F496480

General Info

Members Datasets Scaffolds Average Seq Length
2158 652 2055 201

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100016399|Ga0070670_1000163992
Length 231
Sequence MPRLPLAPVPQVPPRNSDADARGLLAPKAMKRADTASARAWQRMLSGRRLDLLDPSALDVEIEDIAHGLARVARWNGQTKGAHIFSVAQHSLLVEAVARARVPRLDRSLRLAVLLHDAPEYVIGDMISPFKAVIGDAYKAVERRLLTAIHLRFGLPAQMTPQFERLIKTADRAAAYLEATRLAGFDAAEARRFFGRAPDVSPAIERDYLRPWPAETAQARYLERFKKLLGE

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
6 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
7 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
10 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
11 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
12 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
13 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
14 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
15 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
16 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
17 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
18 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
19 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
20 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
21 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
22 2718217927 Rhizobium sp. N324 Isolate Nodule
23 2718218423 Rhizobium sp. N941 Isolate Nodule
24 2721755809 Rhizobium sp. N541 Isolate Nodule
25 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
26 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
27 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
28 2791355261 Rhizobium sp. J15 Isolate Nodule
29 2791355266 Rhizobium sp. L43 Isolate Nodule
30 2791355267 Rhizobium sp. L18 Isolate Nodule
31 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
32 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
33 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
34 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
35 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
36 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
37 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
38 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
39 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
40 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
41 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
42 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
43 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
44 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
45 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
46 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
47 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
48 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
49 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
50 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
51 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
52 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
53 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
54 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
55 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
56 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
57 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
58 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
59 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
60 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
61 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
62 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
63 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
64 2904699407
65 2906610324
66 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
67 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
68 2922425934
69 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
70 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
71 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
72 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
73 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
74 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
75 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
76 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
77 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
78 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
79 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
80 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
81 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
82 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
83 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
84 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
85 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
86 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
87 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
88 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
89 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
90 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
91 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
92 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
93 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
94 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
95 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
96 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
97 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
98 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
99 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
100 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
102 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
103 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
104 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
105 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
106 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
107 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
108 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
109 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
110 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
111 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
112 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
113 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
114 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
115 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
116 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
117 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
118 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
119 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
120 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
121 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
122 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
123 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
124 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
125 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
126 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
127 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
128 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
129 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
130 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
131 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
132 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
133 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
134 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
135 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
136 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
137 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
138 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
139 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
140 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
141 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
142 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
143 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
144 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
145 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
146 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
147 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
148 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
149 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
150 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
151 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
152 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
153 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
154 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
155 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
156 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
157 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
158 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
159 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
160 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
161 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
162 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
163 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
164 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
165 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
166 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
167 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
168 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
169 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
170 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
171 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
172 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
173 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
174 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
175 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
176 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
177 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
178 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
179 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
180 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
181 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
182 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
183 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
184 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
185 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
186 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
187 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
188 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
189 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
190 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
191 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
192 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
193 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
194 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
195 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
196 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
197 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
198 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
199 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
200 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
201 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
202 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
203 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
204 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
205 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
206 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
207 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
208 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
209 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
210 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
211 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
212 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
213 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
214 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
215 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
216 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
217 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
218 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
219 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
220 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
221 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
222 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
223 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
224 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
225 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
226 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
227 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
228 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
229 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
230 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
231 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
232 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
233 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
234 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
235 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
236 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
237 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
238 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
239 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
240 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
241 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
242 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
243 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
244 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
245 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
246 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
247 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
248 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
249 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
250 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
251 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
252 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
253 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
254 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
255 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
256 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
258 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
260 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
261 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
262 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
263 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
334 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
335 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
337 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
338 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
339 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
340 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
344 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
345 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
346 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
347 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
348 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
349 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
352 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
353 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
354 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
355 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
356 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
357 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
358 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
359 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
360 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
361 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
362 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
363 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
364 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
365 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
366 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
367 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
368 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
369 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
370 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
371 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
372 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
373 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
374 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
375 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
376 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
377 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
378 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
379 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
380 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
381 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
382 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
383 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
384 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
385 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
386 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
387 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
388 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
389 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
390 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
391 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
392 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
393 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
394 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
395 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
396 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
397 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
398 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
399 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
400 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
401 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
402 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
403 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
404 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
405 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
406 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
407 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
408 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
409 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
410 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
411 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
412 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
413 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
414 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
415 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
416 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
417 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
418 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
419 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
420 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
421 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
422 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
423 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
424 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
425 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
426 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
427 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
428 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
429 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
430 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
431 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
432 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
433 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
434 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
435 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
436 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
437 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
438 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
439 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
440 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
441 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
442 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
443 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
444 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
445 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
446 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
447 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
448 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
449 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
450 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
451 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
452 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
453 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
454 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
455 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
456 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
457 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
458 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
459 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
460 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
461 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
462 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
463 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
464 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
465 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
466 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
467 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
468 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
469 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
470 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
471 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
472 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
473 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
474 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
475 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
476 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
477 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
478 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
479 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
480 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
481 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
482 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
483 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
484 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
485 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
486 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
487 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
488 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
489 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
490 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
491 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
492 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
493 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
494 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
495 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
496 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
497 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
498 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
499 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
500 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
501 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
502 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
503 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
504 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
505 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
506 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
507 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
508 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
509 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
510 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
511 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
512 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
513 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
514 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
515 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
516 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
517 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
518 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
519 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
520 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
521 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
522 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
523 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
524 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
525 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
526 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
527 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
528 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
529 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
530 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
531 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
532 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
533 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
534 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
535 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
536 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
537 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
538 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
539 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
540 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
541 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
542 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
543 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
544 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
545 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
546 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
547 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
548 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
549 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
550 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
551 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
552 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
553 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
554 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
555 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
556 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
557 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
558 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
559 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
560 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
561 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
562 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
563 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
564 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
565 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
566 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
567 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
568 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
569 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
570 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
571 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
572 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
573 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
574 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
575 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
576 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
577 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
578 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
579 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
580 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
581 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
582 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
583 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
584 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
585 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
586 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
587 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
588 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
589 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
590 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
591 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
592 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
593 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
594 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
595 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
596 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
597 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
598 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
599 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
600 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
601 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
602 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
603 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
604 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
605 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
606 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
607 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
608 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
609 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
610 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
611 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
612 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
613 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
614 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
615 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
616 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
617 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
618 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
619 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
620 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
621 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
622 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
623 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
624 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
625 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
626 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
627 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
628 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
629 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
630 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
631 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
632 8005275841 Rhizobium sp. N4311 Isolate Nodule
633 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
634 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
635 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
636 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
637 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
638 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
639 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
640 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
641 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
642 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
643 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
644 8018176218 Rhizobium sp. N122 Isolate Nodule
645 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
646 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
647 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
648 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
649 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
650 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
651 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
652 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.08
Metatranscriptomes 0.28
Isolates 4.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.97
Nodule 4.03
