697_3976 751
1258 3300038726 Ga0400490_20208 Ga0400490_20208_25006_27285 751
1259 3300038726 Ga0400490_20541 Ga0400490_20541_814_3093 751
1260 3300038726 Ga0400490_39588 Ga0400490_39588_26262_28541 751
1261 3300038727 Ga0400491_08631 Ga0400491_08631_8295_10574 751
1262 3300038735 Ga0400485_02459 Ga0400485_02459_123224_125503 751
1263 3300038735 Ga0400485_21461 Ga0400485_21461_4513_6792 751
1264 3300038741 Ga0400488_37965 Ga0400488_37965_1406_3685 751
1265 3300038742 Ga0400486_05345 Ga0400486_05345_4543_6822 751
1266 3300038742 Ga0400486_06505 Ga0400486_06505_11334_13613 751
1267 3300038742 Ga0400486_23232 Ga0400486_23232_229363_231642 751
1268 3300038742 Ga0400486_24750 Ga0400486_24750_1208_3487 751
1269 3300039062 Ga0400483_020073 Ga0400483_020073_1689_3968 751
1270 3300039062 Ga0400483_053792 Ga0400483_053792_5580_7859 751
1271 3300039062 Ga0400483_117005 Ga0400483_117005_5587_7866 751
1272 3300039062 Ga0400483_196030 Ga0400483_196030_14405_16684 751
1273 3300039062 Ga0400483_227457 Ga0400483_227457_698_2977 751
1274 3300039110 Ga0400487_25234 Ga0400487_25234_79647_81926 751
1275 3300039110 Ga0400487_44972 Ga0400487_44972_10972_13251 751
1276 3300039447 Ga0436361_0156174 Ga0436361_0156174_1168_3459 751
1277 3300039447 Ga0436361_0677791 Ga0436361_0677791_1408_3741 751
1278 3300042531 Ga0450918_000028 Ga0450918_000028_19847_22159 751
1279 3300042876 Ga0451577_0000280 Ga0451577_0000280_53082_55370 751
1280 3300044684 Ga0466966_0012851 Ga0466966_0012851_2767_5058 751
1281 3300044693 Ga0466961_0001290 Ga0466961_0001290_10858_13149 751
1282 3300044694 Ga0466963_0001067 Ga0466963_0001067_8148_10451 751
1283 3300044712 Ga0453684_0000682 Ga0453684_0000682_93963_96239 751
1284 3300044712 Ga0453684_0001982 Ga0453684_0001982_49070_51376 751
1285 3300044712 Ga0453684_0008526 Ga0453684_0008526_10669_12945 751
1286 3300044712 Ga0453684_0013748 Ga0453684_0013748_10032_12320 751
1287 3300044712 Ga0453684_0050465 Ga0453684_0050465_1594_3876 751
1288 3300045051 Ga0451576_0001365 Ga0451576_0001365_896_3172 751
1289 3300046472 Ga0495580_0024301 Ga0495580_0024301_1628_4051 751
1290 3300046515 Ga0495620_0008985 Ga0495620_0008985_1217_3502 751
1291 3300046615 Ga0495656_0002105 Ga0495656_0002105_2541_4823 751
1292 3300046660 Ga0495625_0001112 Ga0495625_0001112_29515_31800 751
1293 3300047472 Ga0495686_0053430 Ga0495686_0053430_212_2506 751
1294 3300048924 Ga0496121_0000164 Ga0496121_0000164_98688_100976 751
1295 3300048924 Ga0496121_0013364 Ga0496121_0013364_5078_7369 751
1296 3300048925 Ga0496122_0000227 Ga0496122_0000227_120433_122721 751
1297 3300048926 Ga0496123_0001919 Ga0496123_0001919_23979_26267 751
1298 3300048927 Ga0496124_0000104 Ga0496124_0000104_155322_157610 751
1299 3300048928 Ga0496125_0000241 Ga0496125_0000241_34553_36841 751
1300 3300048928 Ga0496125_0016006 Ga0496125_0016006_1913_4201 751
1301 3300048929 Ga0496126_0001830 Ga0496126_0001830_4723_7017 751
1302 3300053079 Ga0500610_0001684 Ga0500610_0001684_3589_5874 751
1303 3300053161 Ga0500634_0005072 Ga0500634_0005072_1693_3996 751
1304 iso_pu_bacteria 2721755763 2723879724 751
1305 iso_pu_bacteria 2808606384 2808971507 751
1306 iso_pu_bacteria 2808606390 2809006109 751
1307 iso_pu_bacteria 2808606391 2809013474 751
1308 iso_pu_bacteria 2855730933 2855734774 751
1309 iso_pu_bacteria 2855767633 2855770558 751
1310 iso_pu_bacteria 2856287931 2856288300 751
1311 3300002705 JGI25156J39149_1000476 JGI25156J39149_10004768 752
1312 3300002738 JGI25154J39366_1001213 JGI25154J39366_10012135 752
1313 3300002741 JGI25157J39369_1000500 JGI25157J39369_10005008 752
1314 3300003752 Ga0055539_1000493 Ga0055539_10004933 752
1315 3300003752 Ga0055539_1001124 Ga0055539_10011244 752
1316 3300003756 Ga0055533_1000016 Ga0055533_100001669 752
1317 3300003759 Ga0055525_1001460 Ga0055525_10014603 752
1318 3300003761 Ga0055535_1001027 Ga0055535_10010276 752
1319 3300003763 Ga0055529_1000214 Ga0055529_100021458 752
1320 3300003775 Ga0055524_1000522 Ga0055524_100052219 752
1321 3300005327 Ga0070658_10018442 Ga0070658_100184421 752
1322 3300005331 Ga0070670_100000846 Ga0070670_1000008462 752
1323 3300005354 Ga0070675_100057964 Ga0070675_1000579642 752
1324 3300005435 Ga0070714_100077463 Ga0070714_1000774632 752
1325 3300005436 Ga0070713_100055093 Ga0070713_1000550932 752
1326 3300005456 Ga0070678_100051267 Ga0070678_1000512672 752
1327 3300005471 Ga0070698_100050013 Ga0070698_1000500132 752
1328 3300005518 Ga0070699_100021709 Ga0070699_1000217095 752
1329 3300005535 Ga0070684_100027456 Ga0070684_1000274563 752
1330 3300005543 Ga0070672_100037274 Ga0070672_1000372742 752
1331 3300005563 Ga0068855_100003343 Ga0068855_10000334317 752
1332 3300005614 Ga0068856_100015097 Ga0068856_1000150974 752
1333 3300005615 Ga0070702_100008248 Ga0070702_1000082482 752
1334 3300005718 Ga0068866_10007452 Ga0068866_100074522 752
1335 3300005719 Ga0068861_100018764 Ga0068861_1000187645 752
1336 3300005841 Ga0068863_100042503 Ga0068863_1000425032 752
1337 3300005842 Ga0068858_100017989 Ga0068858_1000179892 752
1338 3300006038 Ga0075365_10040255 Ga0075365_100402552 752
1339 3300006051 Ga0075364_10000226 Ga0075364_1000022614 752
1340 3300006051 Ga0075364_10028353 Ga0075364_100283532 752
1341 3300006058 Ga0075432_10003028 Ga0075432_100030282 752
1342 3300006175 Ga0070712_100004813 Ga0070712_1000048132 752
1343 3300006846 Ga0075430_100003188 Ga0075430_10000318813 752
1344 3300006846 Ga0075430_100023804 Ga0075430_1000238042 752
1345 3300006847 Ga0075431_100029825 Ga0075431_1000298252 752
1346 3300006852 Ga0075433_10006239 Ga0075433_100062393 752
1347 3300006852 Ga0075433_10059534 Ga0075433_100595342 752
1348 3300006871 Ga0075434_100044404 Ga0075434_1000444042 752
1349 3300006880 Ga0075429_100002409 Ga0075429_1000024093 752
1350 3300007076 Ga0075435_100013166 Ga0075435_1000131665 752
1351 3300009094 Ga0111539_10005226 Ga0111539_100052265 752
1352 3300009101 Ga0105247_10011653 Ga0105247_100116532 752
1353 3300009147 Ga0114129_10062820 Ga0114129_100628203 752
1354 3300009545 Ga0105237_10041119 Ga0105237_100411192 752
1355 3300010375 Ga0105239_10009649 Ga0105239_100096493 752
1356 3300013104 Ga0157370_10003668 Ga0157370_1000366818 752
1357 3300013296 Ga0157374_10023573 Ga0157374_100235732 752
1358 3300014325 Ga0163163_10036611 Ga0163163_100366112 752
1359 3300014969 Ga0157376_10049411 Ga0157376_100494112 752
1360 3300021361 Ga0213872_10002496 Ga0213872_100024963 752
1361 3300021361 Ga0213872_10005862 Ga0213872_100058622 752
1362 3300025226 Ga0209674_100041 Ga0209674_100041313 752
1363 3300025230 Ga0209563_100043 Ga0209563_100043313 752
1364 3300025231 Ga0207427_101162 Ga0207427_1011623 752
1365 3300025242 Ga0209258_100270 Ga0209258_10027071 752
1366 3300025242 Ga0209258_100602 Ga0209258_1006023 752
1367 3300025246 Ga0209646_1000410 Ga0209646_10004109 752
1368 3300025250 Ga0209026_1000006 Ga0209026_100000687 752
1369 3300025253 Ga0209677_100098 Ga0209677_10009848 752
1370 3300025253 Ga0209677_100372 Ga0209677_10037210 752
1371 3300025256 Ga0209759_1000194 Ga0209759_10001948 752
1372 3300025256 Ga0209759_1000635 Ga0209759_10006357 752
1373 3300025256 Ga0209759_1002542 Ga0209759_10025422 752
1374 3300025272 Ga0209455_1000195 Ga0209455_10001958 752
1375 3300025299 Ga0209256_1000030 Ga0209256_1000030138 752
1376 3300025303 Ga0209051_1001801 Ga0209051_100180110 752
1377 3300025900 Ga0207710_10007279 Ga0207710_100072794 752
1378 3300025901 Ga0207688_10021244 Ga0207688_100212442 752
1379 3300025907 Ga0207645_10042076 Ga0207645_100420762 752
1380 3300025909 Ga0207705_10000297 Ga0207705_1000029721 752
1381 3300025913 Ga0207695_10024107 Ga0207695_100241072 752
1382 3300025915 Ga0207693_10003912 Ga0207693_100039122 752
1383 3300025915 Ga0207693_10037366 Ga0207693_100373663 752
1384 3300025933 Ga0207706_10027265 Ga0207706_100272652 752
1385 3300025941 Ga0207711_10040931 Ga0207711_100409312 752
1386 3300025949 Ga0207667_10000909 Ga0207667_100009093 752
1387 3300025960 Ga0207651_10023201 Ga0207651_100232012 752
1388 3300026035 Ga0207703_10014156 Ga0207703_100141562 752