Rhizoplane 6.95
Rhizosphere 82.81
Stem 0
Stem Tuber 0
Unclassified 3.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214756346 2209111006 Bacteria 3056
2 ARSoilYngRDRAFT_c00171 3300000042 Bacteria 11037
3 ARcpr5yngRDRAFT_c001563 3300000043 Bacteria 2510
4 ARSoilOldRDRAFT_c001126 3300000044 Bacteria 2568
5 ARCol0oldRDRAFT_c00826 3300000045 Bacteria 2556
6 ARCol0yngRDRAFT_1000939 3300000652 Bacteria 2595
7 JGI24747J21853_1001186 3300001978 Bacteria 1903
8 JGI24739J22299_10008396 3300001989 Bacteria 3857
9 JGI24737J22298_10001849 3300001990 Bacteria 7568
10 JGI24737J22298_10028213 3300001990 Bacteria 1765
11 JGI24743J22301_10009448 3300001991 Bacteria 1728
12 JGI24750J21931_1000984 3300002070 Bacteria 3759
13 JGI24750J21931_1009747 3300002070 Bacteria 1242
14 JGI24745J21846_1000980 3300002073 Bacteria 2672
15 JGI24738J21930_10005472 3300002075 Bacteria 3041
16 JGI24749J21850_1002160 3300002076 Bacteria 2776
17 JGI24749J21850_1021722 3300002076 Bacteria 909
18 JGI24744J21845_10009678 3300002077 Bacteria 1979
19 JGI24744J21845_10022947 3300002077 Bacteria 1222
20 JGI24035J26624_1000873 3300002126 Bacteria 2844
21 JGI24034J26672_10001273 3300002239 Bacteria 3316
22 JGI24034J26672_10013927 3300002239 Bacteria 1223
23 JGI24742J22300_10015321 3300002244 Bacteria 1289
24 JGI25406J46586_10000262 3300003203 Bacteria 23511
25 JGI25165J46597_1012067 3300003214 Bacteria 1217
26 JGI25153J46596_10003455 3300003215 Bacteria 8847
27 Ga0055539_1003885 3300003752 Bacteria 2030
28 Ga0055526_1018124 3300003771 Bacteria 2646
29 Ga0055528_1014267 3300003790 Bacteria 2950
30 Ga0055540_1000406 3300003792 Bacteria 34874
31 Ga0055531_10034081 3300003794 Bacteria 1624
32 JGI25405J52794_10034209 3300003911 Bacteria 1062
33 Ga0065716_1001738 3300005277 Bacteria 3698
34 Ga0065704_10101941 3300005289 Bacteria 2221
35 Ga0065712_10086364 3300005290 Bacteria 2640
36 Ga0065712_10111639 3300005290 Bacteria 1813
37 Ga0065715_10022043 3300005293 Bacteria 1623
38 Ga0065707_10184057 3300005295 Bacteria 1400
39 Ga0070658_10040943 3300005327 Bacteria 3737
40 Ga0070658_10054496 3300005327 Bacteria 3247
41 Ga0070658_10100907 3300005327 Bacteria 2386
42 Ga0070676_10001632 3300005328 Bacteria 11405
43 Ga0070676_10051923 3300005328 Bacteria 2408
44 Ga0070676_10272595 3300005328 Bacteria 1137
45 Ga0070676_10413993 3300005328 Bacteria 940
46 Ga0070683_100028761 3300005329 Bacteria 5026
47 Ga0070683_100208186 3300005329 Bacteria 1857
48 Ga0070690_100001733 3300005330 Bacteria 11520
49 Ga0070690_100006888 3300005330 Bacteria 6467
50 Ga0070690_100024817 3300005330 Bacteria 3690
51 Ga0070690_100257747 3300005330 Bacteria 1236
52 Ga0070670_100016399 3300005331 Bacteria 6361
53 Ga0070670_100041138 3300005331 Bacteria 3972
54 Ga0070670_100058636 3300005331 Bacteria 3305
55 Ga0070670_100127615 3300005331 Bacteria 2195
56 Ga0070670_100195215 3300005331 Bacteria 1758
57 Ga0070677_10001045 3300005333 Bacteria 8930
58 Ga0070677_10164068 3300005333 Bacteria 1045
59 Ga0068869_100001453 3300005334 Bacteria 14015
60 Ga0070666_10115186 3300005335 Bacteria 1861
61 Ga0070666_10528171 3300005335 Bacteria 857
62 Ga0070680_100051020 3300005336 Bacteria 3375
63 Ga0070680_100076159 3300005336 Bacteria 2762
64 Ga0070680_100108595 3300005336 Bacteria 2308
65 Ga0070682_100095383 3300005337 Bacteria 1953
66 Ga0070682_100265912 3300005337 Bacteria 1243
67 Ga0068868_100048532 3300005338 Bacteria 3330
68 Ga0068868_100092820 3300005338 Bacteria 2433
69 Ga0070660_100006368 3300005339 Bacteria 8183
70 Ga0070660_100018468 3300005339 Bacteria 5096
71 Ga0070660_100021005 3300005339 Bacteria 4807
72 Ga0070660_100053919 3300005339 Bacteria 3102
73 Ga0070660_100182880 3300005339 Bacteria 1696
74 Ga0070689_100026887 3300005340 Bacteria 4335
75 Ga0070689_100028586 3300005340 Bacteria 4215
76 Ga0070689_100125140 3300005340 Bacteria 2056
77 Ga0070689_100206602 3300005340 Bacteria 1606
78 Ga0070689_100384494 3300005340 Bacteria 1183
79 Ga0070691_10010873 3300005341 Bacteria 4154
80 Ga0070691_10035315 3300005341 Bacteria 2353
81 Ga0070691_10246280 3300005341 Bacteria 957
82 Ga0070691_10275659 3300005341 Bacteria 911
83 Ga0070687_100000415 3300005343 Bacteria 14399
84 Ga0070687_100011242 3300005343 Bacteria 3909
85 Ga0070687_100013730 3300005343 Bacteria 3619
86 Ga0070661_100062788 3300005344 Bacteria 2727
87 Ga0070661_100075948 3300005344 Bacteria 2476
88 Ga0070661_100166987 3300005344 Bacteria 1670
89 Ga0070661_100203003 3300005344 Bacteria 1515
90 Ga0070661_100488942 3300005344 Bacteria 984
91 Ga0070692_10007860 3300005345 Bacteria 4728
92 Ga0070692_10259171 3300005345 Bacteria 1044
93 Ga0070668_100004752 3300005347 Bacteria 10076
94 Ga0070668_100031419 3300005347 Bacteria 4040
95 Ga0070668_100115058 3300005347 Bacteria 2144
96 Ga0070668_100281141 3300005347 Bacteria 1390
97 Ga0070668_100320324 3300005347 Bacteria 1305
98 Ga0070668_101225085 3300005347 Bacteria 680
99 Ga0070669_100029250 3300005353 Bacteria 3971
100 Ga0070669_100029985 3300005353 Bacteria 3923
101 Ga0070669_100206566 3300005353 Bacteria 1548
102 Ga0070675_100003950 3300005354 Bacteria 11241
103 Ga0070675_100040297 3300005354 Bacteria 3813
104 Ga0070675_100082218 3300005354 Bacteria 2687
105 Ga0070671_100000362 3300005355 Bacteria 31320
106 Ga0070671_100001730 3300005355 Bacteria 16592
107 Ga0070671_100005034 3300005355 Bacteria 10539
108 Ga0070671_100022012 3300005355 Bacteria 5207
109 Ga0070671_100550212 3300005355 Bacteria 995
110 Ga0070671_100814341 3300005355 Bacteria 813
111 Ga0070674_100911808 3300005356 Bacteria 766
112 Ga0070673_100000576 3300005364 Bacteria 19887
113 Ga0070673_100003333 3300005364 Bacteria 9980
114 Ga0070673_100064881 3300005364 Bacteria 2910
115 Ga0070673_100133629 3300005364 Bacteria 2085
116 Ga0070688_100017285 3300005365 Bacteria 4137
117 Ga0070688_100035116 3300005365 Bacteria 3044
118 Ga0070688_100074241 3300005365 Bacteria 2183
119 Ga0070688_100074860 3300005365 Bacteria 2175
120 Ga0070688_100116358 3300005365 Bacteria 1785
121 Ga0070659_100000571 3300005366 Bacteria 26980
122 Ga0070659_100032993 3300005366 Bacteria 4021
123 Ga0070659_100205913 3300005366 Bacteria 1620
124 Ga0070659_100293703 3300005366 Bacteria 1354
125 Ga0070667_100053527 3300005367 Bacteria 3406
126 Ga0070709_10002036 3300005434 Bacteria 10969
127 Ga0070709_10004533 3300005434 Bacteria 7497
128 Ga0070709_10038223 3300005434 Bacteria 2937
129 Ga0070709_10661640 3300005434 Bacteria 809
130 Ga0070714_100007894 3300005435 Bacteria 8289
131 Ga0070714_100044557 3300005435 Bacteria 3756
132 Ga0070714_100064185 3300005435 Bacteria 3159
133 Ga0070714_100073915 3300005435 Bacteria 2954
134 Ga0070714_100253762 3300005435 Bacteria 1627
135 Ga0070714_100322666 3300005435 Bacteria 1444
136 Ga0070714_100695831 3300005435 Bacteria 980
137 Ga0070713_100003099 3300005436 Bacteria 10934
138 Ga0070713_100004514 3300005436 Bacteria 9366
139 Ga0070713_100022648 3300005436 Bacteria 4857
140 Ga0070713_100027473 3300005436 Bacteria 4480
141 Ga0070713_100053082 3300005436 Bacteria 3358
142 Ga0070713_100120138 3300005436 Bacteria 2303
143 Ga0070713_100169696 3300005436 Bacteria 1954
144 Ga0070713_100180315 3300005436 Bacteria 1897
145 Ga0070713_100308099 3300005436 Bacteria 1460
146 Ga0070713_101146803 3300005436 Bacteria 752
147 Ga0070710_10007272 3300005437 Bacteria 5355
148 Ga0070710_10067998 3300005437 Bacteria 2046
149 Ga0070710_10087576 3300005437 Bacteria 1830
150 Ga0070710_10188864 3300005437 Bacteria 1294
151 Ga0070710_10308516 3300005437 Bacteria 1035
152 Ga0070701_10002446 3300005438 Bacteria 7160
153 Ga0070701_10256254 3300005438 Bacteria 1058
154 Ga0070711_100007787 3300005439 Bacteria 6525
155 Ga0070711_100032763 3300005439 Bacteria 3458
156 Ga0070711_100069863 3300005439 Bacteria 2471
157 Ga0070711_100082175 3300005439 Bacteria 2298
158 Ga0070711_100198890 3300005439 Bacteria 1545
159 Ga0070711_100203313 3300005439 Bacteria 1530
160 Ga0070711_100238116 3300005439 Bacteria 1422
161 Ga0070711_100289096 3300005439 Bacteria 1300
162 Ga0070711_100374597 3300005439 Bacteria 1149
163 Ga0070711_100397699 3300005439 Bacteria 1118
164 Ga0070705_100012133 3300005440 Bacteria 4370
165 Ga0070705_100218251 3300005440 Bacteria 1319
166 Ga0070700_100003836 3300005441 Bacteria 7790
167 Ga0070700_100005828 3300005441 Bacteria 6539
168 Ga0070700_100068129 3300005441 Bacteria 2262
169 Ga0070700_100190607 3300005441 Bacteria 1433
170 Ga0070694_100001413 3300005444 Bacteria 14055
171 Ga0070694_100026580 3300005444 Bacteria 3752
172 Ga0070708_100044552 3300005445 Bacteria 3901
173 Ga0070708_100148159 3300005445 Bacteria 2181
174 Ga0070708_100219043 3300005445 Bacteria 1785
175 Ga0070663_100002691 3300005455 Bacteria 10058
176 Ga0070663_100024618 3300005455 Bacteria 4055
177 Ga0070663_100043389 3300005455 Bacteria 3165
178 Ga0070678_100002106 3300005456 Bacteria 10790
179 Ga0070678_100002347 3300005456 Bacteria 10339
180 Ga0070678_100104870 3300005456 Bacteria 2199
181 Ga0070678_100277223 3300005456 Bacteria 1416
182 Ga0070678_100375650 3300005456 Bacteria 1229
183 Ga0070662_100004351 3300005457 Bacteria 8948
184 Ga0070662_100006382 3300005457 Bacteria 7598
185 Ga0070662_100039083 3300005457 Bacteria 3374
186 Ga0070662_100041860 3300005457 Bacteria 3270
187 Ga0070662_100196404 3300005457 Bacteria 1598
188 Ga0070681_10039444 3300005458 Bacteria 4734
189 Ga0070681_10049959 3300005458 Bacteria 4174
190 Ga0070681_10267069 3300005458 Bacteria 1622
191 Ga0070681_10348818 3300005458 Bacteria 1390
192 Ga0070681_10499461 3300005458 Bacteria 1129
193 Ga0070681_11081693 3300005458 Bacteria 722
194 Ga0070685_10001428 3300005466 Bacteria 12528
195 Ga0070685_10170201 3300005466 Bacteria 1395
196 Ga0070706_100440725 3300005467 Bacteria 1212
197 Ga0070706_100880018 3300005467 Bacteria 828
198 Ga0070707_100110041 3300005468 Bacteria 2671
199 Ga0070698_100168522 3300005471 Bacteria 2131
200 Ga0070699_100026547 3300005518 Bacteria 4993
201 Ga0070699_100868491 3300005518 Bacteria 826
202 Ga0070679_100001318 3300005530 Bacteria 21846
203 Ga0070679_100137592 3300005530 Bacteria 2423
204 Ga0070679_100170596 3300005530 Bacteria 2149
205 Ga0070679_100374552 3300005530 Bacteria 1370
206 Ga0070684_100005209 3300005535 Bacteria 9944
207 Ga0070684_100019946 3300005535 Bacteria 5557
208 Ga0070684_100103611 3300005535 Bacteria 2545
209 Ga0070684_100183026 3300005535 Bacteria 1905
210 Ga0070697_100075090 3300005536 Bacteria 2778
211 Ga0070697_100212109 3300005536 Bacteria 1649
212 Ga0068853_100020949 3300005539 Bacteria 5441
213 Ga0068853_100112145 3300005539 Bacteria 2424
214 Ga0068853_100325556 3300005539 Bacteria 1425
215 Ga0068853_100410300 3300005539 Bacteria 1269
216 Ga0070672_100000929 3300005543 Bacteria 17621
217 Ga0070672_100116915 3300005543 Bacteria 2179
218 Ga0070672_100205500 3300005543 Bacteria 1648
219 Ga0070686_100000634 3300005544 Bacteria 20491
220 Ga0070686_100015069 3300005544 Bacteria 4469
221 Ga0070686_100036275 3300005544 Bacteria 3051
222 Ga0070695_100005904 3300005545 Bacteria 7224
223 Ga0070695_100085665 3300005545 Bacteria 2092
224 Ga0070695_100443143 3300005545 Bacteria 993
225 Ga0070695_100573173 3300005545 Bacteria 883
226 Ga0070696_100079774 3300005546 Bacteria 2316
227 Ga0070696_100110290 3300005546 Bacteria 1981
228 Ga0070696_100399091 3300005546 Bacteria 1075
229 Ga0070693_100001518 3300005547 Bacteria 10464
230 Ga0070693_100465540 3300005547 Bacteria 890
231 Ga0070665_100010325 3300005548 Bacteria 9446
232 Ga0070665_100080278 3300005548 Bacteria 3267
233 Ga0070665_100272367 3300005548 Bacteria 1695
234 Ga0070665_100287484 3300005548 Bacteria 1646
235 Ga0070704_100001541 3300005549 Bacteria 12431
236 Ga0070704_100004632 3300005549 Bacteria 7959
237 Ga0068855_100021914 3300005563 Bacteria 7659
238 Ga0068855_100042335 3300005563 Bacteria 5396
239 Ga0068855_100056204 3300005563 Bacteria 4618
240 Ga0068855_100093003 3300005563 Bacteria 3477
241 Ga0068855_100256829 3300005563 Bacteria 1948
242 Ga0068855_100624512 3300005563 Bacteria 1160
243 Ga0070664_100002380 3300005564 Bacteria 15108
244 Ga0070664_100015657 3300005564 Bacteria 6206
245 Ga0070664_100056484 3300005564 Bacteria 3335
246 Ga0070664_100058794 3300005564 Bacteria 3270
247 Ga0068857_100001264 3300005577 Bacteria 19809
248 Ga0068857_100089021 3300005577 Bacteria 2762
249 Ga0068857_101107254 3300005577 Bacteria 765
250 Ga0068854_100013038 3300005578 Bacteria 5448
251 Ga0068854_100155181 3300005578 Bacteria 1768
252 Ga0068856_100006111 3300005614 Bacteria 11824
253 Ga0068856_100146512 3300005614 Bacteria 2369
254 Ga0068856_100542830 3300005614 Bacteria 1184
255 Ga0068856_100583538 3300005614 Bacteria 1139
256 Ga0068856_100710135 3300005614 Bacteria 1026
257 Ga0070702_100000954 3300005615 Bacteria 11355
258 Ga0070702_100015144 3300005615 Bacteria 3931
259 Ga0070702_100026206 3300005615 Bacteria 3130
260 Ga0070702_100200972 3300005615 Bacteria 1319
261 Ga0070702_100374079 3300005615 Bacteria 1011
262 Ga0068852_100006031 3300005616 Bacteria 8730
263 Ga0068852_100079554 3300005616 Bacteria 2904
264 Ga0068852_100125140 3300005616 Bacteria 2359
265 Ga0068852_100166352 3300005616 Bacteria 2063
266 Ga0068852_100892864 3300005616 Bacteria 906
267 Ga0068859_100013029 3300005617 Bacteria 8354
268 Ga0068859_100032614 3300005617 Bacteria 5231
269 Ga0068859_100105649 3300005617 Bacteria 2875
270 Ga0068859_100361620 3300005617 Bacteria 1546
271 Ga0068864_100062645 3300005618 Bacteria 3223
272 Ga0068864_100104321 3300005618 Bacteria 2518
273 Ga0068864_100241937 3300005618 Bacteria 1672
274 Ga0068864_100719943 3300005618 Bacteria 976
275 Ga0068864_101060300 3300005618 Bacteria 805
276 Ga0068866_10001179 3300005718 Bacteria 11435
277 Ga0068866_10013738 3300005718 Bacteria 3559
278 Ga0068866_10224423 3300005718 Bacteria 1135
279 Ga0068861_100050416 3300005719 Bacteria 3156
280 Ga0068861_100484960 3300005719 Bacteria 1114
281 Ga0068870_10000138 3300005840 Bacteria 25429
282 Ga0068870_10010997 3300005840 Bacteria 4181
283 Ga0068863_100021740 3300005841 Bacteria 6120
284 Ga0068863_100125400 3300005841 Bacteria 2449
285 Ga0068863_100689782 3300005841 Bacteria 1015
286 Ga0068858_100000393 3300005842 Bacteria 45778
287 Ga0068858_100317054 3300005842 Bacteria 1489
288 Ga0068860_100003417 3300005843 Bacteria 16323
289 Ga0068860_100012342 3300005843 Bacteria 8417
290 Ga0068860_100017377 3300005843 Bacteria 7009
291 Ga0068860_100074823 3300005843 Bacteria 3221
292 Ga0068860_100216912 3300005843 Bacteria 1857
293 Ga0068860_100757804 3300005843 Bacteria 983
294 Ga0068862_100010169 3300005844 Bacteria 7765
295 Ga0068862_100059337 3300005844 Bacteria 3285
296 Ga0068862_100648838 3300005844 Bacteria 1018
297 Ga0081455_10002467 3300005937 Bacteria 22008
298 Ga0081455_10003445 3300005937 Bacteria 18185
299 Ga0081455_10004051 3300005937 Bacteria 16610
300 Ga0081455_10154528 3300005937 Bacteria 1765
301 Ga0081455_10427265 3300005937 Bacteria 912
302 Ga0081455_10431211 3300005937 Bacteria 906
303 Ga0081538_10001078 3300005981 Bacteria 29015
304 Ga0081538_10018742 3300005981 Bacteria 5179
305 Ga0081540_1000007 3300005983 Bacteria 205328
306 Ga0081540_1025472 3300005983 Bacteria 3402
307 Ga0081540_1038935 3300005983 Bacteria 2498
308 Ga0081540_1062356 3300005983 Bacteria 1771
309 Ga0081539_10000003 3300005985 Bacteria 594833
310 Ga0081539_10022785 3300005985 Bacteria 4127
311 Ga0081539_10082767 3300005985 Bacteria 1681
312 Ga0070717_10002923 3300006028 Bacteria 12133
313 Ga0070717_10003960 3300006028 Bacteria 10658
314 Ga0070717_10047666 3300006028 Bacteria 3512
315 Ga0070717_10051927 3300006028 Bacteria 3376
316 Ga0070717_10144217 3300006028 Bacteria 2056
317 Ga0070717_10241114 3300006028 Bacteria 1594
318 Ga0070717_10248807 3300006028 Bacteria 1570
319 Ga0070717_10435191 3300006028 Bacteria 1181
320 Ga0070717_10932224 3300006028 Bacteria 791
321 Ga0075365_10045928 3300006038 Bacteria 2867
322 Ga0075365_10200770 3300006038 Bacteria 1397
323 Ga0075363_100065225 3300006048 Bacteria 1968
324 Ga0075363_100165745 3300006048 Bacteria 1253
325 Ga0075364_10047888 3300006051 Bacteria 2785
326 Ga0075364_10391767 3300006051 Bacteria 948
327 Ga0075432_10016450 3300006058 Bacteria 2524
328 Ga0070715_10000850 3300006163 Bacteria 8404
329 Ga0070715_10011634 3300006163 Bacteria 3174
330 Ga0070715_10069905 3300006163 Bacteria 1566
331 Ga0070716_100020294 3300006173 Bacteria 3487
332 Ga0070716_100027997 3300006173 Bacteria 3033
333 Ga0070716_100065632 3300006173 Bacteria 2114
334 Ga0070716_100199606 3300006173 Bacteria 1328
335 Ga0070716_100476262 3300006173 Bacteria 916
336 Ga0070712_100000682 3300006175 Bacteria 20073
337 Ga0070712_100013770 3300006175 Bacteria 5173
338 Ga0070712_100037946 3300006175 Bacteria 3288
339 Ga0070712_100055686 3300006175 Bacteria 2770
340 Ga0070712_100074152 3300006175 Bacteria 2444
341 Ga0070712_100133234 3300006175 Bacteria 1886
342 Ga0070712_100179136 3300006175 Bacteria 1650
343 Ga0070712_100188808 3300006175 Bacteria 1611
344 Ga0070712_100190053 3300006175 Bacteria 1606
345 Ga0070712_100206946 3300006175 Bacteria 1545
346 Ga0070712_100417303 3300006175 Bacteria 1111
347 Ga0075367_10164911 3300006178 Bacteria 1378
348 Ga0075367_10462706 3300006178 Bacteria 804
349 Ga0075367_10494353 3300006178 Bacteria 776
350 Ga0075367_10523367 3300006178 Bacteria 753
351 Ga0075366_10066738 3300006195 Bacteria 2141
352 Ga0097621_100008210 3300006237 Bacteria 7509
353 Ga0097621_100101729 3300006237 Bacteria 2418
354 Ga0075370_10022313 3300006353 Bacteria 3475
355 Ga0068871_100003784 3300006358 Bacteria 10418
356 Ga0068871_100052951 3300006358 Bacteria 3288
357 Ga0068871_100116272 3300006358 Bacteria 2255
358 Ga0075428_100000606 3300006844 Bacteria 36554
359 Ga0075428_100025380 3300006844 Bacteria 6559
360 Ga0075428_100105897 3300006844 Bacteria 3066
361 Ga0075430_100042973 3300006846 Bacteria 3821
362 Ga0075430_100049864 3300006846 Bacteria 3532
363 Ga0075430_100218988 3300006846 Bacteria 1579
364 Ga0075430_100582831 3300006846 Bacteria 923
365 Ga0075430_100679355 3300006846 Bacteria 849
366 Ga0075431_100000032 3300006847 Bacteria 72293
367 Ga0075431_100060026 3300006847 Bacteria 3924
368 Ga0075431_100120638 3300006847 Bacteria 2705
369 Ga0075431_100149289 3300006847 Bacteria 2407
370 Ga0075431_100214019 3300006847 Bacteria 1967
371 Ga0075431_100347055 3300006847 Bacteria 1493
372 Ga0075431_100416175 3300006847 Bacteria 1344
373 Ga0075431_100882235 3300006847 Bacteria 865
374 Ga0075433_10000743 3300006852 Bacteria 22360
375 Ga0075433_10033762 3300006852 Bacteria 4388
376 Ga0075433_10079340 3300006852 Bacteria 2893
377 Ga0075433_10197211 3300006852 Bacteria 1790
378 Ga0075433_10245363 3300006852 Bacteria 1590
379 Ga0075434_100001145 3300006871 Bacteria 21892
380 Ga0075434_100014657 3300006871 Bacteria 7499
381 Ga0075434_100061382 3300006871 Bacteria 3739
382 Ga0075434_100134319 3300006871 Bacteria 2494
383 Ga0075434_100164364 3300006871 Bacteria 2239
384 Ga0075434_100166474 3300006871 Bacteria 2224
385 Ga0075434_100181255 3300006871 Bacteria 2126
386 Ga0075434_100189692 3300006871 Bacteria 2076
387 Ga0075434_100226997 3300006871 Bacteria 1887
388 Ga0075434_100469413 3300006871 Bacteria 1280
389 Ga0075434_100521425 3300006871 Bacteria 1209
390 Ga0075434_100568019 3300006871 Bacteria 1154
391 Ga0075434_100872600 3300006871 Bacteria 915
392 Ga0075429_100003655 3300006880 Bacteria 13102
393 Ga0075429_100020145 3300006880 Bacteria 5784
394 Ga0075429_100288261 3300006880 Bacteria 1437
395 Ga0075429_100408735 3300006880 Bacteria 1189
396 Ga0075429_100515473 3300006880 Bacteria 1048
397 Ga0068865_100003940 3300006881 Bacteria 8912
398 Ga0068865_100132893 3300006881 Bacteria 1866
399 Ga0068865_100219044 3300006881 Bacteria 1487
400 Ga0068865_100820335 3300006881 Bacteria 804
401 Ga0075436_100056822 3300006914 Bacteria 2702
402 Ga0075436_100110799 3300006914 Bacteria 1916
403 Ga0097620_100013028 3300006931 Bacteria 8354
404 Ga0097620_100032613 3300006931 Bacteria 5231
405 Ga0097620_100105653 3300006931 Bacteria 2875
406 Ga0097620_100361620 3300006931 Bacteria 1546
407 Ga0075435_100011030 3300007076 Bacteria 6629
408 Ga0075435_100027547 3300007076 Bacteria 4446
409 Ga0075435_100076142 3300007076 Bacteria 2749
410 Ga0075435_100166663 3300007076 Bacteria 1858
411 Ga0075435_100174718 3300007076 Bacteria 1813
412 Ga0075435_100318148 3300007076 Bacteria 1332
413 Ga0099794_10018933 3300007265 Bacteria 3094
414 Ga0099794_10098732 3300007265 Bacteria 1456
415 Ga0099794_10107450 3300007265 Bacteria 1396
416 Ga0099795_10024611 3300007788 Bacteria 2010
417 Ga0105251_10136218 3300009011 Bacteria 1112
418 Ga0105250_10028591 3300009092 Bacteria 2245
419 Ga0105250_10056598 3300009092 Bacteria 1574
420 Ga0105240_10314620 3300009093 Bacteria 1786
421 Ga0105240_10457775 3300009093 Bacteria 1426
422 Ga0105240_10547925 3300009093 Bacteria 1280
423 Ga0105240_10735976 3300009093 Bacteria 1073
424 Ga0111539_10001862 3300009094 Bacteria 28020
425 Ga0111539_10004418 3300009094 Bacteria 18382
426 Ga0111539_10011510 3300009094 Bacteria 11101
427 Ga0111539_10014649 3300009094 Bacteria 9783
428 Ga0111539_10026905 3300009094 Bacteria 7027
429 Ga0111539_10102425 3300009094 Bacteria 3360
430 Ga0111539_10736140 3300009094 Bacteria 1148
431 Ga0105245_10001434 3300009098 Bacteria 21608
432 Ga0105245_10039066 3300009098 Bacteria 4224
433 Ga0105245_10308370 3300009098 Bacteria 1555
434 Ga0105245_10581584 3300009098 Bacteria 1144
435 Ga0105245_11102539 3300009098 Bacteria 840
436 Ga0105245_11174469 3300009098 Bacteria 815
437 Ga0105247_10023297 3300009101 Bacteria 3730
438 Ga0105247_10046100 3300009101 Bacteria 2675
439 Ga0105247_10060606 3300009101 Bacteria 2345
440 Ga0105247_10219651 3300009101 Bacteria 1286
441 Ga0105247_10490643 3300009101 Bacteria 893
442 Ga0114129_10000062 3300009147 Bacteria 96507
443 Ga0114129_10085470 3300009147 Bacteria 4377
444 Ga0114129_10125602 3300009147 Bacteria 3527
445 Ga0114129_10136862 3300009147 Bacteria 3360
446 Ga0114129_10234506 3300009147 Bacteria 2470
447 Ga0114129_10365071 3300009147 Bacteria 1910
448 Ga0114129_10380029 3300009147 Bacteria 1865
449 Ga0114129_11432520 3300009147 Bacteria 851
450 Ga0105243_10030539 3300009148 Bacteria 4149
451 Ga0105243_10048219 3300009148 Bacteria 3357
452 Ga0105243_10101489 3300009148 Bacteria 2389
453 Ga0105243_10828018 3300009148 Bacteria 915
454 Ga0105243_10848620 3300009148 Bacteria 904
455 Ga0105241_10015648 3300009174 Bacteria 5559
456 Ga0105241_10208498 3300009174 Bacteria 1636
457 Ga0105241_10291292 3300009174 Bacteria 1398
458 Ga0105241_10656728 3300009174 Bacteria 953
459 Ga0105241_10946204 3300009174 Bacteria 803
460 Ga0105242_10001717 3300009176 Bacteria 17291
461 Ga0105248_10019390 3300009177 Bacteria 7526
462 Ga0105248_10038448 3300009177 Bacteria 5355
463 Ga0105248_10243768 3300009177 Bacteria 2023
464 Ga0105248_10511498 3300009177 Bacteria 1354
465 Ga0105237_10014046 3300009545 Bacteria 8378
466 Ga0105237_10025834 3300009545 Bacteria 6005
467 Ga0105237_10244674 3300009545 Bacteria 1795
468 Ga0105237_10498577 3300009545 Bacteria 1224
469 Ga0105238_10032820 3300009551 Bacteria 5284
470 Ga0105238_10405314 3300009551 Bacteria 1357
471 Ga0105249_10008900 3300009553 Bacteria 8770
472 Ga0105249_10066562 3300009553 Bacteria 3317
473 Ga0105249_10087701 3300009553 Bacteria 2904
474 Ga0105249_10139820 3300009553 Bacteria 2320
475 Ga0105249_10332018 3300009553 Bacteria 1535
476 Ga0099796_10009623 3300010159 Bacteria 2622
477 Ga0099796_10018289 3300010159 Bacteria 2102
478 Ga0099796_10020963 3300010159 Bacteria 2005
479 Ga0105239_10016103 3300010375 Bacteria 8272
480 Ga0105239_10019746 3300010375 Bacteria 7438
481 Ga0105239_10090961 3300010375 Bacteria 3367
482 Ga0105239_10165467 3300010375 Bacteria 2473
483 Ga0105239_10328510 3300010375 Bacteria 1725
484 Ga0105239_10373912 3300010375 Bacteria 1611
485 Ga0105239_10624879 3300010375 Bacteria 1229
486 Ga0105246_10002104 3300011119 Bacteria 12007
487 Ga0105246_10008553 3300011119 Bacteria 6294
488 Ga0157345_1014588 3300012498 Bacteria 735
489 Ga0157342_1016735 3300012507 Bacteria 814
490 Ga0157327_1030411 3300012512 Bacteria 671
491 Ga0157373_10053065 3300013100 Bacteria 2883
492 Ga0157373_10061521 3300013100 Bacteria 2659
493 Ga0157373_10368676 3300013100 Bacteria 1026
494 Ga0157371_10079259 3300013102 Bacteria 2326
495 Ga0157370_10848726 3300013104 Bacteria 830
496 Ga0157369_10396889 3300013105 Bacteria 1431
497 Ga0157369_10424714 3300013105 Bacteria 1378
498 Ga0157369_10756862 3300013105 Bacteria 999
499 Ga0157374_10004779 3300013296 Bacteria 11364
500 Ga0157374_10011075 3300013296 Bacteria 7791
501 Ga0157374_10119152 3300013296 Bacteria 2546
502 Ga0157374_10311538 3300013296 Bacteria 1558
503 Ga0157378_10011935 3300013297 Bacteria 7607
504 Ga0157378_10086568 3300013297 Bacteria 2841
505 Ga0157378_10096516 3300013297 Bacteria 2694
506 Ga0157378_10904180 3300013297 Bacteria 914
507 Ga0157378_11145382 3300013297 Bacteria 816
508 Ga0163162_10003752 3300013306 Bacteria 14560
509 Ga0163162_10008015 3300013306 Bacteria 10305
510 Ga0163162_10060159 3300013306 Bacteria 3832
511 Ga0163162_10090585 3300013306 Bacteria 3140
512 Ga0157372_10017355 3300013307 Bacteria 7728
513 Ga0157372_10376230 3300013307 Bacteria 1655
514 Ga0157372_10423846 3300013307 Bacteria 1551
515 Ga0157375_10003729 3300013308 Bacteria 13225
516 Ga0157375_10079872 3300013308 Bacteria 3307
517 Ga0157375_10249688 3300013308 Bacteria 1935
518 Ga0157375_10329988 3300013308 Bacteria 1690
519 Ga0157375_11442454 3300013308 Bacteria 811
520 Ga0163163_10003522 3300014325 Bacteria 13290
521 Ga0163163_10021377 3300014325 Bacteria 6105
522 Ga0163163_10052911 3300014325 Bacteria 4007
523 Ga0163163_10580372 3300014325 Bacteria 1184
524 Ga0163163_10857482 3300014325 Bacteria 972
525 Ga0157380_10024823 3300014326 Bacteria 4541
526 Ga0157380_10193483 3300014326 Bacteria 1798
527 Ga0157380_10320795 3300014326 Bacteria 1436
528 Ga0182008_10202850 3300014497 Bacteria 1009
529 Ga0157377_10002285 3300014745 Bacteria 8425
530 Ga0157377_10024192 3300014745 Bacteria 3227
531 Ga0157379_10002636 3300014968 Bacteria 15090
532 Ga0157379_10034526 3300014968 Bacteria 4509
533 Ga0157379_10112379 3300014968 Bacteria 2448
534 Ga0157379_10219728 3300014968 Bacteria 1722
535 Ga0157376_10226459 3300014969 Bacteria 1734
536 Ga0163161_10004025 3300017792 Bacteria 10289
537 Ga0163161_10398171 3300017792 Bacteria 1104
538 Ga0197907_10971222 3300020069 Bacteria 769
539 Ga0213873_10004137 3300021358 Bacteria 2681
540 Ga0213872_10025568 3300021361 Bacteria 2714
541 Ga0213876_10068738 3300021384 Bacteria 1871
542 Ga0213876_10165676 3300021384 Bacteria 1176
543 Ga0213876_10346435 3300021384 Bacteria 790
544 Ga0228598_1048166 3300024227 Bacteria 844
545 Ga0209677_101488 3300025253 Bacteria 10078
546 Ga0209233_1002178 3300025261 Bacteria 7342
547 Ga0209233_1003140 3300025261 Bacteria 5864
548 Ga0207666_1000087 3300025271 Bacteria 14899
549 Ga0207666_1004274 3300025271 Bacteria 1785
550 Ga0209673_1001371 3300025273 Bacteria 23980
551 Ga0207673_1000179 3300025290 Bacteria 6303
552 Ga0209564_1000407 3300025295 Bacteria 76572
553 Ga0209758_1008834 3300025297 Bacteria 6413
554 Ga0209050_1006511 3300025298 Bacteria 6884
555 Ga0209051_1000514 3300025303 Bacteria 48877
556 Ga0209051_1022514 3300025303 Bacteria 2650
557 Ga0209257_1004454 3300025304 Bacteria 10845
558 Ga0207697_10003225 3300025315 Bacteria 8110
559 Ga0207697_10045823 3300025315 Bacteria 1800
560 Ga0207697_10108670 3300025315 Bacteria 1187
561 Ga0207713_1072341 3300025735 Bacteria 1269
562 Ga0207653_10034830 3300025885 Bacteria 1636
563 Ga0207682_10000273 3300025893 Bacteria 23388
564 Ga0207682_10029653 3300025893 Bacteria 2188
565 Ga0207692_10001475 3300025898 Bacteria 8812
566 Ga0207692_10044727 3300025898 Bacteria 2211
567 Ga0207692_10053756 3300025898 Bacteria 2053
568 Ga0207692_10087783 3300025898 Bacteria 1679
569 Ga0207692_10101946 3300025898 Bacteria 1577
570 Ga0207692_10248063 3300025898 Bacteria 1066
571 Ga0207642_10001345 3300025899 Bacteria 7610
572 Ga0207642_10035407 3300025899 Bacteria 2132
573 Ga0207642_10122853 3300025899 Bacteria 1342
574 Ga0207710_10003607 3300025900 Bacteria 6863
575 Ga0207710_10008979 3300025900 Bacteria 4207
576 Ga0207710_10016322 3300025900 Bacteria 3141
577 Ga0207710_10167668 3300025900 Bacteria 1072
578 Ga0207688_10000592 3300025901 Bacteria 17800
579 Ga0207688_10002649 3300025901 Bacteria 9690
580 Ga0207680_10044919 3300025903 Bacteria 2602
581 Ga0207647_10011438 3300025904 Bacteria 6223
582 Ga0207647_10013306 3300025904 Bacteria 5709
583 Ga0207647_10024546 3300025904 Bacteria 3975
584 Ga0207647_10088524 3300025904 Bacteria 1849
585 Ga0207685_10088892 3300025905 Bacteria 1296
586 Ga0207685_10187640 3300025905 Bacteria 963
587 Ga0207699_10001879 3300025906 Bacteria 9892
588 Ga0207699_10005955 3300025906 Bacteria 5869
589 Ga0207699_10023796 3300025906 Bacteria 3338
590 Ga0207699_10067880 3300025906 Bacteria 2169
591 Ga0207645_10001448 3300025907 Bacteria 19416
592 Ga0207645_10030729 3300025907 Bacteria 3461
593 Ga0207645_10064038 3300025907 Bacteria 2349
594 Ga0207643_10000004 3300025908 Bacteria 187006
595 Ga0207643_10014282 3300025908 Bacteria 4312
596 Ga0207705_10046307 3300025909 Bacteria 3125
597 Ga0207705_10064768 3300025909 Bacteria 2641
598 Ga0207705_10072702 3300025909 Bacteria 2495
599 Ga0207684_10142999 3300025910 Bacteria 2057
600 Ga0207654_10006279 3300025911 Bacteria 5975
601 Ga0207654_10463711 3300025911 Bacteria 890
602 Ga0207707_10002688 3300025912 Bacteria 15889
603 Ga0207707_10068246 3300025912 Bacteria 3098
604 Ga0207707_10075776 3300025912 Bacteria 2936
605 Ga0207707_10259783 3300025912 Bacteria 1507
606 Ga0207695_10346255 3300025913 Bacteria 1374
607 Ga0207671_10027924 3300025914 Bacteria 4218
608 Ga0207693_10000479 3300025915 Bacteria 36362
609 Ga0207693_10001676 3300025915 Bacteria 19527
610 Ga0207693_10012453 3300025915 Bacteria 6873
611 Ga0207693_10020232 3300025915 Bacteria 5294
612 Ga0207693_10084524 3300025915 Bacteria 2487
613 Ga0207693_10104257 3300025915 Bacteria 2224
614 Ga0207693_10118977 3300025915 Bacteria 2074
615 Ga0207693_10126753 3300025915 Bacteria 2007
616 Ga0207693_10335606 3300025915 Bacteria 1183
617 Ga0207693_10372224 3300025915 Bacteria 1117
618 Ga0207663_10023702 3300025916 Bacteria 3526
619 Ga0207663_10026800 3300025916 Bacteria 3350
620 Ga0207663_10035589 3300025916 Bacteria 2988
621 Ga0207663_10044563 3300025916 Bacteria 2724
622 Ga0207663_10051544 3300025916 Bacteria 2563
623 Ga0207663_10098729 3300025916 Bacteria 1956
624 Ga0207663_10113341 3300025916 Bacteria 1844
625 Ga0207663_10222204 3300025916 Bacteria 1375
626 Ga0207663_10246205 3300025916 Bacteria 1313
627 Ga0207660_10015658 3300025917 Bacteria 5008
628 Ga0207660_10048508 3300025917 Bacteria 3005
629 Ga0207662_10003398 3300025918 Bacteria 8185
630 Ga0207662_10011799 3300025918 Bacteria 4856
631 Ga0207662_10029128 3300025918 Bacteria 3197
632 Ga0207657_10005995 3300025919 Bacteria 12650
633 Ga0207657_10013202 3300025919 Bacteria 8110
634 Ga0207657_10024125 3300025919 Bacteria 5646
635 Ga0207657_10029516 3300025919 Bacteria 4990
636 Ga0207657_10056462 3300025919 Bacteria 3388
637 Ga0207657_10058483 3300025919 Bacteria 3317
638 Ga0207657_10510325 3300025919 Bacteria 941
639 Ga0207649_10001391 3300025920 Bacteria 14322
640 Ga0207649_10237268 3300025920 Bacteria 1307
641 Ga0207652_10009080 3300025921 Bacteria 8007
642 Ga0207652_10049350 3300025921 Bacteria 3603
643 Ga0207652_10404956 3300025921 Bacteria 1231
644 Ga0207652_10701296 3300025921 Bacteria 903
645 Ga0207646_10106854 3300025922 Bacteria 2510
646 Ga0207646_10238818 3300025922 Bacteria 1642
647 Ga0207646_10257142 3300025922 Bacteria 1578
648 Ga0207681_10001757 3300025923 Bacteria 13921
649 Ga0207681_10019681 3300025923 Bacteria 4269
650 Ga0207694_10034514 3300025924 Bacteria 3879
651 Ga0207694_10178012 3300025924 Bacteria 1723
652 Ga0207650_10017302 3300025925 Bacteria 5045
653 Ga0207650_10629673 3300025925 Bacteria 903
654 Ga0207659_10001162 3300025926 Bacteria 15693
655 Ga0207659_10067725 3300025926 Bacteria 2594
656 Ga0207659_10075499 3300025926 Bacteria 2474
657 Ga0207687_10002670 3300025927 Bacteria 12070
658 Ga0207687_10054764 3300025927 Bacteria 2792
659 Ga0207687_10134399 3300025927 Bacteria 1869
660 Ga0207687_10323042 3300025927 Bacteria 1250
661 Ga0207687_10696223 3300025927 Bacteria 862
662 Ga0207700_10020579 3300025928 Bacteria 4485
663 Ga0207700_10038620 3300025928 Bacteria 3467
664 Ga0207700_10060200 3300025928 Bacteria 2875
665 Ga0207700_10062436 3300025928 Bacteria 2830
666 Ga0207700_10069015 3300025928 Bacteria 2711
667 Ga0207700_10069774 3300025928 Bacteria 2699
668 Ga0207700_10083703 3300025928 Bacteria 2498
669 Ga0207700_10112967 3300025928 Bacteria 2189
670 Ga0207700_10160213 3300025928 Bacteria 1868
671 Ga0207700_10211376 3300025928 Bacteria 1640
672 Ga0207700_10229015 3300025928 Bacteria 1579
673 Ga0207700_10279480 3300025928 Bacteria 1436
674 Ga0207700_10344662 3300025928 Bacteria 1296
675 Ga0207700_10638400 3300025928 Bacteria 949
676 Ga0207664_10026047 3300025929 Bacteria 4415
677 Ga0207664_10057674 3300025929 Bacteria 3087
678 Ga0207664_10166759 3300025929 Bacteria 1882
679 Ga0207664_10180715 3300025929 Bacteria 1811
680 Ga0207664_10278766 3300025929 Bacteria 1466
681 Ga0207664_10494438 3300025929 Bacteria 1095