1389 3300026067 Ga0207678_10009609 Ga0207678_100096092 752
1390 3300026078 Ga0207702_10001360 Ga0207702_100013608 752
1391 3300026089 Ga0207648_10018615 Ga0207648_100186152 752
1392 3300026095 Ga0207676_10005239 Ga0207676_100052392 752
1393 3300026116 Ga0207674_10034776 Ga0207674_100347763 752
1394 3300026121 Ga0207683_10005384 Ga0207683_100053842 752
1395 3300027907 Ga0207428_10002173 Ga0207428_1000217313 752
1396 3300028379 Ga0268266_10023960 Ga0268266_100239602 752
1397 3300028666 Ga0265336_10000133 Ga0265336_1000013326 752
1398 3300028794 Ga0307515_10000089 Ga0307515_1000008943 752
1399 3300029957 Ga0265324_10001688 Ga0265324_100016886 752
1400 3300031911 Ga0307412_10000936 Ga0307412_1000093619 752
1401 3300035170 Ga0373943_0002953 Ga0373943_0002953_746_3052 752
1402 3300035691 Ga0373931_0003797 Ga0373931_0003797_2527_4833 752
1403 3300035692 Ga0373935_0019906 Ga0373935_0019906_1666_3972 752
1404 3300035695 Ga0373927_0001140 Ga0373927_0001140_1482_3890 752
1405 3300035695 Ga0373927_0006018 Ga0373927_0006018_4405_6711 752
1406 3300035725 Ga0373947_0019053 Ga0373947_0019053_763_3069 752
1407 3300037068 Ga0373925_0012885 Ga0373925_0012885_818_3124 752
1408 3300037312 Ga0395899_0057491 Ga0395899_0057491_323_2629 752
1409 3300037418 Ga0395900_0009047 Ga0395900_0009047_5213_7507 752
1410 3300037466 Ga0395898_0047579 Ga0395898_0047579_1453_3759 752
1411 3300037853 Ga0436364_0563245 Ga0436364_0563245_3718_6078 752
1412 3300038443 Ga0395901_0000186 Ga0395901_0000186_35452_37758 752
1413 3300038443 Ga0395901_0000607 Ga0395901_0000607_22766_25072 752
1414 3300038443 Ga0395901_0051392 Ga0395901_0051392_40_2349 752
1415 3300038443 Ga0395901_0055056 Ga0395901_0055056_803_3106 752
1416 3300039062 Ga0400483_154845 Ga0400483_154845_2739_5090 752
1417 3300039447 Ga0436361_0069414 Ga0436361_0069414_1629_3911 752
1418 3300039447 Ga0436361_0203161 Ga0436361_0203161_3065_5347 752
1419 3300042876 Ga0451577_0000817 Ga0451577_0000817_854_3133 752
1420 3300042876 Ga0451577_0044511 Ga0451577_0044511_811_3090 752
1421 3300044656 Ga0466969_0001023 Ga0466969_0001023_3956_6262 752
1422 3300044683 Ga0466965_0005395 Ga0466965_0005395_555_2861 752
1423 3300044684 Ga0466966_0000016 Ga0466966_0000016_99717_102023 752
1424 3300044693 Ga0466961_0002482 Ga0466961_0002482_6572_8854 752
1425 3300044712 Ga0453684_0000014 Ga0453684_0000014_579513_581792 752
1426 3300044712 Ga0453684_0002255 Ga0453684_0002255_35189_37468 752
1427 3300045051 Ga0451576_0004353 Ga0451576_0004353_850_3129 752
1428 3300046455 Ga0495603_0014725 Ga0495603_0014725_819_3125 752
1429 3300046506 Ga0495583_0000328 Ga0495583_0000328_53168_55474 752
1430 3300046660 Ga0495625_0003952 Ga0495625_0003952_10477_12783 752
1431 3300046674 Ga0495588_0005538 Ga0495588_0005538_3281_5587 752
1432 3300046684 Ga0495669_0015511 Ga0495669_0015511_395_2707 752
1433 3300046690 Ga0495624_0039433 Ga0495624_0039433_686_2992 752
1434 3300047321 Ga0495676_0006349 Ga0495676_0006349_5808_8114 752
1435 3300047323 Ga0495683_0007204 Ga0495683_0007204_798_3098 752
1436 3300047444 Ga0495675_0022922 Ga0495675_0022922_76_2409 752
1437 3300048905 Ga0496102_0001256 Ga0496102_0001256_19926_22229 752
1438 3300048905 Ga0496102_0030526 Ga0496102_0030526_1265_3571 752
1439 3300048907 Ga0496104_0007391 Ga0496104_0007391_7163_9475 752
1440 3300048908 Ga0496105_0002735 Ga0496105_0002735_2002_4308 752
1441 3300048908 Ga0496105_0005575 Ga0496105_0005575_7016_9328 752
1442 3300048908 Ga0496105_0085560 Ga0496105_0085560_198_2504 752
1443 3300048909 Ga0496106_0002957 Ga0496106_0002957_8280_10586 752
1444 3300048909 Ga0496106_0009781 Ga0496106_0009781_3973_6279 752
1445 3300048909 Ga0496106_0030397 Ga0496106_0030397_587_2887 752
1446 3300048910 Ga0496107_0004080 Ga0496107_0004080_6842_9148 752
1447 3300048911 Ga0496108_0000373 Ga0496108_0000373_30455_32761 752
1448 3300048911 Ga0496108_0001803 Ga0496108_0001803_3531_5837 752
1449 3300048912 Ga0496109_0001220 Ga0496109_0001220_6565_8871 752
1450 3300048913 Ga0496110_0007314 Ga0496110_0007314_249_2555 752
1451 3300048913 Ga0496110_0033439 Ga0496110_0033439_990_3296 752
1452 3300048914 Ga0496111_0000784 Ga0496111_0000784_7063_9369 752
1453 3300048914 Ga0496111_0016266 Ga0496111_0016266_2495_4801 752
1454 3300048915 Ga0496112_0000798 Ga0496112_0000798_13817_16123 752
1455 3300048915 Ga0496112_0004378 Ga0496112_0004378_8216_10522 752
1456 3300048916 Ga0496113_0000607 Ga0496113_0000607_1961_4267 752
1457 3300048916 Ga0496113_0010522 Ga0496113_0010522_1326_3632 752
1458 3300048922 Ga0496119_0002073 Ga0496119_0002073_1503_3815 752
1459 3300048927 Ga0496124_0023714 Ga0496124_0023714_2986_5286 752
1460 3300048929 Ga0496126_0070527 Ga0496126_0070527_166_2460 752
1461 3300049568 Ga0501031_0010719 Ga0501031_0010719_763_3057 752
1462 3300049569 Ga0501032_0001403 Ga0501032_0001403_11775_14069 752
1463 3300049570 Ga0501033_0001527 Ga0501033_0001527_11866_14160 752
1464 3300049571 Ga0501034_0002124 Ga0501034_0002124_5644_7938 752
1465 3300049572 Ga0501036_0000060 Ga0501036_0000060_19510_21804 752
1466 3300049573 Ga0501037_0002003 Ga0501037_0002003_5092_7386 752
1467 3300049574 Ga0501038_0002769 Ga0501038_0002769_9010_11304 752
1468 3300049579 Ga0501043_0002136 Ga0501043_0002136_3727_6021 752
1469 3300049580 Ga0501046_0003351 Ga0501046_0003351_5483_7777 752
1470 3300049581 Ga0501047_0003715 Ga0501047_0003715_5167_7461 752
1471 3300049822 Ga0501035_0005534 Ga0501035_0005534_8992_11286 752
1472 3300049822 Ga0501035_0010097 Ga0501035_0010097_546_2840 752
1473 3300049823 Ga0501044_0009078 Ga0501044_0009078_5367_7661 752
1474 3300049823 Ga0501044_0010049 Ga0501044_0010049_5619_7913 752
1475 3300050491 nmdc:mga00v17_4140_c1 nmdc:mga00v17_4140_c1_2251_4542 752
1476 3300050491 nmdc:mga00v17_4641_c2 nmdc:mga00v17_4641_c2_301_2592 752
1477 3300050492 nmdc:mga0yw44_3238_c1 nmdc:mga0yw44_3238_c1_416_2719 752
1478 3300050507 nmdc:mga05p37_14521_c1 nmdc:mga05p37_14521_c1_6951_9254 752
1479 3300050508 nmdc:mga09592_6057_c1 nmdc:mga09592_6057_c1_2113_4416 752
1480 3300050509 nmdc:mga0qj67_1028_c1 nmdc:mga0qj67_1028_c1_4992_7295 752
1481 3300050510 nmdc:mga06r32_3631_c1 nmdc:mga06r32_3631_c1_11266_13569 752
1482 3300050511 nmdc:mga08y16_3456_c1 nmdc:mga08y16_3456_c1_11240_13543 752
1483 3300050512 nmdc:mga0n895_7662_c1 nmdc:mga0n895_7662_c1_4883_7186 752
1484 3300053080 Ga0500635_0000219 Ga0500635_0000219_23438_25744 752
1485 3300053085 Ga0495619_0029766 Ga0495619_0029766_295_2628 752
1486 3300053085 Ga0495619_0030108 Ga0495619_0030108_699_3005 752
1487 3300053125 Ga0500618_002688 Ga0500618_002688_825_3203 752
1488 3300061719 Ga0466962_0008092 Ga0466962_0008092_1969_4275 752
1489 3300061719 Ga0466962_0010609 Ga0466962_0010609_122_2428 752
1490 3300002067 JGI24735J21928_10010076 JGI24735J21928_100100762 753
1491 3300003758 Ga0055532_1000236 Ga0055532_100023610 753
1492 3300003758 Ga0055532_1000239 Ga0055532_100023921 753
1493 3300003758 Ga0055532_1000269 Ga0055532_100026920 753
1494 3300003760 Ga0055527_1000228 Ga0055527_100022822 753
1495 3300003761 Ga0055535_1000288 Ga0055535_100028823 753
1496 3300003761 Ga0055535_1000489 Ga0055535_100048922 753
1497 3300003762 Ga0055542_1000258 Ga0055542_100025830 753
1498 3300003763 Ga0055529_1000191 Ga0055529_100019123 753
1499 3300003856 Ga0058692_1002636 Ga0058692_10026364 753
1500 3300005327 Ga0070658_10001161 Ga0070658_1000116115 753
1501 3300005327 Ga0070658_10012516 Ga0070658_100125165 753
1502 3300005339 Ga0070660_100000006 Ga0070660_100000006120 753
1503 3300005339 Ga0070660_100000023 Ga0070660_10000002385 753
1504 3300005339 Ga0070660_100021354 Ga0070660_1000213543 753
1505 3300005340 Ga0070689_100015185 Ga0070689_1000151853 753
1506 3300005344 Ga0070661_100022042 Ga0070661_1000220422 753
1507 3300005366 Ga0070659_100000116 Ga0070659_10000011648 753
1508 3300005366 Ga0070659_100000201 Ga0070659_1000002015 753
1509 3300005455 Ga0070663_100000208 Ga0070663_1000002086 753
1510 3300005455 Ga0070663_100000573 Ga0070663_10000057314 753
1511 3300005455 Ga0070663_100003869 Ga0070663_1000038694 753
1512 3300005547 Ga0070693_100014121 Ga0070693_1000141214 753
1513 3300005563 Ga0068855_100015678 Ga0068855_1000156781 753
1514 3300005563 Ga0068855_100067159 Ga0068855_1000671592 753
1515 3300005616 Ga0068852_100009211 Ga0068852_1000092114 753
1516 3300006051 Ga0075364_10001318 Ga0075364_100013182 753
1517 3300006177 Ga0075362_10005335 Ga0075362_100053353 753
1518 3300009092 Ga0105250_10004552 Ga0105250_100045525 753
1519 3300009093 Ga0105240_10005517 Ga0105240_100055173 753
1520 3300009093 Ga0105240_10043148 Ga0105240_100431481 753
1521 3300009177 Ga0105248_10002960 Ga0105248_1000296013 753
1522 3300009545 Ga0105237_10007415 Ga0105237_100074152 753
1523 3300009545 Ga0105237_10036787 Ga0105237_100367872 753
1524 3300009545 Ga0105237_10037225 Ga0105237_100372254 753
1525 3300009545 Ga0105237_10053923 Ga0105237_100539232 753
1526 3300009545 Ga0105237_10083663 Ga0105237_100836632 753
1527 3300009551 Ga0105238_10024875 Ga0105238_100248755 753
1528 3300010375 Ga0105239_10005130 Ga0105239_100051301 753
1529 3300013104 Ga0157370_10002136 Ga0157370_1000213618 753
1530 3300013104 Ga0157370_10003220 Ga0157370_100032207 753
1531 3300013104 Ga0157370_10077158 Ga0157370_100771581 753
1532 3300013105 Ga0157369_10000541 Ga0157369_1000054133 753
1533 3300013105 Ga0157369_10001147 Ga0157369_1000114724 753
1534 3300013105 Ga0157369_10004159 Ga0157369_100041598 753
1535 3300013296 Ga0157374_10000099 Ga0157374_1000009963 753
1536 3300013307 Ga0157372_10103510 Ga0157372_101035101 753
1537 3300014745 Ga0157377_10000006 Ga0157377_10000006333 753
1538 3300014969 Ga0157376_10040632 Ga0157376_100406322 753
1539 3300015262 Ga0182007_10002498 Ga0182007_100024989 753
1540 3300022467 Ga0224712_10000068 Ga0224712_100000684 753
1541 3300025225 Ga0209566_100089 Ga0209566_10008916 753
1542 3300025225 Ga0209566_102048 Ga0209566_1020481 753
1543 3300025228 Ga0209672_100020 Ga0209672_100020195 753
1544 3300025228 Ga0209672_100030 Ga0209672_100030190 753
1545 3300025228 Ga0209672_100076 Ga0209672_100076123 753
1546 3300025228 Ga0209672_100210 Ga0209672_10021031 753
1547 3300025228 Ga0209672_100512 Ga0209672_10051213 753
1548 3300025229 Ga0209147_100024 Ga0209147_100024195 753
1549 3300025229 Ga0209147_100036 Ga0209147_100036149 753
1550 3300025229 Ga0209147_100103 Ga0209147_100103123 753
1551 3300025229 Ga0209147_100126 Ga0209147_100126110 753
1552 3300025229 Ga0209147_100150 Ga0209147_10015036 753
1553 3300025229 Ga0209147_100275 Ga0209147_10027516 753
1554 3300025242 Ga0209258_100056 Ga0209258_100056190 753
1555 3300025242 Ga0209258_100084 Ga0209258_100084195 753
1556 3300025242 Ga0209258_100435 Ga0209258_10043543 753
1557 3300025242 Ga0209258_100450 Ga0209258_10045031 753
1558 3300025254 Ga0209148_1000105 Ga0209148_1000105188 753
1559 3300025254 Ga0209148_1000814 Ga0209148_100081410 753
1560 3300025254 Ga0209148_1001206 Ga0209148_100120612 753
1561 3300025256 Ga0209759_1001407 Ga0209759_100140713 753
1562 3300025256 Ga0209759_1002308 Ga0209759_10023087 753
1563 3300025272 Ga0209455_1000061 Ga0209455_1000061149 753
1564 3300025272 Ga0209455_1000298 Ga0209455_100029824 753
1565 3300025272 Ga0209455_1000328 Ga0209455_100032816 753
1566 3300025273 Ga0209673_1000108 Ga0209673_1000108132 753
1567 3300025273 Ga0209673_1000650 Ga0209673_100065038 753
1568 3300025295 Ga0209564_1007556 Ga0209564_10075563 753
1569 3300025298 Ga0209050_1001388 Ga0209050_100138822 753
1570 3300025711 Ga0207696_1010917 Ga0207696_10109172 753
1571 3300025904 Ga0207647_10000404 Ga0207647_1000040425 753
1572 3300025904 Ga0207647_10004310 Ga0207647_100043104 753
1573 3300025904 Ga0207647_10036760 Ga0207647_100367601 753
1574 3300025907 Ga0207645_10023453 Ga0207645_100234531 753
1575 3300025909 Ga0207705_10000780 Ga0207705_1000078024 753
1576 3300025910 Ga0207684_10040883 Ga0207684_100408833 753
1577 3300025913 Ga0207695_10000171 Ga0207695_100001712 753
1578 3300025913 Ga0207695_10028836 Ga0207695_100288362 753
1579 3300025914 Ga0207671_10033724 Ga0207671_100337242 753
1580 3300025914 Ga0207671_10043833 Ga0207671_100438332 753
1581 3300025919 Ga0207657_10000003 Ga0207657_10000003204 753
1582 3300025919 Ga0207657_10000016 Ga0207657_10000016143 753
1583 3300025919 Ga0207657_10002781 Ga0207657_100027817 753
1584 3300025924 Ga0207694_10036239 Ga0207694_100362392 753
1585 3300025927 Ga0207687_10049434 Ga0207687_100494342 753
1586 3300025932 Ga0207690_10000007 Ga0207690_10000007205 753
1587 3300025932 Ga0207690_10000012 Ga0207690_1000001215 753
1588 3300025933 Ga0207706_10004915 Ga0207706_100049159 753
1589 3300025949 Ga0207667_10003584 Ga0207667_100035843 753
1590 3300025949 Ga0207667_10006259 Ga0207667_1000625912 753
1591 3300025949 Ga0207667_10007516 Ga0207667_100075168 753
1592 3300025949 Ga0207667_10027717 Ga0207667_100277172 753
1593 3300026067 Ga0207678_10000064 Ga0207678_1000006452 753
1594 3300026067 Ga0207678_10000900 Ga0207678_1000090022 753
1595 3300026067 Ga0207678_10007409 Ga0207678_100074092 753
1596 3300026067 Ga0207678_10009908 Ga0207678_100099089 753
1597 3300026089 Ga0207648_10000713 Ga0207648_1000071321 753
1598 3300026116 Ga0207674_10009233 Ga0207674_100092338 753
1599 3300026118 Ga0207675_100005511 Ga0207675_1000055119 753
1600 3300026142 Ga0207698_10008698 Ga0207698_100086985 753
1601 3300026142 Ga0207698_10064819 Ga0207698_100648191 753
1602 3300027312 Ga0209371_1000103 Ga0209371_100010396 753
1603 3300027312 Ga0209371_1000150 Ga0209371_10001505 753
1604 3300027312 Ga0209371_1000291 Ga0209371_10002915 753
1605 3300030500 Ga0268256_1000242 Ga0268256_100024250 753
1606 3300030500 Ga0268256_1000288 Ga0268256_100028836 753
1607 3300031730 Ga0307516_10004252 Ga0307516_1000425216 753
1608 3300032002 Ga0307416_100033553 Ga0307416_1000335532 753
1609 3300037312 Ga0395899_0000193 Ga0395899_0000193_16614_18884 753
1610 3300037312 Ga0395899_0015407 Ga0395899_0015407_1507_3777 753
1611 3300037418 Ga0395900_0000219 Ga0395900_0000219_16614_18884 753
1612 3300037418 Ga0395900_0000496 Ga0395900_0000496_3796_6066 753
1613 3300037466 Ga0395898_0000469 Ga0395898_0000469_16614_18884 753
1614 3300037466 Ga0395898_0007123 Ga0395898_0007123_3762_6128 753
1615 3300037466 Ga0395898_0026373 Ga0395898_0026373_1064_3364 753
1616 3300037466 Ga0395898_0045992 Ga0395898_0045992_749_3019 753
1617 3300038443 Ga0395901_0000003 Ga0395901_0000003_610437_612746 753
1618 3300038443 Ga0395901_0000175 Ga0395901_0000175_65248_67518 753
1619 3300038443 Ga0395901_0000319 Ga0395901_0000319_46541_48811 753
1620 3300038443 Ga0395901_0023988 Ga0395901_0023988_131_2497 753
1621 3300039447 Ga0436361_0449757 Ga0436361_0449757_250_2547 753
1622 3300042005 Ga0439448_0000589 Ga0439448_0000589_1702_3972 753
1623 3300044656 Ga0466969_0006416 Ga0466969_0006416_2576_4885 753
1624 3300044666 Ga0466977_0008268 Ga0466977_0008268_2873_5152 753
1625 3300044683 Ga0466965_0037708 Ga0466965_0037708_66_2336 753
1626 3300044684 Ga0466966_0010594 Ga0466966_0010594_327_2693 753
1627 3300044693 Ga0466961_0000128 Ga0466961_0000128_347_2713 753
1628 3300044693 Ga0466961_0008030 Ga0466961_0008030_842_3112 753
1629 3300044694 Ga0466963_0046795 Ga0466963_0046795_78_2444 753
1630 3300044712 Ga0453684_0001614 Ga0453684_0001614_46104_48500 753
1631 3300044712 Ga0453684_0005076 Ga0453684_0005076_11038_13353 753
1632 3300044712 Ga0453684_0083473 Ga0453684_0083473_444_2753 753
1633 3300044719 Ga0466971_0000685 Ga0466971_0000685_4754_7024 753
1634 3300044719 Ga0466971_0015551 Ga0466971_0015551_79_2445 753
1635 3300044719 Ga0466971_0019094 Ga0466971_0019094_335_2644 753
1636 3300044735 Ga0466968_0010317 Ga0466968_0010317_1087_3396 753
1637 3300045049 Ga0466959_0014999 Ga0466959_0014999_116_2425 753
1638 3300045051 Ga0451576_0051823 Ga0451576_0051823_1630_3912 753
1639 3300045836 Ga0466958_0014981 Ga0466958_0014981_195_2561 753
1640 3300046459 Ga0495629_0002363 Ga0495629_0002363_2641_4941 753
1641 3300046463 Ga0495653_0003766 Ga0495653_0003766_9465_11765 753
1642 3300046472 Ga0495580_0001487 Ga0495580_0001487_9465_11765 753
1643 3300046473 Ga0495582_0002165 Ga0495582_0002165_503_2803 753