682 Ga0207664_10525780 3300025929 Bacteria 1060
683 Ga0207664_10900403 3300025929 Bacteria 794
684 Ga0207644_10001464 3300025931 Bacteria 15216
685 Ga0207644_10032486 3300025931 Bacteria 3641
686 Ga0207644_10073434 3300025931 Bacteria 2508
687 Ga0207644_10136731 3300025931 Bacteria 1882
688 Ga0207644_10491064 3300025931 Bacteria 1012
689 Ga0207644_10594932 3300025931 Bacteria 918
690 Ga0207690_10002815 3300025932 Bacteria 10492
691 Ga0207690_10040550 3300025932 Bacteria 3045
692 Ga0207690_10131310 3300025932 Bacteria 1833
693 Ga0207690_10289541 3300025932 Bacteria 1278
694 Ga0207706_10014073 3300025933 Bacteria 7254
695 Ga0207706_10022294 3300025933 Bacteria 5682
696 Ga0207706_10076380 3300025933 Bacteria 2946
697 Ga0207706_10243869 3300025933 Bacteria 1571
698 Ga0207706_10360978 3300025933 Bacteria 1262
699 Ga0207686_10141368 3300025934 Bacteria 1664
700 Ga0207686_10265076 3300025934 Bacteria 1261
701 Ga0207686_10282828 3300025934 Bacteria 1225
702 Ga0207709_10001557 3300025935 Bacteria 15725
703 Ga0207709_10777548 3300025935 Bacteria 771
704 Ga0207670_10001424 3300025936 Bacteria 12572
705 Ga0207670_10022105 3300025936 Bacteria 3937
706 Ga0207670_10051208 3300025936 Bacteria 2771
707 Ga0207670_10197476 3300025936 Bacteria 1526
708 Ga0207669_10000387 3300025937 Bacteria 19469
709 Ga0207669_10749858 3300025937 Bacteria 806
710 Ga0207704_10018529 3300025938 Bacteria 3636
711 Ga0207704_10607486 3300025938 Bacteria 896
712 Ga0207665_10000090 3300025939 Bacteria 58962
713 Ga0207665_10000825 3300025939 Bacteria 20977
714 Ga0207665_10012482 3300025939 Bacteria 5579
715 Ga0207665_10038595 3300025939 Bacteria 3181
716 Ga0207665_10101486 3300025939 Bacteria 2009
717 Ga0207665_10408344 3300025939 Bacteria 1035
718 Ga0207665_10529207 3300025939 Bacteria 914
719 Ga0207665_10621648 3300025939 Bacteria 845
720 Ga0207691_10007721 3300025940 Bacteria 10353
721 Ga0207691_10012587 3300025940 Bacteria 8110
722 Ga0207691_10056324 3300025940 Bacteria 3581
723 Ga0207711_10019155 3300025941 Bacteria 5697
724 Ga0207711_10052255 3300025941 Bacteria 3501
725 Ga0207711_10055001 3300025941 Bacteria 3417
726 Ga0207711_10671957 3300025941 Bacteria 966
727 Ga0207711_10738000 3300025941 Bacteria 918
728 Ga0207689_10004579 3300025942 Bacteria 12521
729 Ga0207689_10016941 3300025942 Bacteria 6165
730 Ga0207689_10024716 3300025942 Bacteria 5036
731 Ga0207689_10346394 3300025942 Bacteria 1235
732 Ga0207661_10001752 3300025944 Bacteria 14844
733 Ga0207661_10089258 3300025944 Bacteria 2564
734 Ga0207679_10004356 3300025945 Bacteria 8810
735 Ga0207679_10022703 3300025945 Bacteria 4277
736 Ga0207679_10431133 3300025945 Bacteria 1165
737 Ga0207667_10003251 3300025949 Bacteria 20047
738 Ga0207667_10114797 3300025949 Bacteria 2775
739 Ga0207667_10229892 3300025949 Bacteria 1899
740 Ga0207651_10001884 3300025960 Bacteria 9826
741 Ga0207651_10006087 3300025960 Bacteria 6271
742 Ga0207651_10031144 3300025960 Bacteria 3406
743 Ga0207651_10078007 3300025960 Bacteria 2374
744 Ga0207712_10003703 3300025961 Bacteria 9645
745 Ga0207712_10020315 3300025961 Bacteria 4349
746 Ga0207712_10039020 3300025961 Bacteria 3251
747 Ga0207668_10001379 3300025972 Bacteria 14325
748 Ga0207668_10030310 3300025972 Bacteria 3554
749 Ga0207668_10165352 3300025972 Bacteria 1729
750 Ga0207668_10262192 3300025972 Bacteria 1409
751 Ga0207640_10022416 3300025981 Bacteria 3779
752 Ga0207640_10134383 3300025981 Bacteria 1793
753 Ga0207658_10001904 3300025986 Bacteria 15618
754 Ga0207658_10112112 3300025986 Bacteria 2158
755 Ga0207658_10316698 3300025986 Bacteria 1349
756 Ga0207658_10643180 3300025986 Bacteria 955
757 Ga0207677_10038814 3300026023 Bacteria 3125
758 Ga0207677_10118439 3300026023 Bacteria 1987
759 Ga0207703_10003566 3300026035 Bacteria 13012
760 Ga0207703_10008538 3300026035 Bacteria 8090
761 Ga0207703_10106978 3300026035 Bacteria 2380
762 Ga0207703_10454772 3300026035 Bacteria 1196
763 Ga0207639_10010870 3300026041 Bacteria 6313
764 Ga0207639_10280400 3300026041 Bacteria 1465
765 Ga0207678_10002771 3300026067 Bacteria 15870
766 Ga0207678_10008406 3300026067 Bacteria 9105
767 Ga0207678_10014382 3300026067 Bacteria 6960
768 Ga0207678_10016231 3300026067 Bacteria 6535
769 Ga0207678_10224972 3300026067 Bacteria 1606
770 Ga0207678_11023452 3300026067 Bacteria 731
771 Ga0207708_10007402 3300026075 Bacteria 8110
772 Ga0207708_10007450 3300026075 Bacteria 8089
773 Ga0207708_10022198 3300026075 Bacteria 4793
774 Ga0207708_10264805 3300026075 Bacteria 1388
775 Ga0207641_10018697 3300026088 Bacteria 5681
776 Ga0207641_10029548 3300026088 Bacteria 4534
777 Ga0207641_10089232 3300026088 Bacteria 2694
778 Ga0207641_10119794 3300026088 Bacteria 2346
779 Ga0207648_10000341 3300026089 Bacteria 51269
780 Ga0207648_10014733 3300026089 Bacteria 7214
781 Ga0207648_10416789 3300026089 Bacteria 1219
782 Ga0207676_10006137 3300026095 Bacteria 8483
783 Ga0207676_10076893 3300026095 Bacteria 2698
784 Ga0207676_10105807 3300026095 Bacteria 2343
785 Ga0207676_10284173 3300026095 Bacteria 1503
786 Ga0207676_11073332 3300026095 Bacteria 795
787 Ga0207674_10031788 3300026116 Bacteria 5541
788 Ga0207674_10113997 3300026116 Bacteria 2676
789 Ga0207674_10239076 3300026116 Bacteria 1763
790 Ga0207674_10933124 3300026116 Bacteria 836
791 Ga0207675_100003264 3300026118 Bacteria 15884
792 Ga0207675_100011958 3300026118 Bacteria 8110
793 Ga0207675_100729524 3300026118 Bacteria 1001
794 Ga0207683_10000006 3300026121 Bacteria 181260
795 Ga0207683_10004853 3300026121 Bacteria 11578
796 Ga0207683_10042834 3300026121 Bacteria 3953
797 Ga0207683_10556933 3300026121 Bacteria 1060
798 Ga0207698_10003552 3300026142 Bacteria 9401
799 Ga0207698_10040761 3300026142 Bacteria 3454
800 Ga0207698_10161871 3300026142 Bacteria 1958
801 Ga0209999_1006234 3300027543 Bacteria 2142
802 Ga0210002_1010255 3300027617 Bacteria 1437
803 Ga0209588_1014517 3300027671 Bacteria 2413
804 Ga0209966_1001875 3300027695 Bacteria 3551
805 Ga0209998_10000636 3300027717 Bacteria 9421
806 Ga0209998_10003002 3300027717 Bacteria 3754
807 Ga0209974_10007699 3300027876 Bacteria 3705
808 Ga0209974_10021405 3300027876 Bacteria 2141
809 Ga0207428_10000137 3300027907 Bacteria 98535
810 Ga0207428_10000165 3300027907 Bacteria 91701
811 Ga0207428_10001264 3300027907 Bacteria 27085
812 Ga0207428_10013626 3300027907 Bacteria 7092
813 Ga0268266_10006808 3300028379 Bacteria 10410
814 Ga0268266_10151957 3300028379 Bacteria 2087
815 Ga0268266_10154531 3300028379 Bacteria 2071
816 Ga0268266_10494898 3300028379 Bacteria 1167
817 Ga0268266_10851973 3300028379 Bacteria 881
818 Ga0268265_10047087 3300028380 Bacteria 3228
819 Ga0268265_10101808 3300028380 Bacteria 2321
820 Ga0268265_10547191 3300028380 Bacteria 1098
821 Ga0268264_10000168 3300028381 Bacteria 146056
822 Ga0268264_10008581 3300028381 Bacteria 8490
823 Ga0268264_10032577 3300028381 Bacteria 4276
824 Ga0268264_10279034 3300028381 Bacteria 1564
825 Ga0268264_11078859 3300028381 Bacteria 811
826 Ga0265337_1002275 3300028556 Bacteria 8932
827 Ga0265326_10094387 3300028558 Bacteria 848
828 Ga0265334_10014411 3300028573 Bacteria 3296
829 Ga0265318_10027029 3300028577 Bacteria 2257
830 Ga0265338_10032762 3300028800 Bacteria 5057
831 Ga0265338_10095950 3300028800 Bacteria 2434
832 Ga0307511_10265202 3300030521 Bacteria 809
833 Ga0265773_1014087 3300031018 Bacteria 721
834 Ga0265760_10010372 3300031090 Bacteria 2661
835 Ga0265760_10141176 3300031090 Bacteria 784
836 Ga0265330_10008884 3300031235 Bacteria 4803
837 Ga0265330_10014492 3300031235 Bacteria 3659
838 Ga0265330_10037001 3300031235 Bacteria 2173
839 Ga0265330_10168996 3300031235 Bacteria 927
840 Ga0265332_10042205 3300031238 Bacteria 1972
841 Ga0265332_10063512 3300031238 Bacteria 1578
842 Ga0265332_10223385 3300031238 Bacteria 781
843 Ga0265328_10000026 3300031239 Bacteria 115733
844 Ga0265328_10000762 3300031239 Bacteria 14870
845 Ga0265328_10006008 3300031239 Bacteria 5169
846 Ga0265328_10062682 3300031239 Bacteria 1365
847 Ga0265328_10069003 3300031239 Bacteria 1299
848 Ga0265328_10148797 3300031239 Bacteria 880
849 Ga0265320_10009042 3300031240 Bacteria 6040
850 Ga0265325_10000264 3300031241 Bacteria 37210
851 Ga0265325_10005989 3300031241 Bacteria 7440
852 Ga0265325_10008379 3300031241 Bacteria 6102
853 Ga0265325_10009459 3300031241 Bacteria 5687
854 Ga0265325_10050439 3300031241 Bacteria 2143
855 Ga0265325_10064917 3300031241 Bacteria 1845
856 Ga0265325_10068881 3300031241 Bacteria 1780
857 Ga0265325_10116000 3300031241 Bacteria 1296
858 Ga0265325_10263813 3300031241 Bacteria 776
859 Ga0265329_10047355 3300031242 Bacteria 1372
860 Ga0265329_10065707 3300031242 Bacteria 1148
861 Ga0265340_10005231 3300031247 Bacteria 7203
862 Ga0265340_10007623 3300031247 Bacteria 5871
863 Ga0265340_10007960 3300031247 Bacteria 5746
864 Ga0265340_10009168 3300031247 Bacteria 5320
865 Ga0265340_10017208 3300031247 Bacteria 3739
866 Ga0265340_10052025 3300031247 Bacteria 1982
867 Ga0265340_10206947 3300031247 Bacteria 881
868 Ga0265339_10000129 3300031249 Bacteria 62831
869 Ga0265339_10001725 3300031249 Bacteria 16104
870 Ga0265339_10003778 3300031249 Bacteria 10553
871 Ga0265339_10036438 3300031249 Bacteria 2753
872 Ga0265339_10188528 3300031249 Bacteria 1024
873 Ga0265339_10300694 3300031249 Bacteria 765
874 Ga0265331_10003606 3300031250 Bacteria 9913
875 Ga0265331_10004918 3300031250 Bacteria 8216
876 Ga0265331_10037945 3300031250 Bacteria 2357
877 Ga0265331_10124524 3300031250 Bacteria 1178
878 Ga0265331_10228801 3300031250 Bacteria 835
879 Ga0265331_10284816 3300031250 Bacteria 740
880 Ga0265327_10137281 3300031251 Bacteria 1145
881 Ga0265327_10177658 3300031251 Bacteria 975
882 Ga0265316_10001236 3300031344 Bacteria 27470
883 Ga0265316_10057703 3300031344 Bacteria 3026
884 Ga0265316_10154832 3300031344 Bacteria 1715
885 Ga0265316_10174619 3300031344 Bacteria 1602
886 Ga0265316_10240078 3300031344 Bacteria 1332
887 Ga0265316_10448102 3300031344 Bacteria 926
888 Ga0307509_10072515 3300031507 Bacteria 3587
889 Ga0265313_10000326 3300031595 Bacteria 51836
890 Ga0265313_10003048 3300031595 Bacteria 13902
891 Ga0265313_10003163 3300031595 Bacteria 13593
892 Ga0265313_10005864 3300031595 Bacteria 8910
893 Ga0265313_10029125 3300031595 Bacteria 2860
894 Ga0265313_10051022 3300031595 Bacteria 1982
895 Ga0265313_10088633 3300031595 Bacteria 1393
896 Ga0265314_10003957 3300031711 Bacteria 14046
897 Ga0265314_10036676 3300031711 Bacteria 3559
898 Ga0265314_10089763 3300031711 Bacteria 2004
899 Ga0265314_10096515 3300031711 Bacteria 1912
900 Ga0265342_10001944 3300031712 Bacteria 18500
901 Ga0265342_10012254 3300031712 Bacteria 5814
902 Ga0265342_10062661 3300031712 Bacteria 2188
903 Ga0265342_10126271 3300031712 Bacteria 1436
904 Ga0265342_10228359 3300031712 Bacteria 1000
905 Ga0316576_10221258 3300031727 Bacteria 1424
906 Ga0316578_10005935 3300031728 Bacteria 5978
907 Ga0307516_10399795 3300031730 Bacteria 1033
908 Ga0307413_10128995 3300031824 Bacteria 1727
909 Ga0307411_10177040 3300032005 Bacteria 1615
910 Ga0316583_10000620 3300032133 Bacteria 10846
911 Ga0307507_10008502 3300033179 Bacteria 14157
912 Ga0307510_10060324 3300033180 Bacteria 3905
913 Ga0316215_1001248 3300033544 Bacteria 2468
914 Ga0373930_0000274 3300034816 Bacteria 6574
915 Ga0373930_0009769 3300034816 Bacteria 1704
916 Ga0373948_0002495 3300034817 Bacteria 2730
917 Ga0373948_0002867 3300034817 Bacteria 2592
918 Ga0373950_0000597 3300034818 Bacteria 4455
919 Ga0373958_0001449 3300034819 Bacteria 3193
920 Ga0373959_0000724 3300034820 Bacteria 5633
921 Ga0373959_0013033 3300034820 Bacteria 1494
922 Ga0373959_0023177 3300034820 Bacteria 1205
923 Ga0373938_0001449 3300034957 Bacteria 3801
924 Ga0373938_0001970 3300034957 Bacteria 3291
925 Ga0373926_0071837 3300035083 Bacteria 1272
926 Ga0373926_0101291 3300035083 Bacteria 1077
927 Ga0373926_0123651 3300035083 Bacteria 976
928 Ga0373928_0003226 3300035084 Bacteria 3123
929 Ga0373928_0021017 3300035084 Bacteria 1373
930 Ga0373928_0049353 3300035084 Bacteria 989
931 Ga0373929_0000219 3300035085 Bacteria 10416
932 Ga0373929_0034028 3300035085 Bacteria 1103
933 Ga0373934_0023087 3300035086 Bacteria 2403
934 Ga0373934_0044982 3300035086 Bacteria 1745
935 Ga0373934_0047626 3300035086 Bacteria 1696
936 Ga0373934_0099610 3300035086 Bacteria 1175
937 Ga0373934_0173491 3300035086 Bacteria 885
938 Ga0373934_0193290 3300035086 Bacteria 837
939 Ga0373940_0002065 3300035088 Bacteria 3815
940 Ga0373940_0003791 3300035088 Bacteria 3127
941 Ga0373940_0088585 3300035088 Bacteria 924
942 Ga0373944_0001665 3300035089 Bacteria 5616
943 Ga0373944_0014971 3300035089 Bacteria 2171
944 Ga0373949_0000893 3300035090 Bacteria 9362
945 Ga0373949_0004025 3300035090 Bacteria 3408
946 Ga0373949_0049344 3300035090 Bacteria 1056
947 Ga0373951_0001402 3300035091 Bacteria 6340
948 Ga0373951_0001889 3300035091 Bacteria 5393
949 Ga0373951_0017013 3300035091 Bacteria 1643
950 Ga0373952_0001251 3300035092 Bacteria 4631
951 Ga0373952_0003348 3300035092 Bacteria 2891
952 Ga0373952_0088465 3300035092 Bacteria 801
953 Ga0373923_0006210 3300035111 Bacteria 4112
954 Ga0373923_0021910 3300035111 Bacteria 2499
955 Ga0373923_0022139 3300035111 Bacteria 2489
956 Ga0373923_0028113 3300035111 Bacteria 2248
957 Ga0373923_0143136 3300035111 Bacteria 1082
958 Ga0373923_0207115 3300035111 Bacteria 908
959 Ga0373932_0000298 3300035112 Bacteria 14986
960 Ga0373932_0001785 3300035112 Bacteria 5795
961 Ga0373932_0005293 3300035112 Bacteria 3036
962 Ga0373932_0060844 3300035112 Bacteria 1147
963 Ga0373932_0077826 3300035112 Bacteria 1042
964 Ga0373936_0001726 3300035113 Bacteria 8030
965 Ga0373936_0007554 3300035113 Bacteria 4088
966 Ga0373936_0016863 3300035113 Bacteria 2810
967 Ga0373936_0119661 3300035113 Bacteria 1124
968 Ga0373939_0000364 3300035114 Bacteria 11474
969 Ga0373939_0000408 3300035114 Bacteria 10836
970 Ga0373939_0003904 3300035114 Bacteria 3508
971 Ga0373939_0005387 3300035114 Bacteria 3047
972 Ga0373941_0001495 3300035115 Bacteria 4949
973 Ga0373941_0003811 3300035115 Bacteria 3450
974 Ga0373941_0137201 3300035115 Bacteria 886
975 Ga0373945_0001734 3300035116 Bacteria 6731
976 Ga0373945_0006908 3300035116 Bacteria 3669
977 Ga0373945_0007495 3300035116 Bacteria 3537
978 Ga0373945_0010561 3300035116 Bacteria 3043
979 Ga0373945_0012553 3300035116 Bacteria 2815
980 Ga0373953_0003031 3300035117 Bacteria 5149
981 Ga0373953_0003236 3300035117 Bacteria 5044
982 Ga0373953_0009247 3300035117 Bacteria 3382
983 Ga0373953_0010085 3300035117 Bacteria 3275
984 Ga0373954_0002842 3300035118 Bacteria 7294
985 Ga0373954_0006494 3300035118 Bacteria 5099
986 Ga0373954_0031465 3300035118 Bacteria 2450
987 Ga0373954_0053922 3300035118 Bacteria 1891
988 Ga0373954_0056664 3300035118 Bacteria 1845
989 Ga0373954_0059853 3300035118 Bacteria 1795
990 Ga0373954_0073614 3300035118 Bacteria 1626
991 Ga0373956_0063755 3300035119 Bacteria 1672
992 Ga0373956_0196877 3300035119 Bacteria 955
993 Ga0373956_0201483 3300035119 Bacteria 943
994 Ga0373956_0255092 3300035119 Bacteria 834
995 Ga0373956_0428629 3300035119 Bacteria 631
996 Ga0373957_0000801 3300035120 Bacteria 8169
997 Ga0373957_0007180 3300035120 Bacteria 3553
998 Ga0373957_0007235 3300035120 Bacteria 3545
999 Ga0373957_0035281 3300035120 Bacteria 1857
1000 Ga0373957_0053988 3300035120 Bacteria 1542
1001 Ga0373957_0077474 3300035120 Bacteria 1308
1002 Ga0373960_0001433 3300035121 Bacteria 5281
1003 Ga0373943_0000022 3300035170 Bacteria 52033
1004 Ga0373943_0006093 3300035170 Bacteria 5419
1005 Ga0373943_0024284 3300035170 Bacteria 2825
1006 Ga0373943_0051269 3300035170 Bacteria 2031
1007 Ga0373943_0076183 3300035170 Bacteria 1710
1008 Ga0373943_0082349 3300035170 Bacteria 1652
1009 Ga0373943_0108079 3300035170 Bacteria 1463
1010 Ga0373943_0201871 3300035170 Bacteria 1101
1011 Ga0373943_0578089 3300035170 Bacteria 660
1012 Ga0373946_0002276 3300035171 Bacteria 6784
1013 Ga0373946_0005535 3300035171 Bacteria 4557
1014 Ga0373946_0006570 3300035171 Bacteria 4220
1015 Ga0373946_0007005 3300035171 Bacteria 4109
1016 Ga0373946_0007518 3300035171 Bacteria 3985
1017 Ga0373946_0024726 3300035171 Bacteria 2356
1018 Ga0373946_0158999 3300035171 Bacteria 1059
1019 Ga0373955_0000030 3300035172 Bacteria 56889
1020 Ga0373955_0001406 3300035172 Bacteria 10244
1021 Ga0373955_0004218 3300035172 Bacteria 6343
1022 Ga0373955_0008682 3300035172 Bacteria 4729
1023 Ga0373955_0061721 3300035172 Bacteria 2071
1024 Ga0373955_0063838 3300035172 Bacteria 2039
1025 Ga0373942_0000195 3300035207 Bacteria 15534
1026 Ga0373961_0001194 3300035241 Bacteria 7998
1027 Ga0373961_0010857 3300035241 Bacteria 2252
1028 Ga0373961_0015429 3300035241 Bacteria 1953
1029 Ga0373961_0082888 3300035241 Bacteria 1012
1030 Ga0373962_0001952 3300035242 Bacteria 4918
1031 Ga0373962_0005521 3300035242 Bacteria 3058
1032 Ga0316574_0000231 3300035398 Bacteria 20103
1033 Ga0373924_0002834 3300035410 Bacteria 5872
1034 Ga0373924_0016575 3300035410 Bacteria 2814
1035 Ga0373924_0029401 3300035410 Bacteria 2196
1036 Ga0373924_0111978 3300035410 Bacteria 1180
1037 Ga0373924_0133092 3300035410 Bacteria 1082
1038 Ga0373924_0207262 3300035410 Bacteria 865
1039 Ga0373924_0327570 3300035410 Bacteria 681
1040 Ga0373931_0004135 3300035691 Bacteria 6587
1041 Ga0373931_0008927 3300035691 Bacteria 4776
1042 Ga0373931_0012234 3300035691 Bacteria 4155
1043 Ga0373931_0047346 3300035691 Bacteria 2276
1044 Ga0373931_0048694 3300035691 Bacteria 2248
1045 Ga0373931_0130799 3300035691 Bacteria 1444
1046 Ga0373931_0157057 3300035691 Bacteria 1330
1047 Ga0373931_0340437 3300035691 Bacteria 936
1048 Ga0373935_0001222 3300035692 Bacteria 14189
1049 Ga0373935_0001936 3300035692 Bacteria 11639
1050 Ga0373935_0005030 3300035692 Bacteria 7784
1051 Ga0373935_0010846 3300035692 Bacteria 5473
1052 Ga0373935_0012177 3300035692 Bacteria 5173
1053 Ga0373935_0039541 3300035692 Bacteria 2957
1054 Ga0373935_0123842 3300035692 Bacteria 1730
1055 Ga0373935_0546722 3300035692 Bacteria 844
1056 Ga0373927_0000699 3300035695 Bacteria 25690
1057 Ga0373927_0002079 3300035695 Bacteria 14787
1058 Ga0373927_0004882 3300035695 Bacteria 9319
1059 Ga0373927_0039907 3300035695 Bacteria 3046
1060 Ga0373927_0053254 3300035695 Bacteria 2617
1061 Ga0373927_0054260 3300035695 Bacteria 2592
1062 Ga0373927_0069530 3300035695 Bacteria 2278
1063 Ga0373927_0071628 3300035695 Bacteria 2243
1064 Ga0373927_0092068 3300035695 Bacteria 1969
1065 Ga0373927_0173570 3300035695 Bacteria 1413
1066 Ga0373927_0184552 3300035695 Bacteria 1368
1067 Ga0373933_0006802 3300035724 Bacteria 6231
1068 Ga0373933_0012332 3300035724 Bacteria 4719
1069 Ga0373933_0012648 3300035724 Bacteria 4665
1070 Ga0373933_0078580 3300035724 Bacteria 2019
1071 Ga0373933_0113895 3300035724 Bacteria 1689
1072 Ga0373933_0348988 3300035724 Bacteria 961
1073 Ga0373947_0000274 3300035725 Bacteria 29259
1074 Ga0373947_0000706 3300035725 Bacteria 19883
1075 Ga0373947_0009808 3300035725 Bacteria 5493
1076 Ga0373947_0018132 3300035725 Bacteria 4050
1077 Ga0373947_0065631 3300035725 Bacteria 2214
1078 Ga0373947_0117026 3300035725 Bacteria 1690
1079 Ga0373947_0233719 3300035725 Bacteria 1211
1080 Ga0373947_0433622 3300035725 Bacteria 889
1081 Ga0373937_0000004 3300036401 Bacteria 212269
1082 Ga0373937_0000886 3300036401 Bacteria 25663
1083 Ga0373937_0001403 3300036401 Bacteria 20101
1084 Ga0373937_0005511 3300036401 Bacteria 10850
1085 Ga0373937_0007052 3300036401 Bacteria 9702
1086 Ga0373937_0011662 3300036401 Bacteria 7711
1087 Ga0373937_0016354 3300036401 Bacteria 6586
1088 Ga0373937_0016644 3300036401 Bacteria 6533
1089 Ga0373937_0100053 3300036401 Bacteria 2690
1090 Ga0373937_0103937 3300036401 Bacteria 2638
1091 Ga0373937_0111031 3300036401 Bacteria 2550
1092 Ga0373937_0150344 3300036401 Bacteria 2181
1093 Ga0373937_0158526 3300036401 Bacteria 2122
1094 Ga0373937_0260878 3300036401 Bacteria 1634
1095 Ga0373937_0446144 3300036401 Bacteria 1228
1096 Ga0373937_0589798 3300036401 Bacteria 1055
1097 Ga0373937_0937170 3300036401 Bacteria 815
1098 Ga0310112_022639 3300036458 Bacteria 877
1099 Ga0372808_026249 3300036459 Bacteria 836
1100 Ga0316584_0025762 3300036712 Bacteria 4316
1101 Ga0373925_0000095 3300037068 Bacteria 95071
1102 Ga0373925_0001836 3300037068 Bacteria 17719
1103 Ga0373925_0002028 3300037068 Bacteria 16732
1104 Ga0373925_0016370 3300037068 Bacteria 5370
1105 Ga0373925_0017542 3300037068 Bacteria 5190
1106 Ga0373925_0020481 3300037068 Bacteria 4815
1107 Ga0373925_0049703 3300037068 Bacteria 3126
1108 Ga0373925_0051259 3300037068 Bacteria 3080
1109 Ga0373925_0088496 3300037068 Bacteria 2365
1110 Ga0373925_0105307 3300037068 Bacteria 2173
1111 Ga0373925_0106236 3300037068 Bacteria 2164
1112 Ga0373925_0277216 3300037068 Bacteria 1350
1113 Ga0373925_0289945 3300037068 Bacteria 1319
1114 Ga0373925_0406365 3300037068 Bacteria 1111
1115 Ga0373925_0505062 3300037068 Bacteria 993
1116 Ga0373925_1228245 3300037068 Bacteria 616
1117 Ga0395899_0011749 3300037312 Bacteria 6701
1118 Ga0395899_0099131 3300037312 Bacteria 2105
1119 Ga0395900_0005502 3300037418 Bacteria 13257
1120 Ga0395900_0023914 3300037418 Bacteria 6253
1121 Ga0395900_0145366 3300037418 Bacteria 2425
1122 Ga0395900_0148645 3300037418 Bacteria 2395
1123 Ga0395898_0031330 3300037466 Bacteria 5315
1124 Ga0395898_0034054 3300037466 Bacteria 5080
1125 Ga0395898_0068553 3300037466 Bacteria 3433
1126 Ga0395905_0035844 3300037471 Bacteria 4659
1127 Ga0316581_0125042 3300037588 Bacteria 793
1128 Ga0436364_0310897 3300037853 Bacteria 2450
1129 Ga0436364_0499308 3300037853 Bacteria 1027
1130 Ga0436364_0978152 3300037853 Bacteria 3855
1131 Ga0436364_1448938 3300037853 Bacteria 2108
1132 Ga0395901_0024268 3300038443 Bacteria 6221
1133 Ga0395901_0411115 3300038443 Bacteria 1389
1134 Ga0436365_0309234 3300039437 Bacteria 1657
1135 Ga0436365_0397873 3300039437 Bacteria 783
1136 Ga0436365_1690162 3300039437 Bacteria 9158
1137 Ga0436365_1787618 3300039437 Bacteria 3358
1138 Ga0436360_0499741 3300039438 Bacteria 2483
1139 Ga0436360_0820351 3300039438 Bacteria 2971
1140 Ga0436361_0835040 3300039447 Bacteria 7890
1141 Ga0436361_1020532 3300039447 Bacteria 3065
1142 Ga0436363_0472706 3300039450 Bacteria 995
1143 Ga0436363_1220467 3300039450 Bacteria 4457
1144 Ga0436363_1600909 3300039450 Bacteria 4318
1145 Ga0436362_0090365 3300039453 Bacteria 922
1146 Ga0451835_0194448 3300041492 Bacteria 4321
1147 Ga0451837_0252974 3300041494 Bacteria 3929
1148 Ga0451837_1245134 3300041494 Bacteria 1997
1149 Ga0451839_1310039 3300041496 Bacteria 2010
1150 Ga0451845_0489020 3300041501 Bacteria 661
1151 Ga0451847_0889404 3300041503 Bacteria 1793
1152 Ga0451851_0804289 3300041507 Bacteria 1131
1153 Ga0451855_1036748 3300041511 Bacteria 1356
1154 Ga0451855_1945056 3300041511 Bacteria 2073
1155 Ga0439441_088330 3300042001 Bacteria 683
1156 Ga0439448_0044960 3300042005 Bacteria 1437
1157 Ga0439455_0021007 3300042012 Bacteria 1553
1158 Ga0439455_0091756 3300042012 Bacteria 833
1159 Ga0439464_0131605 3300042439 Bacteria 775
1160 Ga0466966_0170453 3300044684 Bacteria 1323
1161 Ga0466966_0323073 3300044684 Bacteria 927
1162 Ga0466963_0018763 3300044694 Bacteria 4330
1163 Ga0466963_0063084 3300044694 Bacteria 2480
1164 Ga0466963_0519702 3300044694 Bacteria 840
1165 Ga0466964_0478120 3300044706 Bacteria 665
1166 Ga0453684_0096331 3300044712 Bacteria 3636
1167 Ga0466971_0284067 3300044719 Bacteria 792
1168 Ga0466970_0421994 3300044765 Bacteria 763
1169 Ga0466957_0018409 3300044842 Bacteria 4102
1170 Ga0466957_0028820 3300044842 Bacteria 3308
1171 Ga0466957_0071295 3300044842 Bacteria 2149
1172 Ga0466957_0181159 3300044842 Bacteria 1376
1173 Ga0466957_0244508 3300044842 Bacteria 1191
1174 Ga0466959_0188453 3300045049 Bacteria 1440
1175 Ga0466959_0423736 3300045049 Bacteria 903
1176 Ga0451576_0013475 3300045051 Bacteria 9147
1177 Ga0451576_1214078 3300045051 Bacteria 787
1178 Ga0466958_0020255 3300045836 Bacteria 3878
1179 Ga0466958_0145867 3300045836 Bacteria 1491
1180 Ga0466967_0014998 3300045976 Bacteria 6060
1181 Ga0466967_0205589 3300045976 Bacteria 1866
1182 Ga0466967_0315603 3300045976 Bacteria 1506
1183 Ga0466967_0696315 3300045976 Bacteria 1006
1184 Ga0495592_0000029 3300046454 Bacteria 131879
1185 Ga0495592_0000962 3300046454 Bacteria 19966
1186 Ga0495592_0034589 3300046454 Bacteria 3809
1187 Ga0495592_0077155 3300046454 Bacteria 2416
1188 Ga0495592_0077905 3300046454 Bacteria 2401
1189 Ga0495592_0344920 3300046454 Bacteria 956
1190 Ga0495592_0349583 3300046454 Bacteria 948
1191 Ga0495603_0001123 3300046455 Bacteria 15577
1192 Ga0495603_0001668 3300046455 Bacteria 13022
1193 Ga0495603_0001962 3300046455 Bacteria 12136
1194 Ga0495603_0022694 3300046455 Bacteria 3797
1195 Ga0495603_0032422 3300046455 Bacteria 3143
1196 Ga0495603_0155464 3300046455 Bacteria 1327
1197 Ga0495603_0233268 3300046455 Bacteria 1061
1198 Ga0495629_0000316 3300046459 Bacteria 41262
1199 Ga0495629_0002795 3300046459 Bacteria 13310
1200 Ga0495629_0038466 3300046459 Bacteria 3369
1201 Ga0495629_0042076 3300046459 Bacteria 3211
1202 Ga0495629_0057773 3300046459 Bacteria 2712
1203 Ga0495629_0107090 3300046459 Bacteria 1950
1204 Ga0495629_0258766 3300046459 Bacteria 1196
1205 Ga0495638_0452714 3300046460 Bacteria 655
1206 Ga0495641_0003654 3300046461 Bacteria 11359
1207 Ga0495641_0007778 3300046461 Bacteria 6637
1208 Ga0495641_0039730 3300046461 Bacteria 2192
1209 Ga0495651_0000210 3300046462 Bacteria 44718
1210 Ga0495651_0001361 3300046462 Bacteria 18913
1211 Ga0495651_0008870 3300046462 Bacteria 7721
1212 Ga0495651_0012050 3300046462 Bacteria 6655
1213 Ga0495651_0068503 3300046462 Bacteria 2705
1214 Ga0495651_0472102 3300046462 Bacteria 807
1215 Ga0495653_0000045 3300046463 Bacteria 115410
1216 Ga0495653_0025406 3300046463 Bacteria 4761
1217 Ga0495653_0051789 3300046463 Bacteria 3149
1218 Ga0495653_0064203 3300046463 Bacteria 2767
1219 Ga0495653_0102031 3300046463 Bacteria 2077
1220 Ga0495653_0103492 3300046463 Bacteria 2059
1221 Ga0495653_0120650 3300046463 Bacteria 1869
1222 Ga0495653_0303068 3300046463 Bacteria 1041
1223 Ga0495580_0004684 3300046472 Bacteria 11472
1224 Ga0495580_0014866 3300046472 Bacteria 5897
1225 Ga0495580_0120164 3300046472 Bacteria 1824
1226 Ga0495580_0298306 3300046472 Bacteria 1098
1227 Ga0495582_0000038 3300046473 Bacteria 67536
1228 Ga0495582_0001491 3300046473 Bacteria 13241
1229 Ga0495582_0009743 3300046473 Bacteria 5292
1230 Ga0495582_0127891 3300046473 Bacteria 1434
1231 Ga0495582_0135258 3300046473 Bacteria 1394
1232 Ga0495582_0467154 3300046473 Bacteria 729
1233 Ga0495605_0060303 3300046474 Bacteria 1819
1234 Ga0495605_0090983 3300046474 Bacteria 1414
1235 Ga0495639_0000050 3300046475 Bacteria 52004
1236 Ga0495639_0009640 3300046475 Bacteria 4144
1237 Ga0495639_0064345 3300046475 Bacteria 1685
1238 Ga0495639_0077984 3300046475 Bacteria 1539
1239 Ga0495639_0127858 3300046475 Bacteria 1215
1240 Ga0495639_0202131 3300046475 Bacteria 973
1241 Ga0495662_0000240 3300046476 Bacteria 23127
1242 Ga0495662_0001679 3300046476 Bacteria 11042
1243 Ga0495662_0004372 3300046476 Bacteria 7095
1244 Ga0495662_0225821 3300046476 Bacteria 923
1245 Ga0495664_0000004 3300046477 Bacteria 489411
1246 Ga0495664_0000584 3300046477 Bacteria 18401
1247 Ga0495664_0016293 3300046477 Bacteria 4232
1248 Ga0495664_0022812 3300046477 Bacteria 3630
1249 Ga0495664_0032244 3300046477 Bacteria 3073
1250 Ga0495664_0085829 3300046477 Bacteria 1890
1251 Ga0495584_0012187 3300046491 Bacteria 4394
1252 Ga0495584_0158358 3300046491 Bacteria 1151
1253 Ga0495584_0198490 3300046491 Bacteria 1020
1254 Ga0495594_0000658 3300046499 Bacteria 17863
1255 Ga0495594_0000931 3300046499 Bacteria 15130
1256 Ga0495594_0196868 3300046499 Bacteria 1148
1257 Ga0495594_0470876 3300046499 Bacteria 714
1258 Ga0495596_0030928 3300046500 Bacteria 2141
1259 Ga0495596_0039269 3300046500 Bacteria 1870
1260 Ga0495607_0065977 3300046501 Bacteria 2038
1261 Ga0495583_0055013 3300046506 Bacteria 1800
1262 Ga0495606_0000514 3300046507 Bacteria 62799
1263 Ga0495606_0015262 3300046507 Bacteria 5930
1264 Ga0495608_0000017 3300046511 Bacteria 192929
1265 Ga0495608_0024504 3300046511 Bacteria 4124
1266 Ga0495608_0030687 3300046511 Bacteria 3638
1267 Ga0495608_0040209 3300046511 Bacteria 3133
1268 Ga0495608_0453069 3300046511 Bacteria 780
1269 Ga0495608_0563537 3300046511 Bacteria 686
1270 Ga0495610_0002941 3300046512 Bacteria 13760
1271 Ga0495610_0191711 3300046512 Bacteria 843
1272 Ga0495616_0013357 3300046513 Bacteria 4634
1273 Ga0495618_0000006 3300046514 Bacteria 229906
1274 Ga0495618_0002196 3300046514 Bacteria 12758
1275 Ga0495618_0002882 3300046514 Bacteria 10903
1276 Ga0495618_0033376 3300046514 Bacteria 3227
1277 Ga0495618_0038771 3300046514 Bacteria 2996
1278 Ga0495618_0072055 3300046514 Bacteria 2198
1279 Ga0495618_0098052 3300046514 Bacteria 1875
1280 Ga0495618_0254655 3300046514 Bacteria 1100
1281 Ga0495618_0284264 3300046514 Bacteria 1031
1282 Ga0495620_0022569 3300046515 Bacteria 3028
1283 Ga0495628_0000001 3300046516 Bacteria 917742
1284 Ga0495628_0014145 3300046516 Bacteria 6697
1285 Ga0495628_0029138 3300046516 Bacteria 4479
1286 Ga0495628_0090874 3300046516 Bacteria 2363
1287 Ga0495628_0181428 3300046516 Bacteria 1592
1288 Ga0495628_0302039 3300046516 Bacteria 1184
1289 Ga0495628_0378674 3300046516 Bacteria 1037
1290 Ga0495628_0592287 3300046516 Bacteria 793
1291 Ga0495630_0000303 3300046517 Bacteria 39488
1292 Ga0495630_0002603 3300046517 Bacteria 12502
1293 Ga0495630_0004716 3300046517 Bacteria 9560
1294 Ga0495630_0042199 3300046517 Bacteria 3407
1295 Ga0495630_0043199 3300046517 Bacteria 3366
1296 Ga0495630_0072539 3300046517 Bacteria 2591
1297 Ga0495630_0236713 3300046517 Bacteria 1395
1298 Ga0495630_0280016 3300046517 Bacteria 1274
1299 Ga0495630_0490521 3300046517 Bacteria 942
1300 Ga0495632_0006566 3300046519 Bacteria 7449
1301 Ga0495637_0246581 3300046520 Bacteria 644
1302 Ga0495644_0031367 3300046523 Bacteria 2008
1303 Ga0495644_0045247 3300046523 Bacteria 1655
1304 Ga0495666_0037784 3300046526 Bacteria 2348
1305 Ga0495666_0091178 3300046526 Bacteria 1438
1306 Ga0495652_0000002 3300046529 Bacteria 946606
1307 Ga0495652_0004663 3300046529 Bacteria 13078
1308 Ga0495652_0006976 3300046529 Bacteria 10446
1309 Ga0495652_0019963 3300046529 Bacteria 5959
1310 Ga0495652_0065159 3300046529 Bacteria 3062
1311 Ga0495652_0097854 3300046529 Bacteria 2386
1312 Ga0495652_0361868 3300046529 Bacteria 1036
1313 Ga0495654_0032320 3300046530 Bacteria 2653
1314 Ga0495665_0000732 3300046531 Bacteria 16988
1315 Ga0495665_0014244 3300046531 Bacteria 4290
1316 Ga0495665_0022206 3300046531 Bacteria 3412
1317 Ga0495665_0025494 3300046531 Bacteria 3176
1318 Ga0495665_0108516 3300046531 Bacteria 1456
1319 Ga0495665_0190285 3300046531 Bacteria 1065
1320 Ga0495640_0000001 3300046533 Bacteria 853827
1321 Ga0495640_0003781 3300046533 Bacteria 12144
1322 Ga0495640_0004317 3300046533 Bacteria 11356
1323 Ga0495640_0013746 3300046533 Bacteria 6150
1324 Ga0495640_0022389 3300046533 Bacteria 4619
1325 Ga0495640_0177264 3300046533 Bacteria 1360
1326 Ga0495640_0181579 3300046533 Bacteria 1340
1327 Ga0495640_0384670 3300046533 Bacteria 863
1328 Ga0495586_0010447 3300046535 Bacteria 4935
1329 Ga0495586_0026467 3300046535 Bacteria 3103
1330 Ga0495586_0166282 3300046535 Bacteria 1245
1331 Ga0495586_0205306 3300046535 Bacteria 1118
1332 Ga0495587_0000008 3300046536 Bacteria 271097
1333 Ga0495587_0009922 3300046536 Bacteria 6078
1334 Ga0495587_0015166 3300046536 Bacteria 4815
1335 Ga0495587_0015325 3300046536 Bacteria 4789
1336 Ga0495587_0168417 3300046536 Bacteria 1245
1337 Ga0495597_0116357 3300046542 Bacteria 1117
1338 Ga0495645_0000002 3300046543 Bacteria 651644
1339 Ga0495645_0013788 3300046543 Bacteria 5727
1340 Ga0495645_0016339 3300046543 Bacteria 5296
1341 Ga0495645_0127641 3300046543 Bacteria 1786
1342 Ga0495645_0217368 3300046543 Bacteria 1287
1343 Ga0495622_0007054 3300046557 Bacteria 5217
1344 Ga0495622_0046811 3300046557 Bacteria 2010
1345 Ga0495622_0069998 3300046557 Bacteria 1620
1346 Ga0495667_0000029 3300046559 Bacteria 151568
1347 Ga0495667_0003159 3300046559 Bacteria 11047
1348 Ga0495667_0014030 3300046559 Bacteria 5410
1349 Ga0495667_0021156 3300046559 Bacteria 4388
1350 Ga0495667_0113262 3300046559 Bacteria 1753
1351 Ga0495667_0122810 3300046559 Bacteria 1676
1352 Ga0495667_0220629 3300046559 Bacteria 1210
1353 Ga0495667_0531941 3300046559 Bacteria 735
1354 Ga0495656_0114045 3300046615 Bacteria 1268
1355 Ga0495668_0012497 3300046616 Bacteria 5034
1356 Ga0495634_0000082 3300046642 Bacteria 74301
1357 Ga0495634_0000931 3300046642 Bacteria 27727
1358 Ga0495634_0003005 3300046642 Bacteria 13730
1359 Ga0495634_0004383 3300046642 Bacteria 11103
1360 Ga0495634_0020543 3300046642 Bacteria 4682
1361 Ga0495634_0021663 3300046642 Bacteria 4539
1362 Ga0495634_0052150 3300046642 Bacteria 2742
1363 Ga0495634_0072363 3300046642 Bacteria 2267
1364 Ga0495634_0092966 3300046642 Bacteria 1956
1365 Ga0495625_0026417 3300046660 Bacteria 4387
1366 Ga0495635_0000002 3300046663 Bacteria 490490
1367 Ga0495635_0000415 3300046663 Bacteria 27018
1368 Ga0495635_0003450 3300046663 Bacteria 10929
1369 Ga0495635_0004272 3300046663 Bacteria 9893
1370 Ga0495635_0004535 3300046663 Bacteria 9623
1371 Ga0495635_0012438 3300046663 Bacteria 5963
1372 Ga0495635_0068193 3300046663 Bacteria 2440