1644 3300046476 Ga0495662_0001321 Ga0495662_0001321_7367_9667 753
1645 3300046477 Ga0495664_0000188 Ga0495664_0000188_19302_21602 753
1646 3300046477 Ga0495664_0005284 Ga0495664_0005284_2970_5276 753
1647 3300046514 Ga0495618_0001351 Ga0495618_0001351_8587_10887 753
1648 3300046516 Ga0495628_0002801 Ga0495628_0002801_4536_6836 753
1649 3300046516 Ga0495628_0021125 Ga0495628_0021125_929_3229 753
1650 3300046517 Ga0495630_0023682 Ga0495630_0023682_1737_4037 753
1651 3300046526 Ga0495666_0000335 Ga0495666_0000335_9463_11763 753
1652 3300046531 Ga0495665_0002423 Ga0495665_0002423_1616_3916 753
1653 3300046533 Ga0495640_0002342 Ga0495640_0002342_7181_9481 753
1654 3300046533 Ga0495640_0002769 Ga0495640_0002769_11704_14004 753
1655 3300046535 Ga0495586_0000616 Ga0495586_0000616_8813_11113 753
1656 3300046536 Ga0495587_0005545 Ga0495587_0005545_3432_5732 753
1657 3300046536 Ga0495587_0006160 Ga0495587_0006160_3794_6094 753
1658 3300046642 Ga0495634_0003611 Ga0495634_0003611_1243_3543 753
1659 3300046642 Ga0495634_0019706 Ga0495634_0019706_231_2531 753
1660 3300046665 Ga0495661_0001659 Ga0495661_0001659_5687_7987 753
1661 3300046679 Ga0495623_0002932 Ga0495623_0002932_168_2468 753
1662 3300046680 Ga0495646_0001418 Ga0495646_0001418_2717_5017 753
1663 3300046680 Ga0495646_0006489 Ga0495646_0006489_3331_5631 753
1664 3300046689 Ga0495613_0002909 Ga0495613_0002909_2717_5017 753
1665 3300046690 Ga0495624_0034571 Ga0495624_0034571_176_2482 753
1666 3300046794 Ga0495589_0008630 Ga0495589_0008630_1151_3451 753
1667 3300047317 Ga0495604_0002010 Ga0495604_0002010_5665_7965 753
1668 3300047317 Ga0495604_0009554 Ga0495604_0009554_1620_3920 753
1669 3300047319 Ga0495674_0016705 Ga0495674_0016705_3287_5587 753
1670 3300047321 Ga0495676_0001635 Ga0495676_0001635_9442_11742 753
1671 3300047322 Ga0495680_0003491 Ga0495680_0003491_3565_5865 753
1672 3300047322 Ga0495680_0019390 Ga0495680_0019390_3010_5310 753
1673 3300047446 Ga0495679_001321 Ga0495679_001321_9449_11749 753
1674 3300047673 Ga0495593_0003322 Ga0495593_0003322_1684_3984 753
1675 3300048088 Ga0495602_0005930 Ga0495602_0005930_8807_11107 753
1676 3300048089 Ga0495614_0000420 Ga0495614_0000420_5670_7970 753
1677 3300048909 Ga0496106_0005518 Ga0496106_0005518_3922_6294 753
1678 3300048910 Ga0496107_0036979 Ga0496107_0036979_327_2699 753
1679 3300048913 Ga0496110_0055643 Ga0496110_0055643_939_3311 753
1680 3300048914 Ga0496111_0047692 Ga0496111_0047692_87_2459 753
1681 3300048919 Ga0496116_0013075 Ga0496116_0013075_1215_3515 753
1682 3300048920 Ga0496117_0000426 Ga0496117_0000426_10141_12456 753
1683 3300048921 Ga0496118_0004065 Ga0496118_0004065_4907_7222 753
1684 3300048923 Ga0496120_0003202 Ga0496120_0003202_6296_8593 753
1685 3300048924 Ga0496121_0000141 Ga0496121_0000141_14704_17004 753
1686 3300048924 Ga0496121_0001701 Ga0496121_0001701_2376_4676 753
1687 3300048925 Ga0496122_0000047 Ga0496122_0000047_43992_46292 753
1688 3300048926 Ga0496123_0000077 Ga0496123_0000077_176410_178710 753
1689 3300048928 Ga0496125_0014738 Ga0496125_0014738_3996_6296 753
1690 3300048929 Ga0496126_0000032 Ga0496126_0000032_30908_33208 753
1691 3300048929 Ga0496126_0003623 Ga0496126_0003623_14523_16823 753
1692 3300049649 Ga0501198_000023 Ga0501198_000023_25963_28416 753
1693 3300049662 Ga0501222_000031 Ga0501222_000031_40701_43154 753
1694 3300050491 nmdc:mga00v17_26210_c1 nmdc:mga00v17_26210_c1_897_3212 753
1695 3300055283 Ga0500661_001784 Ga0500661_001784_1038_3329 753
1696 3300061719 Ga0466962_0001534 Ga0466962_0001534_6393_8702 753
1697 3300061719 Ga0466962_0007435 Ga0466962_0007435_2231_4501 753
1698 3300061719 Ga0466962_0016040 Ga0466962_0016040_1147_3513 753
1699 iso_pu_bacteria 2562617112 2563064550 753
1700 iso_pu_bacteria 2582581311 2585292610 753
1701 iso_pu_bacteria 2711768613 2713472853 753
1702 iso_pu_bacteria 2739367655 2739610419 753
1703 iso_pu_bacteria 2791355137 2792841132 753
1704 iso_pu_bacteria 2857542790 2857544050 753
1705 iso_pu_bacteria 2870068957 2870074518 753
1706 iso_pu_bacteria 8040167225 8040170716 753
1707 iso_pu_bacteria 8055225921 8055227344 753
1708 3300002737 JGI25162J39368_1000052 JGI25162J39368_100005259 754
1709 3300003187 JGI25151J46595_10000951 JGI25151J46595_100009516 754
1710 3300003214 JGI25165J46597_1000105 JGI25165J46597_100010593 754
1711 3300003354 JGI25160J50197_1004594 JGI25160J50197_10045943 754
1712 3300003751 Ga0055538_1000043 Ga0055538_100004393 754
1713 3300003752 Ga0055539_1000057 Ga0055539_100005793 754
1714 3300003756 Ga0055533_1000071 Ga0055533_100007193 754
1715 3300003759 Ga0055525_1000085 Ga0055525_100008593 754
1716 3300003794 Ga0055531_10014584 Ga0055531_100145841 754
1717 3300003841 Ga0055541_1000044 Ga0055541_100004459 754
1718 3300005329 Ga0070683_100003533 Ga0070683_1000035334 754
1719 3300005331 Ga0070670_100003950 Ga0070670_10000395011 754
1720 3300005335 Ga0070666_10018126 Ga0070666_100181262 754
1721 3300005338 Ga0068868_100002281 Ga0068868_1000022817 754
1722 3300005338 Ga0068868_100042366 Ga0068868_1000423662 754
1723 3300005344 Ga0070661_100018306 Ga0070661_1000183063 754
1724 3300005354 Ga0070675_100017118 Ga0070675_1000171182 754
1725 3300005355 Ga0070671_100006639 Ga0070671_1000066394 754
1726 3300005364 Ga0070673_100004435 Ga0070673_1000044357 754
1727 3300005456 Ga0070678_100002072 Ga0070678_1000020723 754
1728 3300005457 Ga0070662_100016824 Ga0070662_1000168242 754
1729 3300005458 Ga0070681_10000372 Ga0070681_1000037222 754
1730 3300005459 Ga0068867_100008662 Ga0068867_1000086625 754
1731 3300005543 Ga0070672_100001173 Ga0070672_1000011733 754
1732 3300005548 Ga0070665_100025412 Ga0070665_1000254122 754
1733 3300005564 Ga0070664_100001898 Ga0070664_1000018982 754
1734 3300005616 Ga0068852_100000657 Ga0068852_10000065717 754
1735 3300005618 Ga0068864_100014646 Ga0068864_1000146462 754
1736 3300005834 Ga0068851_10002400 Ga0068851_100024004 754
1737 3300005841 Ga0068863_100038522 Ga0068863_1000385221 754
1738 3300005841 Ga0068863_100061588 Ga0068863_1000615882 754
1739 3300005842 Ga0068858_100004425 Ga0068858_1000044255 754
1740 3300005843 Ga0068860_100010515 Ga0068860_1000105153 754
1741 3300006237 Ga0097621_100003706 Ga0097621_1000037069 754
1742 3300006358 Ga0068871_100007836 Ga0068871_1000078363 754
1743 3300006844 Ga0075428_100139217 Ga0075428_1001392172 754
1744 3300009177 Ga0105248_10058266 Ga0105248_100582662 754
1745 3300013296 Ga0157374_10013130 Ga0157374_100131307 754
1746 3300013306 Ga0163162_10013481 Ga0163162_100134812 754
1747 3300013308 Ga0157375_10017231 Ga0157375_100172313 754
1748 3300014969 Ga0157376_10023011 Ga0157376_100230112 754
1749 3300015265 Ga0182005_1000573 Ga0182005_100057310 754
1750 3300025224 Ga0209784_100069 Ga0209784_10006995 754
1751 3300025225 Ga0209566_100083 Ga0209566_10008395 754
1752 3300025226 Ga0209674_100106 Ga0209674_10010695 754
1753 3300025230 Ga0209563_100100 Ga0209563_10010095 754
1754 3300025231 Ga0207427_100279 Ga0207427_10027935 754
1755 3300025233 Ga0209437_100156 Ga0209437_10015695 754
1756 3300025253 Ga0209677_100061 Ga0209677_10006195 754
1757 3300025261 Ga0209233_1000165 Ga0209233_100016595 754
1758 3300025294 Ga0209025_1000064 Ga0209025_100006451 754
1759 3300025321 Ga0207656_10002699 Ga0207656_100026994 754
1760 3300025903 Ga0207680_10006014 Ga0207680_100060142 754
1761 3300025912 Ga0207707_10000590 Ga0207707_1000059019 754
1762 3300025918 Ga0207662_10009297 Ga0207662_100092972 754
1763 3300025920 Ga0207649_10002026 Ga0207649_1000202611 754
1764 3300025925 Ga0207650_10001127 Ga0207650_1000112715 754
1765 3300025926 Ga0207659_10005217 Ga0207659_100052174 754
1766 3300025931 Ga0207644_10008443 Ga0207644_100084434 754
1767 3300025940 Ga0207691_10001444 Ga0207691_100014447 754
1768 3300025941 Ga0207711_10077043 Ga0207711_100770432 754
1769 3300025944 Ga0207661_10007156 Ga0207661_100071563 754
1770 3300025945 Ga0207679_10001704 Ga0207679_100017046 754
1771 3300025960 Ga0207651_10004833 Ga0207651_100048334 754
1772 3300026023 Ga0207677_10003682 Ga0207677_100036822 754
1773 3300026023 Ga0207677_10009249 Ga0207677_100092492 754
1774 3300026035 Ga0207703_10009337 Ga0207703_100093373 754
1775 3300026088 Ga0207641_10015026 Ga0207641_100150263 754
1776 3300026095 Ga0207676_10012287 Ga0207676_100122872 754
1777 3300026121 Ga0207683_10000838 Ga0207683_100008389 754
1778 3300026142 Ga0207698_10001250 Ga0207698_100012506 754
1779 3300028381 Ga0268264_10021966 Ga0268264_100219662 754
1780 3300028381 Ga0268264_10074954 Ga0268264_100749541 754
1781 3300031649 Ga0307514_10000339 Ga0307514_1000033916 754
1782 3300037471 Ga0395905_0000110 Ga0395905_0000110_134724_137030 754
1783 3300042876 Ga0451577_0014354 Ga0451577_0014354_321_2633 754
1784 3300044658 Ga0466972_0023652 Ga0466972_0023652_560_2878 754
1785 3300044712 Ga0453684_0015326 Ga0453684_0015326_9818_12103 754
1786 3300044712 Ga0453684_0090144 Ga0453684_0090144_805_3117 754
1787 3300045051 Ga0451576_0051929 Ga0451576_0051929_906_3233 754
1788 3300046454 Ga0495592_0017464 Ga0495592_0017464_315_2624 754
1789 3300046459 Ga0495629_0000492 Ga0495629_0000492_8843_11116 754
1790 3300046462 Ga0495651_0014167 Ga0495651_0014167_1484_3793 754
1791 3300046462 Ga0495651_0032225 Ga0495651_0032225_1247_3556 754
1792 3300046463 Ga0495653_0008523 Ga0495653_0008523_516_2825 754
1793 3300046471 Ga0495650_0004299 Ga0495650_0004299_4145_6418 754
1794 3300046507 Ga0495606_0005160 Ga0495606_0005160_5413_7686 754
1795 3300046511 Ga0495608_0004347 Ga0495608_0004347_1450_3759 754
1796 3300046511 Ga0495608_0025134 Ga0495608_0025134_292_2601 754
1797 3300046512 Ga0495610_0006826 Ga0495610_0006826_2334_4670 754
1798 3300046514 Ga0495618_0006888 Ga0495618_0006888_1280_3589 754
1799 3300046516 Ga0495628_0000137 Ga0495628_0000137_12253_14562 754
1800 3300046516 Ga0495628_0006104 Ga0495628_0006104_5951_8260 754
1801 3300046529 Ga0495652_0031836 Ga0495652_0031836_116_2425 754
1802 3300046543 Ga0495645_0001667 Ga0495645_0001667_10474_12747 754
1803 3300046678 Ga0495599_0005345 Ga0495599_0005345_4044_6353 754
1804 3300046679 Ga0495623_0002007 Ga0495623_0002007_9350_11659 754
1805 3300046680 Ga0495646_0000375 Ga0495646_0000375_9957_12266 754
1806 3300046689 Ga0495613_0023865 Ga0495613_0023865_2122_4395 754
1807 3300046690 Ga0495624_0003671 Ga0495624_0003671_4415_6724 754
1808 3300046694 Ga0495649_0012052 Ga0495649_0012052_1130_3403 754
1809 3300046809 Ga0495600_0005612 Ga0495600_0005612_309_2618 754
1810 3300047317 Ga0495604_0055848 Ga0495604_0055848_82_2391 754
1811 3300047323 Ga0495683_0019256 Ga0495683_0019256_1114_3387 754
1812 3300048907 Ga0496104_0067461 Ga0496104_0067461_818_3151 754
1813 3300048909 Ga0496106_0000001 Ga0496106_0000001_193175_195478 754
1814 3300048910 Ga0496107_0034522 Ga0496107_0034522_22_2346 754
1815 3300048911 Ga0496108_0011360 Ga0496108_0011360_2866_5157 754
1816 3300048911 Ga0496108_0016326 Ga0496108_0016326_345_2717 754
1817 3300048912 Ga0496109_0024792 Ga0496109_0024792_2584_4875 754
1818 3300048913 Ga0496110_0004858 Ga0496110_0004858_5524_7815 754
1819 3300048917 Ga0496114_0010920 Ga0496114_0010920_3148_5439 754
1820 3300048917 Ga0496114_0018009 Ga0496114_0018009_1489_3762 754
1821 3300048918 Ga0496115_0005174 Ga0496115_0005174_2249_4522 754
1822 3300048924 Ga0496121_0006761 Ga0496121_0006761_1185_3488 754
1823 3300048929 Ga0496126_0076099 Ga0496126_0076099_98_2401 754
1824 3300049579 Ga0501043_0000018 Ga0501043_0000018_29675_32002 754
1825 3300049580 Ga0501046_0000042 Ga0501046_0000042_29675_32002 754
1826 3300049581 Ga0501047_0000052 Ga0501047_0000052_121447_123774 754
1827 3300050496 nmdc:mga07m45_6782_c1 nmdc:mga07m45_6782_c1_3196_5523 754
1828 3300050512 nmdc:mga0n895_16310_c1 nmdc:mga0n895_16310_c1_827_3118 754
1829 3300053077 Ga0495601_0020846 Ga0495601_0020846_1157_3466 754
1830 iso_pu_bacteria 2501025502 2501078527 754
1831 iso_pu_bacteria 2501025504 2501410278 754
1832 iso_pu_bacteria 2510917013 2511090219 754
1833 iso_pu_bacteria 2510917014 2511095597 754
1834 iso_pu_bacteria 2513237166 2514050689 754
1835 iso_pu_bacteria 2515154189 2516018632 754
1836 iso_pu_bacteria 2562617112 2563055685 754
1837 iso_pu_bacteria 2711768613 2713478670 754
1838 iso_pu_bacteria 2791355137 2792836850 754
1839 iso_pu_bacteria 2883087390 2883096261 754
1840 iso_pu_bacteria 2904615490 2904623721 754
1841 iso_pu_bacteria 2921643360 2921648467 754
1842 iso_pu_bacteria 642555112 642594674 754
1843 3300003763 Ga0055529_1002100 Ga0055529_10021002 755
1844 3300005331 Ga0070670_100005989 Ga0070670_1000059896 755
1845 3300005335 Ga0070666_10006186 Ga0070666_100061863 755
1846 3300005436 Ga0070713_100000028 Ga0070713_10000002859 755
1847 3300005445 Ga0070708_100001610 Ga0070708_1000016106 755
1848 3300006844 Ga0075428_100002690 Ga0075428_1000026905 755
1849 3300006852 Ga0075433_10026503 Ga0075433_100265034 755
1850 3300007076 Ga0075435_100008278 Ga0075435_1000082784 755
1851 3300009094 Ga0111539_10008156 Ga0111539_100081563 755
1852 3300009551 Ga0105238_10093068 Ga0105238_100930682 755
1853 3300013308 Ga0157375_10132738 Ga0157375_101327381 755
1854 3300025272 Ga0209455_1003176 Ga0209455_10031763 755
1855 3300025928 Ga0207700_10000338 Ga0207700_1000033819 755
1856 3300027907 Ga0207428_10019607 Ga0207428_100196073 755
1857 3300028794 Ga0307515_10011006 Ga0307515_1001100613 755
1858 3300031251 Ga0265327_10000479 Ga0265327_100004793 755
1859 3300031344 Ga0265316_10000026 Ga0265316_10000026107 755
1860 3300031548 Ga0307408_100055264 Ga0307408_1000552641 755
1861 3300031731 Ga0307405_10016540 Ga0307405_100165402 755
1862 3300031824 Ga0307413_10016232 Ga0307413_100162323 755
1863 3300031995 Ga0307409_100052775 Ga0307409_1000527752 755
1864 3300031995 Ga0307409_100087937 Ga0307409_1000879371 755
1865 3300032004 Ga0307414_10025291 Ga0307414_100252913 755
1866 3300032005 Ga0307411_10017035 Ga0307411_100170353 755
1867 3300032126 Ga0307415_100033101 Ga0307415_1000331011 755
1868 3300042876 Ga0451577_0033252 Ga0451577_0033252_2068_4383 755
1869 3300048917 Ga0496114_0038375 Ga0496114_0038375_1336_3648 755
1870 3300049569 Ga0501032_0005217 Ga0501032_0005217_1538_3859 755
1871 3300049570 Ga0501033_0001070 Ga0501033_0001070_6359_8680 755
1872 3300049571 Ga0501034_0046518 Ga0501034_0046518_1206_3527 755
1873 3300049571 Ga0501034_0067978 Ga0501034_0067978_400_2697 755
1874 3300049572 Ga0501036_0012375 Ga0501036_0012375_985_3306 755
1875 3300049573 Ga0501037_0003436 Ga0501037_0003436_5829_8150 755
1876 3300049573 Ga0501037_0010245 Ga0501037_0010245_3453_5747 755
1877 3300049574 Ga0501038_0008096 Ga0501038_0008096_6308_8629 755
1878 3300049575 Ga0501039_0003971 Ga0501039_0003971_1560_3854 755
1879 3300049575 Ga0501039_0007946 Ga0501039_0007946_1928_4249 755
1880 3300049576 Ga0501040_0034487 Ga0501040_0034487_810_3104 755
1881 3300049578 Ga0501042_0004749 Ga0501042_0004749_3034_5328 755
1882 3300049579 Ga0501043_0006187 Ga0501043_0006187_7040_9361 755
1883 3300049580 Ga0501046_0004252 Ga0501046_0004252_7136_9457 755
1884 3300049581 Ga0501047_0010324 Ga0501047_0010324_1839_4160 755
1885 3300049582 Ga0501048_0016931 Ga0501048_0016931_1559_3880 755
1886 3300049583 Ga0501067_0005114 Ga0501067_0005114_3983_6304 755
1887 3300049585 Ga0501069_0003376 Ga0501069_0003376_5598_7919 755
1888 3300049586 Ga0501070_0001537 Ga0501070_0001537_3918_6239 755
1889 3300049589 Ga0501073_0000690 Ga0501073_0000690_19399_21720 755
1890 3300049590 Ga0501074_0008203 Ga0501074_0008203_3028_5349 755
1891 3300049591 Ga0501075_0001438 Ga0501075_0001438_1257_3551 755
1892 3300049592 Ga0501076_0020462 Ga0501076_0020462_1195_3489 755
1893 3300049593 Ga0501077_0013081 Ga0501077_0013081_1297_3591 755
1894 3300049741 Ga0501079_0021530 Ga0501079_0021530_2090_4411 755
1895 3300049742 Ga0501080_0000579 Ga0501080_0000579_25613_27934 755
1896 3300049742 Ga0501080_0002387 Ga0501080_0002387_11502_13796 755
1897 3300049743 Ga0501081_0000068 Ga0501081_0000068_11536_13830 755
1898 3300049744 Ga0501083_0005480 Ga0501083_0005480_5811_8132 755
1899 3300049744 Ga0501083_0012389 Ga0501083_0012389_3114_5426 755
1900 3300049822 Ga0501035_0001027 Ga0501035_0001027_23417_25738 755