1373 Ga0495635_0073247 3300046663 Bacteria 2346
1374 Ga0495635_0109234 3300046663 Bacteria 1889
1375 Ga0495635_0156420 3300046663 Bacteria 1551
1376 Ga0495635_0518271 3300046663 Bacteria 784
1377 Ga0495659_0014664 3300046664 Bacteria 2569
1378 Ga0495659_0268170 3300046664 Bacteria 715
1379 Ga0495588_0028455 3300046674 Bacteria 2797
1380 Ga0495588_0056912 3300046674 Bacteria 2019
1381 Ga0495588_0159700 3300046674 Bacteria 1192
1382 Ga0495588_0175252 3300046674 Bacteria 1134
1383 Ga0495657_0000064 3300046675 Bacteria 94324
1384 Ga0495657_0020713 3300046675 Bacteria 4728
1385 Ga0495657_0042191 3300046675 Bacteria 3116
1386 Ga0495657_0074167 3300046675 Bacteria 2214
1387 Ga0495657_0122450 3300046675 Bacteria 1637
1388 Ga0495657_0142709 3300046675 Bacteria 1492
1389 Ga0495657_0283791 3300046675 Bacteria 990
1390 Ga0495657_0295147 3300046675 Bacteria 967
1391 Ga0495657_0343610 3300046675 Bacteria 884
1392 Ga0495599_0000104 3300046678 Bacteria 59442
1393 Ga0495599_0002103 3300046678 Bacteria 11558
1394 Ga0495599_0110503 3300046678 Bacteria 1712
1395 Ga0495599_0113318 3300046678 Bacteria 1688
1396 Ga0495599_0135540 3300046678 Bacteria 1528
1397 Ga0495623_0000108 3300046679 Bacteria 51088
1398 Ga0495623_0000561 3300046679 Bacteria 24733
1399 Ga0495623_0023294 3300046679 Bacteria 3996
1400 Ga0495623_0039478 3300046679 Bacteria 3016
1401 Ga0495623_0065061 3300046679 Bacteria 2281
1402 Ga0495646_0000023 3300046680 Bacteria 110212
1403 Ga0495646_0005444 3300046680 Bacteria 8046
1404 Ga0495646_0009308 3300046680 Bacteria 6232
1405 Ga0495646_0022961 3300046680 Bacteria 3929
1406 Ga0495646_0026486 3300046680 Bacteria 3641
1407 Ga0495646_0135009 3300046680 Bacteria 1385
1408 Ga0495647_0000195 3300046681 Bacteria 16130
1409 Ga0495647_0014984 3300046681 Bacteria 2709
1410 Ga0495647_0019147 3300046681 Bacteria 2446
1411 Ga0495647_0131487 3300046681 Bacteria 1061
1412 Ga0495647_0177687 3300046681 Bacteria 925
1413 Ga0495658_0000802 3300046683 Bacteria 16866
1414 Ga0495658_0048346 3300046683 Bacteria 2398
1415 Ga0495658_0069738 3300046683 Bacteria 2038
1416 Ga0495658_0078448 3300046683 Bacteria 1933
1417 Ga0495658_0189924 3300046683 Bacteria 1277
1418 Ga0495613_0002073 3300046689 Bacteria 15236
1419 Ga0495613_0006101 3300046689 Bacteria 9015
1420 Ga0495613_0040933 3300046689 Bacteria 3432
1421 Ga0495613_0065807 3300046689 Bacteria 2648
1422 Ga0495613_0068818 3300046689 Bacteria 2581
1423 Ga0495613_0074251 3300046689 Bacteria 2477
1424 Ga0495613_0095354 3300046689 Bacteria 2152
1425 Ga0495613_0145915 3300046689 Bacteria 1689
1426 Ga0495613_0159145 3300046689 Bacteria 1607
1427 Ga0495613_0168143 3300046689 Bacteria 1557
1428 Ga0495613_0261185 3300046689 Bacteria 1206
1429 Ga0495613_0407195 3300046689 Bacteria 927
1430 Ga0495624_0005838 3300046690 Bacteria 8807
1431 Ga0495624_0013276 3300046690 Bacteria 5615
1432 Ga0495624_0037808 3300046690 Bacteria 3104
1433 Ga0495624_0107915 3300046690 Bacteria 1712
1434 Ga0495624_0197058 3300046690 Bacteria 1224
1435 Ga0495671_0017211 3300046692 Bacteria 3848
1436 Ga0495649_0154678 3300046694 Bacteria 1204
1437 Ga0495649_0193906 3300046694 Bacteria 1057
1438 Ga0495589_0070963 3300046794 Bacteria 1703
1439 Ga0495600_0000010 3300046809 Bacteria 143675
1440 Ga0495600_0009846 3300046809 Bacteria 5913
1441 Ga0495600_0013445 3300046809 Bacteria 5144
1442 Ga0495600_0207286 3300046809 Bacteria 1257
1443 Ga0495660_0011331 3300046810 Bacteria 5176
1444 Ga0495581_0000749 3300047315 Bacteria 17233
1445 Ga0495581_0004588 3300047315 Bacteria 7981
1446 Ga0495581_0022669 3300047315 Bacteria 3638
1447 Ga0495581_0024425 3300047315 Bacteria 3502
1448 Ga0495581_0084712 3300047315 Bacteria 1837
1449 Ga0495581_0089594 3300047315 Bacteria 1784
1450 Ga0495581_0101817 3300047315 Bacteria 1669
1451 Ga0495581_0532204 3300047315 Bacteria 682
1452 Ga0495604_0000009 3300047317 Bacteria 326341
1453 Ga0495604_0001737 3300047317 Bacteria 17883
1454 Ga0495604_0020499 3300047317 Bacteria 5280
1455 Ga0495604_0022991 3300047317 Bacteria 4974
1456 Ga0495604_0063007 3300047317 Bacteria 2830
1457 Ga0495604_0295257 3300047317 Bacteria 1090
1458 Ga0495604_0374041 3300047317 Bacteria 942
1459 Ga0495604_0420101 3300047317 Bacteria 878
1460 Ga0495636_0006880 3300047318 Bacteria 4473
1461 Ga0495674_0000002 3300047319 Bacteria 642785
1462 Ga0495674_0005524 3300047319 Bacteria 12129
1463 Ga0495674_0019395 3300047319 Bacteria 6311
1464 Ga0495674_0021316 3300047319 Bacteria 5994
1465 Ga0495674_0024878 3300047319 Bacteria 5496
1466 Ga0495674_0026267 3300047319 Bacteria 5330
1467 Ga0495674_0042326 3300047319 Bacteria 4063
1468 Ga0495674_0145389 3300047319 Bacteria 1991
1469 Ga0495674_0154702 3300047319 Bacteria 1921
1470 Ga0495674_0207571 3300047319 Bacteria 1623
1471 Ga0495674_0362064 3300047319 Bacteria 1176
1472 Ga0495674_0364507 3300047319 Bacteria 1171
1473 Ga0495674_0494835 3300047319 Bacteria 978
1474 Ga0495672_0082483 3300047320 Bacteria 1788
1475 Ga0495672_0101123 3300047320 Bacteria 1563
1476 Ga0495676_0022697 3300047321 Bacteria 5455
1477 Ga0495676_0070470 3300047321 Bacteria 2692
1478 Ga0495676_0088994 3300047321 Bacteria 2314
1479 Ga0495676_0125904 3300047321 Bacteria 1857
1480 Ga0495676_0496253 3300047321 Bacteria 801
1481 Ga0495680_0000263 3300047322 Bacteria 58120
1482 Ga0495680_0000924 3300047322 Bacteria 32584
1483 Ga0495680_0015541 3300047322 Bacteria 6566
1484 Ga0495680_0024509 3300047322 Bacteria 5004
1485 Ga0495680_0034049 3300047322 Bacteria 4120
1486 Ga0495680_0283547 3300047322 Bacteria 1167
1487 Ga0495683_0133826 3300047323 Bacteria 1167
1488 Ga0495683_0133973 3300047323 Bacteria 1166
1489 Ga0495675_0000680 3300047444 Bacteria 21389
1490 Ga0495675_0003143 3300047444 Bacteria 9910
1491 Ga0495675_0008654 3300047444 Bacteria 6312
1492 Ga0495675_0013027 3300047444 Bacteria 5243
1493 Ga0495675_0063481 3300047444 Bacteria 2337
1494 Ga0495675_0590990 3300047444 Bacteria 630
1495 Ga0495677_0052688 3300047445 Bacteria 1500
1496 Ga0495677_0123303 3300047445 Bacteria 989
1497 Ga0495679_099040 3300047446 Bacteria 811
1498 Ga0495684_0000006 3300047471 Bacteria 247568
1499 Ga0495684_0002213 3300047471 Bacteria 15573
1500 Ga0495684_0004425 3300047471 Bacteria 10986
1501 Ga0495684_0007203 3300047471 Bacteria 8634
1502 Ga0495684_0018159 3300047471 Bacteria 5420
1503 Ga0495684_0032006 3300047471 Bacteria 4037
1504 Ga0495684_0032184 3300047471 Bacteria 4025
1505 Ga0495684_0146924 3300047471 Bacteria 1765
1506 Ga0495684_0166185 3300047471 Bacteria 1643
1507 Ga0495684_0324651 3300047471 Bacteria 1099
1508 Ga0495686_0045721 3300047472 Bacteria 2769
1509 Ga0495593_0000291 3300047673 Bacteria 27242
1510 Ga0495593_0000991 3300047673 Bacteria 16692
1511 Ga0495593_0001262 3300047673 Bacteria 14851
1512 Ga0495593_0005880 3300047673 Bacteria 7229
1513 Ga0495593_0031228 3300047673 Bacteria 2911
1514 Ga0495602_0000005 3300048088 Bacteria 325957
1515 Ga0495602_0032253 3300048088 Bacteria 4935
1516 Ga0495602_0086338 3300048088 Bacteria 2620
1517 Ga0495602_0124807 3300048088 Bacteria 2064
1518 Ga0495614_0036724 3300048089 Bacteria 2103
1519 Ga0495614_0246486 3300048089 Bacteria 816
1520 Ga0496100_0005312 3300048903 Bacteria 6922
1521 Ga0496100_0014750 3300048903 Bacteria 4544
1522 Ga0496100_0036624 3300048903 Bacteria 3096
1523 Ga0496100_0072884 3300048903 Bacteria 2297
1524 Ga0496100_0190296 3300048903 Bacteria 1489
1525 Ga0496100_0280890 3300048903 Bacteria 1241
1526 Ga0496100_0416046 3300048903 Bacteria 1026
1527 Ga0496100_0453940 3300048903 Bacteria 983
1528 Ga0496101_0001713 3300048904 Bacteria 13127
1529 Ga0496101_0016399 3300048904 Bacteria 5004
1530 Ga0496101_0018353 3300048904 Bacteria 4755
1531 Ga0496101_0018648 3300048904 Bacteria 4722
1532 Ga0496101_0146188 3300048904 Bacteria 1805
1533 Ga0496101_0299419 3300048904 Bacteria 1259
1534 Ga0496101_0746034 3300048904 Bacteria 773
1535 Ga0496102_0009456 3300048905 Bacteria 8376
1536 Ga0496102_0021360 3300048905 Bacteria 5725
1537 Ga0496102_0022503 3300048905 Bacteria 5585
1538 Ga0496102_0040298 3300048905 Bacteria 4224
1539 Ga0496102_0064264 3300048905 Bacteria 3361
1540 Ga0496102_0075937 3300048905 Bacteria 3089
1541 Ga0496102_0130038 3300048905 Bacteria 2356
1542 Ga0496102_0193781 3300048905 Bacteria 1915
1543 Ga0496102_0545951 3300048905 Bacteria 1082
1544 Ga0496103_0020484 3300048906 Bacteria 3972
1545 Ga0496103_0094636 3300048906 Bacteria 1887
1546 Ga0496103_0313453 3300048906 Bacteria 1009
1547 Ga0496103_0466252 3300048906 Bacteria 809
1548 Ga0496104_0002976 3300048907 Bacteria 14602
1549 Ga0496104_0026244 3300048907 Bacteria 5376
1550 Ga0496104_0036951 3300048907 Bacteria 4567
1551 Ga0496104_0037417 3300048907 Bacteria 4539
1552 Ga0496104_0040170 3300048907 Bacteria 4384
1553 Ga0496104_0056217 3300048907 Bacteria 3720
1554 Ga0496104_0063234 3300048907 Bacteria 3510
1555 Ga0496104_0092448 3300048907 Bacteria 2892
1556 Ga0496104_0125167 3300048907 Bacteria 2468
1557 Ga0496104_0196597 3300048907 Bacteria 1928
1558 Ga0496104_0560122 3300048907 Bacteria 1053
1559 Ga0496105_0002126 3300048908 Bacteria 14351
1560 Ga0496105_0002325 3300048908 Bacteria 13781
1561 Ga0496105_0002459 3300048908 Bacteria 13410
1562 Ga0496105_0039958 3300048908 Bacteria 3867
1563 Ga0496105_0043170 3300048908 Bacteria 3718
1564 Ga0496105_0088347 3300048908 Bacteria 2560
1565 Ga0496106_0001467 3300048909 Bacteria 17734
1566 Ga0496106_0008495 3300048909 Bacteria 7596
1567 Ga0496106_0009807 3300048909 Bacteria 7073
1568 Ga0496106_0012330 3300048909 Bacteria 6308
1569 Ga0496106_0029863 3300048909 Bacteria 4063
1570 Ga0496106_0086803 3300048909 Bacteria 2410
1571 Ga0496106_0112358 3300048909 Bacteria 2123
1572 Ga0496106_0123106 3300048909 Bacteria 2029
1573 Ga0496106_0169011 3300048909 Bacteria 1732
1574 Ga0496106_0182882 3300048909 Bacteria 1664
1575 Ga0496106_0398041 3300048909 Bacteria 1107
1576 Ga0496106_0438641 3300048909 Bacteria 1049
1577 Ga0496106_0440857 3300048909 Bacteria 1046
1578 Ga0496107_0017729 3300048910 Bacteria 5011
1579 Ga0496107_0049154 3300048910 Bacteria 3039
1580 Ga0496107_0064776 3300048910 Bacteria 2649
1581 Ga0496107_0071766 3300048910 Bacteria 2516
1582 Ga0496107_0080283 3300048910 Bacteria 2379
1583 Ga0496107_0093973 3300048910 Bacteria 2193
1584 Ga0496107_0190847 3300048910 Bacteria 1522
1585 Ga0496107_0229933 3300048910 Bacteria 1380
1586 Ga0496107_0280823 3300048910 Bacteria 1239
1587 Ga0496107_0328003 3300048910 Bacteria 1139
1588 Ga0496107_0470038 3300048910 Bacteria 933
1589 Ga0496107_0476376 3300048910 Bacteria 926
1590 Ga0496108_0001568 3300048911 Bacteria 18102
1591 Ga0496108_0004071 3300048911 Bacteria 11728
1592 Ga0496108_0009038 3300048911 Bacteria 8075
1593 Ga0496108_0010763 3300048911 Bacteria 7426
1594 Ga0496108_0014299 3300048911 Bacteria 6477
1595 Ga0496108_0094121 3300048911 Bacteria 2550
1596 Ga0496108_0094354 3300048911 Bacteria 2547
1597 Ga0496108_0539003 3300048911 Bacteria 1018
1598 Ga0496109_0000998 3300048912 Bacteria 23365
1599 Ga0496109_0001821 3300048912 Bacteria 17708
1600 Ga0496109_0002182 3300048912 Bacteria 16241
1601 Ga0496109_0002615 3300048912 Bacteria 15097
1602 Ga0496109_0006231 3300048912 Bacteria 10032
1603 Ga0496109_0044488 3300048912 Bacteria 4027
1604 Ga0496109_0082949 3300048912 Bacteria 2955
1605 Ga0496109_0119749 3300048912 Bacteria 2451
1606 Ga0496109_0215499 3300048912 Bacteria 1805
1607 Ga0496109_0540399 3300048912 Bacteria 1099
1608 Ga0496109_0897795 3300048912 Bacteria 824
1609 Ga0496109_0983083 3300048912 Bacteria 782
1610 Ga0496110_0012384 3300048913 Bacteria 7012
1611 Ga0496110_0014302 3300048913 Bacteria 6585
1612 Ga0496110_0024940 3300048913 Bacteria 5103
1613 Ga0496110_0037618 3300048913 Bacteria 4207
1614 Ga0496110_0104469 3300048913 Bacteria 2541
1615 Ga0496110_0136311 3300048913 Bacteria 2218
1616 Ga0496110_0187134 3300048913 Bacteria 1880
1617 Ga0496110_0237532 3300048913 Bacteria 1658
1618 Ga0496110_0371510 3300048913 Bacteria 1303
1619 Ga0496110_0624163 3300048913 Bacteria 977
1620 Ga0496110_0768006 3300048913 Bacteria 867
1621 Ga0496111_0000650 3300048914 Bacteria 18303
1622 Ga0496111_0009487 3300048914 Bacteria 6499
1623 Ga0496111_0016736 3300048914 Bacteria 5058
1624 Ga0496111_0017445 3300048914 Bacteria 4964
1625 Ga0496111_0048473 3300048914 Bacteria 3060
1626 Ga0496111_0079077 3300048914 Bacteria 2398
1627 Ga0496111_0118761 3300048914 Bacteria 1952
1628 Ga0496111_0144161 3300048914 Bacteria 1765
1629 Ga0496111_0311011 3300048914 Bacteria 1167
1630 Ga0496111_0460484 3300048914 Bacteria 938
1631 Ga0496111_0752116 3300048914 Bacteria 707
1632 Ga0496112_0000045 3300048915 Bacteria 85873
1633 Ga0496112_0001986 3300048915 Bacteria 16179
1634 Ga0496112_0010259 3300048915 Bacteria 8490
1635 Ga0496112_0018414 3300048915 Bacteria 6575
1636 Ga0496112_0107662 3300048915 Bacteria 2757
1637 Ga0496112_0119330 3300048915 Bacteria 2607
1638 Ga0496112_0156292 3300048915 Bacteria 2247
1639 Ga0496112_0170823 3300048915 Bacteria 2139
1640 Ga0496112_0217026 3300048915 Bacteria 1869
1641 Ga0496112_0458456 3300048915 Bacteria 1212
1642 Ga0496112_0666253 3300048915 Bacteria 970
1643 Ga0496113_0002083 3300048916 Bacteria 11507
1644 Ga0496113_0008509 3300048916 Bacteria 6688
1645 Ga0496113_0013337 3300048916 Bacteria 5563
1646 Ga0496113_0068645 3300048916 Bacteria 2690
1647 Ga0496113_0079560 3300048916 Bacteria 2510
1648 Ga0496113_0080243 3300048916 Bacteria 2499
1649 Ga0496113_0090148 3300048916 Bacteria 2361
1650 Ga0496113_0094699 3300048916 Bacteria 2307
1651 Ga0496113_0232852 3300048916 Bacteria 1469
1652 Ga0496114_0010559 3300048917 Bacteria 7348
1653 Ga0496114_0011354 3300048917 Bacteria 7114
1654 Ga0496114_0034731 3300048917 Bacteria 4161
1655 Ga0496114_0059384 3300048917 Bacteria 3195
1656 Ga0496114_0096209 3300048917 Bacteria 2521
1657 Ga0496114_0141439 3300048917 Bacteria 2084
1658 Ga0496114_0339299 3300048917 Bacteria 1329
1659 Ga0496114_0757852 3300048917 Bacteria 848
1660 Ga0496115_0014957 3300048918 Bacteria 5882
1661 Ga0496115_0020501 3300048918 Bacteria 5101
1662 Ga0496115_0042828 3300048918 Bacteria 3608
1663 Ga0496115_0047410 3300048918 Bacteria 3436
1664 Ga0496115_0048406 3300048918 Bacteria 3400
1665 Ga0496115_0066566 3300048918 Bacteria 2912
1666 Ga0496115_0113003 3300048918 Bacteria 2231
1667 Ga0496115_0302860 3300048918 Bacteria 1309
1668 Ga0496115_0326434 3300048918 Bacteria 1254
1669 Ga0496116_0135269 3300048919 Bacteria 1397
1670 Ga0496117_0035263 3300048920 Bacteria 3757
1671 Ga0496118_0016550 3300048921 Bacteria 6761
1672 Ga0496119_0173657 3300048922 Bacteria 1136
1673 Ga0496119_0280865 3300048922 Bacteria 828
1674 Ga0496119_0357452 3300048922 Bacteria 706
1675 Ga0496121_0000225 3300048924 Bacteria 122351
1676 Ga0496121_0002977 3300048924 Bacteria 24658
1677 Ga0496121_0052155 3300048924 Bacteria 3438
1678 Ga0496121_0105958 3300048924 Bacteria 2156
1679 Ga0496121_0219787 3300048924 Bacteria 1339
1680 Ga0496121_0372297 3300048924 Bacteria 945
1681 Ga0496122_0031165 3300048925 Bacteria 4446
1682 Ga0496124_0344692 3300048927 Bacteria 1056
1683 Ga0496125_0058042 3300048928 Bacteria 3129
1684 Ga0496126_0008193 3300048929 Bacteria 11304
1685 Ga0496126_0011577 3300048929 Bacteria 9107
1686 Ga0496126_0022043 3300048929 Bacteria 6207
1687 Ga0496126_0030338 3300048929 Bacteria 5123
1688 Ga0496126_0077975 3300048929 Bacteria 2936
1689 Ga0496126_0091722 3300048929 Bacteria 2670
1690 Ga0496126_0100248 3300048929 Bacteria 2535
1691 Ga0496126_0111714 3300048929 Bacteria 2380
1692 Ga0496126_0320985 3300048929 Bacteria 1273
1693 Ga0496126_0331048 3300048929 Bacteria 1250
1694 Ga0496126_0434443 3300048929 Bacteria 1059
1695 Ga0501031_0009458 3300049568 Bacteria 6337
1696 Ga0501031_0039821 3300049568 Bacteria 3067
1697 Ga0501031_0084632 3300049568 Bacteria 2067
1698 Ga0501031_0311177 3300049568 Bacteria 1020
1699 Ga0501032_0030107 3300049569 Bacteria 3723
1700 Ga0501032_0033117 3300049569 Bacteria 3542
1701 Ga0501032_0043048 3300049569 Bacteria 3060
1702 Ga0501032_0045454 3300049569 Bacteria 2969
1703 Ga0501032_0064363 3300049569 Bacteria 2454
1704 Ga0501032_0107812 3300049569 Bacteria 1844
1705 Ga0501032_0281678 3300049569 Bacteria 1076
1706 Ga0501033_0002151 3300049570 Bacteria 17041
1707 Ga0501033_0051838 3300049570 Bacteria 3042
1708 Ga0501033_0078102 3300049570 Bacteria 2429
1709 Ga0501033_0097360 3300049570 Bacteria 2149
1710 Ga0501033_0105015 3300049570 Bacteria 2059
1711 Ga0501033_0111535 3300049570 Bacteria 1990
1712 Ga0501033_0134982 3300049570 Bacteria 1785
1713 Ga0501034_0000229 3300049571 Bacteria 105030
1714 Ga0501034_0001110 3300049571 Bacteria 37765
1715 Ga0501034_0018371 3300049571 Bacteria 7170
1716 Ga0501034_0052518 3300049571 Bacteria 4105
1717 Ga0501034_0085275 3300049571 Bacteria 3160
1718 Ga0501034_0126497 3300049571 Bacteria 2540
1719 Ga0501034_0335243 3300049571 Bacteria 1443
1720 Ga0501034_0348332 3300049571 Bacteria 1410
1721 Ga0501034_0428178 3300049571 Bacteria 1243
1722 Ga0501034_0551844 3300049571 Bacteria 1061
1723 Ga0501034_0773272 3300049571 Bacteria 854
1724 Ga0501034_0774539 3300049571 Bacteria 853
1725 Ga0501034_0938544 3300049571 Bacteria 751
1726 Ga0501036_0000783 3300049572 Bacteria 23531
1727 Ga0501036_0024848 3300049572 Bacteria 5052
1728 Ga0501036_0076036 3300049572 Bacteria 2840
1729 Ga0501036_0141196 3300049572 Bacteria 2032
1730 Ga0501036_0191211 3300049572 Bacteria 1722
1731 Ga0501036_0238178 3300049572 Bacteria 1526
1732 Ga0501036_0702826 3300049572 Bacteria 835
1733 Ga0501037_0000635 3300049573 Bacteria 27166
1734 Ga0501037_0027143 3300049573 Bacteria 4229
1735 Ga0501037_0106908 3300049573 Bacteria 2016
1736 Ga0501037_0146859 3300049573 Bacteria 1686
1737 Ga0501037_0302380 3300049573 Bacteria 1111
1738 Ga0501038_0000377 3300049574 Bacteria 38374
1739 Ga0501038_0018922 3300049574 Bacteria 6215
1740 Ga0501038_0025675 3300049574 Bacteria 5248
1741 Ga0501038_0080510 3300049574 Bacteria 2745
1742 Ga0501038_0095269 3300049574 Bacteria 2486
1743 Ga0501038_0124595 3300049574 Bacteria 2121
1744 Ga0501038_0231213 3300049574 Bacteria 1471
1745 Ga0501038_0338649 3300049574 Bacteria 1173
1746 Ga0501038_0426717 3300049574 Bacteria 1022
1747 Ga0501038_0634534 3300049574 Bacteria 805
1748 Ga0501038_0687554 3300049574 Bacteria 767
1749 Ga0501039_0041561 3300049575 Bacteria 3551
1750 Ga0501039_0073132 3300049575 Bacteria 2664
1751 Ga0501039_0078603 3300049575 Bacteria 2566
1752 Ga0501039_0112015 3300049575 Bacteria 2133
1753 Ga0501039_0145647 3300049575 Bacteria 1861
1754 Ga0501039_0195007 3300049575 Bacteria 1592
1755 Ga0501039_0519851 3300049575 Bacteria 934
1756 Ga0501040_0222973 3300049576 Bacteria 1341
1757 Ga0501041_0084359 3300049577 Bacteria 1958
1758 Ga0501042_0021760 3300049578 Bacteria 4472
1759 Ga0501042_0105746 3300049578 Bacteria 2025
1760 Ga0501042_0121299 3300049578 Bacteria 1882
1761 Ga0501042_0192819 3300049578 Bacteria 1469
1762 Ga0501042_0414801 3300049578 Bacteria 976
1763 Ga0501043_0002218 3300049579 Bacteria 16572
1764 Ga0501043_0006300 3300049579 Bacteria 9527
1765 Ga0501043_0060612 3300049579 Bacteria 2970
1766 Ga0501043_0069873 3300049579 Bacteria 2758
1767 Ga0501043_0088359 3300049579 Bacteria 2436
1768 Ga0501043_0336677 3300049579 Bacteria 1148
1769 Ga0501046_0027341 3300049580 Bacteria 4654
1770 Ga0501046_0033141 3300049580 Bacteria 4176
1771 Ga0501046_0057108 3300049580 Bacteria 3062
1772 Ga0501046_0091582 3300049580 Bacteria 2338
1773 Ga0501046_0107150 3300049580 Bacteria 2138
1774 Ga0501046_0606059 3300049580 Bacteria 777
1775 Ga0501047_0000164 3300049581 Bacteria 81200
1776 Ga0501047_0012833 3300049581 Bacteria 7937
1777 Ga0501047_0013485 3300049581 Bacteria 7747
1778 Ga0501047_0070002 3300049581 Bacteria 3377
1779 Ga0501047_0226856 3300049581 Bacteria 1722
1780 Ga0501047_0405850 3300049581 Bacteria 1195
1781 Ga0501047_0435933 3300049581 Bacteria 1141
1782 Ga0501047_0470019 3300049581 Bacteria 1086
1783 Ga0501048_0002364 3300049582 Bacteria 14401
1784 Ga0501048_0158879 3300049582 Bacteria 1599
1785 Ga0501048_0460563 3300049582 Bacteria 911
1786 Ga0501048_0477572 3300049582 Bacteria 893
1787 Ga0501067_0015512 3300049583 Bacteria 4216
1788 Ga0501067_0070852 3300049583 Bacteria 1930
1789 Ga0501067_0106206 3300049583 Bacteria 1560
1790 Ga0501068_0083680 3300049584 Bacteria 1961
1791 Ga0501068_0167413 3300049584 Bacteria 1386
1792 Ga0501068_0178984 3300049584 Bacteria 1340
1793 Ga0501069_0135418 3300049585 Bacteria 1412
1794 Ga0501069_0159929 3300049585 Bacteria 1297
1795 Ga0501069_0182688 3300049585 Bacteria 1212
1796 Ga0501069_0217974 3300049585 Bacteria 1108
1797 Ga0501069_0424913 3300049585 Bacteria 788
1798 Ga0501070_0005770 3300049586 Bacteria 10559
1799 Ga0501070_0033475 3300049586 Bacteria 4300
1800 Ga0501070_0058298 3300049586 Bacteria 3200
1801 Ga0501070_0088291 3300049586 Bacteria 2566
1802 Ga0501070_0229941 3300049586 Bacteria 1519
1803 Ga0501070_0238312 3300049586 Bacteria 1489
1804 Ga0501070_0241482 3300049586 Bacteria 1478
1805 Ga0501070_0248316 3300049586 Bacteria 1456
1806 Ga0501070_0254728 3300049586 Bacteria 1435
1807 Ga0501070_0559971 3300049586 Bacteria 914
1808 Ga0501071_0059386 3300049587 Bacteria 2767
1809 Ga0501071_0151091 3300049587 Bacteria 1732
1810 Ga0501071_0159817 3300049587 Bacteria 1684
1811 Ga0501071_0211522 3300049587 Bacteria 1458
1812 Ga0501071_0823500 3300049587 Bacteria 716
1813 Ga0501072_0010199 3300049588 Bacteria 7158
1814 Ga0501072_0015238 3300049588 Bacteria 5893
1815 Ga0501072_0067723 3300049588 Bacteria 2817
1816 Ga0501072_0089127 3300049588 Bacteria 2448
1817 Ga0501072_0119238 3300049588 Bacteria 2102
1818 Ga0501072_0255325 3300049588 Bacteria 1396
1819 Ga0501073_0013212 3300049589 Bacteria 6018
1820 Ga0501073_0019091 3300049589 Bacteria 4953
1821 Ga0501073_0021687 3300049589 Bacteria 4627
1822 Ga0501073_0051498 3300049589 Bacteria 2884
1823 Ga0501073_0096275 3300049589 Bacteria 2055
1824 Ga0501073_0172528 3300049589 Bacteria 1497
1825 Ga0501073_0433910 3300049589 Bacteria 908
1826 Ga0501073_0488844 3300049589 Bacteria 851
1827 Ga0501074_0010235 3300049590 Bacteria 6805
1828 Ga0501074_0018790 3300049590 Bacteria 5021
1829 Ga0501074_0126844 3300049590 Bacteria 1826
1830 Ga0501074_0280602 3300049590 Bacteria 1184
1831 Ga0501074_0491434 3300049590 Bacteria 870
1832 Ga0501074_0512397 3300049590 Bacteria 850
1833 Ga0501074_0517164 3300049590 Bacteria 845
1834 Ga0501075_0132963 3300049591 Bacteria 1895
1835 Ga0501075_0403826 3300049591 Bacteria 1042
1836 Ga0501075_0578113 3300049591 Bacteria 857
1837 Ga0501076_0078632 3300049592 Bacteria 2647
1838 Ga0501076_0125129 3300049592 Bacteria 2083
1839 Ga0501076_0162889 3300049592 Bacteria 1817
1840 Ga0501076_0820351 3300049592 Bacteria 767
1841 Ga0501077_0022201 3300049593 Bacteria 4020
1842 Ga0501077_0057771 3300049593 Bacteria 2463
1843 Ga0501077_0162657 3300049593 Bacteria 1417
1844 Ga0501077_0196201 3300049593 Bacteria 1282
1845 Ga0501077_0449444 3300049593 Bacteria 825
1846 Ga0501079_0006517 3300049741 Bacteria 8771
1847 Ga0501079_0035642 3300049741 Bacteria 3831
1848 Ga0501079_0054642 3300049741 Bacteria 3080
1849 Ga0501080_0000458 3300049742 Bacteria 31621
1850 Ga0501080_0041782 3300049742 Bacteria 4270
1851 Ga0501080_0061086 3300049742 Bacteria 3509
1852 Ga0501080_0094407 3300049742 Bacteria 2778
1853 Ga0501080_0186619 3300049742 Bacteria 1907
1854 Ga0501080_0189266 3300049742 Bacteria 1891
1855 Ga0501080_0437686 3300049742 Bacteria 1173
1856 Ga0501080_0550518 3300049742 Bacteria 1028
1857 Ga0501080_0571777 3300049742 Bacteria 1005
1858 Ga0501080_0801770 3300049742 Bacteria 826
1859 Ga0501081_0074853 3300049743 Bacteria 2363
1860 Ga0501081_0272370 3300049743 Bacteria 1238
1861 Ga0501081_0283839 3300049743 Bacteria 1212
1862 Ga0501083_0000506 3300049744 Bacteria 24815
1863 Ga0501083_0027807 3300049744 Bacteria 3900
1864 Ga0501083_0046328 3300049744 Bacteria 2940
1865 Ga0501083_0108050 3300049744 Bacteria 1830
1866 Ga0501083_0175491 3300049744 Bacteria 1400
1867 Ga0501083_0221667 3300049744 Bacteria 1232
1868 Ga0501083_0465073 3300049744 Bacteria 823
1869 Ga0501083_0684714 3300049744 Bacteria 667
1870 Ga0501035_0001593 3300049822 Bacteria 22971
1871 Ga0501035_0050613 3300049822 Bacteria 3722
1872 Ga0501035_0094099 3300049822 Bacteria 2635
1873 Ga0501035_0118824 3300049822 Bacteria 2312
1874 Ga0501035_0148625 3300049822 Bacteria 2034
1875 Ga0501035_0166166 3300049822 Bacteria 1908
1876 Ga0501035_0292516 3300049822 Bacteria 1374
1877 Ga0501035_0314293 3300049822 Bacteria 1317
1878 Ga0501035_0594802 3300049822 Bacteria 902
1879 Ga0501035_0676504 3300049822 Bacteria 834
1880 Ga0501035_0812377 3300049822 Bacteria 746
1881 Ga0501044_0001195 3300049823 Bacteria 30773
1882 Ga0501044_0011954 3300049823 Bacteria 9407
1883 Ga0501044_0034340 3300049823 Bacteria 5319
1884 Ga0501044_0040881 3300049823 Bacteria 4829
1885 Ga0501044_0064971 3300049823 Bacteria 3722
1886 Ga0501044_0077113 3300049823 Bacteria 3380
1887 Ga0501044_0091153 3300049823 Bacteria 3074
1888 Ga0501044_0172483 3300049823 Bacteria 2133
1889 Ga0501044_0187796 3300049823 Bacteria 2030
1890 Ga0501044_0189908 3300049823 Bacteria 2017
1891 Ga0501044_0497866 3300049823 Bacteria 1120
1892 Ga0501045_0031334 3300049824 Bacteria 3851
1893 nmdc:mga03n38_180277_c1 3300050490 Bacteria 1082
1894 nmdc:mga0yw44_16885_c1 3300050492 Bacteria 3955
1895 nmdc:mga0yw44_67919_c1 3300050492 Bacteria 2204
1896 nmdc:mga0k408_82504_c1 3300050493 Bacteria 1884
1897 nmdc:mga06z11_44901_c1 3300050494 Bacteria 2231
1898 nmdc:mga06z11_501335_c1 3300050494 Bacteria 735
1899 nmdc:mga06z11_682812_c1 3300050494 Bacteria 625
1900 nmdc:mga07m45_12224_c2 3300050496 Bacteria 3968
1901 nmdc:mga05p37_168275_c1 3300050507 Bacteria 2674
1902 nmdc:mga05p37_303319_c1 3300050507 Bacteria 1896
1903 nmdc:mga05p37_311_c1 3300050507 Bacteria 51481
1904 nmdc:mga05p37_39108_c1 3300050507 Bacteria 5821
1905 nmdc:mga05p37_49306_c1 3300050507 Bacteria 5179
1906 nmdc:mga05p37_523814_c1 3300050507 Bacteria 1355
1907 nmdc:mga05p37_7849_c2 3300050507 Bacteria 6565
1908 nmdc:mga09592_1063729_c1 3300050508 Bacteria 674
1909 nmdc:mga09592_18000_c1 3300050508 Bacteria 5791
1910 nmdc:mga09592_20420_c1 3300050508 Bacteria 5446
1911 nmdc:mga09592_283874_c1 3300050508 Bacteria 1436
1912 nmdc:mga09592_45615_c1 3300050508 Bacteria 3692
1913 nmdc:mga0qj67_1385_c1 3300050509 Bacteria 16986
1914 nmdc:mga0qj67_238417_c1 3300050509 Bacteria 1475
1915 nmdc:mga0qj67_35764_c1 3300050509 Bacteria 3884
1916 nmdc:mga0qj67_422305_c1 3300050509 Bacteria 1075
1917 nmdc:mga0qj67_89806_c1 3300050509 Bacteria 2468
1918 nmdc:mga06r32_120512_c1 3300050510 Bacteria 2587
1919 nmdc:mga06r32_13113_c1 3300050510 Bacteria 7504
1920 nmdc:mga06r32_170522_c1 3300050510 Bacteria 2160
1921 nmdc:mga06r32_175066_c1 3300050510 Bacteria 2130
1922 nmdc:mga06r32_191_c1 3300050510 Bacteria 49056
1923 nmdc:mga06r32_24096_c1 3300050510 Bacteria 5643
1924 nmdc:mga06r32_94267_c1 3300050510 Bacteria 2929
1925 nmdc:mga08y16_165_c1 3300050511 Bacteria 57478
1926 nmdc:mga08y16_19811_c1 3300050511 Bacteria 7093
1927 nmdc:mga08y16_26026_c1 3300050511 Bacteria 6172
1928 nmdc:mga08y16_356824_c1 3300050511 Bacteria 1501
1929 nmdc:mga08y16_48905_c1 3300050511 Bacteria 4425
1930 nmdc:mga08y16_66217_c1 3300050511 Bacteria 3770
1931 nmdc:mga08y16_7282_c1 3300050511 Bacteria 11613
1932 nmdc:mga0n895_11422_c1 3300050512 Bacteria 5080
1933 nmdc:mga0n895_14277_c1 3300050512 Bacteria 7207
1934 nmdc:mga0n895_1572_c1 3300050512 Bacteria 17177
1935 nmdc:mga0n895_184831_c1 3300050512 Bacteria 2115
1936 nmdc:mga0n895_1865_c2 3300050512 Bacteria 13990
1937 nmdc:mga0n895_484605_c1 3300050512 Bacteria 1247
1938 nmdc:mga0n895_60539_c1 3300050512 Bacteria 3736
1939 nmdc:mga0n895_68900_c1 3300050512 Bacteria 3504
1940 nmdc:mga0n895_705_c1 3300050512 Bacteria 23492
1941 nmdc:mga0n895_827543_c1 3300050512 Bacteria 915
1942 nmdc:mga0rr50_127434_c1 3300050513 Bacteria 2034
1943 nmdc:mga0rr50_14135_c1 3300050513 Bacteria 5225
1944 nmdc:mga0rr50_18530_c1 3300050513 Bacteria 4081
1945 nmdc:mga0rr50_517561_c1 3300050513 Bacteria 1015
1946 nmdc:mga0rr50_59040_c1 3300050513 Bacteria 2878
1947 nmdc:mga0rr50_65150_c1 3300050513 Bacteria 2759
1948 nmdc:mga0rr50_72352_c1 3300050513 Bacteria 2632
1949 nmdc:mga08x19_134561_c1 3300050514 Bacteria 1665
1950 nmdc:mga08x19_208000_c1 3300050514 Bacteria 1343
1951 nmdc:mga08x19_35999_c1 3300050514 Bacteria 3133
1952 nmdc:mga08x19_471515_c1 3300050514 Bacteria 884
1953 nmdc:mga08x19_745588_c1 3300050514 Bacteria 695
1954 nmdc:mga08x19_907648_c1 3300050514 Bacteria 626
1955 nmdc:mga08x19_98054_c1 3300050514 Bacteria 1941
1956 nmdc:mga0a205_131184_c1 3300050515 Bacteria 2406
1957 nmdc:mga0a205_264829_c1 3300050515 Bacteria 1596
1958 nmdc:mga0a205_30157_c1 3300050515 Bacteria 5192
1959 nmdc:mga0a205_70120_c1 3300050515 Bacteria 3384
1960 nmdc:mga0a205_70858_c1 3300050515 Bacteria 3366
1961 nmdc:mga0a205_83640_c1 3300050515 Bacteria 3082
1962 nmdc:mga0a205_945_c1 3300050515 Bacteria 23974
1963 nmdc:mga0sz30_21653_c1 3300050516 Bacteria 2105
1964 Ga0495601_0000002 3300053077 Bacteria 528704
1965 Ga0495601_0014886 3300053077 Bacteria 4695
1966 Ga0495601_0019363 3300053077 Bacteria 4151
1967 Ga0495601_0024993 3300053077 Bacteria 3680
1968 Ga0495601_0025768 3300053077 Bacteria 3628
1969 Ga0495601_0047516 3300053077 Bacteria 2702
1970 Ga0495601_0084076 3300053077 Bacteria 2044
1971 Ga0495601_0089801 3300053077 Bacteria 1976
1972 Ga0495601_0090595 3300053077 Bacteria 1968
1973 Ga0495601_0155042 3300053077 Bacteria 1495
1974 Ga0495601_0199043 3300053077 Bacteria 1309
1975 Ga0495612_0000010 3300053078 Bacteria 227618
1976 Ga0495612_0003499 3300053078 Bacteria 6509
1977 Ga0495612_0007245 3300053078 Bacteria 4538
1978 Ga0495612_0036954 3300053078 Bacteria 1982
1979 Ga0495612_0090065 3300053078 Bacteria 1297
1980 Ga0495612_0142632 3300053078 Bacteria 1040
1981 Ga0495612_0259827 3300053078 Bacteria 773
1982 Ga0495612_0316538 3300053078 Bacteria 701
1983 Ga0500635_0025476 3300053080 Bacteria 1864
1984 Ga0500635_0036756 3300053080 Bacteria 1615
1985 Ga0495655_0027329 3300053083 Bacteria 1352
1986 Ga0495595_0000020 3300053084 Bacteria 115983
1987 Ga0495595_0000665 3300053084 Bacteria 13109
1988 Ga0495595_0001064 3300053084 Bacteria 10630
1989 Ga0495595_0006022 3300053084 Bacteria 4928
1990 Ga0495595_0024641 3300053084 Bacteria 2659
1991 Ga0495595_0030548 3300053084 Bacteria 2417
1992 Ga0495595_0049516 3300053084 Bacteria 1944
1993 Ga0495595_0052867 3300053084 Bacteria 1886
1994 Ga0495595_0101766 3300053084 Bacteria 1387
1995 Ga0495595_0131523 3300053084 Bacteria 1223
1996 Ga0495595_0259162 3300053084 Bacteria 871
1997 Ga0495619_0000019 3300053085 Bacteria 209518
1998 Ga0495619_0000045 3300053085 Bacteria 108543
1999 Ga0495619_0000337 3300053085 Bacteria 32903
2000 Ga0495619_0002863 3300053085 Bacteria 11240
2001 Ga0495619_0006500 3300053085 Bacteria 7398
2002 Ga0495619_0014870 3300053085 Bacteria 4916
2003 Ga0495619_0017529 3300053085 Bacteria 4535
2004 Ga0495619_0027880 3300053085 Bacteria 3642
2005 Ga0495619_0036704 3300053085 Bacteria 3192
2006 Ga0495619_0037279 3300053085 Bacteria 3166
2007 Ga0495619_0097299 3300053085 Bacteria 1999
2008 Ga0495619_0106868 3300053085 Bacteria 1909
2009 Ga0495619_0149872 3300053085 Bacteria 1609
2010 Ga0495619_0151213 3300053085 Bacteria 1601
2011 Ga0495619_0170732 3300053085 Bacteria 1504
2012 Ga0495619_0185012 3300053085 Bacteria 1441
2013 Ga0500583_0463916 3300053092 Bacteria 600
2014 Ga0500566_0091176 3300053094 Bacteria 1684
2015 Ga0500566_0234622 3300053094 Bacteria 903
2016 Ga0500566_0261252 3300053094 Bacteria 836
2017 Ga0500554_048007 3300053102 Bacteria 1334
2018 Ga0500572_001844 3300053111 Bacteria 5368
2019 Ga0500594_0020316 3300053118 Bacteria 1656
2020 Ga0500595_003476 3300053119 Bacteria 7330
2021 Ga0500595_032431 3300053119 Bacteria 1744
2022 Ga0500597_157720 3300053120 Bacteria 972
2023 Ga0500658_0021369 3300053134 Bacteria 2450
2024 Ga0500659_0129596 3300053135 Bacteria 1279
2025 Ga0500559_0000226 3300053136 Bacteria 45182
2026 Ga0500603_000752 3300053150 Bacteria 7866
2027 Ga0500603_035113 3300053150 Bacteria 1313
2028 Ga0500616_0000048 3300053153 Bacteria 313108
2029 Ga0500616_0020976 3300053153 Bacteria 3667
2030 Ga0500619_050394 3300053154 Bacteria 1346
2031 Ga0500627_0183772 3300053158 Bacteria 940
2032 Ga0500639_022150 3300053163 Bacteria 3356
2033 Ga0500639_174928 3300053163 Bacteria 957
2034 Ga0500636_0113867 3300053177 Bacteria 1524
2035 Ga0500576_089735 3300053725 Bacteria 1279
2036 Ga0500596_002085 3300053735 Bacteria 3977
2037 Ga0501084_0041967 3300054114 Bacteria 3826
2038 Ga0501084_0082116 3300054114 Bacteria 2704
2039 Ga0501084_0176333 3300054114 Bacteria 1804
2040 Ga0501084_0337376 3300054114 Bacteria 1273
2041 Ga0501084_0381981 3300054114 Bacteria 1190
2042 Ga0501084_0483637 3300054114 Bacteria 1046
2043 Ga0501084_0809502 3300054114 Bacteria 789
2044 Ga0590077_018053 3300059426 Bacteria 1488
2045 Ga0501082_0017497 3300060353 Bacteria 6176
2046 Ga0501082_0118846 3300060353 Bacteria 2290
2047 Ga0501082_0173400 3300060353 Bacteria 1875
2048 Ga0501082_0698256 3300060353 Bacteria 888
2049 Ga0501082_1181799 3300060353 Bacteria 669
2050 Ga0466962_0036473 3300061719 Bacteria 2353
2051 Ga0530510_0041355 3300061734 Bacteria 3328
2052 Ga0530510_0207320 3300061734 Bacteria 1456
2053 Ga0530510_0220338 3300061734 Bacteria 1410
2054 Ga0530510_0312681 3300061734 Bacteria 1177
2055 Ga0530510_0342914 3300061734 Bacteria 1122

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005437 Ga0070710_10087576 Ga0070710_100875763 169
2 3300006175 Ga0070712_100190053 Ga0070712_1001900532 169
3 3300005439 Ga0070711_100082175 Ga0070711_1000821752 170
4 3300005546 Ga0070696_100110290 Ga0070696_1001102903 170
5 3300048912 Ga0496109_0983083 Ga0496109_0983083_205_768 170
6 3300050512 nmdc:mga0n895_484605_c1 nmdc:mga0n895_484605_c1_639_1202 170
7 3300041492 Ga0451835_0194448 Ga0451835_0194448_398_970 175
8 3300039450 Ga0436363_1600909 Ga0436363_1600909_1504_2067 179
9 3300003215 JGI25153J46596_10003455 JGI25153J46596_100034552 182
10 3300041494 Ga0451837_0252974 Ga0451837_0252974_450_1022 182
11 3300041494 Ga0451837_1245134 Ga0451837_1245134_548_1120 182
12 3300041496 Ga0451839_1310039 Ga0451839_1310039_1377_1949 182
13 3300041501 Ga0451845_0489020 Ga0451845_0489020_52_624 182
14 3300041503 Ga0451847_0889404 Ga0451847_0889404_548_1120 182
15 3300041507 Ga0451851_0804289 Ga0451851_0804289_330_902 182
16 3300041511 Ga0451855_1036748 Ga0451855_1036748_450_1022 182
17 3300041511 Ga0451855_1945056 Ga0451855_1945056_1446_2018 182
18 3300046474 Ga0495605_0060303 Ga0495605_0060303_113_685 182
19 3300046491 Ga0495584_0198490 Ga0495584_0198490_281_853 182
20 3300046500 Ga0495596_0039269 Ga0495596_0039269_1110_1682 182
21 3300046501 Ga0495607_0065977 Ga0495607_0065977_392_964 182
22 3300046506 Ga0495583_0055013 Ga0495583_0055013_913_1485 182
23 3300046507 Ga0495606_0015262 Ga0495606_0015262_1059_1631 182
24 3300046512 Ga0495610_0002941 Ga0495610_0002941_7728_8300 182
25 3300046513 Ga0495616_0013357 Ga0495616_0013357_3532_4104 182
26 3300046515 Ga0495620_0022569 Ga0495620_0022569_1317_1889 182
27 3300046519 Ga0495632_0006566 Ga0495632_0006566_2837_3409 182
28 3300046530 Ga0495654_0032320 Ga0495654_0032320_1281_1853 182
29 3300046542 Ga0495597_0116357 Ga0495597_0116357_161_733 182
30 3300046616 Ga0495668_0012497 Ga0495668_0012497_691_1263 182
31 3300046660 Ga0495625_0026417 Ga0495625_0026417_1777_2349 182
32 3300046692 Ga0495671_0017211 Ga0495671_0017211_2516_3088 182
33 3300046810 Ga0495660_0011331 Ga0495660_0011331_289_861 182
34 3300047318 Ga0495636_0006880 Ga0495636_0006880_2428_3000 182
35 3300047323 Ga0495683_0133973 Ga0495683_0133973_208_780 182
36 3300047445 Ga0495677_0123303 Ga0495677_0123303_194_766 182
37 3300047472 Ga0495686_0045721 Ga0495686_0045721_1430_2002 182
38 3300053118 Ga0500594_0020316 Ga0500594_0020316_272_844 182
39 3300053134 Ga0500658_0021369 Ga0500658_0021369_1853_2425 182
40 3300053135 Ga0500659_0129596 Ga0500659_0129596_490_1062 182
41 3300053153 Ga0500616_0020976 Ga0500616_0020976_2328_2900 182
42 3300005434 Ga0070709_10038223 Ga0070709_100382233 185
43 3300006173 Ga0070716_100027997 Ga0070716_1000279974 185
44 3300025898 Ga0207692_10044727 Ga0207692_100447272 185
45 3300025939 Ga0207665_10000825 Ga0207665_1000082514 185
46 3300048903 Ga0496100_0072884 Ga0496100_0072884_1083_1703 185
47 3300048909 Ga0496106_0398041 Ga0496106_0398041_450_1070 185
48 3300050507 nmdc:mga05p37_303319_c1 nmdc:mga05p37_303319_c1_196_816 185
49 3300005435 Ga0070714_100073915 Ga0070714_1000739153 186
50 3300006163 Ga0070715_10000850 Ga0070715_100008508 186
51 3300006175 Ga0070712_100206946 Ga0070712_1002069462 186
52 3300006846 Ga0075430_100218988 Ga0075430_1002189882 186
53 3300006847 Ga0075431_100060026 Ga0075431_1000600263 186
54 3300006847 Ga0075431_100214019 Ga0075431_1002140192 186
55 3300006871 Ga0075434_100189692 Ga0075434_1001896922 186
56 3300013297 Ga0157378_10904180 Ga0157378_109041801 186
57 3300014497 Ga0182008_10202850 Ga0182008_102028501 186
58 3300025915 Ga0207693_10020232 Ga0207693_100202323 186
59 3300025928 Ga0207700_10060200 Ga0207700_100602003 186
60 3300025929 Ga0207664_10494438 Ga0207664_104944382 186
61 3300031239 Ga0265328_10000026 Ga0265328_1000002637 186
62 3300031250 Ga0265331_10037945 Ga0265331_100379451 186
63 3300031251 Ga0265327_10177658 Ga0265327_101776582 186
64 3300036401 Ga0373937_0589798 Ga0373937_0589798_49_609 186
65 3300045051 Ga0451576_1214078 Ga0451576_1214078_69_629 186
66 3300045976 Ga0466967_0205589 Ga0466967_0205589_59_619 186
67 3300048905 Ga0496102_0130038 Ga0496102_0130038_1039_1659 186
68 3300048907 Ga0496104_0125167 Ga0496104_0125167_1670_2230 186
69 3300048910 Ga0496107_0476376 Ga0496107_0476376_121_741 186
70 3300048913 Ga0496110_0371510 Ga0496110_0371510_530_1090 186
71 3300049591 Ga0501075_0578113 Ga0501075_0578113_287_847 186
72 3300050510 nmdc:mga06r32_170522_c1 nmdc:mga06r32_170522_c1_921_1481 186
73 3300050510 nmdc:mga06r32_94267_c1 nmdc:mga06r32_94267_c1_683_1243 186
74 3300050514 nmdc:mga08x19_471515_c1 nmdc:mga08x19_471515_c1_41_661 186
75 3300050515 nmdc:mga0a205_83640_c1 nmdc:mga0a205_83640_c1_387_1007 186
76 3300053084 Ga0495595_0052867 Ga0495595_0052867_1185_1745 186
77 3300005344 Ga0070661_100203003 Ga0070661_1002030032 187
78 3300005355 Ga0070671_100550212 Ga0070671_1005502121 187
79 3300005356 Ga0070674_100911808 Ga0070674_1009118081 187
80 3300005436 Ga0070713_100120138 Ga0070713_1001201383 187
81 3300005445 Ga0070708_100148159 Ga0070708_1001481592 187
82 3300005445 Ga0070708_100219043 Ga0070708_1002190433 187
83 3300005457 Ga0070662_100004351 Ga0070662_1000043516 187
84 3300005467 Ga0070706_100440725 Ga0070706_1004407252 187
85 3300005467 Ga0070706_100880018 Ga0070706_1008800181 187
86 3300005518 Ga0070699_100026547 Ga0070699_1000265476 187
87 3300005564 Ga0070664_100015657 Ga0070664_1000156574 187
88 3300005614 Ga0068856_100583538 Ga0068856_1005835382 187
89 3300005617 Ga0068859_100105649 Ga0068859_1001056492 187
90 3300005844 Ga0068862_100648838 Ga0068862_1006488382 187
91 3300005985 Ga0081539_10082767 Ga0081539_100827672 187
92 3300006178 Ga0075367_10523367 Ga0075367_105233672 187
93 3300006847 Ga0075431_100416175 Ga0075431_1004161752 187
94 3300006852 Ga0075433_10245363 Ga0075433_102453632 187
95 3300006871 Ga0075434_100521425 Ga0075434_1005214251 187
96 3300006880 Ga0075429_100288261 Ga0075429_1002882612 187
97 3300006931 Ga0097620_100105653 Ga0097620_1001056532 187
98 3300007265 Ga0099794_10107450 Ga0099794_101074502 187
99 3300009093 Ga0105240_10457775 Ga0105240_104577751 187
100 3300009093 Ga0105240_10735976 Ga0105240_107359762 187
101 3300009098 Ga0105245_11174469 Ga0105245_111744692 187
102 3300009101 Ga0105247_10060606 Ga0105247_100606063 187
103 3300009101 Ga0105247_10219651 Ga0105247_102196512 187
104 3300009147 Ga0114129_10365071 Ga0114129_103650712 187
105 3300009147 Ga0114129_10380029 Ga0114129_103800293 187
106 3300009147 Ga0114129_11432520 Ga0114129_114325202 187
107 3300009148 Ga0105243_10048219 Ga0105243_100482193 187
108 3300012512 Ga0157327_1030411 Ga0157327_10304111 187
109 3300014326 Ga0157380_10320795 Ga0157380_103207952 187
110 3300021361 Ga0213872_10025568 Ga0213872_100255682 187
111 3300025910 Ga0207684_10142999 Ga0207684_101429992 187
112 3300025919 Ga0207657_10510325 Ga0207657_105103252 187
113 3300025921 Ga0207652_10404956 Ga0207652_104049562 187
114 3300025922 Ga0207646_10106854 Ga0207646_101068542 187
115 3300025928 Ga0207700_10344662 Ga0207700_103446622 187
116 3300025931 Ga0207644_10491064 Ga0207644_104910641 187
117 3300025933 Ga0207706_10022294 Ga0207706_100222944 187
118 3300025937 Ga0207669_10749858 Ga0207669_107498581 187
119 3300028379 Ga0268266_10851973 Ga0268266_108519731 187
120 3300028380 Ga0268265_10547191 Ga0268265_105471912 187
121 3300028577 Ga0265318_10027029 Ga0265318_100270293 187
122 3300031235 Ga0265330_10008884 Ga0265330_100088841 187
123 3300031238 Ga0265332_10042205 Ga0265332_100422053 187
124 3300031239 Ga0265328_10006008 Ga0265328_100060083 187
125 3300031240 Ga0265320_10009042 Ga0265320_100090424 187
126 3300031241 Ga0265325_10068881 Ga0265325_100688811 187
127 3300031241 Ga0265325_10263813 Ga0265325_102638132 187
128 3300031247 Ga0265340_10007623 Ga0265340_100076234 187
129 3300031247 Ga0265340_10009168 Ga0265340_100091686 187
130 3300031249 Ga0265339_10036438 Ga0265339_100364384 187
131 3300031250 Ga0265331_10004918 Ga0265331_1000491810 187
132 3300031250 Ga0265331_10284816 Ga0265331_102848162 187
133 3300031344 Ga0265316_10154832 Ga0265316_101548322 187
134 3300031595 Ga0265313_10005864 Ga0265313_1000586412 187
135 3300031595 Ga0265313_10051022 Ga0265313_100510223 187
136 3300031711 Ga0265314_10003957 Ga0265314_1000395713 187
137 3300031711 Ga0265314_10096515 Ga0265314_100965153 187
138 3300031712 Ga0265342_10062661 Ga0265342_100626612 187
139 3300031712 Ga0265342_10228359 Ga0265342_102283592 187
140 3300035086 Ga0373934_0099610 Ga0373934_0099610_451_1014 187
141 3300035086 Ga0373934_0173491 Ga0373934_0173491_95_658 187
142 3300035111 Ga0373923_0021910 Ga0373923_0021910_53_616 187
143 3300035119 Ga0373956_0196877 Ga0373956_0196877_259_822 187
144 3300035410 Ga0373924_0327570 Ga0373924_0327570_66_629 187
145 3300035692 Ga0373935_0546722 Ga0373935_0546722_67_633 187
146 3300035695 Ga0373927_0173570 Ga0373927_0173570_26_589 187
147 3300036401 Ga0373937_0100053 Ga0373937_0100053_1169_1732 187
148 3300036401 Ga0373937_0260878 Ga0373937_0260878_411_977 187
149 3300036458 Ga0310112_022639 Ga0310112_022639_283_846 187
150 3300039447 Ga0436361_0835040 Ga0436361_0835040_4342_4905 187
151 3300039453 Ga0436362_0090365 Ga0436362_0090365_275_838 187
152 3300044706 Ga0466964_0478120 Ga0466964_0478120_67_630 187
153 3300045976 Ga0466967_0696315 Ga0466967_0696315_251_814 187
154 3300046455 Ga0495603_0155464 Ga0495603_0155464_612_1175 187
155 3300046473 Ga0495582_0467154 Ga0495582_0467154_49_615 187
156 3300046477 Ga0495664_0085829 Ga0495664_0085829_1308_1871 187
157 3300046516 Ga0495628_0378674 Ga0495628_0378674_299_865 187
158 3300046520 Ga0495637_0246581 Ga0495637_0246581_55_618 187
159 3300046523 Ga0495644_0031367 Ga0495644_0031367_1419_1982 187
160 3300046664 Ga0495659_0014664 Ga0495659_0014664_410_973 187
161 3300046664 Ga0495659_0268170 Ga0495659_0268170_58_621 187
162 3300046689 Ga0495613_0407195 Ga0495613_0407195_69_632 187
163 3300047319 Ga0495674_0362064 Ga0495674_0362064_444_1010 187
164 3300047320 Ga0495672_0082483 Ga0495672_0082483_851_1414 187
165 3300048912 Ga0496109_0001821 Ga0496109_0001821_15089_15652 187
166 3300048913 Ga0496110_0187134 Ga0496110_0187134_352_915 187
167 3300048913 Ga0496110_0624163 Ga0496110_0624163_377_940 187
168 3300048914 Ga0496111_0017445 Ga0496111_0017445_568_1131 187
169 3300048914 Ga0496111_0118761 Ga0496111_0118761_416_979 187
170 3300048914 Ga0496111_0752116 Ga0496111_0752116_36_599 187
171 3300048916 Ga0496113_0079560 Ga0496113_0079560_1528_2091 187
172 3300048922 Ga0496119_0280865 Ga0496119_0280865_28_591 187
173 3300048925 Ga0496122_0031165 Ga0496122_0031165_1629_2192 187
174 3300048929 Ga0496126_0011577 Ga0496126_0011577_1457_2020 187
175 3300048929 Ga0496126_0022043 Ga0496126_0022043_1551_2114 187
176 3300048929 Ga0496126_0030338 Ga0496126_0030338_3282_3845 187
177 3300048929 Ga0496126_0434443 Ga0496126_0434443_152_715 187
178 3300049568 Ga0501031_0009458 Ga0501031_0009458_10_573 187
179 3300049568 Ga0501031_0311177 Ga0501031_0311177_42_605 187
180 3300049569 Ga0501032_0281678 Ga0501032_0281678_483_1046 187
181 3300049571 Ga0501034_0773272 Ga0501034_0773272_99_662 187
182 3300049573 Ga0501037_0302380 Ga0501037_0302380_527_1090 187
183 3300049574 Ga0501038_0426717 Ga0501038_0426717_428_991 187
184 3300049575 Ga0501039_0073132 Ga0501039_0073132_351_914 187
185 3300049578 Ga0501042_0121299 Ga0501042_0121299_603_1166 187
186 3300049580 Ga0501046_0606059 Ga0501046_0606059_202_765 187
187 3300049582 Ga0501048_0460563 Ga0501048_0460563_305_868 187
188 3300049582 Ga0501048_0477572 Ga0501048_0477572_311_874 187
189 3300049585 Ga0501069_0424913 Ga0501069_0424913_142_705 187
190 3300049586 Ga0501070_0254728 Ga0501070_0254728_439_1002 187
191 3300049587 Ga0501071_0159817 Ga0501071_0159817_79_642 187
192 3300049588 Ga0501072_0015238 Ga0501072_0015238_3261_3827 187
193 3300049588 Ga0501072_0067723 Ga0501072_0067723_1755_2318 187
194 3300049589 Ga0501073_0172528 Ga0501073_0172528_888_1451 187
195 3300049589 Ga0501073_0433910 Ga0501073_0433910_18_581 187
196 3300049589 Ga0501073_0488844 Ga0501073_0488844_224_787 187
197 3300049590 Ga0501074_0280602 Ga0501074_0280602_55_618 187
198 3300049592 Ga0501076_0125129 Ga0501076_0125129_762_1325 187
199 3300049593 Ga0501077_0449444 Ga0501077_0449444_219_782 187
200 3300049741 Ga0501079_0035642 Ga0501079_0035642_2430_2993 187
201 3300049742 Ga0501080_0801770 Ga0501080_0801770_29_592 187
202 3300049743 Ga0501081_0283839 Ga0501081_0283839_594_1157 187
203 3300049744 Ga0501083_0046328 Ga0501083_0046328_1627_2193 187
204 3300049744 Ga0501083_0108050 Ga0501083_0108050_809_1372 187
205 3300049822 Ga0501035_0094099 Ga0501035_0094099_512_1075 187
206 3300050507 nmdc:mga05p37_168275_c1 nmdc:mga05p37_168275_c1_511_1074 187
207 3300050507 nmdc:mga05p37_523814_c1 nmdc:mga05p37_523814_c1_159_722 187
208 3300050508 nmdc:mga09592_283874_c1 nmdc:mga09592_283874_c1_764_1327 187
209 3300050508 nmdc:mga09592_45615_c1 nmdc:mga09592_45615_c1_2499_3062 187
210 3300050509 nmdc:mga0qj67_89806_c1 nmdc:mga0qj67_89806_c1_328_891 187
211 3300050510 nmdc:mga06r32_24096_c1 nmdc:mga06r32_24096_c1_1335_1898 187
212 3300050515 nmdc:mga0a205_264829_c1 nmdc:mga0a205_264829_c1_536_1099 187
213 3300053077 Ga0495601_0025768 Ga0495601_0025768_421_987 187
214 3300053077 Ga0495601_0199043 Ga0495601_0199043_724_1287 187
215 3300053078 Ga0495612_0259827 Ga0495612_0259827_80_646 187
216 3300053085 Ga0495619_0014870 Ga0495619_0014870_2281_2847 187
217 3300053111 Ga0500572_001844 Ga0500572_001844_4529_5092 187
218 3300053136 Ga0500559_0000226 Ga0500559_0000226_33781_34344 187
219 3300053163 Ga0500639_022150 Ga0500639_022150_302_865 187
220 3300053725 Ga0500576_089735 Ga0500576_089735_234_797 187
221 3300053735 Ga0500596_002085 Ga0500596_002085_3163_3726 187
222 3300054114 Ga0501084_0176333 Ga0501084_0176333_26_589 187
223 3300054114 Ga0501084_0337376 Ga0501084_0337376_36_599 187
224 3300054114 Ga0501084_0809502 Ga0501084_0809502_79_642 187
225 3300060353 Ga0501082_0118846 Ga0501082_0118846_37_600 187
226 3300060353 Ga0501082_0698256 Ga0501082_0698256_101_664 187
227 3300061734 Ga0530510_0207320 Ga0530510_0207320_445_1008 187
228 3300061734 Ga0530510_0220338 Ga0530510_0220338_560_1123 187
229 3300005330 Ga0070690_100024817 Ga0070690_1000248171 188
230 3300005337 Ga0070682_100265912 Ga0070682_1002659121 188
231 3300005338 Ga0068868_100048532 Ga0068868_1000485322 188
232 3300005341 Ga0070691_10246280 Ga0070691_102462802 188
233 3300005347 Ga0070668_101225085 Ga0070668_1012250851 188
234 3300005355 Ga0070671_100814341 Ga0070671_1008143411 188
235 3300005434 Ga0070709_10661640 Ga0070709_106616401 188
236 3300005435 Ga0070714_100253762 Ga0070714_1002537623 188
237 3300005435 Ga0070714_100695831 Ga0070714_1006958312 188
238 3300005436 Ga0070713_100180315 Ga0070713_1001803152 188
239 3300005440 Ga0070705_100218251 Ga0070705_1002182512 188
240 3300005456 Ga0070678_100002106 Ga0070678_1000021069 188
241 3300005458 Ga0070681_10348818 Ga0070681_103488182 188
242 3300005535 Ga0070684_100183026 Ga0070684_1001830263 188
243 3300005545 Ga0070695_100443143 Ga0070695_1004431432 188
244 3300005614 Ga0068856_100146512 Ga0068856_1001465123 188
245 3300005614 Ga0068856_100710135 Ga0068856_1007101351 188
246 3300005615 Ga0070702_100015144 Ga0070702_1000151444 188
247 3300005618 Ga0068864_101060300 Ga0068864_1010603001 188
248 3300005937 Ga0081455_10154528 Ga0081455_101545282 188
249 3300005985 Ga0081539_10022785 Ga0081539_100227853 188
250 3300006028 Ga0070717_10047666 Ga0070717_100476662 188
251 3300006028 Ga0070717_10144217 Ga0070717_101442171 188
252 3300006038 Ga0075365_10045928 Ga0075365_100459284 188
253 3300006048 Ga0075363_100065225 Ga0075363_1000652252 188
254 3300006051 Ga0075364_10047888 Ga0075364_100478884 188
255 3300006173 Ga0070716_100065632 Ga0070716_1000656324 188
256 3300006195 Ga0075366_10066738 Ga0075366_100667382 188
257 3300006353 Ga0075370_10022313 Ga0075370_100223134 188
258 3300006846 Ga0075430_100679355 Ga0075430_1006793552 188
259 3300006847 Ga0075431_100000032 Ga0075431_10000003229 188
260 3300006847 Ga0075431_100347055 Ga0075431_1003470552 188
261 3300006914 Ga0075436_100056822 Ga0075436_1000568222 188
262 3300006914 Ga0075436_100110799 Ga0075436_1001107993 188
263 3300007076 Ga0075435_100174718 Ga0075435_1001747182 188
264 3300009093 Ga0105240_10547925 Ga0105240_105479251 188
265 3300009098 Ga0105245_10039066 Ga0105245_100390662 188
266 3300009148 Ga0105243_10848620 Ga0105243_108486201 188
267 3300009174 Ga0105241_10291292 Ga0105241_102912923 188
268 3300009174 Ga0105241_10946204 Ga0105241_109462041 188
269 3300009177 Ga0105248_10511498 Ga0105248_105114982 188
270 3300009551 Ga0105238_10032820 Ga0105238_100328203 188
271 3300009551 Ga0105238_10405314 Ga0105238_104053143 188
272 3300009553 Ga0105249_10139820 Ga0105249_101398203 188
273 3300009553 Ga0105249_10332018 Ga0105249_103320183 188
274 3300010159 Ga0099796_10018289 Ga0099796_100182893 188
275 3300010375 Ga0105239_10090961 Ga0105239_100909614 188
276 3300010375 Ga0105239_10373912 Ga0105239_103739121 188
277 3300010375 Ga0105239_10624879 Ga0105239_106248792 188
278 3300012498 Ga0157345_1014588 Ga0157345_10145882 188
279 3300013100 Ga0157373_10368676 Ga0157373_103686762 188
280 3300013105 Ga0157369_10756862 Ga0157369_107568622 188
281 3300013296 Ga0157374_10011075 Ga0157374_100110759 188
282 3300013296 Ga0157374_10119152 Ga0157374_101191523 188
283 3300013297 Ga0157378_10096516 Ga0157378_100965164 188
284 3300013297 Ga0157378_11145382 Ga0157378_111453822 188
285 3300013306 Ga0163162_10060159 Ga0163162_100601594 188
286 3300013307 Ga0157372_10423846 Ga0157372_104238462 188
287 3300013308 Ga0157375_10079872 Ga0157375_100798724 188
288 3300013308 Ga0157375_11442454 Ga0157375_114424542 188
289 3300014325 Ga0163163_10857482 Ga0163163_108574821 188
290 3300025898 Ga0207692_10053756 Ga0207692_100537562 188
291 3300025898 Ga0207692_10101946 Ga0207692_101019462 188
292 3300025899 Ga0207642_10122853 Ga0207642_101228532 188
293 3300025904 Ga0207647_10088524 Ga0207647_100885243 188
294 3300025906 Ga0207699_10067880 Ga0207699_100678803 188
295 3300025911 Ga0207654_10463711 Ga0207654_104637111 188
296 3300025912 Ga0207707_10259783 Ga0207707_102597832 188
297 3300025915 Ga0207693_10335606 Ga0207693_103356062 188
298 3300025916 Ga0207663_10246205 Ga0207663_102462052 188
299 3300025928 Ga0207700_10211376 Ga0207700_102113762 188
300 3300025928 Ga0207700_10229015 Ga0207700_102290151 188
301 3300025929 Ga0207664_10180715 Ga0207664_101807152 188
302 3300025929 Ga0207664_10525780 Ga0207664_105257802 188
303 3300025933 Ga0207706_10243869 Ga0207706_102438693 188
304 3300025933 Ga0207706_10360978 Ga0207706_103609782 188
305 3300025934 Ga0207686_10282828 Ga0207686_102828281 188
306 3300025935 Ga0207709_10777548 Ga0207709_107775482 188
307 3300025936 Ga0207670_10197476 Ga0207670_101974762 188
308 3300025938 Ga0207704_10607486 Ga0207704_106074862 188
309 3300025939 Ga0207665_10408344 Ga0207665_104083442 188
310 3300025941 Ga0207711_10671957 Ga0207711_106719572 188
311 3300025942 Ga0207689_10024716 Ga0207689_100247164 188
312 3300025945 Ga0207679_10431133 Ga0207679_104311332 188
313 3300025972 Ga0207668_10262192 Ga0207668_102621922 188
314 3300025981 Ga0207640_10134383 Ga0207640_101343833 188
315 3300025986 Ga0207658_10316698 Ga0207658_103166982 188
316 3300026023 Ga0207677_10118439 Ga0207677_101184392 188
317 3300026067 Ga0207678_10224972 Ga0207678_102249722 188
318 3300026116 Ga0207674_10239076 Ga0207674_102390763 188
319 3300026118 Ga0207675_100729524 Ga0207675_1007295242 188
320 3300028379 Ga0268266_10494898 Ga0268266_104948982 188
321 3300028381 Ga0268264_11078859 Ga0268264_110788592 188
322 3300028573 Ga0265334_10014411 Ga0265334_100144113 188
323 3300028800 Ga0265338_10032762 Ga0265338_100327624 188
324 3300028800 Ga0265338_10095950 Ga0265338_100959505 188
325 3300031241 Ga0265325_10005989 Ga0265325_100059892 188
326 3300031242 Ga0265329_10065707 Ga0265329_100657072 188
327 3300031247 Ga0265340_10007960 Ga0265340_100079605 188
328 3300031247 Ga0265340_10206947 Ga0265340_102069472 188
329 3300031249 Ga0265339_10000129 Ga0265339_1000012934 188
330 3300031250 Ga0265331_10228801 Ga0265331_102288012 188
331 3300031344 Ga0265316_10057703 Ga0265316_100577034 188
332 3300031595 Ga0265313_10003048 Ga0265313_100030483 188
333 3300031595 Ga0265313_10088633 Ga0265313_100886333 188
334 3300034816 Ga0373930_0009769 Ga0373930_0009769_283_849 188
335 3300034820 Ga0373959_0023177 Ga0373959_0023177_186_752 188
336 3300034957 Ga0373938_0001449 Ga0373938_0001449_1247_1813 188
337 3300035083 Ga0373926_0071837 Ga0373926_0071837_253_837 188
338 3300035083 Ga0373926_0101291 Ga0373926_0101291_501_1067 188
339 3300035084 Ga0373928_0049353 Ga0373928_0049353_164_730 188
340 3300035085 Ga0373929_0034028 Ga0373929_0034028_488_1054 188
341 3300035086 Ga0373934_0023087 Ga0373934_0023087_618_1202 188
342 3300035088 Ga0373940_0003791 Ga0373940_0003791_139_705 188
343 3300035090 Ga0373949_0004025 Ga0373949_0004025_2374_2940 188
344 3300035091 Ga0373951_0017013 Ga0373951_0017013_63_629 188
345 3300035092 Ga0373952_0003348 Ga0373952_0003348_1009_1575 188
346 3300035111 Ga0373923_0006210 Ga0373923_0006210_1972_2556 188
347 3300035111 Ga0373923_0207115 Ga0373923_0207115_85_651 188
348 3300035112 Ga0373932_0001785 Ga0373932_0001785_1656_2222 188
349 3300035113 Ga0373936_0001726 Ga0373936_0001726_3040_3624 188
350 3300035113 Ga0373936_0119661 Ga0373936_0119661_429_995 188
351 3300035114 Ga0373939_0005387 Ga0373939_0005387_1008_1574 188
352 3300035115 Ga0373941_0137201 Ga0373941_0137201_147_713 188
353 3300035116 Ga0373945_0006908 Ga0373945_0006908_2864_3448 188
354 3300035116 Ga0373945_0007495 Ga0373945_0007495_181_747 188
355 3300035116 Ga0373945_0010561 Ga0373945_0010561_363_929 188
356 3300035117 Ga0373953_0003236 Ga0373953_0003236_3282_3848 188
357 3300035117 Ga0373953_0009247 Ga0373953_0009247_996_1580 188
358 3300035118 Ga0373954_0002842 Ga0373954_0002842_6691_7275 188
359 3300035118 Ga0373954_0031465 Ga0373954_0031465_1152_1718 188
360 3300035119 Ga0373956_0201483 Ga0373956_0201483_39_623 188
361 3300035119 Ga0373956_0428629 Ga0373956_0428629_20_586 188
362 3300035120 Ga0373957_0007235 Ga0373957_0007235_1651_2235 188
363 3300035120 Ga0373957_0035281 Ga0373957_0035281_414_980 188
364 3300035170 Ga0373943_0006093 Ga0373943_0006093_4269_4853 188
365 3300035170 Ga0373943_0076183 Ga0373943_0076183_335_901 188
366 3300035170 Ga0373943_0108079 Ga0373943_0108079_306_872 188
367 3300035170 Ga0373943_0578089 Ga0373943_0578089_42_608 188
368 3300035171 Ga0373946_0005535 Ga0373946_0005535_2572_3138 188
369 3300035171 Ga0373946_0006570 Ga0373946_0006570_92_658 188
370 3300035171 Ga0373946_0007005 Ga0373946_0007005_1736_2320 188
371 3300035171 Ga0373946_0007518 Ga0373946_0007518_157_723 188
372 3300035171 Ga0373946_0158999 Ga0373946_0158999_406_972 188
373 3300035172 Ga0373955_0000030 Ga0373955_0000030_46435_47019 188
374 3300035172 Ga0373955_0004218 Ga0373955_0004218_2674_3240 188
375 3300035172 Ga0373955_0008682 Ga0373955_0008682_843_1409 188
376 3300035172 Ga0373955_0061721 Ga0373955_0061721_1237_1803 188
377 3300035207 Ga0373942_0000195 Ga0373942_0000195_9752_10318 188
378 3300035241 Ga0373961_0015429 Ga0373961_0015429_287_853 188
379 3300035242 Ga0373962_0005521 Ga0373962_0005521_907_1473 188
380 3300035410 Ga0373924_0002834 Ga0373924_0002834_3113_3697 188
381 3300035410 Ga0373924_0029401 Ga0373924_0029401_941_1507 188
382 3300035691 Ga0373931_0008927 Ga0373931_0008927_1775_2341 188
383 3300035691 Ga0373931_0048694 Ga0373931_0048694_1484_2050 188
384 3300035691 Ga0373931_0130799 Ga0373931_0130799_806_1372 188
385 3300035692 Ga0373935_0001222 Ga0373935_0001222_4281_4847 188
386 3300035692 Ga0373935_0001936 Ga0373935_0001936_3116_3700 188
387 3300035692 Ga0373935_0005030 Ga0373935_0005030_2344_2910 188
388 3300035692 Ga0373935_0039541 Ga0373935_0039541_2373_2939 188
389 3300035695 Ga0373927_0002079 Ga0373927_0002079_6476_7042 188
390 3300035695 Ga0373927_0004882 Ga0373927_0004882_7462_8046 188
391 3300035695 Ga0373927_0039907 Ga0373927_0039907_865_1431 188
392 3300035695 Ga0373927_0053254 Ga0373927_0053254_2033_2599 188
393 3300035724 Ga0373933_0006802 Ga0373933_0006802_2360_2926 188
394 3300035724 Ga0373933_0012648 Ga0373933_0012648_1857_2441 188
395 3300035724 Ga0373933_0078580 Ga0373933_0078580_947_1513 188
396 3300035725 Ga0373947_0000706 Ga0373947_0000706_12401_12985 188
397 3300035725 Ga0373947_0009808 Ga0373947_0009808_1876_2442 188
398 3300035725 Ga0373947_0233719 Ga0373947_0233719_575_1141 188
399 3300035725 Ga0373947_0433622 Ga0373947_0433622_25_594 188
400 3300036401 Ga0373937_0000004 Ga0373937_0000004_159838_160422 188
401 3300036401 Ga0373937_0005511 Ga0373937_0005511_5594_6160 188
402 3300036401 Ga0373937_0007052 Ga0373937_0007052_3128_3694 188
403 3300036401 Ga0373937_0016354 Ga0373937_0016354_101_667 188
404 3300036401 Ga0373937_0016644 Ga0373937_0016644_3732_4298 188
405 3300036401 Ga0373937_0103937 Ga0373937_0103937_2054_2620 188
406 3300036459 Ga0372808_026249 Ga0372808_026249_21_599 188
407 3300037068 Ga0373925_0000095 Ga0373925_0000095_52591_53175 188
408 3300037068 Ga0373925_0002028 Ga0373925_0002028_12056_12622 188
409 3300037068 Ga0373925_0016370 Ga0373925_0016370_1421_1987 188
410 3300037068 Ga0373925_0406365 Ga0373925_0406365_293_859 188
411 3300037068 Ga0373925_1228245 Ga0373925_1228245_28_594 188
412 3300037312 Ga0395899_0011749 Ga0395899_0011749_26_616 188
413 3300037312 Ga0395899_0099131 Ga0395899_0099131_160_750 188
414 3300037418 Ga0395900_0005502 Ga0395900_0005502_6902_7492 188
415 3300037466 Ga0395898_0031330 Ga0395898_0031330_3890_4480 188
416 3300037588 Ga0316581_0125042 Ga0316581_0125042_188_754 188
417 3300037853 Ga0436364_1448938 Ga0436364_1448938_638_1210 188
418 3300039437 Ga0436365_0397873 Ga0436365_0397873_170_736 188
419 3300039438 Ga0436360_0499741 Ga0436360_0499741_1558_2127 188
420 3300042001 Ga0439441_088330 Ga0439441_088330_90_656 188
421 3300042005 Ga0439448_0044960 Ga0439448_0044960_517_1083 188
422 3300042439 Ga0439464_0131605 Ga0439464_0131605_150_716 188
423 3300046454 Ga0495592_0000029 Ga0495592_0000029_54447_55031 188
424 3300046454 Ga0495592_0000962 Ga0495592_0000962_12163_12729 188
425 3300046454 Ga0495592_0034589 Ga0495592_0034589_37_603 188
426 3300046454 Ga0495592_0077905 Ga0495592_0077905_36_602 188
427 3300046454 Ga0495592_0344920 Ga0495592_0344920_54_620 188
428 3300046455 Ga0495603_0001123 Ga0495603_0001123_13063_13629 188
429 3300046455 Ga0495603_0001962 Ga0495603_0001962_10072_10638 188
430 3300046455 Ga0495603_0022694 Ga0495603_0022694_3115_3681 188
431 3300046459 Ga0495629_0000316 Ga0495629_0000316_11955_12521 188
432 3300046459 Ga0495629_0002795 Ga0495629_0002795_10891_11457 188
433 3300046459 Ga0495629_0057773 Ga0495629_0057773_1865_2449 188
434 3300046459 Ga0495629_0258766 Ga0495629_0258766_197_763 188
435 3300046461 Ga0495641_0003654 Ga0495641_0003654_7164_7730 188
436 3300046461 Ga0495641_0007778 Ga0495641_0007778_4958_5524 188
437 3300046462 Ga0495651_0001361 Ga0495651_0001361_9834_10418 188
438 3300046462 Ga0495651_0008870 Ga0495651_0008870_2908_3474 188
439 3300046462 Ga0495651_0012050 Ga0495651_0012050_5861_6427 188
440 3300046462 Ga0495651_0068503 Ga0495651_0068503_1646_2212 188
441 3300046462 Ga0495651_0472102 Ga0495651_0472102_134_700 188
442 3300046463 Ga0495653_0000045 Ga0495653_0000045_84100_84684 188
443 3300046463 Ga0495653_0025406 Ga0495653_0025406_1582_2148 188
444 3300046463 Ga0495653_0064203 Ga0495653_0064203_250_816 188
445 3300046463 Ga0495653_0102031 Ga0495653_0102031_1018_1584 188
446 3300046463 Ga0495653_0103492 Ga0495653_0103492_1412_1978 188
447 3300046463 Ga0495653_0120650 Ga0495653_0120650_283_849 188
448 3300046472 Ga0495580_0004684 Ga0495580_0004684_6825_7391 188
449 3300046472 Ga0495580_0120164 Ga0495580_0120164_725_1291 188
450 3300046473 Ga0495582_0000038 Ga0495582_0000038_56661_57227 188
451 3300046473 Ga0495582_0001491 Ga0495582_0001491_21_587 188
452 3300046473 Ga0495582_0009743 Ga0495582_0009743_1851_2417 188
453 3300046475 Ga0495639_0000050 Ga0495639_0000050_11550_12116 188
454 3300046475 Ga0495639_0064345 Ga0495639_0064345_81_665 188
455 3300046476 Ga0495662_0000240 Ga0495662_0000240_17018_17602 188
456 3300046476 Ga0495662_0001679 Ga0495662_0001679_2873_3439 188
457 3300046476 Ga0495662_0225821 Ga0495662_0225821_128_694 188
458 3300046477 Ga0495664_0000004 Ga0495664_0000004_84111_84695 188
459 3300046477 Ga0495664_0016293 Ga0495664_0016293_3474_4040 188
460 3300046477 Ga0495664_0022812 Ga0495664_0022812_1604_2170 188
461 3300046477 Ga0495664_0032244 Ga0495664_0032244_1642_2208 188
462 3300046499 Ga0495594_0000658 Ga0495594_0000658_8176_8742 188
463 3300046499 Ga0495594_0000931 Ga0495594_0000931_1665_2231 188
464 3300046499 Ga0495594_0196868 Ga0495594_0196868_114_680 188
465 3300046511 Ga0495608_0000017 Ga0495608_0000017_84098_84682 188
466 3300046511 Ga0495608_0024504 Ga0495608_0024504_1070_1636 188
467 3300046511 Ga0495608_0563537 Ga0495608_0563537_104_670 188
468 3300046514 Ga0495618_0000006 Ga0495618_0000006_43204_43788 188
469 3300046514 Ga0495618_0002196 Ga0495618_0002196_871_1437 188
470 3300046514 Ga0495618_0072055 Ga0495618_0072055_1411_1977 188
471 3300046514 Ga0495618_0098052 Ga0495618_0098052_473_1039 188
472 3300046516 Ga0495628_0000001 Ga0495628_0000001_84100_84684 188
473 3300046516 Ga0495628_0014145 Ga0495628_0014145_84_650 188
474 3300046516 Ga0495628_0090874 Ga0495628_0090874_903_1469 188
475 3300046516 Ga0495628_0181428 Ga0495628_0181428_628_1194 188
476 3300046517 Ga0495630_0000303 Ga0495630_0000303_36967_37551 188
477 3300046517 Ga0495630_0002603 Ga0495630_0002603_3153_3719 188
478 3300046517 Ga0495630_0042199 Ga0495630_0042199_1987_2553 188
479 3300046517 Ga0495630_0236713 Ga0495630_0236713_153_719 188
480 3300046517 Ga0495630_0490521 Ga0495630_0490521_358_924 188
481 3300046529 Ga0495652_0000002 Ga0495652_0000002_298634_299218 188
482 3300046529 Ga0495652_0006976 Ga0495652_0006976_6635_7201 188
483 3300046529 Ga0495652_0065159 Ga0495652_0065159_1726_2292 188
484 3300046529 Ga0495652_0097854 Ga0495652_0097854_553_1119 188
485 3300046529 Ga0495652_0361868 Ga0495652_0361868_421_987 188
486 3300046531 Ga0495665_0000732 Ga0495665_0000732_11881_12447 188
487 3300046531 Ga0495665_0022206 Ga0495665_0022206_2372_2938 188
488 3300046533 Ga0495640_0000001 Ga0495640_0000001_392638_393222 188
489 3300046533 Ga0495640_0004317 Ga0495640_0004317_8843_9409 188
490 3300046535 Ga0495586_0010447 Ga0495586_0010447_625_1191 188
491 3300046536 Ga0495587_0000008 Ga0495587_0000008_84318_84902 188
492 3300046536 Ga0495587_0015166 Ga0495587_0015166_4166_4732 188
493 3300046536 Ga0495587_0168417 Ga0495587_0168417_423_989 188
494 3300046543 Ga0495645_0000002 Ga0495645_0000002_84113_84697 188
495 3300046543 Ga0495645_0016339 Ga0495645_0016339_2165_2731 188
496 3300046543 Ga0495645_0127641 Ga0495645_0127641_704_1270 188
497 3300046557 Ga0495622_0007054 Ga0495622_0007054_2581_3147 188
498 3300046559 Ga0495667_0000029 Ga0495667_0000029_84109_84693 188
499 3300046559 Ga0495667_0014030 Ga0495667_0014030_4390_4956 188
500 3300046559 Ga0495667_0021156 Ga0495667_0021156_2333_2899 188
501 3300046559 Ga0495667_0531941 Ga0495667_0531941_93_659 188
502 3300046642 Ga0495634_0000082 Ga0495634_0000082_38963_39547 188
503 3300046642 Ga0495634_0000931 Ga0495634_0000931_10316_10882 188
504 3300046642 Ga0495634_0072363 Ga0495634_0072363_332_898 188
505 3300046663 Ga0495635_0000002 Ga0495635_0000002_402240_402824 188
506 3300046663 Ga0495635_0000415 Ga0495635_0000415_10346_10912 188
507 3300046663 Ga0495635_0004535 Ga0495635_0004535_6816_7382 188
508 3300046663 Ga0495635_0068193 Ga0495635_0068193_806_1372 188
509 3300046663 Ga0495635_0073247 Ga0495635_0073247_1627_2193 188
510 3300046663 Ga0495635_0518271 Ga0495635_0518271_120_686 188
511 3300046674 Ga0495588_0159700 Ga0495588_0159700_46_612 188
512 3300046675 Ga0495657_0000064 Ga0495657_0000064_9630_10214 188
513 3300046675 Ga0495657_0074167 Ga0495657_0074167_1566_2132 188
514 3300046675 Ga0495657_0122450 Ga0495657_0122450_56_622 188
515 3300046675 Ga0495657_0283791 Ga0495657_0283791_153_719 188
516 3300046675 Ga0495657_0343610 Ga0495657_0343610_137_703 188
517 3300046678 Ga0495599_0000104 Ga0495599_0000104_5826_6410 188
518 3300046678 Ga0495599_0113318 Ga0495599_0113318_1020_1586 188
519 3300046679 Ga0495623_0000108 Ga0495623_0000108_31523_32107 188
520 3300046679 Ga0495623_0000561 Ga0495623_0000561_12006_12572 188
521 3300046679 Ga0495623_0065061 Ga0495623_0065061_129_695 188
522 3300046680 Ga0495646_0000023 Ga0495646_0000023_83987_84571 188
523 3300046680 Ga0495646_0005444 Ga0495646_0005444_3127_3693 188
524 3300046680 Ga0495646_0009308 Ga0495646_0009308_4064_4630 188
525 3300046681 Ga0495647_0000195 Ga0495647_0000195_3952_4518 188
526 3300046681 Ga0495647_0014984 Ga0495647_0014984_1326_1892 188
527 3300046681 Ga0495647_0019147 Ga0495647_0019147_200_766 188
528 3300046683 Ga0495658_0000802 Ga0495658_0000802_4518_5084 188
529 3300046689 Ga0495613_0002073 Ga0495613_0002073_2790_3356 188
530 3300046689 Ga0495613_0006101 Ga0495613_0006101_6593_7159 188
531 3300046689 Ga0495613_0040933 Ga0495613_0040933_710_1294 188