1901 3300049822 Ga0501035_0036959 Ga0501035_0036959_837_3146 755
1902 3300049823 Ga0501044_0000124 Ga0501044_0000124_2000_4309 755
1903 3300049823 Ga0501044_0038369 Ga0501044_0038369_976_3297 755
1904 3300049823 Ga0501044_0090847 Ga0501044_0090847_244_2568 755
1905 3300050511 nmdc:mga08y16_6769_c1 nmdc:mga08y16_6769_c1_7908_10211 755
1906 3300050515 nmdc:mga0a205_35391_c1 nmdc:mga0a205_35391_c1_1364_3658 755
1907 3300054114 Ga0501084_0086224 Ga0501084_0086224_205_2526 755
1908 3300060353 Ga0501082_0001515 Ga0501082_0001515_5854_8148 755
1909 3300060353 Ga0501082_0008182 Ga0501082_0008182_4014_6335 755
1910 3300003215 JGI25153J46596_10000255 JGI25153J46596_1000025520 756
1911 3300005466 Ga0070685_10007836 Ga0070685_100078363 756
1912 3300005615 Ga0070702_100011674 Ga0070702_1000116742 756
1913 3300013100 Ga0157373_10009014 Ga0157373_100090143 756
1914 3300025297 Ga0209758_1000118 Ga0209758_1000118157 756
1915 3300025315 Ga0207697_10004020 Ga0207697_100040204 756
1916 3300025893 Ga0207682_10000918 Ga0207682_100009189 756
1917 3300025901 Ga0207688_10009508 Ga0207688_100095082 756
1918 3300025907 Ga0207645_10008977 Ga0207645_100089774 756
1919 3300025908 Ga0207643_10003743 Ga0207643_100037432 756
1920 3300025925 Ga0207650_10028103 Ga0207650_100281033 756
1921 3300025931 Ga0207644_10020968 Ga0207644_100209682 756
1922 3300025933 Ga0207706_10009151 Ga0207706_100091512 756
1923 3300025937 Ga0207669_10005167 Ga0207669_100051674 756
1924 3300025942 Ga0207689_10014493 Ga0207689_100144934 756
1925 3300026075 Ga0207708_10001819 Ga0207708_100018199 756
1926 3300026089 Ga0207648_10011667 Ga0207648_100116677 756
1927 3300026116 Ga0207674_10053618 Ga0207674_100536182 756
1928 3300026121 Ga0207683_10027968 Ga0207683_100279682 756
1929 3300031239 Ga0265328_10004600 Ga0265328_100046004 756
1930 3300031250 Ga0265331_10004230 Ga0265331_100042302 756
1931 3300031711 Ga0265314_10000488 Ga0265314_100004887 756
1932 3300031731 Ga0307405_10012089 Ga0307405_100120892 756
1933 3300031911 Ga0307412_10010845 Ga0307412_100108452 756
1934 3300031995 Ga0307409_100004787 Ga0307409_1000047875 756
1935 3300032002 Ga0307416_100005548 Ga0307416_1000055485 756
1936 3300032126 Ga0307415_100000806 Ga0307415_1000008068 756
1937 3300042876 Ga0451577_0002906 Ga0451577_0002906_13708_16029 756
1938 3300042876 Ga0451577_0045359 Ga0451577_0045359_793_3114 756
1939 3300045051 Ga0451576_0003357 Ga0451576_0003357_1696_4017 756
1940 3300046457 Ga0495590_0011791 Ga0495590_0011791_135_2495 756
1941 3300046460 Ga0495638_0001861 Ga0495638_0001861_3793_6153 756
1942 3300046474 Ga0495605_0001047 Ga0495605_0001047_3751_6111 756
1943 3300046492 Ga0495585_0007651 Ga0495585_0007651_3568_5928 756
1944 3300046492 Ga0495585_0023829 Ga0495585_0023829_657_3002 756
1945 3300046501 Ga0495607_0001793 Ga0495607_0001793_3714_6074 756
1946 3300046501 Ga0495607_0003737 Ga0495607_0003737_8527_10863 756
1947 3300046506 Ga0495583_0000177 Ga0495583_0000177_92590_94950 756
1948 3300046507 Ga0495606_0003707 Ga0495606_0003707_4246_6564 756
1949 3300046513 Ga0495616_0001746 Ga0495616_0001746_8598_10958 756
1950 3300046516 Ga0495628_0063567 Ga0495628_0063567_33_2351 756
1951 3300046523 Ga0495644_0000073 Ga0495644_0000073_26800_29160 756
1952 3300046523 Ga0495644_0000257 Ga0495644_0000257_14584_16944 756
1953 3300046524 Ga0495648_0002104 Ga0495648_0002104_3848_6208 756
1954 3300046528 Ga0495642_0021028 Ga0495642_0021028_23_2320 756
1955 3300046531 Ga0495665_0000823 Ga0495665_0000823_853_3171 756
1956 3300046543 Ga0495645_0055656 Ga0495645_0055656_38_2317 756
1957 3300046558 Ga0495633_0000801 Ga0495633_0000801_8075_10420 756
1958 3300046616 Ga0495668_0000136 Ga0495668_0000136_17266_19575 756
1959 3300046648 Ga0495611_0000240 Ga0495611_0000240_7229_9589 756
1960 3300046648 Ga0495611_0001717 Ga0495611_0001717_4454_6814 756
1961 3300046660 Ga0495625_0005705 Ga0495625_0005705_1866_4226 756
1962 3300046660 Ga0495625_0021357 Ga0495625_0021357_2270_4606 756
1963 3300046665 Ga0495661_0026576 Ga0495661_0026576_265_2610 756
1964 3300046691 Ga0495670_0001773 Ga0495670_0001773_737_3097 756
1965 3300046794 Ga0495589_0010655 Ga0495589_0010655_2373_4733 756
1966 3300047318 Ga0495636_0000347 Ga0495636_0000347_11346_13706 756
1967 3300047320 Ga0495672_0001846 Ga0495672_0001846_12320_14656 756
1968 3300047320 Ga0495672_0002343 Ga0495672_0002343_3603_5963 756
1969 3300047322 Ga0495680_0012420 Ga0495680_0012420_5113_7431 756
1970 3300047323 Ga0495683_0001111 Ga0495683_0001111_4061_6421 756
1971 3300047443 Ga0495687_000751 Ga0495687_000751_20182_22542 756
1972 3300047447 Ga0495685_000012 Ga0495685_000012_13680_16040 756
1973 3300047472 Ga0495686_0000817 Ga0495686_0000817_10482_12791 756
1974 3300048088 Ga0495602_0003463 Ga0495602_0003463_836_3154 756
1975 3300048908 Ga0496105_0034874 Ga0496105_0034874_403_2721 756
1976 3300048925 Ga0496122_0036230 Ga0496122_0036230_1645_3951 756
1977 3300048927 Ga0496124_0000007 Ga0496124_0000007_384920_387226 756
1978 3300049459 Ga0495678_001618 Ga0495678_001618_3489_5849 756
1979 3300049460 Ga0495682_0000216 Ga0495682_0000216_21157_23502 756
1980 3300049460 Ga0495682_0001700 Ga0495682_0001700_4540_6900 756
1981 3300049584 Ga0501068_0004506 Ga0501068_0004506_3082_5400 756
1982 3300049589 Ga0501073_0006811 Ga0501073_0006811_1364_3682 756
1983 3300049742 Ga0501080_0020081 Ga0501080_0020081_3341_5659 756
1984 3300049744 Ga0501083_0011935 Ga0501083_0011935_1144_3444 756
1985 3300050509 nmdc:mga0qj67_57248_c1 nmdc:mga0qj67_57248_c1_427_2790 756
1986 3300053119 Ga0500595_000291 Ga0500595_000291_1954_4272 756
1987 3300053139 Ga0500568_0012899 Ga0500568_0012899_1255_3573 756
1988 3300053149 Ga0500600_0014439 Ga0500600_0014439_901_3303 756
1989 3300053153 Ga0500616_0002529 Ga0500616_0002529_7852_10170 756
1990 3300054114 Ga0501084_0046504 Ga0501084_0046504_1108_3426 756
1991 3300060353 Ga0501082_0023107 Ga0501082_0023107_1251_3569 756
1992 iso_pu_bacteria 2501025501 2501070744 756
1993 iso_pu_bacteria 2508501125 2509131620 756
1994 iso_pu_bacteria 2510917015 2511102146 756
1995 iso_pu_bacteria 2512047030 2512347127 756
1996 iso_pu_bacteria 2513237151 2513959728 756
1997 iso_pu_bacteria 2515154122 2515683493 756
1998 iso_pu_bacteria 2526164713 2527079754 756
1999 iso_pu_bacteria 2600255067 2600813104 756
2000 iso_pu_bacteria 2738541296 2738824675 756
2001 iso_pu_bacteria 2738541298 2738837143 756
2002 iso_pu_bacteria 2738541306 2738878673 756
2003 iso_pu_bacteria 2738543002 2739190324 756
2004 iso_pu_bacteria 2738543008 2739225264 756
2005 iso_pu_bacteria 2744054900 2746088032 756
2006 iso_pu_bacteria 2744054901 2746098514 756
2007 iso_pu_bacteria 2751185846 2753571514 756
2008 iso_pu_bacteria 2818991450 2819624924 756
2009 iso_pu_bacteria 2842324504 2842332862 756
2010 iso_pu_bacteria 2842348783 2842357068 756
2011 iso_pu_bacteria 2842454564 2842458815 756
2012 iso_pu_bacteria 2885270888 2885279000 756
2013 iso_pu_bacteria 2900634093 2900637008 756
2014 iso_pu_bacteria 2902682994 2902691431 756
2015 iso_pu_bacteria 2904483920 2904487964 756
2016 iso_pu_bacteria 2919527303 2919531302 756
2017 iso_pu_bacteria 2928108538 2928114600 756
2018 iso_pu_bacteria 2928135762 2928142065 756
2019 iso_pu_bacteria 2928503688 2928509950 756
2020 iso_pu_bacteria 2945934425 2945934626 756
2021 iso_pu_bacteria 2990703756 2990704815 756
2022 iso_pu_bacteria 641736151 642427371 756
2023 iso_pu_bacteria 642555113 642623263 756
2024 iso_pu_bacteria 8055266321 8055272779 756
2025 iso_pu_bacteria 8055301274 8055305759 756
2026 3300005328 Ga0070676_10007686 Ga0070676_100076862 757
2027 3300005331 Ga0070670_100027325 Ga0070670_1000273252 757
2028 3300005338 Ga0068868_100049061 Ga0068868_1000490612 757
2029 3300005354 Ga0070675_100028246 Ga0070675_1000282462 757
2030 3300005364 Ga0070673_100015287 Ga0070673_1000152875 757
2031 3300005367 Ga0070667_100001024 Ga0070667_10000102415 757
2032 3300005543 Ga0070672_100016431 Ga0070672_1000164312 757
2033 3300025907 Ga0207645_10010246 Ga0207645_100102463 757
2034 3300025908 Ga0207643_10028473 Ga0207643_100284732 757
2035 3300025986 Ga0207658_10000692 Ga0207658_1000069215 757
2036 3300026116 Ga0207674_10039004 Ga0207674_100390043 757
2037 3300039447 Ga0436361_0946249 Ga0436361_0946249_21_2348 757
2038 iso_pu_bacteria 2643221654 2644301843 757
2039 3300003354 JGI25160J50197_1000104 JGI25160J50197_100010460 758
2040 3300005262 Ga0065165_1000332 Ga0065165_100033260 758
2041 3300016635 Ga0183361_10001 Ga0183361_10001817 758
2042 3300025284 Ga0209130_1004659 Ga0209130_10046592 758
2043 3300025302 Ga0207426_1000007 Ga0207426_1000007859 758
2044 3300025913 Ga0207695_10069217 Ga0207695_100692172 758
2045 3300028800 Ga0265338_10001745 Ga0265338_1000174521 758
2046 3300037471 Ga0395905_0000176 Ga0395905_0000176_14188_16473 758
2047 3300046455 Ga0495603_0016108 Ga0495603_0016108_1511_3796 758
2048 3300046524 Ga0495648_0016879 Ga0495648_0016879_766_3051 758
2049 3300048903 Ga0496100_0015993 Ga0496100_0015993_1508_3793 758
2050 3300048904 Ga0496101_0010062 Ga0496101_0010062_1879_4164 758
2051 3300048906 Ga0496103_0001718 Ga0496103_0001718_5842_8127 758
2052 3300048920 Ga0496117_0011082 Ga0496117_0011082_4720_7005 758
2053 3300048921 Ga0496118_0007827 Ga0496118_0007827_2986_5271 758
2054 3300025941 Ga0207711_10028842 Ga0207711_100288422 759
2055 3300047320 Ga0495672_0006574 Ga0495672_0006574_1711_3999 759
2056 3300047472 Ga0495686_0000067 Ga0495686_0000067_22674_24962 759
2057 3300001979 JGI24740J21852_10000971 JGI24740J21852_100009712 760
2058 3300001989 JGI24739J22299_10001114 JGI24739J22299_100011142 760
2059 3300001989 JGI24739J22299_10001476 JGI24739J22299_100014762 760
2060 3300001989 JGI24739J22299_10010851 JGI24739J22299_100108511 760
2061 3300002067 JGI24735J21928_10000203 JGI24735J21928_1000020318 760
2062 3300002067 JGI24735J21928_10000468 JGI24735J21928_100004685 760
2063 3300002705 JGI25156J39149_1001733 JGI25156J39149_10017333 760
2064 3300002705 JGI25156J39149_1001764 JGI25156J39149_10017643 760
2065 3300002705 JGI25156J39149_1002152 JGI25156J39149_10021523 760
2066 3300002705 JGI25156J39149_1002790 JGI25156J39149_10027902 760
2067 3300003214 JGI25165J46597_1001543 JGI25165J46597_10015433 760
2068 3300003756 Ga0055533_1000339 Ga0055533_10003393 760
2069 3300003756 Ga0055533_1000680 Ga0055533_10006802 760
2070 3300003756 Ga0055533_1000760 Ga0055533_10007607 760
2071 3300003758 Ga0055532_1000043 Ga0055532_100004315 760
2072 3300003760 Ga0055527_1000026 Ga0055527_1000026162 760
2073 3300003761 Ga0055535_1000032 Ga0055535_1000032164 760
2074 3300003762 Ga0055542_1000049 Ga0055542_100004915 760
2075 3300003763 Ga0055529_1000059 Ga0055529_1000059164 760
2076 3300009011 Ga0105251_10000438 Ga0105251_1000043816 760
2077 3300013105 Ga0157369_10020943 Ga0157369_100209432 760
2078 3300013105 Ga0157369_10022845 Ga0157369_100228452 760
2079 3300025226 Ga0209674_100017 Ga0209674_100017616 760
2080 3300025226 Ga0209674_100209 Ga0209674_10020915 760
2081 3300025228 Ga0209672_100001 Ga0209672_1000012493 760
2082 3300025229 Ga0209147_100022 Ga0209147_10002215 760
2083 3300025230 Ga0209563_103934 Ga0209563_1039341 760
2084 3300025231 Ga0207427_101078 Ga0207427_1010782 760
2085 3300025242 Ga0209258_100033 Ga0209258_100033397 760
2086 3300025254 Ga0209148_1000046 Ga0209148_100004616 760
2087 3300025256 Ga0209759_1000271 Ga0209759_100027160 760
2088 3300025256 Ga0209759_1000535 Ga0209759_10005356 760
2089 3300025256 Ga0209759_1000770 Ga0209759_100077015 760
2090 3300025261 Ga0209233_1000050 Ga0209233_100005015 760
2091 3300025272 Ga0209455_1000038 Ga0209455_100003816 760
2092 3300025735 Ga0207713_1000390 Ga0207713_100039016 760
2093 3300025904 Ga0207647_10005063 Ga0207647_100050635 760
2094 3300025904 Ga0207647_10005511 Ga0207647_100055116 760
2095 3300031548 Ga0307408_100001028 Ga0307408_10000102813 760
2096 3300031731 Ga0307405_10037144 Ga0307405_100371442 760
2097 3300031911 Ga0307412_10000011 Ga0307412_1000001116 760
2098 3300031995 Ga0307409_100034980 Ga0307409_1000349802 760
2099 3300032002 Ga0307416_100020962 Ga0307416_1000209622 760
2100 3300046457 Ga0495590_0007733 Ga0495590_0007733_84_2366 760
2101 3300046458 Ga0495591_002221 Ga0495591_002221_6046_8328 760
2102 3300046459 Ga0495629_0000609 Ga0495629_0000609_16137_18419 760
2103 3300046459 Ga0495629_0008744 Ga0495629_0008744_4748_7030 760
2104 3300046462 Ga0495651_0028013 Ga0495651_0028013_582_2864 760
2105 3300046462 Ga0495651_0063232 Ga0495651_0063232_353_2635 760
2106 3300046471 Ga0495650_0004714 Ga0495650_0004714_2158_4440 760
2107 3300046471 Ga0495650_0013081 Ga0495650_0013081_167_2449 760
2108 3300046472 Ga0495580_0000844 Ga0495580_0000844_15985_18267 760
2109 3300046472 Ga0495580_0011034 Ga0495580_0011034_2115_4397 760
2110 3300046500 Ga0495596_0005802 Ga0495596_0005802_2841_5123 760
2111 3300046506 Ga0495583_0001650 Ga0495583_0001650_3794_6076 760
2112 3300046511 Ga0495608_0038607 Ga0495608_0038607_352_2634 760
2113 3300046514 Ga0495618_0037468 Ga0495618_0037468_304_2586 760
2114 3300046517 Ga0495630_0010541 Ga0495630_0010541_2111_4393 760
2115 3300046526 Ga0495666_0000207 Ga0495666_0000207_16101_18383 760
2116 3300046526 Ga0495666_0028157 Ga0495666_0028157_438_2720 760
2117 3300046529 Ga0495652_0004075 Ga0495652_0004075_4162_6444 760
2118 3300046529 Ga0495652_0021384 Ga0495652_0021384_3399_5681 760
2119 3300046533 Ga0495640_0042568 Ga0495640_0042568_521_2803 760
2120 3300046535 Ga0495586_0000456 Ga0495586_0000456_6110_8392 760
2121 3300046535 Ga0495586_0011201 Ga0495586_0011201_2300_4582 760
2122 3300046543 Ga0495645_0016143 Ga0495645_0016143_2922_5204 760
2123 3300046642 Ga0495634_0006200 Ga0495634_0006200_2425_4707 760
2124 3300046642 Ga0495634_0020395 Ga0495634_0020395_546_2828 760
2125 3300046663 Ga0495635_0008481 Ga0495635_0008481_2096_4378 760
2126 3300046665 Ga0495661_0001079 Ga0495661_0001079_8428_10710 760
2127 3300046665 Ga0495661_0039830 Ga0495661_0039830_175_2457 760
2128 3300046678 Ga0495599_0001260 Ga0495599_0001260_3989_6370 760
2129 3300046680 Ga0495646_0002095 Ga0495646_0002095_281_2563 760
2130 3300046680 Ga0495646_0005299 Ga0495646_0005299_1246_3528 760
2131 3300046689 Ga0495613_0005078 Ga0495613_0005078_4516_6798 760
2132 3300046690 Ga0495624_0007815 Ga0495624_0007815_2921_5203 760
2133 3300046694 Ga0495649_0022509 Ga0495649_0022509_444_2726 760
2134 3300046809 Ga0495600_0012542 Ga0495600_0012542_2975_5257 760
2135 3300047315 Ga0495581_0000183 Ga0495581_0000183_10621_12903 760
2136 3300047317 Ga0495604_0062546 Ga0495604_0062546_477_2759 760
2137 3300047319 Ga0495674_0005804 Ga0495674_0005804_7067_9349 760
2138 3300047322 Ga0495680_0001822 Ga0495680_0001822_8420_10702 760
2139 3300047322 Ga0495680_0021410 Ga0495680_0021410_2497_4779 760
2140 3300047323 Ga0495683_0005598 Ga0495683_0005598_3549_5831 760
2141 3300047323 Ga0495683_0014117 Ga0495683_0014117_1390_3672 760
2142 3300047444 Ga0495675_0004099 Ga0495675_0004099_4675_6957 760
2143 3300047446 Ga0495679_000139 Ga0495679_000139_46943_49225 760
2144 3300047446 Ga0495679_000825 Ga0495679_000825_1271_3553 760
2145 3300047446 Ga0495679_002878 Ga0495679_002878_461_2743 760
2146 3300047673 Ga0495593_0009182 Ga0495593_0009182_3203_5485 760
2147 3300048088 Ga0495602_0001984 Ga0495602_0001984_2144_4426 760
2148 3300048089 Ga0495614_0000712 Ga0495614_0000712_4642_6924 760
2149 3300048089 Ga0495614_0005320 Ga0495614_0005320_2859_5141 760
2150 3300048091 Ga0495626_0007886 Ga0495626_0007886_2559_4841 760
2151 3300048921 Ga0496118_0003961 Ga0496118_0003961_2707_4989 760
2152 3300048921 Ga0496118_0004357 Ga0496118_0004357_8690_10981 760
2153 3300048921 Ga0496118_0007256 Ga0496118_0007256_9519_11801 760
2154 3300048921 Ga0496118_0020975 Ga0496118_0020975_998_3280 760
2155 3300048921 Ga0496118_0031810 Ga0496118_0031810_1483_3765 760
2156 3300048924 Ga0496121_0001113 Ga0496121_0001113_3162_5444 760
2157 3300048929 Ga0496126_0000623 Ga0496126_0000623_49868_52156 760
2158 3300048929 Ga0496126_0000645 Ga0496126_0000645_25937_28228 760
2159 3300048929 Ga0496126_0000646 Ga0496126_0000646_13839_16121 760
2160 3300048929 Ga0496126_0002866 Ga0496126_0002866_371_2653 760