532 3300046689 Ga0495613_0068818 Ga0495613_0068818_1345_1911 188
533 3300046690 Ga0495624_0013276 Ga0495624_0013276_2090_2656 188
534 3300046690 Ga0495624_0037808 Ga0495624_0037808_1928_2512 188
535 3300046809 Ga0495600_0000010 Ga0495600_0000010_89349_89933 188
536 3300046809 Ga0495600_0013445 Ga0495600_0013445_3734_4300 188
537 3300046809 Ga0495600_0207286 Ga0495600_0207286_538_1104 188
538 3300047315 Ga0495581_0000749 Ga0495581_0000749_16100_16666 188
539 3300047315 Ga0495581_0004588 Ga0495581_0004588_2161_2745 188
540 3300047315 Ga0495581_0022669 Ga0495581_0022669_1747_2313 188
541 3300047315 Ga0495581_0532204 Ga0495581_0532204_89_655 188
542 3300047317 Ga0495604_0000009 Ga0495604_0000009_241608_242192 188
543 3300047317 Ga0495604_0001737 Ga0495604_0001737_13036_13602 188
544 3300047317 Ga0495604_0063007 Ga0495604_0063007_1044_1610 188
545 3300047317 Ga0495604_0374041 Ga0495604_0374041_113_679 188
546 3300047319 Ga0495674_0000002 Ga0495674_0000002_84101_84685 188
547 3300047319 Ga0495674_0005524 Ga0495674_0005524_2431_2997 188
548 3300047319 Ga0495674_0024878 Ga0495674_0024878_3307_3873 188
549 3300047319 Ga0495674_0042326 Ga0495674_0042326_16_582 188
550 3300047319 Ga0495674_0145389 Ga0495674_0145389_1368_1934 188
551 3300047319 Ga0495674_0494835 Ga0495674_0494835_10_576 188
552 3300047321 Ga0495676_0022697 Ga0495676_0022697_1737_2303 188
553 3300047322 Ga0495680_0000263 Ga0495680_0000263_19865_20449 188
554 3300047322 Ga0495680_0015541 Ga0495680_0015541_3328_3894 188
555 3300047322 Ga0495680_0034049 Ga0495680_0034049_3298_3864 188
556 3300047444 Ga0495675_0000680 Ga0495675_0000680_13607_14191 188
557 3300047444 Ga0495675_0003143 Ga0495675_0003143_4309_4875 188
558 3300047444 Ga0495675_0063481 Ga0495675_0063481_244_810 188
559 3300047444 Ga0495675_0590990 Ga0495675_0590990_29_595 188
560 3300047471 Ga0495684_0000006 Ga0495684_0000006_84060_84644 188
561 3300047471 Ga0495684_0007203 Ga0495684_0007203_5893_6459 188
562 3300047471 Ga0495684_0032006 Ga0495684_0032006_275_841 188
563 3300047471 Ga0495684_0166185 Ga0495684_0166185_1014_1580 188
564 3300047673 Ga0495593_0000291 Ga0495593_0000291_11836_12402 188
565 3300047673 Ga0495593_0000991 Ga0495593_0000991_2245_2829 188
566 3300047673 Ga0495593_0001262 Ga0495593_0001262_3936_4502 188
567 3300048088 Ga0495602_0000005 Ga0495602_0000005_260989_261573 188
568 3300048088 Ga0495602_0086338 Ga0495602_0086338_1364_1930 188
569 3300048089 Ga0495614_0036724 Ga0495614_0036724_740_1306 188
570 3300048903 Ga0496100_0005312 Ga0496100_0005312_3778_4344 188
571 3300048903 Ga0496100_0014750 Ga0496100_0014750_3288_3854 188
572 3300048903 Ga0496100_0190296 Ga0496100_0190296_799_1365 188
573 3300048904 Ga0496101_0016399 Ga0496101_0016399_3458_4024 188
574 3300048904 Ga0496101_0018353 Ga0496101_0018353_2737_3303 188
575 3300048904 Ga0496101_0018648 Ga0496101_0018648_42_608 188
576 3300048904 Ga0496101_0299419 Ga0496101_0299419_315_881 188
577 3300048904 Ga0496101_0746034 Ga0496101_0746034_30_596 188
578 3300048905 Ga0496102_0021360 Ga0496102_0021360_734_1300 188
579 3300048905 Ga0496102_0022503 Ga0496102_0022503_4095_4661 188
580 3300048905 Ga0496102_0040298 Ga0496102_0040298_115_681 188
581 3300048905 Ga0496102_0064264 Ga0496102_0064264_633_1199 188
582 3300048906 Ga0496103_0094636 Ga0496103_0094636_225_791 188
583 3300048906 Ga0496103_0466252 Ga0496103_0466252_63_629 188
584 3300048907 Ga0496104_0026244 Ga0496104_0026244_210_776 188
585 3300048907 Ga0496104_0056217 Ga0496104_0056217_1234_1800 188
586 3300048907 Ga0496104_0092448 Ga0496104_0092448_743_1309 188
587 3300048907 Ga0496104_0196597 Ga0496104_0196597_925_1491 188
588 3300048908 Ga0496105_0002325 Ga0496105_0002325_3873_4439 188
589 3300048908 Ga0496105_0039958 Ga0496105_0039958_1621_2187 188
590 3300048908 Ga0496105_0088347 Ga0496105_0088347_438_1004 188
591 3300048909 Ga0496106_0012330 Ga0496106_0012330_925_1491 188
592 3300048909 Ga0496106_0086803 Ga0496106_0086803_167_733 188
593 3300048909 Ga0496106_0112358 Ga0496106_0112358_906_1472 188
594 3300048909 Ga0496106_0182882 Ga0496106_0182882_996_1562 188
595 3300048910 Ga0496107_0093973 Ga0496107_0093973_1145_1711 188
596 3300048910 Ga0496107_0280823 Ga0496107_0280823_116_682 188
597 3300048910 Ga0496107_0470038 Ga0496107_0470038_244_810 188
598 3300048911 Ga0496108_0014299 Ga0496108_0014299_1621_2187 188
599 3300048911 Ga0496108_0094121 Ga0496108_0094121_322_888 188
600 3300048912 Ga0496109_0044488 Ga0496109_0044488_1986_2552 188
601 3300048912 Ga0496109_0082949 Ga0496109_0082949_1465_2031 188
602 3300048912 Ga0496109_0119749 Ga0496109_0119749_1522_2088 188
603 3300048912 Ga0496109_0897795 Ga0496109_0897795_209_775 188
604 3300048913 Ga0496110_0037618 Ga0496110_0037618_893_1459 188
605 3300048913 Ga0496110_0104469 Ga0496110_0104469_361_927 188
606 3300048914 Ga0496111_0009487 Ga0496111_0009487_4710_5276 188
607 3300048914 Ga0496111_0079077 Ga0496111_0079077_1406_1972 188
608 3300048914 Ga0496111_0144161 Ga0496111_0144161_666_1232 188
609 3300048915 Ga0496112_0107662 Ga0496112_0107662_438_1004 188
610 3300048915 Ga0496112_0156292 Ga0496112_0156292_606_1172 188
611 3300048916 Ga0496113_0094699 Ga0496113_0094699_173_739 188
612 3300048917 Ga0496114_0010559 Ga0496114_0010559_4086_4652 188
613 3300048917 Ga0496114_0034731 Ga0496114_0034731_2451_3017 188
614 3300048917 Ga0496114_0059384 Ga0496114_0059384_2411_3001 188
615 3300048917 Ga0496114_0339299 Ga0496114_0339299_744_1310 188
616 3300048918 Ga0496115_0014957 Ga0496115_0014957_1946_2512 188
617 3300048918 Ga0496115_0042828 Ga0496115_0042828_1652_2218 188
618 3300048918 Ga0496115_0113003 Ga0496115_0113003_1519_2085 188
619 3300048924 Ga0496121_0372297 Ga0496121_0372297_224_790 188
620 3300048929 Ga0496126_0100248 Ga0496126_0100248_1933_2502 188
621 3300049568 Ga0501031_0084632 Ga0501031_0084632_468_1034 188
622 3300049569 Ga0501032_0064363 Ga0501032_0064363_1242_1808 188
623 3300049570 Ga0501033_0051838 Ga0501033_0051838_1907_2473 188
624 3300049570 Ga0501033_0078102 Ga0501033_0078102_770_1336 188
625 3300049570 Ga0501033_0097360 Ga0501033_0097360_108_674 188
626 3300049571 Ga0501034_0000229 Ga0501034_0000229_83978_84544 188
627 3300049571 Ga0501034_0052518 Ga0501034_0052518_611_1177 188
628 3300049571 Ga0501034_0085275 Ga0501034_0085275_463_1029 188
629 3300049571 Ga0501034_0126497 Ga0501034_0126497_635_1201 188
630 3300049571 Ga0501034_0335243 Ga0501034_0335243_430_996 188
631 3300049571 Ga0501034_0348332 Ga0501034_0348332_38_607 188
632 3300049571 Ga0501034_0428178 Ga0501034_0428178_16_582 188
633 3300049571 Ga0501034_0551844 Ga0501034_0551844_148_714 188
634 3300049571 Ga0501034_0774539 Ga0501034_0774539_148_714 188
635 3300049572 Ga0501036_0076036 Ga0501036_0076036_1493_2059 188
636 3300049572 Ga0501036_0141196 Ga0501036_0141196_820_1386 188
637 3300049572 Ga0501036_0238178 Ga0501036_0238178_850_1416 188
638 3300049572 Ga0501036_0702826 Ga0501036_0702826_50_616 188
639 3300049573 Ga0501037_0106908 Ga0501037_0106908_653_1219 188
640 3300049574 Ga0501038_0124595 Ga0501038_0124595_909_1475 188
641 3300049574 Ga0501038_0634534 Ga0501038_0634534_112_678 188
642 3300049574 Ga0501038_0687554 Ga0501038_0687554_81_647 188
643 3300049575 Ga0501039_0112015 Ga0501039_0112015_921_1487 188
644 3300049575 Ga0501039_0145647 Ga0501039_0145647_649_1215 188
645 3300049580 Ga0501046_0033141 Ga0501046_0033141_1406_1972 188
646 3300049581 Ga0501047_0226856 Ga0501047_0226856_917_1483 188
647 3300049581 Ga0501047_0405850 Ga0501047_0405850_178_744 188
648 3300049582 Ga0501048_0158879 Ga0501048_0158879_806_1372 188
649 3300049583 Ga0501067_0106206 Ga0501067_0106206_790_1356 188
650 3300049584 Ga0501068_0083680 Ga0501068_0083680_280_846 188
651 3300049585 Ga0501069_0135418 Ga0501069_0135418_344_910 188
652 3300049586 Ga0501070_0033475 Ga0501070_0033475_1154_1720 188
653 3300049586 Ga0501070_0229941 Ga0501070_0229941_292_858 188
654 3300049586 Ga0501070_0238312 Ga0501070_0238312_474_1040 188
655 3300049586 Ga0501070_0241482 Ga0501070_0241482_662_1228 188
656 3300049587 Ga0501071_0823500 Ga0501071_0823500_109_675 188
657 3300049588 Ga0501072_0255325 Ga0501072_0255325_338_904 188
658 3300049589 Ga0501073_0096275 Ga0501073_0096275_642_1208 188
659 3300049590 Ga0501074_0517164 Ga0501074_0517164_259_825 188
660 3300049742 Ga0501080_0061086 Ga0501080_0061086_2305_2871 188
661 3300049742 Ga0501080_0186619 Ga0501080_0186619_702_1268 188
662 3300049744 Ga0501083_0175491 Ga0501083_0175491_785_1351 188
663 3300049744 Ga0501083_0221667 Ga0501083_0221667_371_937 188
664 3300049822 Ga0501035_0118824 Ga0501035_0118824_814_1380 188
665 3300049822 Ga0501035_0166166 Ga0501035_0166166_1023_1589 188
666 3300049822 Ga0501035_0292516 Ga0501035_0292516_583_1149 188
667 3300049822 Ga0501035_0812377 Ga0501035_0812377_27_593 188
668 3300049823 Ga0501044_0064971 Ga0501044_0064971_2216_2782 188
669 3300049823 Ga0501044_0091153 Ga0501044_0091153_1559_2125 188
670 3300049823 Ga0501044_0187796 Ga0501044_0187796_1038_1604 188
671 3300049823 Ga0501044_0189908 Ga0501044_0189908_399_965 188
672 3300050490 nmdc:mga03n38_180277_c1 nmdc:mga03n38_180277_c1_123_689 188
673 3300050492 nmdc:mga0yw44_16885_c1 nmdc:mga0yw44_16885_c1_371_937 188
674 3300050493 nmdc:mga0k408_82504_c1 nmdc:mga0k408_82504_c1_179_745 188
675 3300050494 nmdc:mga06z11_44901_c1 nmdc:mga06z11_44901_c1_1452_2039 188
676 3300050494 nmdc:mga06z11_682812_c1 nmdc:mga06z11_682812_c1_37_603 188
677 3300050496 nmdc:mga07m45_12224_c2 nmdc:mga07m45_12224_c2_1852_2418 188
678 3300050509 nmdc:mga0qj67_422305_c1 nmdc:mga0qj67_422305_c1_471_1037 188
679 3300050511 nmdc:mga08y16_66217_c1 nmdc:mga08y16_66217_c1_751_1317 188
680 3300050512 nmdc:mga0n895_184831_c1 nmdc:mga0n895_184831_c1_1511_2077 188
681 3300050513 nmdc:mga0rr50_127434_c1 nmdc:mga0rr50_127434_c1_735_1301 188
682 3300050514 nmdc:mga08x19_35999_c1 nmdc:mga08x19_35999_c1_2013_2579 188
683 3300050514 nmdc:mga08x19_907648_c1 nmdc:mga08x19_907648_c1_35_601 188
684 3300053077 Ga0495601_0000002 Ga0495601_0000002_226777_227361 188
685 3300053077 Ga0495601_0014886 Ga0495601_0014886_2845_3411 188
686 3300053077 Ga0495601_0019363 Ga0495601_0019363_2337_2903 188
687 3300053077 Ga0495601_0047516 Ga0495601_0047516_601_1167 188
688 3300053078 Ga0495612_0000010 Ga0495612_0000010_162665_163249 188
689 3300053078 Ga0495612_0003499 Ga0495612_0003499_2637_3203 188
690 3300053084 Ga0495595_0000020 Ga0495595_0000020_84110_84694 188
691 3300053084 Ga0495595_0131523 Ga0495595_0131523_536_1102 188
692 3300053085 Ga0495619_0000019 Ga0495619_0000019_186113_186697 188
693 3300053085 Ga0495619_0000045 Ga0495619_0000045_98284_98850 188
694 3300053085 Ga0495619_0000337 Ga0495619_0000337_16754_17320 188
695 3300053085 Ga0495619_0006500 Ga0495619_0006500_5206_5772 188
696 3300053085 Ga0495619_0097299 Ga0495619_0097299_146_712 188
697 3300053092 Ga0500583_0463916 Ga0500583_0463916_18_584 188
698 3300053094 Ga0500566_0234622 Ga0500566_0234622_229_795 188
699 3300053094 Ga0500566_0261252 Ga0500566_0261252_123_689 188
700 3300053158 Ga0500627_0183772 Ga0500627_0183772_205_771 188
701 3300054114 Ga0501084_0483637 Ga0501084_0483637_132_698 188
702 3300060353 Ga0501082_1181799 Ga0501082_1181799_70_639 188
703 iso_pu_bacteria 2842395702 2842398307 188
704 iso_pu_bacteria 8005301065 8005304559 188
705 iso_pu_bacteria 8005688590 8005690982 188
706 iso_pu_bacteria 8005695170 8005698832 188
707 3300025942 Ga0207689_10346394 Ga0207689_103463942 189
708 3300028556 Ga0265337_1002275 Ga0265337_100227510 189
709 3300035118 Ga0373954_0056664 Ga0373954_0056664_601_1215 189
710 3300035724 Ga0373933_0113895 Ga0373933_0113895_514_1128 189
711 3300036401 Ga0373937_0111031 Ga0373937_0111031_1793_2407 189
712 3300053084 Ga0495595_0030548 Ga0495595_0030548_1566_2180 189
713 3300053085 Ga0495619_0149872 Ga0495619_0149872_63_677 189
714 iso_pu_bacteria 2509276021 2509387751 189
715 iso_pu_bacteria 2510065019 2510132266 189
716 iso_pu_bacteria 2513237084 2513569103 189
717 iso_pu_bacteria 2513237085 2513580754 189
718 iso_pu_bacteria 2513237093 2513632788 189
719 iso_pu_bacteria 2513237103 2513709239 189
720 iso_pu_bacteria 2515154134 2515740428 189
721 iso_pu_bacteria 2516653077 2517039892 189
722 iso_pu_bacteria 2516653085 2517075433 189
723 iso_pu_bacteria 2517093000 2517094023 189
724 iso_pu_bacteria 2529292951 2530643927 189
725 iso_pu_bacteria 2585427526 2585527930 189
726 iso_pu_bacteria 2718217927 2719384821 189
727 iso_pu_bacteria 2718218423 2721398540 189
728 iso_pu_bacteria 2721755809 2724037353 189
729 iso_pu_bacteria 2724679232 2725948450 189
730 iso_pu_bacteria 2765235942 2766067637 189
731 iso_pu_bacteria 2791355261 2793327166 189
732 iso_pu_bacteria 2791355266 2793358878 189
733 iso_pu_bacteria 2791355267 2793367813 189
734 iso_pu_bacteria 2838680041 2838681304 189
735 iso_pu_bacteria 2838686498 2838688651 189
736 iso_pu_bacteria 2838694306 2838694661 189
737 iso_pu_bacteria 2838707686 2838708039 189
738 iso_pu_bacteria 2838729681 2838730946 189
739 iso_pu_bacteria 2838742623 2838744160 189
740 iso_pu_bacteria 2841851746 2841856841 189
741 iso_pu_bacteria 2841864319 2841865516 189
742 iso_pu_bacteria 2842077413 2842080730 189
743 iso_pu_bacteria 2842110456 2842117810 189
744 iso_pu_bacteria 2842118031 2842121349 189
745 iso_pu_bacteria 2842156927 2842160011 189
746 iso_pu_bacteria 2842163707 2842168253 189
747 iso_pu_bacteria 2842180545 2842183372 189
748 iso_pu_bacteria 2842217011 2842221169 189
749 iso_pu_bacteria 2842229732 2842235027 189
750 iso_pu_bacteria 2842237096 2842237450 189
751 iso_pu_bacteria 2842243621 2842245624 189
752 iso_pu_bacteria 2842257432 2842259726 189
753 iso_pu_bacteria 2842271015 2842274565 189
754 iso_pu_bacteria 2842291075 2842294386 189
755 iso_pu_bacteria 2842304105 2842306809 189
756 iso_pu_bacteria 2842341865 2842343636 189
757 iso_pu_bacteria 2842363717 2842365208 189
758 iso_pu_bacteria 2842370503 2842371767 189
759 iso_pu_bacteria 2842377471 2842380784 189
760 iso_pu_bacteria 2842384541 2842387855 189
761 iso_pu_bacteria 2844454524 2844455168 189
762 iso_pu_bacteria 2857516855 2857520326 189
763 iso_pu_bacteria 2933570622 2933573077 189
764 iso_pu_bacteria 2933586486 2933591339 189
765 iso_pu_bacteria 2935894831 2935895183 189
766 iso_pu_bacteria 2935901341 2935904173 189
767 iso_pu_bacteria 2936367885 2936368161 189
768 iso_pu_bacteria 2936375103 2936381446 189
769 iso_pu_bacteria 639633055 639647401 189
770 iso_pu_bacteria 8005275841 8005279539 189
771 iso_pu_bacteria 8005307578 8005309131 189
772 iso_pu_bacteria 8005376324 8005376648 189
773 iso_pu_bacteria 8005556819 8005558959 189
774 iso_pu_bacteria 8005563573 8005570403 189
775 iso_pu_bacteria 8018163183 8018169124 189
776 iso_pu_bacteria 8018176218 8018177286 189
777 iso_pu_bacteria 8023680758 8023686993 189
778 iso_pu_bacteria 8024479707 8024481069 189
779 iso_pu_bacteria 8056375014 8056380694 189
780 iso_pu_bacteria 8057874678 8057879554 189
781 3300006871 Ga0075434_100568019 Ga0075434_1005680192 191
782 3300007076 Ga0075435_100166663 Ga0075435_1001666632 191
783 3300026095 Ga0207676_11073332 Ga0207676_110733322 191
784 3300050513 nmdc:mga0rr50_517561_c1 nmdc:mga0rr50_517561_c1_71_703 191
785 3300003790 Ga0055528_1014267 Ga0055528_10142672 193
786 3300003792 Ga0055540_1000406 Ga0055540_100040613 193
787 3300003794 Ga0055531_10034081 Ga0055531_100340813 193
788 3300005327 Ga0070658_10054496 Ga0070658_100544965 193
789 3300005339 Ga0070660_100006368 Ga0070660_1000063683 193
790 3300005344 Ga0070661_100166987 Ga0070661_1001669873 193
791 3300005458 Ga0070681_10039444 Ga0070681_100394443 193
792 3300005614 Ga0068856_100542830 Ga0068856_1005428302 193
793 3300006038 Ga0075365_10200770 Ga0075365_102007701 193
794 3300006048 Ga0075363_100165745 Ga0075363_1001657452 193
795 3300013307 Ga0157372_10376230 Ga0157372_103762303 193
796 3300025273 Ga0209673_1001371 Ga0209673_100137126 193
797 3300025297 Ga0209758_1008834 Ga0209758_10088343 193
798 3300025298 Ga0209050_1006511 Ga0209050_10065116 193
799 3300025303 Ga0209051_1000514 Ga0209051_100051441 193
800 3300025303 Ga0209051_1022514 Ga0209051_10225143 193
801 3300025304 Ga0209257_1004454 Ga0209257_10044542 193
802 3300025909 Ga0207705_10064768 Ga0207705_100647683 193
803 3300025912 Ga0207707_10075776 Ga0207707_100757763 193
804 3300025919 Ga0207657_10005995 Ga0207657_100059958 193
805 3300031241 Ga0265325_10064917 Ga0265325_100649173 193
806 3300031595 Ga0265313_10029125 Ga0265313_100291253 193
807 3300031712 Ga0265342_10001944 Ga0265342_100019446 193
808 3300049581 Ga0501047_0013485 Ga0501047_0013485_163_804 193
809 3300049590 Ga0501074_0491434 Ga0501074_0491434_101_742 193
810 iso_pu_bacteria 2884298095 2884299387 193
811 3300005458 Ga0070681_10499461 Ga0070681_104994611 194
812 3300005563 Ga0068855_100042335 Ga0068855_1000423353 194
813 3300006175 Ga0070712_100133234 Ga0070712_1001332343 194
814 3300025898 Ga0207692_10087783 Ga0207692_100877832 194
815 3300025913 Ga0207695_10346255 Ga0207695_103462552 194
816 3300025939 Ga0207665_10529207 Ga0207665_105292071 194
817 3300049570 Ga0501033_0105015 Ga0501033_0105015_1058_1645 194
818 3300049823 Ga0501044_0172483 Ga0501044_0172483_1042_1629 194
819 3300050514 nmdc:mga08x19_134561_c1 nmdc:mga08x19_134561_c1_80_676 194
820 3300006051 Ga0075364_10391767 Ga0075364_103917672 195
821 3300035724 Ga0373933_0348988 Ga0373933_0348988_193_831 195
822 3300045049 Ga0466959_0188453 Ga0466959_0188453_87_740 195
823 3300045836 Ga0466958_0020255 Ga0466958_0020255_2681_3334 195
824 3300005436 Ga0070713_100169696 Ga0070713_1001696963 196
825 3300005439 Ga0070711_100397699 Ga0070711_1003976992 196
826 3300009148 Ga0105243_10828018 Ga0105243_108280182 196
827 3300021358 Ga0213873_10004137 Ga0213873_100041372 196
828 3300025916 Ga0207663_10098729 Ga0207663_100987293 196
829 3300025928 Ga0207700_10160213 Ga0207700_101602133 196
830 3300039438 Ga0436360_0820351 Ga0436360_0820351_1547_2152 196
831 3300039447 Ga0436361_1020532 Ga0436361_1020532_2251_2856 196
832 3300044684 Ga0466966_0323073 Ga0466966_0323073_37_642 196
833 3300044694 Ga0466963_0063084 Ga0466963_0063084_478_1083 196
834 3300045976 Ga0466967_0315603 Ga0466967_0315603_108_713 196
835 3300049742 Ga0501080_0550518 Ga0501080_0550518_92_682 196
836 iso_pu_bacteria 2513237098 2513677127 196
837 iso_pu_bacteria 2513237141 2513887411 196
838 iso_pu_bacteria 2903768456 2903770904 196
839 iso_pu_bacteria 2935769743 2935771122 196
840 iso_pu_bacteria 2935785616 2935786177 196
841 iso_pu_bacteria 2935793552 2935794026 196
842 iso_pu_bacteria 2941531003 2941531586 196
843 3300005327 Ga0070658_10040943 Ga0070658_100409432 197
844 3300005563 Ga0068855_100021914 Ga0068855_1000219145 197
845 3300005616 Ga0068852_100892864 Ga0068852_1008928642 197
846 3300006846 Ga0075430_100582831 Ga0075430_1005828312 197
847 3300006871 Ga0075434_100226997 Ga0075434_1002269972 197
848 3300025909 Ga0207705_10072702 Ga0207705_100727023 197
849 3300025949 Ga0207667_10003251 Ga0207667_1000325119 197
850 3300031090 Ga0265760_10010372 Ga0265760_100103723 197
851 3300031090 Ga0265760_10141176 Ga0265760_101411761 197
852 3300044694 Ga0466963_0018763 Ga0466963_0018763_2189_2791 197
853 3300044694 Ga0466963_0519702 Ga0466963_0519702_39_653 197
854 3300044719 Ga0466971_0284067 Ga0466971_0284067_119_721 197
855 3300044842 Ga0466957_0018409 Ga0466957_0018409_2902_3504 197
856 3300044842 Ga0466957_0028820 Ga0466957_0028820_1975_2589 197
857 3300045836 Ga0466958_0145867 Ga0466958_0145867_661_1263 197
858 3300045976 Ga0466967_0014998 Ga0466967_0014998_2526_3140 197
859 3300049578 Ga0501042_0414801 Ga0501042_0414801_369_965 197
860 3300049586 Ga0501070_0559971 Ga0501070_0559971_292_897 197
861 3300049589 Ga0501073_0051498 Ga0501073_0051498_655_1260 197
862 3300049742 Ga0501080_0094407 Ga0501080_0094407_555_1160 197
863 3300049744 Ga0501083_0465073 Ga0501083_0465073_64_669 197
864 3300050509 nmdc:mga0qj67_238417_c1 nmdc:mga0qj67_238417_c1_122_718 197
865 3300050511 nmdc:mga08y16_356824_c1 nmdc:mga08y16_356824_c1_17_619 197
866 3300050512 nmdc:mga0n895_68900_c1 nmdc:mga0n895_68900_c1_2633_3226 197
867 3300053077 Ga0495601_0084076 Ga0495601_0084076_1165_1785 197
868 3300053077 Ga0495601_0090595 Ga0495601_0090595_842_1444 197
869 3300061719 Ga0466962_0036473 Ga0466962_0036473_1559_2161 197
870 iso_pu_bacteria 2524023210 2524469662 197
871 iso_pu_bacteria 2671180139 2671692057 197
872 iso_pu_bacteria 2885383462 2885391933 197
873 iso_pu_bacteria 2922386360 2922387279 197
874 iso_pu_bacteria 8006926726 8006927236 197
875 iso_pu_bacteria 8056681323 8056682242 197
876 iso_pu_bacteria 8056689827 8056695246 197
877 3300005328 Ga0070676_10272595 Ga0070676_102725951 198
878 3300005355 Ga0070671_100005034 Ga0070671_10000503410 198
879 3300005364 Ga0070673_100064881 Ga0070673_1000648813 198
880 3300005436 Ga0070713_101146803 Ga0070713_1011468031 198
881 3300005456 Ga0070678_100104870 Ga0070678_1001048703 198
882 3300005457 Ga0070662_100041860 Ga0070662_1000418604 198
883 3300005563 Ga0068855_100256829 Ga0068855_1002568291 198
884 3300005983 Ga0081540_1062356 Ga0081540_10623562 198
885 3300006028 Ga0070717_10248807 Ga0070717_102488072 198
886 3300006871 Ga0075434_100469413 Ga0075434_1004694132 198
887 3300021384 Ga0213876_10068738 Ga0213876_100687383 198
888 3300025261 Ga0209233_1003140 Ga0209233_10031402 198
889 3300025928 Ga0207700_10062436 Ga0207700_100624362 198
890 3300025928 Ga0207700_10279480 Ga0207700_102794802 198
891 3300025960 Ga0207651_10078007 Ga0207651_100780072 198
892 3300026121 Ga0207683_10042834 Ga0207683_100428342 198
893 3300031239 Ga0265328_10148797 Ga0265328_101487972 198
894 3300031250 Ga0265331_10003606 Ga0265331_100036064 198
895 3300031344 Ga0265316_10448102 Ga0265316_104481021 198
896 3300037853 Ga0436364_0310897 Ga0436364_0310897_1531_2157 198
897 3300039437 Ga0436365_0309234 Ga0436365_0309234_384_1004 198
898 3300039437 Ga0436365_1787618 Ga0436365_1787618_948_1574 198
899 3300046514 Ga0495618_0284264 Ga0495618_0284264_321_941 198
900 3300048909 Ga0496106_0438641 Ga0496106_0438641_405_1016 198
901 3300048910 Ga0496107_0328003 Ga0496107_0328003_388_999 198
902 3300048915 Ga0496112_0666253 Ga0496112_0666253_208_819 198
903 3300048924 Ga0496121_0219787 Ga0496121_0219787_354_965 198
904 3300049592 Ga0501076_0820351 Ga0501076_0820351_143_754 198
905 3300053078 Ga0495612_0142632 Ga0495612_0142632_103_723 198
906 3300053085 Ga0495619_0037279 Ga0495619_0037279_220_882 198
907 3300061734 Ga0530510_0342914 Ga0530510_0342914_130_741 198
908 iso_pu_bacteria 2508501128 2509148741 198
909 iso_pu_bacteria 2517572143 2517894831 198
910 iso_pu_bacteria 2524023228 2524534596 198
911 iso_pu_bacteria 2667528175 2671119246 198
912 iso_pu_bacteria 2791355197 2793071918 198
913 iso_pu_bacteria 2904699407 2904705996 198
914 iso_pu_bacteria 2906610324 2906611561 198
915 iso_pu_bacteria 2908739725 2908745141 198
916 iso_pu_bacteria 2922425934 2922427788 198
917 iso_pu_bacteria 2935630451 2935632271 198
918 iso_pu_bacteria 2941507105 2941508218 198
919 iso_pu_bacteria 2941515067 2941515276 198
920 iso_pu_bacteria 2941523033 2941524149 198
921 iso_pu_bacteria 8006933436 8006933729 198
922 iso_pu_bacteria 8006973647 8006983401 198
923 iso_pu_bacteria 8019555841 8019559659 198
924 iso_pu_bacteria 8019565922 8019569766 198
925 3300003214 JGI25165J46597_1012067 JGI25165J46597_10120672 199
926 3300003752 Ga0055539_1003885 Ga0055539_10038852 199
927 3300005347 Ga0070668_100320324 Ga0070668_1003203242 199
928 3300005435 Ga0070714_100007894 Ga0070714_1000078942 199
929 3300005436 Ga0070713_100027473 Ga0070713_1000274735 199
930 3300005439 Ga0070711_100198890 Ga0070711_1001988902 199
931 3300005441 Ga0070700_100190607 Ga0070700_1001906072 199
932 3300005518 Ga0070699_100868491 Ga0070699_1008684911 199
933 3300005536 Ga0070697_100075090 Ga0070697_1000750903 199
934 3300005547 Ga0070693_100465540 Ga0070693_1004655401 199
935 3300005618 Ga0068864_100104321 Ga0068864_1001043212 199
936 3300006028 Ga0070717_10051927 Ga0070717_100519273 199
937 3300006028 Ga0070717_10932224 Ga0070717_109322242 199
938 3300009098 Ga0105245_11102539 Ga0105245_111025391 199
939 3300009101 Ga0105247_10023297 Ga0105247_100232973 199
940 3300009101 Ga0105247_10490643 Ga0105247_104906431 199
941 3300009545 Ga0105237_10244674 Ga0105237_102446743 199
942 3300009545 Ga0105237_10498577 Ga0105237_104985772 199
943 3300010375 Ga0105239_10328510 Ga0105239_103285102 199
944 3300013306 Ga0163162_10090585 Ga0163162_100905853 199
945 3300014968 Ga0157379_10219728 Ga0157379_102197282 199
946 3300014969 Ga0157376_10226459 Ga0157376_102264592 199
947 3300025253 Ga0209677_101488 Ga0209677_1014884 199
948 3300025261 Ga0209233_1002178 Ga0209233_10021785 199
949 3300025927 Ga0207687_10696223 Ga0207687_106962231 199
950 3300025928 Ga0207700_10038620 Ga0207700_100386202 199
951 3300025928 Ga0207700_10112967 Ga0207700_101129672 199
952 3300025929 Ga0207664_10026047 Ga0207664_100260472 199
953 3300025972 Ga0207668_10165352 Ga0207668_101653523 199
954 3300026095 Ga0207676_10105807 Ga0207676_101058072 199
955 3300031018 Ga0265773_1014087 Ga0265773_10140871 199
956 3300031239 Ga0265328_10000762 Ga0265328_100007627 199
957 3300031242 Ga0265329_10047355 Ga0265329_100473552 199
958 3300031247 Ga0265340_10052025 Ga0265340_100520252 199
959 3300031249 Ga0265339_10003778 Ga0265339_100037782 199
960 3300031251 Ga0265327_10137281 Ga0265327_101372811 199
961 3300031344 Ga0265316_10001236 Ga0265316_1000123623 199
962 3300031730 Ga0307516_10399795 Ga0307516_103997952 199
963 3300033544 Ga0316215_1001248 Ga0316215_10012483 199
964 3300035120 Ga0373957_0007180 Ga0373957_0007180_480_1115 199
965 3300035170 Ga0373943_0082349 Ga0373943_0082349_61_696 199
966 3300035172 Ga0373955_0001406 Ga0373955_0001406_2829_3464 199
967 3300035410 Ga0373924_0016575 Ga0373924_0016575_690_1325 199
968 3300035691 Ga0373931_0157057 Ga0373931_0157057_519_1145 199
969 3300035724 Ga0373933_0012332 Ga0373933_0012332_3814_4449 199
970 3300035725 Ga0373947_0065631 Ga0373947_0065631_49_684 199
971 3300036401 Ga0373937_0001403 Ga0373937_0001403_3587_4222 199
972 3300037418 Ga0395900_0148645 Ga0395900_0148645_686_1297 199
973 3300037466 Ga0395898_0034054 Ga0395898_0034054_412_1023 199
974 3300037853 Ga0436364_0499308 Ga0436364_0499308_264_908 199
975 3300039450 Ga0436363_1220467 Ga0436363_1220467_1205_1816 199
976 3300044765 Ga0466970_0421994 Ga0466970_0421994_146_751 199
977 3300044842 Ga0466957_0071295 Ga0466957_0071295_590_1195 199
978 3300044842 Ga0466957_0181159 Ga0466957_0181159_312_917 199
979 3300044842 Ga0466957_0244508 Ga0466957_0244508_498_1103 199
980 3300045049 Ga0466959_0423736 Ga0466959_0423736_101_706 199
981 3300046455 Ga0495603_0233268 Ga0495603_0233268_106_741 199
982 3300046459 Ga0495629_0038466 Ga0495629_0038466_2603_3238 199
983 3300046462 Ga0495651_0000210 Ga0495651_0000210_3764_4399 199
984 3300046463 Ga0495653_0303068 Ga0495653_0303068_17_652 199
985 3300046472 Ga0495580_0298306 Ga0495580_0298306_322_957 199
986 3300046514 Ga0495618_0038771 Ga0495618_0038771_2156_2791 199
987 3300046516 Ga0495628_0029138 Ga0495628_0029138_3200_3835 199
988 3300046529 Ga0495652_0019963 Ga0495652_0019963_1492_2127 199
989 3300046531 Ga0495665_0108516 Ga0495665_0108516_54_689 199
990 3300046533 Ga0495640_0022389 Ga0495640_0022389_3831_4466 199
991 3300046533 Ga0495640_0384670 Ga0495640_0384670_59_670 199
992 3300046536 Ga0495587_0009922 Ga0495587_0009922_3831_4466 199
993 3300046543 Ga0495645_0217368 Ga0495645_0217368_347_982 199
994 3300046559 Ga0495667_0003159 Ga0495667_0003159_3796_4431 199
995 3300046642 Ga0495634_0004383 Ga0495634_0004383_3759_4394 199
996 3300046663 Ga0495635_0012438 Ga0495635_0012438_3809_4444 199
997 3300046675 Ga0495657_0020713 Ga0495657_0020713_2898_3533 199
998 3300046678 Ga0495599_0002103 Ga0495599_0002103_2274_2909 199
999 3300046680 Ga0495646_0022961 Ga0495646_0022961_888_1523 199
1000 3300046681 Ga0495647_0131487 Ga0495647_0131487_66_677 199
1001 3300046809 Ga0495600_0009846 Ga0495600_0009846_3793_4428 199
1002 3300047317 Ga0495604_0022991 Ga0495604_0022991_3822_4457 199
1003 3300047319 Ga0495674_0021316 Ga0495674_0021316_3836_4471 199
1004 3300047321 Ga0495676_0088994 Ga0495676_0088994_136_771 199
1005 3300047322 Ga0495680_0000924 Ga0495680_0000924_29863_30498 199
1006 3300047444 Ga0495675_0013027 Ga0495675_0013027_858_1493 199
1007 3300047471 Ga0495684_0032184 Ga0495684_0032184_66_701 199
1008 3300048088 Ga0495602_0032253 Ga0495602_0032253_3831_4466 199
1009 3300048903 Ga0496100_0280890 Ga0496100_0280890_618_1226 199
1010 3300048905 Ga0496102_0545951 Ga0496102_0545951_189_797 199
1011 3300048906 Ga0496103_0313453 Ga0496103_0313453_122_748 199
1012 3300048907 Ga0496104_0040170 Ga0496104_0040170_271_897 199
1013 3300048908 Ga0496105_0043170 Ga0496105_0043170_1341_1967 199
1014 3300048909 Ga0496106_0009807 Ga0496106_0009807_1708_2334 199
1015 3300048910 Ga0496107_0080283 Ga0496107_0080283_1313_1939 199
1016 3300048912 Ga0496109_0006231 Ga0496109_0006231_3973_4599 199
1017 3300048913 Ga0496110_0014302 Ga0496110_0014302_861_1487 199
1018 3300048913 Ga0496110_0237532 Ga0496110_0237532_688_1296 199
1019 3300048915 Ga0496112_0001986 Ga0496112_0001986_10842_11468 199
1020 3300048915 Ga0496112_0170823 Ga0496112_0170823_517_1125 199
1021 3300048916 Ga0496113_0068645 Ga0496113_0068645_626_1252 199
1022 3300048918 Ga0496115_0326434 Ga0496115_0326434_159_785 199
1023 3300048919 Ga0496116_0135269 Ga0496116_0135269_188_796 199
1024 3300048920 Ga0496117_0035263 Ga0496117_0035263_183_791 199
1025 3300048921 Ga0496118_0016550 Ga0496118_0016550_3442_4050 199
1026 3300048922 Ga0496119_0173657 Ga0496119_0173657_49_657 199
1027 3300048924 Ga0496121_0052155 Ga0496121_0052155_389_997 199
1028 3300048928 Ga0496125_0058042 Ga0496125_0058042_1730_2338 199
1029 3300048929 Ga0496126_0320985 Ga0496126_0320985_321_932 199
1030 3300048929 Ga0496126_0331048 Ga0496126_0331048_450_1061 199
1031 3300049571 Ga0501034_0018371 Ga0501034_0018371_4730_5341 199
1032 3300050514 nmdc:mga08x19_745588_c1 nmdc:mga08x19_745588_c1_36_644 199
1033 3300053077 Ga0495601_0024993 Ga0495601_0024993_1635_2270 199
1034 3300053078 Ga0495612_0007245 Ga0495612_0007245_1723_2358 199
1035 3300053084 Ga0495595_0001064 Ga0495595_0001064_3115_3750 199
1036 3300053085 Ga0495619_0002863 Ga0495619_0002863_3813_4448 199
1037 3300053120 Ga0500597_157720 Ga0500597_157720_207_818 199
1038 3300053154 Ga0500619_050394 Ga0500619_050394_283_897 199
1039 3300053163 Ga0500639_174928 Ga0500639_174928_180_791 199
1040 3300005327 Ga0070658_10100907 Ga0070658_101009072 200
1041 3300005439 Ga0070711_100289096 Ga0070711_1002890962 200
1042 3300005539 Ga0068853_100410300 Ga0068853_1004103002 200
1043 3300005843 Ga0068860_100003417 Ga0068860_1000034179 200
1044 3300006178 Ga0075367_10494353 Ga0075367_104943532 200
1045 3300006852 Ga0075433_10079340 Ga0075433_100793402 200
1046 3300006871 Ga0075434_100061382 Ga0075434_1000613823 200
1047 3300007076 Ga0075435_100027547 Ga0075435_1000275473 200
1048 3300009093 Ga0105240_10314620 Ga0105240_103146201 200
1049 3300009094 Ga0111539_10026905 Ga0111539_100269055 200
1050 3300009545 Ga0105237_10025834 Ga0105237_100258345 200
1051 3300021384 Ga0213876_10165676 Ga0213876_101656762 200
1052 3300021384 Ga0213876_10346435 Ga0213876_103464352 200
1053 3300025924 Ga0207694_10034514 Ga0207694_100345143 200
1054 3300025929 Ga0207664_10278766 Ga0207664_102787662 200
1055 3300025931 Ga0207644_10594932 Ga0207644_105949322 200
1056 3300025949 Ga0207667_10114797 Ga0207667_101147972 200
1057 3300026035 Ga0207703_10454772 Ga0207703_104547722 200
1058 3300026067 Ga0207678_10016231 Ga0207678_100162314 200
1059 3300026088 Ga0207641_10089232 Ga0207641_100892323 200
1060 3300028381 Ga0268264_10000168 Ga0268264_1000016849 200
1061 3300030521 Ga0307511_10265202 Ga0307511_102652022 200
1062 3300031507 Ga0307509_10072515 Ga0307509_100725152 200
1063 3300033179 Ga0307507_10008502 Ga0307507_1000850215 200
1064 3300033180 Ga0307510_10060324 Ga0307510_100603242 200
1065 3300035170 Ga0373943_0051269 Ga0373943_0051269_607_1224 200
1066 3300035695 Ga0373927_0069530 Ga0373927_0069530_378_995 200
1067 3300037068 Ga0373925_0051259 Ga0373925_0051259_1852_2469 200
1068 3300037068 Ga0373925_0277216 Ga0373925_0277216_631_1245 200
1069 3300037418 Ga0395900_0023914 Ga0395900_0023914_4209_4823 200
1070 3300037466 Ga0395898_0068553 Ga0395898_0068553_1308_1922 200
1071 3300038443 Ga0395901_0024268 Ga0395901_0024268_5474_6088 200
1072 3300039437 Ga0436365_1690162 Ga0436365_1690162_519_1136 200
1073 3300039450 Ga0436363_0472706 Ga0436363_0472706_192_800 200
1074 3300044684 Ga0466966_0170453 Ga0466966_0170453_329_943 200
1075 3300046455 Ga0495603_0032422 Ga0495603_0032422_290_904 200
1076 3300046507 Ga0495606_0000514 Ga0495606_0000514_49579_50193 200
1077 3300046535 Ga0495586_0205306 Ga0495586_0205306_234_851 200
1078 3300046557 Ga0495622_0069998 Ga0495622_0069998_895_1512 200
1079 3300046681 Ga0495647_0177687 Ga0495647_0177687_83_697 200
1080 3300048903 Ga0496100_0453940 Ga0496100_0453940_190_798 200
1081 3300048909 Ga0496106_0123106 Ga0496106_0123106_974_1582 200
1082 3300048910 Ga0496107_0017729 Ga0496107_0017729_1912_2526 200
1083 3300048924 Ga0496121_0002977 Ga0496121_0002977_15593_16207 200
1084 3300048924 Ga0496121_0105958 Ga0496121_0105958_228_845 200
1085 3300048929 Ga0496126_0008193 Ga0496126_0008193_6021_6635 200
1086 3300048929 Ga0496126_0077975 Ga0496126_0077975_213_827 200
1087 3300049568 Ga0501031_0039821 Ga0501031_0039821_435_1046 200
1088 3300049569 Ga0501032_0030107 Ga0501032_0030107_1701_2348 200
1089 3300049569 Ga0501032_0033117 Ga0501032_0033117_1850_2461 200
1090 3300049569 Ga0501032_0043048 Ga0501032_0043048_988_1599 200
1091 3300049569 Ga0501032_0045454 Ga0501032_0045454_1546_2157 200
1092 3300049570 Ga0501033_0002151 Ga0501033_0002151_8209_8856 200
1093 3300049570 Ga0501033_0111535 Ga0501033_0111535_1346_1960 200
1094 3300049570 Ga0501033_0134982 Ga0501033_0134982_831_1442 200
1095 3300049571 Ga0501034_0938544 Ga0501034_0938544_93_704 200
1096 3300049572 Ga0501036_0024848 Ga0501036_0024848_1625_2272 200
1097 3300049573 Ga0501037_0000635 Ga0501037_0000635_3038_3646 200
1098 3300049573 Ga0501037_0146859 Ga0501037_0146859_943_1554 200
1099 3300049574 Ga0501038_0000377 Ga0501038_0000377_15511_16122 200
1100 3300049574 Ga0501038_0018922 Ga0501038_0018922_2523_3134 200
1101 3300049574 Ga0501038_0025675 Ga0501038_0025675_1691_2338 200
1102 3300049574 Ga0501038_0080510 Ga0501038_0080510_1558_2166 200
1103 3300049574 Ga0501038_0095269 Ga0501038_0095269_677_1288 200
1104 3300049575 Ga0501039_0041561 Ga0501039_0041561_1940_2587 200
1105 3300049575 Ga0501039_0519851 Ga0501039_0519851_78_686 200
1106 3300049576 Ga0501040_0222973 Ga0501040_0222973_556_1167 200
1107 3300049578 Ga0501042_0105746 Ga0501042_0105746_738_1346 200
1108 3300049578 Ga0501042_0192819 Ga0501042_0192819_460_1068 200
1109 3300049579 Ga0501043_0006300 Ga0501043_0006300_2328_2975 200
1110 3300049579 Ga0501043_0060612 Ga0501043_0060612_1839_2450 200
1111 3300049579 Ga0501043_0069873 Ga0501043_0069873_2013_2627 200
1112 3300049579 Ga0501043_0336677 Ga0501043_0336677_250_861 200
1113 3300049580 Ga0501046_0027341 Ga0501046_0027341_2452_3099 200
1114 3300049580 Ga0501046_0091582 Ga0501046_0091582_1250_1858 200
1115 3300049580 Ga0501046_0107150 Ga0501046_0107150_367_981 200
1116 3300049581 Ga0501047_0070002 Ga0501047_0070002_1591_2202 200
1117 3300049581 Ga0501047_0435933 Ga0501047_0435933_85_699 200
1118 3300049583 Ga0501067_0015512 Ga0501067_0015512_2130_2741 200
1119 3300049584 Ga0501068_0167413 Ga0501068_0167413_651_1298 200
1120 3300049585 Ga0501069_0182688 Ga0501069_0182688_301_912 200
1121 3300049586 Ga0501070_0058298 Ga0501070_0058298_221_832 200
1122 3300049587 Ga0501071_0059386 Ga0501071_0059386_682_1293 200
1123 3300049588 Ga0501072_0089127 Ga0501072_0089127_674_1285 200
1124 3300049589 Ga0501073_0021687 Ga0501073_0021687_1617_2228 200
1125 3300049590 Ga0501074_0018790 Ga0501074_0018790_2978_3589 200
1126 3300049593 Ga0501077_0057771 Ga0501077_0057771_1243_1854 200
1127 3300049741 Ga0501079_0006517 Ga0501079_0006517_7758_8369 200
1128 3300049742 Ga0501080_0041782 Ga0501080_0041782_972_1583 200
1129 3300049742 Ga0501080_0437686 Ga0501080_0437686_326_934 200
1130 3300049744 Ga0501083_0027807 Ga0501083_0027807_2018_2629 200
1131 3300049822 Ga0501035_0001593 Ga0501035_0001593_13536_14144 200
1132 3300049822 Ga0501035_0314293 Ga0501035_0314293_457_1071 200
1133 3300049822 Ga0501035_0676504 Ga0501035_0676504_73_681 200
1134 3300049823 Ga0501044_0011954 Ga0501044_0011954_7545_8156 200
1135 3300049823 Ga0501044_0040881 Ga0501044_0040881_1314_1922 200
1136 3300049824 Ga0501045_0031334 Ga0501045_0031334_2954_3565 200
1137 3300050511 nmdc:mga08y16_48905_c1 nmdc:mga08y16_48905_c1_2347_2988 200
1138 3300050512 nmdc:mga0n895_1865_c2 nmdc:mga0n895_1865_c2_4307_4939 200
1139 3300050512 nmdc:mga0n895_60539_c1 nmdc:mga0n895_60539_c1_1113_1754 200
1140 3300050513 nmdc:mga0rr50_14135_c1 nmdc:mga0rr50_14135_c1_110_751 200
1141 3300050515 nmdc:mga0a205_131184_c1 nmdc:mga0a205_131184_c1_220_861 200
1142 3300053080 Ga0500635_0025476 Ga0500635_0025476_423_1037 200
1143 3300053080 Ga0500635_0036756 Ga0500635_0036756_556_1170 200
1144 3300053094 Ga0500566_0091176 Ga0500566_0091176_126_740 200
1145 3300053102 Ga0500554_048007 Ga0500554_048007_492_1106 200
1146 3300053119 Ga0500595_032431 Ga0500595_032431_475_1092 200
1147 3300053150 Ga0500603_000752 Ga0500603_000752_425_1039 200
1148 3300053150 Ga0500603_035113 Ga0500603_035113_266_883 200
1149 3300053177 Ga0500636_0113867 Ga0500636_0113867_720_1334 200
1150 3300054114 Ga0501084_0082116 Ga0501084_0082116_995_1606 200
1151 3300060353 Ga0501082_0173400 Ga0501082_0173400_800_1411 200
1152 3300061734 Ga0530510_0312681 Ga0530510_0312681_348_959 200
1153 3300003203 JGI25406J46586_10000262 JGI25406J46586_1000026216 201
1154 3300005339 Ga0070660_100182880 Ga0070660_1001828802 201
1155 3300005341 Ga0070691_10275659 Ga0070691_102756592 201
1156 3300005366 Ga0070659_100205913 Ga0070659_1002059132 201
1157 3300005434 Ga0070709_10002036 Ga0070709_100020365 201
1158 3300005435 Ga0070714_100322666 Ga0070714_1003226662 201
1159 3300005436 Ga0070713_100003099 Ga0070713_1000030994 201
1160 3300005436 Ga0070713_100053082 Ga0070713_1000530822 201
1161 3300005436 Ga0070713_100308099 Ga0070713_1003080993 201
1162 3300005437 Ga0070710_10007272 Ga0070710_100072725 201
1163 3300005439 Ga0070711_100007787 Ga0070711_1000077876 201
1164 3300005468 Ga0070707_100110041 Ga0070707_1001100413 201
1165 3300005530 Ga0070679_100170596 Ga0070679_1001705963 201
1166 3300005539 Ga0068853_100112145 Ga0068853_1001121453 201
1167 3300005615 Ga0070702_100374079 Ga0070702_1003740792 201
1168 3300005983 Ga0081540_1000007 Ga0081540_100000777 201
1169 3300005985 Ga0081539_10000003 Ga0081539_10000003494 201
1170 3300006028 Ga0070717_10002923 Ga0070717_1000292315 201
1171 3300006028 Ga0070717_10435191 Ga0070717_104351912 201
1172 3300006173 Ga0070716_100020294 Ga0070716_1000202944 201
1173 3300006175 Ga0070712_100013770 Ga0070712_1000137704 201
1174 3300006844 Ga0075428_100000606 Ga0075428_10000060625 201
1175 3300006880 Ga0075429_100515473 Ga0075429_1005154732 201
1176 3300007265 Ga0099794_10018933 Ga0099794_100189333 201
1177 3300007265 Ga0099794_10098732 Ga0099794_100987322 201
1178 3300007788 Ga0099795_10024611 Ga0099795_100246113 201
1179 3300010159 Ga0099796_10020963 Ga0099796_100209632 201
1180 3300013100 Ga0157373_10061521 Ga0157373_100615211 201
1181 3300013105 Ga0157369_10396889 Ga0157369_103968893 201
1182 3300024227 Ga0228598_1048166 Ga0228598_10481662 201
1183 3300025898 Ga0207692_10001475 Ga0207692_1000147510 201
1184 3300025905 Ga0207685_10088892 Ga0207685_100888922 201
1185 3300025906 Ga0207699_10001879 Ga0207699_100018792 201
1186 3300025909 Ga0207705_10046307 Ga0207705_100463073 201
1187 3300025915 Ga0207693_10000479 Ga0207693_1000047922 201
1188 3300025916 Ga0207663_10051544 Ga0207663_100515441 201
1189 3300025919 Ga0207657_10056462 Ga0207657_100564623 201
1190 3300025921 Ga0207652_10701296 Ga0207652_107012961 201
1191 3300025922 Ga0207646_10257142 Ga0207646_102571422 201
1192 3300025928 Ga0207700_10069774 Ga0207700_100697744 201
1193 3300025928 Ga0207700_10083703 Ga0207700_100837033 201
1194 3300025928 Ga0207700_10638400 Ga0207700_106384002 201
1195 3300025929 Ga0207664_10166759 Ga0207664_101667592 201
1196 3300025929 Ga0207664_10900403 Ga0207664_109004031 201
1197 3300025939 Ga0207665_10000090 Ga0207665_1000009015 201
1198 3300025939 Ga0207665_10038595 Ga0207665_100385952 201
1199 3300026041 Ga0207639_10280400 Ga0207639_102804002 201
1200 3300027671 Ga0209588_1014517 Ga0209588_10145172 201
1201 3300028558 Ga0265326_10094387 Ga0265326_100943871 201
1202 3300031235 Ga0265330_10014492 Ga0265330_100144924 201
1203 3300031235 Ga0265330_10037001 Ga0265330_100370012 201
1204 3300031235 Ga0265330_10168996 Ga0265330_101689962 201
1205 3300031238 Ga0265332_10063512 Ga0265332_100635123 201
1206 3300031238 Ga0265332_10223385 Ga0265332_102233851 201
1207 3300031239 Ga0265328_10062682 Ga0265328_100626822 201
1208 3300031239 Ga0265328_10069003 Ga0265328_100690032 201
1209 3300031241 Ga0265325_10050439 Ga0265325_100504392 201
1210 3300031241 Ga0265325_10116000 Ga0265325_101160002 201
1211 3300031247 Ga0265340_10005231 Ga0265340_100052314 201
1212 3300031249 Ga0265339_10188528 Ga0265339_101885282 201
1213 3300031249 Ga0265339_10300694 Ga0265339_103006941 201
1214 3300031250 Ga0265331_10124524 Ga0265331_101245241 201
1215 3300031344 Ga0265316_10174619 Ga0265316_101746192 201
1216 3300031344 Ga0265316_10240078 Ga0265316_102400782 201
1217 3300031711 Ga0265314_10036676 Ga0265314_100366761 201
1218 3300031711 Ga0265314_10089763 Ga0265314_100897631 201
1219 3300031712 Ga0265342_10012254 Ga0265342_100122542 201
1220 3300031712 Ga0265342_10126271 Ga0265342_101262711 201
1221 3300035086 Ga0373934_0044982 Ga0373934_0044982_1055_1672 201
1222 3300035086 Ga0373934_0047626 Ga0373934_0047626_1041_1658 201
1223 3300035092 Ga0373952_0088465 Ga0373952_0088465_102_728 201
1224 3300035117 Ga0373953_0003031 Ga0373953_0003031_1302_1919 201
1225 3300035117 Ga0373953_0010085 Ga0373953_0010085_1927_2544 201
1226 3300035118 Ga0373954_0006494 Ga0373954_0006494_3184_3801 201
1227 3300035118 Ga0373954_0059853 Ga0373954_0059853_139_756 201
1228 3300035119 Ga0373956_0063755 Ga0373956_0063755_538_1155 201
1229 3300035120 Ga0373957_0000801 Ga0373957_0000801_727_1344 201
1230 3300035120 Ga0373957_0077474 Ga0373957_0077474_129_746 201
1231 3300035410 Ga0373924_0207262 Ga0373924_0207262_41_658 201
1232 3300035692 Ga0373935_0123842 Ga0373935_0123842_187_804 201
1233 3300035695 Ga0373927_0054260 Ga0373927_0054260_357_974 201
1234 3300036401 Ga0373937_0011662 Ga0373937_0011662_4931_5548 201
1235 3300036401 Ga0373937_0446144 Ga0373937_0446144_547_1164 201
1236 3300037068 Ga0373925_0049703 Ga0373925_0049703_859_1476 201
1237 3300046454 Ga0495592_0077155 Ga0495592_0077155_691_1308 201
1238 3300046455 Ga0495603_0001668 Ga0495603_0001668_8439_9056 201
1239 3300046463 Ga0495653_0051789 Ga0495653_0051789_497_1114 201
1240 3300046475 Ga0495639_0127858 Ga0495639_0127858_45_662 201
1241 3300046511 Ga0495608_0040209 Ga0495608_0040209_1547_2164 201
1242 3300046511 Ga0495608_0453069 Ga0495608_0453069_141_758 201
1243 3300046512 Ga0495610_0191711 Ga0495610_0191711_175_792 201
1244 3300046514 Ga0495618_0254655 Ga0495618_0254655_251_868 201
1245 3300046516 Ga0495628_0302039 Ga0495628_0302039_282_899 201
1246 3300046517 Ga0495630_0043199 Ga0495630_0043199_850_1467 201
1247 3300046533 Ga0495640_0003781 Ga0495640_0003781_11376_11993 201
1248 3300046535 Ga0495586_0166282 Ga0495586_0166282_457_1074 201
1249 3300046536 Ga0495587_0015325 Ga0495587_0015325_300_917 201
1250 3300046559 Ga0495667_0122810 Ga0495667_0122810_340_957 201
1251 3300046642 Ga0495634_0020543 Ga0495634_0020543_810_1427 201
1252 3300046642 Ga0495634_0092966 Ga0495634_0092966_489_1106 201
1253 3300046663 Ga0495635_0004272 Ga0495635_0004272_8469_9086 201
1254 3300046663 Ga0495635_0156420 Ga0495635_0156420_833_1450 201
1255 3300046674 Ga0495588_0028455 Ga0495588_0028455_1802_2419 201
1256 3300046675 Ga0495657_0042191 Ga0495657_0042191_1055_1672 201
1257 3300046675 Ga0495657_0295147 Ga0495657_0295147_319_936 201
1258 3300046678 Ga0495599_0110503 Ga0495599_0110503_822_1439 201
1259 3300046678 Ga0495599_0135540 Ga0495599_0135540_680_1297 201
1260 3300046679 Ga0495623_0023294 Ga0495623_0023294_2883_3500 201
1261 3300046679 Ga0495623_0039478 Ga0495623_0039478_1212_1829 201
1262 3300046680 Ga0495646_0026486 Ga0495646_0026486_2873_3490 201
1263 3300046680 Ga0495646_0135009 Ga0495646_0135009_129_746 201
1264 3300046689 Ga0495613_0065807 Ga0495613_0065807_818_1435 201
1265 3300046689 Ga0495613_0095354 Ga0495613_0095354_232_849 201
1266 3300046689 Ga0495613_0145915 Ga0495613_0145915_477_1094 201
1267 3300047317 Ga0495604_0020499 Ga0495604_0020499_91_708 201
1268 3300047319 Ga0495674_0019395 Ga0495674_0019395_1110_1727 201
1269 3300047319 Ga0495674_0026267 Ga0495674_0026267_3925_4542 201
1270 3300047322 Ga0495680_0024509 Ga0495680_0024509_1573_2190 201
1271 3300047444 Ga0495675_0008654 Ga0495675_0008654_2941_3558 201
1272 3300047471 Ga0495684_0004425 Ga0495684_0004425_8284_8901 201
1273 3300047673 Ga0495593_0031228 Ga0495593_0031228_1183_1800 201
1274 3300048088 Ga0495602_0124807 Ga0495602_0124807_592_1209 201
1275 3300048911 Ga0496108_0539003 Ga0496108_0539003_218_835 201
1276 3300048912 Ga0496109_0540399 Ga0496109_0540399_386_1003 201
1277 3300048913 Ga0496110_0768006 Ga0496110_0768006_20_637 201
1278 3300048915 Ga0496112_0000045 Ga0496112_0000045_6879_7496 201
1279 3300048916 Ga0496113_0090148 Ga0496113_0090148_913_1530 201
1280 3300048917 Ga0496114_0757852 Ga0496114_0757852_112_729 201
1281 3300048918 Ga0496115_0020501 Ga0496115_0020501_3413_4030 201
1282 3300048922 Ga0496119_0357452 Ga0496119_0357452_56_667 201
1283 3300048924 Ga0496121_0000225 Ga0496121_0000225_77809_78426 201
1284 3300048929 Ga0496126_0091722 Ga0496126_0091722_1016_1633 201
1285 3300049574 Ga0501038_0231213 Ga0501038_0231213_503_1117 201
1286 3300049574 Ga0501038_0338649 Ga0501038_0338649_380_997 201
1287 3300049575 Ga0501039_0195007 Ga0501039_0195007_899_1513 201
1288 3300049579 Ga0501043_0088359 Ga0501043_0088359_1198_1812 201
1289 3300049581 Ga0501047_0470019 Ga0501047_0470019_422_1039 201
1290 3300049584 Ga0501068_0178984 Ga0501068_0178984_580_1194 201
1291 3300049823 Ga0501044_0077113 Ga0501044_0077113_684_1298 201
1292 3300049823 Ga0501044_0497866 Ga0501044_0497866_348_983 201
1293 3300053077 Ga0495601_0089801 Ga0495601_0089801_864_1481 201
1294 3300053078 Ga0495612_0036954 Ga0495612_0036954_293_910 201
1295 3300053084 Ga0495595_0000665 Ga0495595_0000665_4911_5528 201
1296 3300053084 Ga0495595_0101766 Ga0495595_0101766_91_708 201
1297 3300053085 Ga0495619_0017529 Ga0495619_0017529_2941_3558 201
1298 3300053119 Ga0500595_003476 Ga0500595_003476_229_846 201
1299 3300053153 Ga0500616_0000048 Ga0500616_0000048_32149_32775 201
1300 3300003771 Ga0055526_1018124 Ga0055526_10181243 202
1301 3300005439 Ga0070711_100374597 Ga0070711_1003745972 202
1302 3300005536 Ga0070697_100212109 Ga0070697_1002121092 202
1303 3300005843 Ga0068860_100216912 Ga0068860_1002169122 202
1304 3300005937 Ga0081455_10002467 Ga0081455_1000246710 202
1305 3300005981 Ga0081538_10018742 Ga0081538_100187424 202
1306 3300005983 Ga0081540_1025472 Ga0081540_10254722 202
1307 3300006173 Ga0070716_100199606 Ga0070716_1001996062 202
1308 3300006175 Ga0070712_100188808 Ga0070712_1001888083 202
1309 3300006871 Ga0075434_100164364 Ga0075434_1001643642 202
1310 3300006880 Ga0075429_100408735 Ga0075429_1004087352 202
1311 3300006881 Ga0068865_100820335 Ga0068865_1008203352 202
1312 3300009094 Ga0111539_10011510 Ga0111539_100115103 202
1313 3300010159 Ga0099796_10009623 Ga0099796_100096233 202
1314 3300013105 Ga0157369_10424714 Ga0157369_104247142 202
1315 3300025295 Ga0209564_1000407 Ga0209564_100040743 202
1316 3300025916 Ga0207663_10023702 Ga0207663_100237024 202
1317 3300025939 Ga0207665_10101486 Ga0207665_101014862 202
1318 3300026121 Ga0207683_10556933 Ga0207683_105569332 202
1319 3300031595 Ga0265313_10000326 Ga0265313_1000032635 202
1320 3300031824 Ga0307413_10128995 Ga0307413_101289952 202
1321 3300035084 Ga0373928_0021017 Ga0373928_0021017_162_779 202
1322 3300035086 Ga0373934_0193290 Ga0373934_0193290_72_731 202
1323 3300035111 Ga0373923_0143136 Ga0373923_0143136_176_835 202
1324 3300035112 Ga0373932_0060844 Ga0373932_0060844_462_1079 202
1325 3300035114 Ga0373939_0000364 Ga0373939_0000364_7737_8372 202
1326 3300035120 Ga0373957_0053988 Ga0373957_0053988_556_1215 202
1327 3300035410 Ga0373924_0133092 Ga0373924_0133092_26_685 202
1328 3300035695 Ga0373927_0071628 Ga0373927_0071628_980_1597 202
1329 3300035695 Ga0373927_0184552 Ga0373927_0184552_128_751 202
1330 3300036401 Ga0373937_0000886 Ga0373937_0000886_2074_2733 202
1331 3300036401 Ga0373937_0937170 Ga0373937_0937170_166_783 202
1332 3300037068 Ga0373925_0020481 Ga0373925_0020481_1876_2487 202
1333 3300037068 Ga0373925_0106236 Ga0373925_0106236_927_1544 202
1334 3300037418 Ga0395900_0145366 Ga0395900_0145366_915_1535 202
1335 3300037471 Ga0395905_0035844 Ga0395905_0035844_2382_3002 202
1336 3300038443 Ga0395901_0411115 Ga0395901_0411115_250_870 202
1337 3300046460 Ga0495638_0452714 Ga0495638_0452714_22_636 202
1338 3300046473 Ga0495582_0127891 Ga0495582_0127891_387_1004 202
1339 3300046475 Ga0495639_0077984 Ga0495639_0077984_176_799 202
1340 3300046475 Ga0495639_0202131 Ga0495639_0202131_111_728 202
1341 3300046491 Ga0495584_0012187 Ga0495584_0012187_3087_3701 202
1342 3300046491 Ga0495584_0158358 Ga0495584_0158358_132_749 202
1343 3300046499 Ga0495594_0470876 Ga0495594_0470876_26_643 202
1344 3300046517 Ga0495630_0280016 Ga0495630_0280016_29_688 202
1345 3300046526 Ga0495666_0091178 Ga0495666_0091178_446_1063 202
1346 3300046683 Ga0495658_0078448 Ga0495658_0078448_167_784 202
1347 3300046683 Ga0495658_0189924 Ga0495658_0189924_132_755 202
1348 3300046694 Ga0495649_0154678 Ga0495649_0154678_576_1193 202
1349 3300047315 Ga0495581_0101817 Ga0495581_0101817_678_1301 202
1350 3300047320 Ga0495672_0101123 Ga0495672_0101123_751_1368 202
1351 3300048907 Ga0496104_0063234 Ga0496104_0063234_970_1587 202
1352 3300048909 Ga0496106_0440857 Ga0496106_0440857_14_631 202
1353 3300048910 Ga0496107_0229933 Ga0496107_0229933_667_1284 202
1354 3300048911 Ga0496108_0094354 Ga0496108_0094354_1333_1950 202
1355 3300048915 Ga0496112_0458456 Ga0496112_0458456_170_787 202
1356 3300048916 Ga0496113_0232852 Ga0496113_0232852_308_925 202
1357 3300048917 Ga0496114_0096209 Ga0496114_0096209_1842_2459 202
1358 3300048927 Ga0496124_0344692 Ga0496124_0344692_133_756 202
1359 3300048929 Ga0496126_0111714 Ga0496126_0111714_726_1346 202
1360 3300049572 Ga0501036_0191211 Ga0501036_0191211_558_1166 202
1361 3300049581 Ga0501047_0012833 Ga0501047_0012833_5159_5767 202
1362 3300049583 Ga0501067_0070852 Ga0501067_0070852_945_1553 202
1363 3300049585 Ga0501069_0217974 Ga0501069_0217974_181_789 202
1364 3300049586 Ga0501070_0088291 Ga0501070_0088291_1609_2217 202
1365 3300049587 Ga0501071_0211522 Ga0501071_0211522_331_939 202
1366 3300049588 Ga0501072_0119238 Ga0501072_0119238_143_751 202
1367 3300049589 Ga0501073_0013212 Ga0501073_0013212_632_1240 202
1368 3300049590 Ga0501074_0010235 Ga0501074_0010235_542_1150 202
1369 3300049593 Ga0501077_0162657 Ga0501077_0162657_34_645 202
1370 3300049742 Ga0501080_0189266 Ga0501080_0189266_611_1219 202
1371 3300049822 Ga0501035_0050613 Ga0501035_0050613_1979_2587 202
1372 3300049822 Ga0501035_0594802 Ga0501035_0594802_132_740 202
1373 3300049823 Ga0501044_0034340 Ga0501044_0034340_288_896 202
1374 3300050512 nmdc:mga0n895_11422_c1 nmdc:mga0n895_11422_c1_4062_4679 202
1375 3300053078 Ga0495612_0316538 Ga0495612_0316538_59_679 202
1376 3300053084 Ga0495595_0006022 Ga0495595_0006022_2576_3199 202
1377 3300053084 Ga0495595_0049516 Ga0495595_0049516_1170_1787 202
1378 3300053085 Ga0495619_0027880 Ga0495619_0027880_2932_3555 202
1379 3300053085 Ga0495619_0106868 Ga0495619_0106868_1056_1676 202
1380 3300053085 Ga0495619_0170732 Ga0495619_0170732_92_709 202
1381 3300001991 JGI24743J22301_10009448 JGI24743J22301_100094482 203
1382 3300002070 JGI24750J21931_1009747 JGI24750J21931_10097472 203
1383 3300002077 JGI24744J21845_10022947 JGI24744J21845_100229472 203
1384 3300002239 JGI24034J26672_10013927 JGI24034J26672_100139272 203
1385 3300005328 Ga0070676_10413993 Ga0070676_104139931 203
1386 3300005331 Ga0070670_100016399 Ga0070670_1000163992 203
1387 3300005331 Ga0070670_100041138 Ga0070670_1000411382 203
1388 3300005331 Ga0070670_100127615 Ga0070670_1001276153 203
1389 3300005333 Ga0070677_10164068 Ga0070677_101640681 203
1390 3300005338 Ga0068868_100092820 Ga0068868_1000928203 203
1391 3300005339 Ga0070660_100021005 Ga0070660_1000210055 203
1392 3300005340 Ga0070689_100125140 Ga0070689_1001251402 203
1393 3300005340 Ga0070689_100206602 Ga0070689_1002066022 203
1394 3300005343 Ga0070687_100011242 Ga0070687_1000112425 203
1395 3300005344 Ga0070661_100075948 Ga0070661_1000759482 203
1396 3300005344 Ga0070661_100488942 Ga0070661_1004889421 203
1397 3300005347 Ga0070668_100031419 Ga0070668_1000314193 203
1398 3300005353 Ga0070669_100029985 Ga0070669_1000299852 203
1399 3300005354 Ga0070675_100082218 Ga0070675_1000822183 203
1400 3300005355 Ga0070671_100001730 Ga0070671_1000017302 203
1401 3300005355 Ga0070671_100022012 Ga0070671_1000220124 203
1402 3300005364 Ga0070673_100003333 Ga0070673_1000033336 203
1403 3300005365 Ga0070688_100074241 Ga0070688_1000742412 203
1404 3300005365 Ga0070688_100116358 Ga0070688_1001163582 203
1405 3300005366 Ga0070659_100293703 Ga0070659_1002937032 203
1406 3300005438 Ga0070701_10002446 Ga0070701_100024465 203
1407 3300005439 Ga0070711_100069863 Ga0070711_1000698633 203
1408 3300005439 Ga0070711_100203313 Ga0070711_1002033132 203
1409 3300005441 Ga0070700_100005828 Ga0070700_1000058282 203
1410 3300005456 Ga0070678_100277223 Ga0070678_1002772231 203
1411 3300005457 Ga0070662_100196404 Ga0070662_1001964041 203
1412 3300005471 Ga0070698_100168522 Ga0070698_1001685223 203
1413 3300005535 Ga0070684_100103611 Ga0070684_1001036114 203
1414 3300005543 Ga0070672_100205500 Ga0070672_1002055002 203
1415 3300005544 Ga0070686_100036275 Ga0070686_1000362753 203
1416 3300005548 Ga0070665_100080278 Ga0070665_1000802782 203
1417 3300005548 Ga0070665_100272367 Ga0070665_1002723672 203
1418 3300005548 Ga0070665_100287484 Ga0070665_1002874842 203
1419 3300005563 Ga0068855_100093003 Ga0068855_1000930032 203
1420 3300005577 Ga0068857_100089021 Ga0068857_1000890213 203
1421 3300005578 Ga0068854_100155181 Ga0068854_1001551812 203
1422 3300005615 Ga0070702_100026206 Ga0070702_1000262063 203
1423 3300005616 Ga0068852_100125140 Ga0068852_1001251403 203
1424 3300005718 Ga0068866_10013738 Ga0068866_100137384 203
1425 3300005719 Ga0068861_100050416 Ga0068861_1000504162 203
1426 3300005840 Ga0068870_10010997 Ga0068870_100109971 203
1427 3300005841 Ga0068863_100125400 Ga0068863_1001254002 203
1428 3300005843 Ga0068860_100074823 Ga0068860_1000748234 203
1429 3300005983 Ga0081540_1038935 Ga0081540_10389352 203
1430 3300006028 Ga0070717_10241114 Ga0070717_102411142 203
1431 3300006163 Ga0070715_10069905 Ga0070715_100699051 203
1432 3300006175 Ga0070712_100037946 Ga0070712_1000379463 203
1433 3300006175 Ga0070712_100074152 Ga0070712_1000741522 203
1434 3300006178 Ga0075367_10164911 Ga0075367_101649112 203
1435 3300006178 Ga0075367_10462706 Ga0075367_104627062 203
1436 3300006358 Ga0068871_100116272 Ga0068871_1001162721 203
1437 3300006844 Ga0075428_100025380 Ga0075428_1000253804 203
1438 3300006847 Ga0075431_100882235 Ga0075431_1008822352 203
1439 3300006871 Ga0075434_100134319 Ga0075434_1001343192 203
1440 3300006881 Ga0068865_100132893 Ga0068865_1001328932 203
1441 3300009098 Ga0105245_10581584 Ga0105245_105815842 203
1442 3300009147 Ga0114129_10125602 Ga0114129_101256024 203
1443 3300009174 Ga0105241_10656728 Ga0105241_106567281 203
1444 3300009177 Ga0105248_10243768 Ga0105248_102437683 203
1445 3300009553 Ga0105249_10066562 Ga0105249_100665622 203
1446 3300010375 Ga0105239_10165467 Ga0105239_101654672 203
1447 3300011119 Ga0105246_10008553 Ga0105246_100085535 203
1448 3300013296 Ga0157374_10311538 Ga0157374_103115381 203
1449 3300013297 Ga0157378_10086568 Ga0157378_100865684 203
1450 3300013308 Ga0157375_10249688 Ga0157375_102496882 203
1451 3300014325 Ga0163163_10580372 Ga0163163_105803722 203
1452 3300014745 Ga0157377_10024192 Ga0157377_100241924 203
1453 3300014968 Ga0157379_10034526 Ga0157379_100345265 203
1454 3300025893 Ga0207682_10029653 Ga0207682_100296533 203
1455 3300025899 Ga0207642_10035407 Ga0207642_100354073 203
1456 3300025900 Ga0207710_10016322 Ga0207710_100163222 203
1457 3300025900 Ga0207710_10167668 Ga0207710_101676682 203
1458 3300025901 Ga0207688_10002649 Ga0207688_100026495 203
1459 3300025904 Ga0207647_10011438 Ga0207647_100114388 203
1460 3300025907 Ga0207645_10030729 Ga0207645_100307294 203
1461 3300025908 Ga0207643_10014282 Ga0207643_100142826 203
1462 3300025915 Ga0207693_10084524 Ga0207693_100845243 203
1463 3300025915 Ga0207693_10118977 Ga0207693_101189772 203
1464 3300025916 Ga0207663_10026800 Ga0207663_100268002 203
1465 3300025916 Ga0207663_10113341 Ga0207663_101133413 203
1466 3300025916 Ga0207663_10222204 Ga0207663_102222042 203
1467 3300025918 Ga0207662_10011799 Ga0207662_100117994 203
1468 3300025919 Ga0207657_10058483 Ga0207657_100584833 203
1469 3300025920 Ga0207649_10237268 Ga0207649_102372682 203
1470 3300025923 Ga0207681_10019681 Ga0207681_100196812 203
1471 3300025925 Ga0207650_10017302 Ga0207650_100173023 203
1472 3300025926 Ga0207659_10075499 Ga0207659_100754993 203
1473 3300025927 Ga0207687_10323042 Ga0207687_103230422 203
1474 3300025931 Ga0207644_10073434 Ga0207644_100734343 203
1475 3300025931 Ga0207644_10136731 Ga0207644_101367312 203
1476 3300025932 Ga0207690_10131310 Ga0207690_101313102 203
1477 3300025932 Ga0207690_10289541 Ga0207690_102895412 203
1478 3300025934 Ga0207686_10141368 Ga0207686_101413681 203
1479 3300025936 Ga0207670_10051208 Ga0207670_100512082 203
1480 3300025940 Ga0207691_10007721 Ga0207691_100077213 203
1481 3300025940 Ga0207691_10056324 Ga0207691_100563242 203
1482 3300025941 Ga0207711_10738000 Ga0207711_107380001 203
1483 3300025942 Ga0207689_10016941 Ga0207689_100169416 203
1484 3300025960 Ga0207651_10006087 Ga0207651_100060872 203
1485 3300025961 Ga0207712_10020315 Ga0207712_100203154 203
1486 3300025986 Ga0207658_10643180 Ga0207658_106431802 203
1487 3300026067 Ga0207678_10008406 Ga0207678_100084065 203
1488 3300026075 Ga0207708_10022198 Ga0207708_100221985 203
1489 3300026088 Ga0207641_10029548 Ga0207641_100295483 203
1490 3300026089 Ga0207648_10014733 Ga0207648_100147334 203
1491 3300026095 Ga0207676_10006137 Ga0207676_100061376 203
1492 3300026116 Ga0207674_10113997 Ga0207674_101139973 203
1493 3300026118 Ga0207675_100003264 Ga0207675_10000326412 203
1494 3300026142 Ga0207698_10161871 Ga0207698_101618712 203
1495 3300028379 Ga0268266_10154531 Ga0268266_101545311 203
1496 3300028381 Ga0268264_10032577 Ga0268264_100325772 203
1497 3300031241 Ga0265325_10008379 Ga0265325_100083792 203
1498 3300031249 Ga0265339_10001725 Ga0265339_1000172513 203
1499 3300031595 Ga0265313_10003163 Ga0265313_100031637 203
1500 3300032005 Ga0307411_10177040 Ga0307411_101770402 203
1501 3300035083 Ga0373926_0123651 Ga0373926_0123651_174_833 203
1502 3300035089 Ga0373944_0001665 Ga0373944_0001665_2604_3263 203
1503 3300035089 Ga0373944_0014971 Ga0373944_0014971_93_713 203
1504 3300035111 Ga0373923_0022139 Ga0373923_0022139_233_892 203
1505 3300035111 Ga0373923_0028113 Ga0373923_0028113_246_866 203
1506 3300035112 Ga0373932_0077826 Ga0373932_0077826_63_683 203
1507 3300035113 Ga0373936_0007554 Ga0373936_0007554_2056_2715 203
1508 3300035116 Ga0373945_0001734 Ga0373945_0001734_3980_4639 203
1509 3300035116 Ga0373945_0012553 Ga0373945_0012553_1123_1743 203
1510 3300035170 Ga0373943_0000022 Ga0373943_0000022_46819_47478 203
1511 3300035170 Ga0373943_0024284 Ga0373943_0024284_2019_2639 203
1512 3300035170 Ga0373943_0201871 Ga0373943_0201871_401_1021 203
1513 3300035171 Ga0373946_0002276 Ga0373946_0002276_4174_4833 203
1514 3300035171 Ga0373946_0024726 Ga0373946_0024726_1428_2048 203
1515 3300035241 Ga0373961_0082888 Ga0373961_0082888_28_648 203
1516 3300035410 Ga0373924_0111978 Ga0373924_0111978_232_891 203
1517 3300035691 Ga0373931_0047346 Ga0373931_0047346_826_1446 203
1518 3300035691 Ga0373931_0340437 Ga0373931_0340437_245_865 203
1519 3300035692 Ga0373935_0010846 Ga0373935_0010846_2033_2692 203
1520 3300035692 Ga0373935_0012177 Ga0373935_0012177_1960_2580 203
1521 3300035695 Ga0373927_0000699 Ga0373927_0000699_13697_14356 203
1522 3300035695 Ga0373927_0092068 Ga0373927_0092068_292_912 203
1523 3300035725 Ga0373947_0000274 Ga0373947_0000274_3579_4238 203
1524 3300035725 Ga0373947_0018132 Ga0373947_0018132_2017_2676 203
1525 3300035725 Ga0373947_0117026 Ga0373947_0117026_914_1534 203
1526 3300036401 Ga0373937_0158526 Ga0373937_0158526_1385_2044 203
1527 3300037068 Ga0373925_0001836 Ga0373925_0001836_3653_4312 203
1528 3300037068 Ga0373925_0017542 Ga0373925_0017542_4405_5025 203
1529 3300037068 Ga0373925_0105307 Ga0373925_0105307_283_942 203
1530 3300037068 Ga0373925_0289945 Ga0373925_0289945_205_825 203
1531 3300046454 Ga0495592_0349583 Ga0495592_0349583_72_731 203
1532 3300046459 Ga0495629_0042076 Ga0495629_0042076_2322_2942 203
1533 3300046459 Ga0495629_0107090 Ga0495629_0107090_968_1627 203
1534 3300046461 Ga0495641_0039730 Ga0495641_0039730_1281_1901 203
1535 3300046472 Ga0495580_0014866 Ga0495580_0014866_4277_4936 203
1536 3300046473 Ga0495582_0135258 Ga0495582_0135258_458_1078 203
1537 3300046474 Ga0495605_0090983 Ga0495605_0090983_419_1039 203
1538 3300046475 Ga0495639_0009640 Ga0495639_0009640_1878_2537 203
1539 3300046476 Ga0495662_0004372 Ga0495662_0004372_3213_3872 203
1540 3300046477 Ga0495664_0000584 Ga0495664_0000584_4524_5183 203
1541 3300046500 Ga0495596_0030928 Ga0495596_0030928_27_647 203
1542 3300046514 Ga0495618_0002882 Ga0495618_0002882_2033_2692 203
1543 3300046514 Ga0495618_0033376 Ga0495618_0033376_2321_2980 203
1544 3300046516 Ga0495628_0592287 Ga0495628_0592287_66_725 203
1545 3300046517 Ga0495630_0004716 Ga0495630_0004716_3372_4031 203
1546 3300046517 Ga0495630_0072539 Ga0495630_0072539_382_1041 203
1547 3300046523 Ga0495644_0045247 Ga0495644_0045247_494_1114 203
1548 3300046526 Ga0495666_0037784 Ga0495666_0037784_178_837 203
1549 3300046529 Ga0495652_0004663 Ga0495652_0004663_100_759 203
1550 3300046531 Ga0495665_0014244 Ga0495665_0014244_1650_2309 203
1551 3300046531 Ga0495665_0025494 Ga0495665_0025494_2428_3087 203
1552 3300046531 Ga0495665_0190285 Ga0495665_0190285_379_999 203
1553 3300046533 Ga0495640_0013746 Ga0495640_0013746_3081_3740 203
1554 3300046533 Ga0495640_0177264 Ga0495640_0177264_364_984 203
1555 3300046533 Ga0495640_0181579 Ga0495640_0181579_160_819 203
1556 3300046535 Ga0495586_0026467 Ga0495586_0026467_1526_2185 203
1557 3300046543 Ga0495645_0013788 Ga0495645_0013788_1846_2505 203
1558 3300046557 Ga0495622_0046811 Ga0495622_0046811_366_986 203
1559 3300046559 Ga0495667_0113262 Ga0495667_0113262_830_1450 203
1560 3300046615 Ga0495656_0114045 Ga0495656_0114045_199_819 203
1561 3300046642 Ga0495634_0003005 Ga0495634_0003005_2199_2858 203
1562 3300046642 Ga0495634_0021663 Ga0495634_0021663_47_667 203
1563 3300046642 Ga0495634_0052150 Ga0495634_0052150_607_1266 203
1564 3300046663 Ga0495635_0003450 Ga0495635_0003450_6651_7310 203
1565 3300046663 Ga0495635_0109234 Ga0495635_0109234_592_1251 203
1566 3300046674 Ga0495588_0056912 Ga0495588_0056912_291_911 203
1567 3300046674 Ga0495588_0175252 Ga0495588_0175252_28_654 203
1568 3300046683 Ga0495658_0048346 Ga0495658_0048346_1197_1817 203
1569 3300046683 Ga0495658_0069738 Ga0495658_0069738_1071_1730 203
1570 3300046689 Ga0495613_0074251 Ga0495613_0074251_543_1202 203
1571 3300046689 Ga0495613_0159145 Ga0495613_0159145_657_1277 203
1572 3300046689 Ga0495613_0168143 Ga0495613_0168143_29_688 203
1573 3300046690 Ga0495624_0005838 Ga0495624_0005838_5610_6269 203
1574 3300046690 Ga0495624_0107915 Ga0495624_0107915_195_815 203
1575 3300046690 Ga0495624_0197058 Ga0495624_0197058_565_1185 203
1576 3300046694 Ga0495649_0193906 Ga0495649_0193906_400_1020 203
1577 3300046794 Ga0495589_0070963 Ga0495589_0070963_762_1382 203
1578 3300047315 Ga0495581_0024425 Ga0495581_0024425_1933_2592 203
1579 3300047315 Ga0495581_0084712 Ga0495581_0084712_767_1387 203
1580 3300047315 Ga0495581_0089594 Ga0495581_0089594_11_631 203
1581 3300047317 Ga0495604_0295257 Ga0495604_0295257_198_857 203
1582 3300047317 Ga0495604_0420101 Ga0495604_0420101_214_834 203
1583 3300047319 Ga0495674_0154702 Ga0495674_0154702_317_976 203
1584 3300047319 Ga0495674_0207571 Ga0495674_0207571_486_1145 203
1585 3300047319 Ga0495674_0364507 Ga0495674_0364507_475_1095 203
1586 3300047321 Ga0495676_0070470 Ga0495676_0070470_1768_2388 203
1587 3300047321 Ga0495676_0125904 Ga0495676_0125904_649_1308 203
1588 3300047321 Ga0495676_0496253 Ga0495676_0496253_53_673 203
1589 3300047322 Ga0495680_0283547 Ga0495680_0283547_84_743 203
1590 3300047323 Ga0495683_0133826 Ga0495683_0133826_523_1143 203
1591 3300047445 Ga0495677_0052688 Ga0495677_0052688_490_1110 203
1592 3300047446 Ga0495679_099040 Ga0495679_099040_170_790 203
1593 3300047471 Ga0495684_0002213 Ga0495684_0002213_2755_3414 203
1594 3300047471 Ga0495684_0018159 Ga0495684_0018159_3117_3776 203
1595 3300047471 Ga0495684_0146924 Ga0495684_0146924_705_1325 203
1596 3300047471 Ga0495684_0324651 Ga0495684_0324651_402_1061 203
1597 3300047673 Ga0495593_0005880 Ga0495593_0005880_2772_3431 203
1598 3300048089 Ga0495614_0246486 Ga0495614_0246486_28_648 203
1599 3300048903 Ga0496100_0416046 Ga0496100_0416046_245_865 203
1600 3300048904 Ga0496101_0146188 Ga0496101_0146188_901_1521 203
1601 3300048905 Ga0496102_0009456 Ga0496102_0009456_1512_2132 203
1602 3300048905 Ga0496102_0075937 Ga0496102_0075937_1958_2578 203
1603 3300048907 Ga0496104_0002976 Ga0496104_0002976_9858_10478 203
1604 3300048907 Ga0496104_0560122 Ga0496104_0560122_271_891 203
1605 3300048908 Ga0496105_0002126 Ga0496105_0002126_2282_2902 203
1606 3300048908 Ga0496105_0002459 Ga0496105_0002459_8592_9212 203
1607 3300048909 Ga0496106_0008495 Ga0496106_0008495_5878_6498 203
1608 3300048910 Ga0496107_0064776 Ga0496107_0064776_176_796 203
1609 3300048911 Ga0496108_0004071 Ga0496108_0004071_6471_7091 203
1610 3300048911 Ga0496108_0009038 Ga0496108_0009038_7061_7681 203