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00390

malic

Malic enzyme, N-terminal domain

113

180

0.97

PF01515

PTA_PTB

Phosphate acetyl/butaryl transferase

571

868

0.96

PF00390

malic

Malic enzyme, N-terminal domain

15

115

0.95

PF03949

Malic_M

Malic enzyme, NAD binding domain

421

484

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zn7-assembly1.cif.gz_A maeb malic enzyme domain apoprotein 0.9666 4 407
6zn7-assembly1.cif.gz_A maeb malic enzyme domain apoprotein 0.962 4 407
5cee-assembly1.cif.gz_A-2 malic enzyme from candidatus phytoplasma aywb in complex with nad and mg2+ 0.9488 6 405
5cee-assembly1.cif.gz_A-2 malic enzyme from candidatus phytoplasma aywb in complex with nad and mg2+ 0.9416 6 405
6znj-assembly1.cif.gz_B maeb full-length enzyme apoprotein form 0.9389 4 756
ID Description Score Start End Superfamily
af_P76558_161_444_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9879 162 441 3.40.50.720
af_P76558_161_444_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9706 162 441 3.40.50.720
1ww8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Malic enzyme, N-terminal domain 0.9624 7 160 3.40.50.10380
1ww8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Malic enzyme, N-terminal domain 0.9502 7 160 3.40.50.10380
3nv9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Malic enzyme, N-terminal domain 0.9453 3 160 3.40.50.10380
ID Description Score Start End GO Terms
AF-A0A7G2K370-F1-model_v4 NADP-dependent malic enzyme (EC 1.1.1.40) 0.9993 44 147 GO:0004473
GO:0008948
AF-X1EWL2-F1-model_v4 Malic enzyme NAD-binding domain-containing protein 0.999 45 292 GO:0004470
GO:0016616
GO:0051287
AF-A0A4U9WCX3-F1-model_v4 NADP-dependent malic enzyme (EC 1.1.1.40) 0.9975 68 344 GO:0004473
GO:0008948
GO:0046872
GO:0051287
AF-A0A7X7LX90-F1-model_v4 NADP-dependent malic enzyme (EC 1.1.1.40) 0.9975 1 147 GO:0004473
GO:0008948
AF-A0A7C5QYY5-F1-model_v4 NADP-dependent malic enzyme 0.9968 9 169 GO:0004470
GO:0016616

Feature Viewer

pLDDT pTM Quality
90.78 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map