1611 3300048912 Ga0496109_0000998 Ga0496109_0000998_9789_10409 203
1612 3300048912 Ga0496109_0215499 Ga0496109_0215499_163_783 203
1613 3300048913 Ga0496110_0012384 Ga0496110_0012384_163_783 203
1614 3300048913 Ga0496110_0024940 Ga0496110_0024940_1884_2504 203
1615 3300048914 Ga0496111_0000650 Ga0496111_0000650_5360_5980 203
1616 3300048914 Ga0496111_0016736 Ga0496111_0016736_4228_4848 203
1617 3300048915 Ga0496112_0010259 Ga0496112_0010259_5987_6607 203
1618 3300048915 Ga0496112_0119330 Ga0496112_0119330_295_915 203
1619 3300048915 Ga0496112_0217026 Ga0496112_0217026_916_1536 203
1620 3300048916 Ga0496113_0002083 Ga0496113_0002083_2399_3019 203
1621 3300048916 Ga0496113_0080243 Ga0496113_0080243_158_778 203
1622 3300048917 Ga0496114_0011354 Ga0496114_0011354_571_1191 203
1623 3300048918 Ga0496115_0047410 Ga0496115_0047410_318_938 203
1624 3300048918 Ga0496115_0066566 Ga0496115_0066566_1836_2456 203
1625 3300048918 Ga0496115_0302860 Ga0496115_0302860_421_1041 203
1626 3300049577 Ga0501041_0084359 Ga0501041_0084359_1022_1642 203
1627 3300049590 Ga0501074_0512397 Ga0501074_0512397_56_676 203
1628 3300049593 Ga0501077_0196201 Ga0501077_0196201_432_1052 203
1629 3300050492 nmdc:mga0yw44_67919_c1 nmdc:mga0yw44_67919_c1_691_1311 203
1630 3300050507 nmdc:mga05p37_7849_c2 nmdc:mga05p37_7849_c2_2449_3069 203
1631 3300053077 Ga0495601_0155042 Ga0495601_0155042_479_1138 203
1632 3300053078 Ga0495612_0090065 Ga0495612_0090065_32_691 203
1633 3300053083 Ga0495655_0027329 Ga0495655_0027329_378_998 203
1634 3300053084 Ga0495595_0024641 Ga0495595_0024641_1795_2415 203
1635 3300053084 Ga0495595_0259162 Ga0495595_0259162_45_665 203
1636 3300053085 Ga0495619_0036704 Ga0495619_0036704_624_1283 203
1637 3300053085 Ga0495619_0151213 Ga0495619_0151213_627_1286 203
1638 3300053085 Ga0495619_0185012 Ga0495619_0185012_349_969 203
1639 3300005434 Ga0070709_10004533 Ga0070709_100045337 204
1640 3300005435 Ga0070714_100064185 Ga0070714_1000641852 204
1641 3300005436 Ga0070713_100022648 Ga0070713_1000226485 204
1642 3300005439 Ga0070711_100032763 Ga0070711_1000327632 204
1643 3300005563 Ga0068855_100624512 Ga0068855_1006245121 204
1644 3300006173 Ga0070716_100476262 Ga0070716_1004762622 204
1645 3300006175 Ga0070712_100055686 Ga0070712_1000556863 204
1646 3300006175 Ga0070712_100179136 Ga0070712_1001791362 204
1647 3300006175 Ga0070712_100417303 Ga0070712_1004173032 204
1648 3300020069 Ga0197907_10971222 Ga0197907_109712221 204
1649 3300025906 Ga0207699_10023796 Ga0207699_100237963 204
1650 3300025915 Ga0207693_10001676 Ga0207693_1000167615 204
1651 3300025915 Ga0207693_10104257 Ga0207693_101042572 204
1652 3300025915 Ga0207693_10372224 Ga0207693_103722242 204
1653 3300025916 Ga0207663_10044563 Ga0207663_100445634 204
1654 3300025921 Ga0207652_10009080 Ga0207652_100090805 204
1655 3300025928 Ga0207700_10020579 Ga0207700_100205793 204
1656 3300025939 Ga0207665_10621648 Ga0207665_106216482 204
1657 3300026142 Ga0207698_10040761 Ga0207698_100407613 204
1658 3300031241 Ga0265325_10000264 Ga0265325_1000026418 204
1659 3300037853 Ga0436364_0978152 Ga0436364_0978152_555_1181 204
1660 3300046511 Ga0495608_0030687 Ga0495608_0030687_1293_1907 204
1661 3300046675 Ga0495657_0142709 Ga0495657_0142709_399_1013 204
1662 3300049586 Ga0501070_0005770 Ga0501070_0005770_7366_8019 204
1663 3300049822 Ga0501035_0148625 Ga0501035_0148625_815_1468 204
1664 3300050494 nmdc:mga06z11_501335_c1 nmdc:mga06z11_501335_c1_19_642 204
1665 3300050516 nmdc:mga0sz30_21653_c1 nmdc:mga0sz30_21653_c1_760_1410 204
1666 3300005458 Ga0070681_10267069 Ga0070681_102670691 205
1667 3300031241 Ga0265325_10009459 Ga0265325_100094597 205
1668 3300035113 Ga0373936_0016863 Ga0373936_0016863_1501_2136 205
1669 3300035118 Ga0373954_0053922 Ga0373954_0053922_172_807 205
1670 3300035119 Ga0373956_0255092 Ga0373956_0255092_78_698 205
1671 3300036401 Ga0373937_0150344 Ga0373937_0150344_167_802 205
1672 3300037068 Ga0373925_0088496 Ga0373925_0088496_952_1587 205
1673 3300037068 Ga0373925_0505062 Ga0373925_0505062_225_860 205
1674 3300046559 Ga0495667_0220629 Ga0495667_0220629_536_1171 205
1675 3300046689 Ga0495613_0261185 Ga0495613_0261185_554_1189 205
1676 3300049569 Ga0501032_0107812 Ga0501032_0107812_47_673 205
1677 3300049571 Ga0501034_0001110 Ga0501034_0001110_13834_14460 205
1678 3300049572 Ga0501036_0000783 Ga0501036_0000783_13312_13938 205
1679 3300049573 Ga0501037_0027143 Ga0501037_0027143_767_1393 205
1680 3300049579 Ga0501043_0002218 Ga0501043_0002218_8846_9472 205
1681 3300049580 Ga0501046_0057108 Ga0501046_0057108_980_1606 205
1682 3300049581 Ga0501047_0000164 Ga0501047_0000164_25213_25839 205
1683 3300049582 Ga0501048_0002364 Ga0501048_0002364_1955_2581 205
1684 3300049589 Ga0501073_0019091 Ga0501073_0019091_3680_4306 205
1685 3300049742 Ga0501080_0000458 Ga0501080_0000458_7708_8334 205
1686 3300049744 Ga0501083_0000506 Ga0501083_0000506_3525_4151 205
1687 3300049744 Ga0501083_0684714 Ga0501083_0684714_12_638 205
1688 3300049823 Ga0501044_0001195 Ga0501044_0001195_5199_5825 205
1689 3300050514 nmdc:mga08x19_208000_c1 nmdc:mga08x19_208000_c1_246_881 205
1690 3300003911 JGI25405J52794_10034209 JGI25405J52794_100342092 206
1691 3300005329 Ga0070683_100208186 Ga0070683_1002081863 206
1692 3300005331 Ga0070670_100195215 Ga0070670_1001952152 206
1693 3300005340 Ga0070689_100384494 Ga0070689_1003844942 206
1694 3300005364 Ga0070673_100133629 Ga0070673_1001336291 206
1695 3300005365 Ga0070688_100035116 Ga0070688_1000351161 206
1696 3300005436 Ga0070713_100004514 Ga0070713_1000045148 206
1697 3300005437 Ga0070710_10067998 Ga0070710_100679981 206
1698 3300005439 Ga0070711_100238116 Ga0070711_1002381161 206
1699 3300005456 Ga0070678_100375650 Ga0070678_1003756502 206
1700 3300005466 Ga0070685_10170201 Ga0070685_101702012 206
1701 3300005535 Ga0070684_100019946 Ga0070684_1000199463 206
1702 3300005564 Ga0070664_100056484 Ga0070664_1000564842 206
1703 3300005616 Ga0068852_100166352 Ga0068852_1001663522 206
1704 3300005617 Ga0068859_100361620 Ga0068859_1003616202 206
1705 3300005618 Ga0068864_100241937 Ga0068864_1002419372 206
1706 3300005937 Ga0081455_10004051 Ga0081455_1000405116 206
1707 3300005981 Ga0081538_10001078 Ga0081538_100010783 206
1708 3300006028 Ga0070717_10003960 Ga0070717_100039608 206
1709 3300006163 Ga0070715_10011634 Ga0070715_100116344 206
1710 3300006175 Ga0070712_100000682 Ga0070712_1000006822 206
1711 3300006358 Ga0068871_100052951 Ga0068871_1000529514 206
1712 3300006871 Ga0075434_100166474 Ga0075434_1001664742 206
1713 3300006931 Ga0097620_100361620 Ga0097620_1003616202 206
1714 3300009092 Ga0105250_10056598 Ga0105250_100565983 206
1715 3300009174 Ga0105241_10208498 Ga0105241_102084981 206
1716 3300014325 Ga0163163_10052911 Ga0163163_100529112 206
1717 3300017792 Ga0163161_10398171 Ga0163161_103981712 206
1718 3300025735 Ga0207713_1072341 Ga0207713_10723412 206
1719 3300025898 Ga0207692_10248063 Ga0207692_102480632 206
1720 3300025900 Ga0207710_10008979 Ga0207710_100089792 206
1721 3300025905 Ga0207685_10187640 Ga0207685_101876402 206
1722 3300025906 Ga0207699_10005955 Ga0207699_100059554 206
1723 3300025915 Ga0207693_10012453 Ga0207693_100124536 206
1724 3300025915 Ga0207693_10126753 Ga0207693_101267533 206
1725 3300025916 Ga0207663_10035589 Ga0207663_100355892 206
1726 3300025924 Ga0207694_10178012 Ga0207694_101780123 206
1727 3300025925 Ga0207650_10629673 Ga0207650_106296732 206
1728 3300025926 Ga0207659_10067725 Ga0207659_100677254 206
1729 3300025927 Ga0207687_10054764 Ga0207687_100547641 206
1730 3300025928 Ga0207700_10069015 Ga0207700_100690152 206
1731 3300025929 Ga0207664_10057674 Ga0207664_100576743 206
1732 3300025931 Ga0207644_10032486 Ga0207644_100324863 206
1733 3300025939 Ga0207665_10012482 Ga0207665_100124824 206
1734 3300025941 Ga0207711_10052255 Ga0207711_100522553 206
1735 3300025944 Ga0207661_10089258 Ga0207661_100892584 206
1736 3300025945 Ga0207679_10022703 Ga0207679_100227033 206
1737 3300025960 Ga0207651_10031144 Ga0207651_100311444 206
1738 3300025972 Ga0207668_10030310 Ga0207668_100303104 206
1739 3300026035 Ga0207703_10106978 Ga0207703_101069783 206
1740 3300026075 Ga0207708_10264805 Ga0207708_102648052 206
1741 3300026088 Ga0207641_10018697 Ga0207641_100186976 206
1742 3300026095 Ga0207676_10076893 Ga0207676_100768934 206
1743 3300026121 Ga0207683_10004853 Ga0207683_1000485311 206
1744 3300028379 Ga0268266_10151957 Ga0268266_101519572 206
1745 3300035241 Ga0373961_0010857 Ga0373961_0010857_1220_1843 206
1746 2209111006 2214756346 2213770245 207
1747 3300000042 ARSoilYngRDRAFT_c00171 ARSoilYngRDRAFT_001713 207
1748 3300000043 ARcpr5yngRDRAFT_c001563 ARcpr5yngRDRAFT_0015633 207
1749 3300000044 ARSoilOldRDRAFT_c001126 ARSoilOldRDRAFT_0011263 207
1750 3300000045 ARCol0oldRDRAFT_c00826 ARCol0oldRDRAFT_008263 207
1751 3300000652 ARCol0yngRDRAFT_1000939 ARCol0yngRDRAFT_10009393 207
1752 3300001978 JGI24747J21853_1001186 JGI24747J21853_10011862 207
1753 3300001989 JGI24739J22299_10008396 JGI24739J22299_100083962 207
1754 3300001990 JGI24737J22298_10001849 JGI24737J22298_100018499 207
1755 3300001990 JGI24737J22298_10028213 JGI24737J22298_100282133 207
1756 3300002070 JGI24750J21931_1000984 JGI24750J21931_10009843 207
1757 3300002073 JGI24745J21846_1000980 JGI24745J21846_10009803 207
1758 3300002075 JGI24738J21930_10005472 JGI24738J21930_100054723 207
1759 3300002076 JGI24749J21850_1002160 JGI24749J21850_10021603 207
1760 3300002076 JGI24749J21850_1021722 JGI24749J21850_10217222 207
1761 3300002077 JGI24744J21845_10009678 JGI24744J21845_100096782 207
1762 3300002126 JGI24035J26624_1000873 JGI24035J26624_10008733 207
1763 3300002239 JGI24034J26672_10001273 JGI24034J26672_100012732 207
1764 3300002244 JGI24742J22300_10015321 JGI24742J22300_100153212 207
1765 3300005277 Ga0065716_1001738 Ga0065716_10017382 207
1766 3300005289 Ga0065704_10101941 Ga0065704_101019412 207
1767 3300005290 Ga0065712_10086364 Ga0065712_100863643 207
1768 3300005290 Ga0065712_10111639 Ga0065712_101116393 207
1769 3300005293 Ga0065715_10022043 Ga0065715_100220433 207
1770 3300005295 Ga0065707_10184057 Ga0065707_101840572 207
1771 3300005328 Ga0070676_10001632 Ga0070676_100016323 207
1772 3300005328 Ga0070676_10051923 Ga0070676_100519233 207
1773 3300005329 Ga0070683_100028761 Ga0070683_1000287613 207
1774 3300005330 Ga0070690_100001733 Ga0070690_1000017339 207
1775 3300005330 Ga0070690_100006888 Ga0070690_1000068885 207
1776 3300005330 Ga0070690_100257747 Ga0070690_1002577472 207
1777 3300005331 Ga0070670_100058636 Ga0070670_1000586363 207
1778 3300005333 Ga0070677_10001045 Ga0070677_100010453 207
1779 3300005334 Ga0068869_100001453 Ga0068869_10000145312 207
1780 3300005335 Ga0070666_10115186 Ga0070666_101151861 207
1781 3300005335 Ga0070666_10528171 Ga0070666_105281711 207
1782 3300005336 Ga0070680_100051020 Ga0070680_1000510202 207
1783 3300005336 Ga0070680_100076159 Ga0070680_1000761592 207
1784 3300005336 Ga0070680_100108595 Ga0070680_1001085952 207
1785 3300005337 Ga0070682_100095383 Ga0070682_1000953833 207
1786 3300005339 Ga0070660_100018468 Ga0070660_1000184682 207
1787 3300005339 Ga0070660_100053919 Ga0070660_1000539192 207
1788 3300005340 Ga0070689_100026887 Ga0070689_1000268875 207
1789 3300005340 Ga0070689_100028586 Ga0070689_1000285862 207
1790 3300005341 Ga0070691_10010873 Ga0070691_100108733 207
1791 3300005341 Ga0070691_10035315 Ga0070691_100353152 207
1792 3300005343 Ga0070687_100000415 Ga0070687_1000004157 207
1793 3300005343 Ga0070687_100013730 Ga0070687_1000137303 207
1794 3300005344 Ga0070661_100062788 Ga0070661_1000627882 207
1795 3300005345 Ga0070692_10007860 Ga0070692_100078602 207
1796 3300005345 Ga0070692_10259171 Ga0070692_102591712 207
1797 3300005347 Ga0070668_100004752 Ga0070668_10000475211 207
1798 3300005347 Ga0070668_100115058 Ga0070668_1001150583 207
1799 3300005347 Ga0070668_100281141 Ga0070668_1002811412 207
1800 3300005353 Ga0070669_100029250 Ga0070669_1000292502 207
1801 3300005353 Ga0070669_100206566 Ga0070669_1002065662 207
1802 3300005354 Ga0070675_100003950 Ga0070675_10000395011 207
1803 3300005354 Ga0070675_100040297 Ga0070675_1000402973 207
1804 3300005355 Ga0070671_100000362 Ga0070671_10000036231 207
1805 3300005364 Ga0070673_100000576 Ga0070673_10000057611 207
1806 3300005365 Ga0070688_100017285 Ga0070688_1000172853 207
1807 3300005365 Ga0070688_100074860 Ga0070688_1000748603 207
1808 3300005366 Ga0070659_100000571 Ga0070659_10000057111 207
1809 3300005366 Ga0070659_100032993 Ga0070659_1000329933 207
1810 3300005367 Ga0070667_100053527 Ga0070667_1000535273 207
1811 3300005435 Ga0070714_100044557 Ga0070714_1000445574 207
1812 3300005437 Ga0070710_10188864 Ga0070710_101888642 207
1813 3300005437 Ga0070710_10308516 Ga0070710_103085161 207
1814 3300005438 Ga0070701_10256254 Ga0070701_102562542 207
1815 3300005440 Ga0070705_100012133 Ga0070705_1000121333 207
1816 3300005441 Ga0070700_100003836 Ga0070700_1000038367 207
1817 3300005441 Ga0070700_100068129 Ga0070700_1000681293 207
1818 3300005444 Ga0070694_100001413 Ga0070694_10000141316 207
1819 3300005444 Ga0070694_100026580 Ga0070694_1000265803 207
1820 3300005445 Ga0070708_100044552 Ga0070708_1000445524 207
1821 3300005455 Ga0070663_100002691 Ga0070663_10000269110 207
1822 3300005455 Ga0070663_100024618 Ga0070663_1000246182 207
1823 3300005455 Ga0070663_100043389 Ga0070663_1000433894 207
1824 3300005456 Ga0070678_100002347 Ga0070678_1000023477 207
1825 3300005457 Ga0070662_100006382 Ga0070662_1000063823 207
1826 3300005457 Ga0070662_100039083 Ga0070662_1000390833 207
1827 3300005458 Ga0070681_10049959 Ga0070681_100499593 207
1828 3300005458 Ga0070681_11081693 Ga0070681_110816931 207
1829 3300005466 Ga0070685_10001428 Ga0070685_100014283 207
1830 3300005530 Ga0070679_100001318 Ga0070679_10000131812 207
1831 3300005530 Ga0070679_100137592 Ga0070679_1001375923 207
1832 3300005530 Ga0070679_100374552 Ga0070679_1003745522 207
1833 3300005535 Ga0070684_100005209 Ga0070684_1000052093 207
1834 3300005539 Ga0068853_100020949 Ga0068853_1000209493 207
1835 3300005539 Ga0068853_100325556 Ga0068853_1003255562 207
1836 3300005543 Ga0070672_100000929 Ga0070672_1000009293 207
1837 3300005543 Ga0070672_100116915 Ga0070672_1001169153 207
1838 3300005544 Ga0070686_100000634 Ga0070686_1000006342 207
1839 3300005544 Ga0070686_100015069 Ga0070686_1000150693 207
1840 3300005545 Ga0070695_100005904 Ga0070695_1000059048 207
1841 3300005545 Ga0070695_100085665 Ga0070695_1000856653 207
1842 3300005545 Ga0070695_100573173 Ga0070695_1005731731 207
1843 3300005546 Ga0070696_100079774 Ga0070696_1000797742 207
1844 3300005546 Ga0070696_100399091 Ga0070696_1003990912 207
1845 3300005547 Ga0070693_100001518 Ga0070693_10000151811 207
1846 3300005548 Ga0070665_100010325 Ga0070665_10001032510 207
1847 3300005549 Ga0070704_100001541 Ga0070704_1000015413 207
1848 3300005549 Ga0070704_100004632 Ga0070704_1000046325 207
1849 3300005563 Ga0068855_100056204 Ga0068855_1000562043 207
1850 3300005564 Ga0070664_100002380 Ga0070664_10000238013 207
1851 3300005564 Ga0070664_100058794 Ga0070664_1000587942 207
1852 3300005577 Ga0068857_100001264 Ga0068857_10000126418 207
1853 3300005577 Ga0068857_101107254 Ga0068857_1011072541 207
1854 3300005578 Ga0068854_100013038 Ga0068854_1000130386 207
1855 3300005614 Ga0068856_100006111 Ga0068856_1000061113 207
1856 3300005615 Ga0070702_100000954 Ga0070702_10000095411 207
1857 3300005615 Ga0070702_100200972 Ga0070702_1002009722 207
1858 3300005616 Ga0068852_100006031 Ga0068852_1000060313 207
1859 3300005616 Ga0068852_100079554 Ga0068852_1000795544 207
1860 3300005617 Ga0068859_100013029 Ga0068859_1000130293 207
1861 3300005617 Ga0068859_100032614 Ga0068859_1000326145 207
1862 3300005618 Ga0068864_100062645 Ga0068864_1000626453 207
1863 3300005618 Ga0068864_100719943 Ga0068864_1007199431 207
1864 3300005718 Ga0068866_10001179 Ga0068866_1000117911 207
1865 3300005718 Ga0068866_10224423 Ga0068866_102244231 207
1866 3300005719 Ga0068861_100484960 Ga0068861_1004849601 207
1867 3300005840 Ga0068870_10000138 Ga0068870_1000013812 207
1868 3300005841 Ga0068863_100021740 Ga0068863_1000217401 207
1869 3300005841 Ga0068863_100689782 Ga0068863_1006897822 207
1870 3300005842 Ga0068858_100000393 Ga0068858_10000039310 207
1871 3300005842 Ga0068858_100317054 Ga0068858_1003170542 207
1872 3300005843 Ga0068860_100012342 Ga0068860_1000123422 207
1873 3300005843 Ga0068860_100017377 Ga0068860_1000173773 207
1874 3300005843 Ga0068860_100757804 Ga0068860_1007578041 207
1875 3300005844 Ga0068862_100010169 Ga0068862_1000101698 207
1876 3300005844 Ga0068862_100059337 Ga0068862_1000593373 207
1877 3300005937 Ga0081455_10003445 Ga0081455_1000344510 207
1878 3300005937 Ga0081455_10427265 Ga0081455_104272652 207
1879 3300005937 Ga0081455_10431211 Ga0081455_104312112 207
1880 3300006058 Ga0075432_10016450 Ga0075432_100164503 207
1881 3300006237 Ga0097621_100008210 Ga0097621_1000082107 207
1882 3300006237 Ga0097621_100101729 Ga0097621_1001017292 207
1883 3300006358 Ga0068871_100003784 Ga0068871_10000378412 207
1884 3300006844 Ga0075428_100105897 Ga0075428_1001058973 207
1885 3300006846 Ga0075430_100042973 Ga0075430_1000429732 207
1886 3300006846 Ga0075430_100049864 Ga0075430_1000498643 207
1887 3300006847 Ga0075431_100120638 Ga0075431_1001206383 207
1888 3300006847 Ga0075431_100149289 Ga0075431_1001492892 207
1889 3300006852 Ga0075433_10000743 Ga0075433_1000074323 207
1890 3300006852 Ga0075433_10033762 Ga0075433_100337623 207
1891 3300006852 Ga0075433_10197211 Ga0075433_101972113 207
1892 3300006871 Ga0075434_100001145 Ga0075434_1000011456 207
1893 3300006871 Ga0075434_100014657 Ga0075434_1000146576 207
1894 3300006871 Ga0075434_100181255 Ga0075434_1001812553 207
1895 3300006871 Ga0075434_100872600 Ga0075434_1008726001 207
1896 3300006880 Ga0075429_100003655 Ga0075429_10000365518 207
1897 3300006880 Ga0075429_100020145 Ga0075429_1000201453 207
1898 3300006881 Ga0068865_100003940 Ga0068865_10000394011 207
1899 3300006881 Ga0068865_100219044 Ga0068865_1002190442 207
1900 3300006931 Ga0097620_100013028 Ga0097620_1000130288 207
1901 3300006931 Ga0097620_100032613 Ga0097620_1000326135 207
1902 3300007076 Ga0075435_100011030 Ga0075435_1000110303 207
1903 3300007076 Ga0075435_100076142 Ga0075435_1000761422 207
1904 3300007076 Ga0075435_100318148 Ga0075435_1003181482 207
1905 3300009011 Ga0105251_10136218 Ga0105251_101362182 207
1906 3300009092 Ga0105250_10028591 Ga0105250_100285913 207
1907 3300009094 Ga0111539_10001862 Ga0111539_1000186217 207
1908 3300009094 Ga0111539_10004418 Ga0111539_100044186 207
1909 3300009094 Ga0111539_10014649 Ga0111539_100146497 207
1910 3300009094 Ga0111539_10102425 Ga0111539_101024254 207
1911 3300009094 Ga0111539_10736140 Ga0111539_107361402 207
1912 3300009098 Ga0105245_10001434 Ga0105245_100014343 207
1913 3300009098 Ga0105245_10308370 Ga0105245_103083701 207
1914 3300009101 Ga0105247_10046100 Ga0105247_100461002 207
1915 3300009147 Ga0114129_10000062 Ga0114129_1000006248 207
1916 3300009147 Ga0114129_10085470 Ga0114129_100854703 207
1917 3300009147 Ga0114129_10136862 Ga0114129_101368624 207
1918 3300009147 Ga0114129_10234506 Ga0114129_102345063 207
1919 3300009148 Ga0105243_10030539 Ga0105243_100305393 207
1920 3300009148 Ga0105243_10101489 Ga0105243_101014893 207
1921 3300009174 Ga0105241_10015648 Ga0105241_100156484 207
1922 3300009176 Ga0105242_10001717 Ga0105242_1000171718 207
1923 3300009177 Ga0105248_10019390 Ga0105248_100193903 207
1924 3300009177 Ga0105248_10038448 Ga0105248_100384484 207
1925 3300009545 Ga0105237_10014046 Ga0105237_100140468 207
1926 3300009553 Ga0105249_10008900 Ga0105249_100089002 207
1927 3300009553 Ga0105249_10087701 Ga0105249_100877013 207
1928 3300010375 Ga0105239_10016103 Ga0105239_100161039 207
1929 3300010375 Ga0105239_10019746 Ga0105239_100197467 207
1930 3300011119 Ga0105246_10002104 Ga0105246_100021043 207
1931 3300012507 Ga0157342_1016735 Ga0157342_10167351 207
1932 3300013100 Ga0157373_10053065 Ga0157373_100530653 207
1933 3300013102 Ga0157371_10079259 Ga0157371_100792592 207
1934 3300013104 Ga0157370_10848726 Ga0157370_108487262 207
1935 3300013296 Ga0157374_10004779 Ga0157374_100047798 207
1936 3300013297 Ga0157378_10011935 Ga0157378_100119356 207
1937 3300013306 Ga0163162_10003752 Ga0163162_100037523 207
1938 3300013306 Ga0163162_10008015 Ga0163162_1000801513 207
1939 3300013307 Ga0157372_10017355 Ga0157372_100173555 207
1940 3300013308 Ga0157375_10003729 Ga0157375_100037295 207
1941 3300013308 Ga0157375_10329988 Ga0157375_103299882 207
1942 3300014325 Ga0163163_10003522 Ga0163163_100035224 207
1943 3300014325 Ga0163163_10021377 Ga0163163_100213772 207
1944 3300014326 Ga0157380_10024823 Ga0157380_100248233 207
1945 3300014326 Ga0157380_10193483 Ga0157380_101934833 207
1946 3300014745 Ga0157377_10002285 Ga0157377_100022853 207
1947 3300014968 Ga0157379_10002636 Ga0157379_100026362 207
1948 3300014968 Ga0157379_10112379 Ga0157379_101123792 207
1949 3300017792 Ga0163161_10004025 Ga0163161_1000402512 207
1950 3300025271 Ga0207666_1000087 Ga0207666_10000878 207
1951 3300025271 Ga0207666_1004274 Ga0207666_10042742 207
1952 3300025290 Ga0207673_1000179 Ga0207673_10001793 207
1953 3300025315 Ga0207697_10003225 Ga0207697_100032252 207
1954 3300025315 Ga0207697_10045823 Ga0207697_100458233 207
1955 3300025315 Ga0207697_10108670 Ga0207697_101086701 207
1956 3300025885 Ga0207653_10034830 Ga0207653_100348303 207
1957 3300025893 Ga0207682_10000273 Ga0207682_1000027316 207
1958 3300025899 Ga0207642_10001345 Ga0207642_100013453 207
1959 3300025900 Ga0207710_10003607 Ga0207710_100036073 207
1960 3300025901 Ga0207688_10000592 Ga0207688_1000059215 207
1961 3300025903 Ga0207680_10044919 Ga0207680_100449193 207
1962 3300025904 Ga0207647_10013306 Ga0207647_100133066 207
1963 3300025904 Ga0207647_10024546 Ga0207647_100245462 207
1964 3300025907 Ga0207645_10001448 Ga0207645_1000144816 207
1965 3300025907 Ga0207645_10064038 Ga0207645_100640382 207
1966 3300025908 Ga0207643_10000004 Ga0207643_1000000412 207
1967 3300025911 Ga0207654_10006279 Ga0207654_100062794 207
1968 3300025912 Ga0207707_10002688 Ga0207707_100026888 207
1969 3300025912 Ga0207707_10068246 Ga0207707_100682463 207
1970 3300025914 Ga0207671_10027924 Ga0207671_100279244 207
1971 3300025917 Ga0207660_10015658 Ga0207660_100156583 207
1972 3300025917 Ga0207660_10048508 Ga0207660_100485083 207
1973 3300025918 Ga0207662_10003398 Ga0207662_100033988 207
1974 3300025918 Ga0207662_10029128 Ga0207662_100291283 207
1975 3300025919 Ga0207657_10013202 Ga0207657_100132028 207
1976 3300025919 Ga0207657_10024125 Ga0207657_100241257 207
1977 3300025919 Ga0207657_10029516 Ga0207657_100295165 207
1978 3300025920 Ga0207649_10001391 Ga0207649_1000139116 207
1979 3300025921 Ga0207652_10049350 Ga0207652_100493503 207
1980 3300025922 Ga0207646_10238818 Ga0207646_102388182 207
1981 3300025923 Ga0207681_10001757 Ga0207681_100017576 207
1982 3300025926 Ga0207659_10001162 Ga0207659_1000116216 207
1983 3300025927 Ga0207687_10002670 Ga0207687_1000267010 207
1984 3300025927 Ga0207687_10134399 Ga0207687_101343993 207
1985 3300025931 Ga0207644_10001464 Ga0207644_100014643 207
1986 3300025932 Ga0207690_10002815 Ga0207690_1000281510 207
1987 3300025932 Ga0207690_10040550 Ga0207690_100405503 207
1988 3300025933 Ga0207706_10014073 Ga0207706_100140732 207
1989 3300025933 Ga0207706_10076380 Ga0207706_100763803 207
1990 3300025934 Ga0207686_10265076 Ga0207686_102650761 207
1991 3300025935 Ga0207709_10001557 Ga0207709_1000155716 207
1992 3300025936 Ga0207670_10001424 Ga0207670_100014248 207
1993 3300025936 Ga0207670_10022105 Ga0207670_100221053 207
1994 3300025937 Ga0207669_10000387 Ga0207669_1000038716 207
1995 3300025938 Ga0207704_10018529 Ga0207704_100185293 207
1996 3300025940 Ga0207691_10012587 Ga0207691_100125872 207
1997 3300025941 Ga0207711_10019155 Ga0207711_100191556 207
1998 3300025941 Ga0207711_10055001 Ga0207711_100550013 207
1999 3300025942 Ga0207689_10004579 Ga0207689_100045798 207
2000 3300025944 Ga0207661_10001752 Ga0207661_100017527 207
2001 3300025945 Ga0207679_10004356 Ga0207679_100043561 207
2002 3300025949 Ga0207667_10229892 Ga0207667_102298923 207
2003 3300025960 Ga0207651_10001884 Ga0207651_100018843 207
2004 3300025961 Ga0207712_10003703 Ga0207712_100037033 207
2005 3300025961 Ga0207712_10039020 Ga0207712_100390203 207
2006 3300025972 Ga0207668_10001379 Ga0207668_1000137911 207
2007 3300025981 Ga0207640_10022416 Ga0207640_100224164 207
2008 3300025986 Ga0207658_10001904 Ga0207658_1000190412 207
2009 3300025986 Ga0207658_10112112 Ga0207658_101121123 207
2010 3300026023 Ga0207677_10038814 Ga0207677_100388142 207
2011 3300026035 Ga0207703_10003566 Ga0207703_100035667 207
2012 3300026035 Ga0207703_10008538 Ga0207703_100085383 207
2013 3300026041 Ga0207639_10010870 Ga0207639_100108704 207
2014 3300026067 Ga0207678_10002771 Ga0207678_100027718 207
2015 3300026067 Ga0207678_10014382 Ga0207678_100143828 207
2016 3300026067 Ga0207678_11023452 Ga0207678_110234521 207
2017 3300026075 Ga0207708_10007402 Ga0207708_100074028 207
2018 3300026075 Ga0207708_10007450 Ga0207708_100074508 207
2019 3300026088 Ga0207641_10119794 Ga0207641_101197943 207
2020 3300026089 Ga0207648_10000341 Ga0207648_1000034148 207
2021 3300026089 Ga0207648_10416789 Ga0207648_104167892 207
2022 3300026095 Ga0207676_10284173 Ga0207676_102841732 207
2023 3300026116 Ga0207674_10031788 Ga0207674_100317884 207
2024 3300026116 Ga0207674_10933124 Ga0207674_109331242 207
2025 3300026118 Ga0207675_100011958 Ga0207675_1000119582 207
2026 3300026121 Ga0207683_10000006 Ga0207683_10000006155 207
2027 3300026142 Ga0207698_10003552 Ga0207698_100035528 207
2028 3300027543 Ga0209999_1006234 Ga0209999_10062343 207
2029 3300027617 Ga0210002_1010255 Ga0210002_10102552 207
2030 3300027695 Ga0209966_1001875 Ga0209966_10018754 207
2031 3300027717 Ga0209998_10000636 Ga0209998_100006364 207
2032 3300027717 Ga0209998_10003002 Ga0209998_100030023 207
2033 3300027876 Ga0209974_10007699 Ga0209974_100076993 207
2034 3300027876 Ga0209974_10021405 Ga0209974_100214053 207
2035 3300027907 Ga0207428_10000137 Ga0207428_100001375 207
2036 3300027907 Ga0207428_10000165 Ga0207428_1000016527 207
2037 3300027907 Ga0207428_10001264 Ga0207428_1000126426 207
2038 3300027907 Ga0207428_10013626 Ga0207428_100136267 207
2039 3300028379 Ga0268266_10006808 Ga0268266_100068088 207
2040 3300028380 Ga0268265_10047087 Ga0268265_100470873 207
2041 3300028380 Ga0268265_10101808 Ga0268265_101018083 207
2042 3300028381 Ga0268264_10008581 Ga0268264_1000858110 207
2043 3300028381 Ga0268264_10279034 Ga0268264_102790342 207
2044 3300031247 Ga0265340_10017208 Ga0265340_100172083 207
2045 3300031727 Ga0316576_10221258 Ga0316576_102212582 207
2046 3300031728 Ga0316578_10005935 Ga0316578_100059354 207
2047 3300032133 Ga0316583_10000620 Ga0316583_100006209 207
2048 3300034816 Ga0373930_0000274 Ga0373930_0000274_1394_2017 207
2049 3300034817 Ga0373948_0002495 Ga0373948_0002495_1664_2287 207
2050 3300034817 Ga0373948_0002867 Ga0373948_0002867_256_879 207
2051 3300034818 Ga0373950_0000597 Ga0373950_0000597_1721_2344 207
2052 3300034819 Ga0373958_0001449 Ga0373958_0001449_1172_1795 207
2053 3300034820 Ga0373959_0000724 Ga0373959_0000724_3486_4109 207
2054 3300034820 Ga0373959_0013033 Ga0373959_0013033_388_1011 207
2055 3300034957 Ga0373938_0001970 Ga0373938_0001970_837_1460 207
2056 3300035084 Ga0373928_0003226 Ga0373928_0003226_1483_2106 207
2057 3300035085 Ga0373929_0000219 Ga0373929_0000219_9136_9759 207
2058 3300035088 Ga0373940_0002065 Ga0373940_0002065_549_1172 207
2059 3300035088 Ga0373940_0088585 Ga0373940_0088585_166_789 207
2060 3300035090 Ga0373949_0000893 Ga0373949_0000893_7397_8020 207
2061 3300035090 Ga0373949_0049344 Ga0373949_0049344_17_640 207
2062 3300035091 Ga0373951_0001402 Ga0373951_0001402_503_1126 207
2063 3300035091 Ga0373951_0001889 Ga0373951_0001889_1465_2088 207
2064 3300035092 Ga0373952_0001251 Ga0373952_0001251_545_1168 207
2065 3300035112 Ga0373932_0000298 Ga0373932_0000298_11179_11802 207
2066 3300035112 Ga0373932_0005293 Ga0373932_0005293_678_1301 207
2067 3300035114 Ga0373939_0000408 Ga0373939_0000408_8694_9317 207
2068 3300035114 Ga0373939_0003904 Ga0373939_0003904_1451_2074 207
2069 3300035115 Ga0373941_0001495 Ga0373941_0001495_923_1546 207
2070 3300035115 Ga0373941_0003811 Ga0373941_0003811_1247_1870 207
2071 3300035118 Ga0373954_0073614 Ga0373954_0073614_53_679 207
2072 3300035121 Ga0373960_0001433 Ga0373960_0001433_4304_4927 207
2073 3300035172 Ga0373955_0063838 Ga0373955_0063838_817_1443 207
2074 3300035241 Ga0373961_0001194 Ga0373961_0001194_4077_4700 207
2075 3300035242 Ga0373962_0001952 Ga0373962_0001952_1702_2325 207
2076 3300035398 Ga0316574_0000231 Ga0316574_0000231_6710_7381 207
2077 3300035691 Ga0373931_0004135 Ga0373931_0004135_3587_4210 207
2078 3300035691 Ga0373931_0012234 Ga0373931_0012234_1344_1967 207
2079 3300036712 Ga0316584_0025762 Ga0316584_0025762_1353_2024 207
2080 3300042012 Ga0439455_0021007 Ga0439455_0021007_782_1405 207
2081 3300042012 Ga0439455_0091756 Ga0439455_0091756_54_677 207
2082 3300044712 Ga0453684_0096331 Ga0453684_0096331_2719_3342 207
2083 3300045051 Ga0451576_0013475 Ga0451576_0013475_2661_3284 207
2084 3300048903 Ga0496100_0036624 Ga0496100_0036624_1890_2513 207
2085 3300048904 Ga0496101_0001713 Ga0496101_0001713_11921_12544 207
2086 3300048905 Ga0496102_0193781 Ga0496102_0193781_885_1508 207
2087 3300048906 Ga0496103_0020484 Ga0496103_0020484_2799_3422 207
2088 3300048907 Ga0496104_0036951 Ga0496104_0036951_3347_3970 207
2089 3300048907 Ga0496104_0037417 Ga0496104_0037417_25_648 207
2090 3300048909 Ga0496106_0001467 Ga0496106_0001467_8377_9000 207
2091 3300048909 Ga0496106_0029863 Ga0496106_0029863_3398_4021 207
2092 3300048909 Ga0496106_0169011 Ga0496106_0169011_1030_1653 207
2093 3300048910 Ga0496107_0049154 Ga0496107_0049154_1692_2315 207
2094 3300048910 Ga0496107_0071766 Ga0496107_0071766_456_1079 207
2095 3300048910 Ga0496107_0190847 Ga0496107_0190847_81_704 207
2096 3300048911 Ga0496108_0001568 Ga0496108_0001568_7866_8489 207
2097 3300048911 Ga0496108_0010763 Ga0496108_0010763_2922_3545 207
2098 3300048912 Ga0496109_0002182 Ga0496109_0002182_4717_5340 207
2099 3300048912 Ga0496109_0002615 Ga0496109_0002615_8580_9203 207
2100 3300048913 Ga0496110_0136311 Ga0496110_0136311_382_1005 207
2101 3300048914 Ga0496111_0048473 Ga0496111_0048473_600_1223 207
2102 3300048914 Ga0496111_0311011 Ga0496111_0311011_89_712 207
2103 3300048914 Ga0496111_0460484 Ga0496111_0460484_113_736 207
2104 3300048915 Ga0496112_0018414 Ga0496112_0018414_1954_2577 207
2105 3300048916 Ga0496113_0008509 Ga0496113_0008509_5678_6301 207
2106 3300048916 Ga0496113_0013337 Ga0496113_0013337_647_1270 207
2107 3300048917 Ga0496114_0141439 Ga0496114_0141439_118_741 207
2108 3300048918 Ga0496115_0048406 Ga0496115_0048406_1312_1935 207
2109 3300049575 Ga0501039_0078603 Ga0501039_0078603_1110_1793 207
2110 3300049578 Ga0501042_0021760 Ga0501042_0021760_1058_1741 207
2111 3300049585 Ga0501069_0159929 Ga0501069_0159929_402_1085 207
2112 3300049586 Ga0501070_0248316 Ga0501070_0248316_685_1368 207
2113 3300049587 Ga0501071_0151091 Ga0501071_0151091_506_1189 207
2114 3300049588 Ga0501072_0010199 Ga0501072_0010199_6041_6724 207
2115 3300049590 Ga0501074_0126844 Ga0501074_0126844_116_799 207
2116 3300049591 Ga0501075_0132963 Ga0501075_0132963_204_887 207
2117 3300049591 Ga0501075_0403826 Ga0501075_0403826_122_745 207
2118 3300049592 Ga0501076_0078632 Ga0501076_0078632_1617_2240 207
2119 3300049592 Ga0501076_0162889 Ga0501076_0162889_900_1583 207
2120 3300049593 Ga0501077_0022201 Ga0501077_0022201_1112_1735 207
2121 3300049741 Ga0501079_0054642 Ga0501079_0054642_1326_2009 207
2122 3300049742 Ga0501080_0571777 Ga0501080_0571777_20_703 207
2123 3300049743 Ga0501081_0074853 Ga0501081_0074853_1721_2344 207
2124 3300049743 Ga0501081_0272370 Ga0501081_0272370_474_1157 207
2125 3300050507 nmdc:mga05p37_311_c1 nmdc:mga05p37_311_c1_814_1506 207
2126 3300050507 nmdc:mga05p37_39108_c1 nmdc:mga05p37_39108_c1_1769_2395 207
2127 3300050507 nmdc:mga05p37_49306_c1 nmdc:mga05p37_49306_c1_2363_2989 207
2128 3300050508 nmdc:mga09592_1063729_c1 nmdc:mga09592_1063729_c1_16_639 207
2129 3300050508 nmdc:mga09592_18000_c1 nmdc:mga09592_18000_c1_3427_4053 207
2130 3300050508 nmdc:mga09592_20420_c1 nmdc:mga09592_20420_c1_4228_4920 207
2131 3300050509 nmdc:mga0qj67_1385_c1 nmdc:mga0qj67_1385_c1_12692_13318 207
2132 3300050509 nmdc:mga0qj67_35764_c1 nmdc:mga0qj67_35764_c1_2736_3428 207
2133 3300050510 nmdc:mga06r32_120512_c1 nmdc:mga06r32_120512_c1_672_1322 207
2134 3300050510 nmdc:mga06r32_13113_c1 nmdc:mga06r32_13113_c1_3427_4053 207
2135 3300050510 nmdc:mga06r32_175066_c1 nmdc:mga06r32_175066_c1_103_753 207
2136 3300050510 nmdc:mga06r32_191_c1 nmdc:mga06r32_191_c1_23962_24654 207
2137 3300050511 nmdc:mga08y16_165_c1 nmdc:mga08y16_165_c1_2341_3033 207
2138 3300050511 nmdc:mga08y16_19811_c1 nmdc:mga08y16_19811_c1_5887_6510 207
2139 3300050511 nmdc:mga08y16_26026_c1 nmdc:mga08y16_26026_c1_4077_4700 207
2140 3300050511 nmdc:mga08y16_7282_c1 nmdc:mga08y16_7282_c1_8268_8894 207
2141 3300050512 nmdc:mga0n895_14277_c1 nmdc:mga0n895_14277_c1_4748_5374 207
2142 3300050512 nmdc:mga0n895_1572_c1 nmdc:mga0n895_1572_c1_415_1038 207
2143 3300050512 nmdc:mga0n895_705_c1 nmdc:mga0n895_705_c1_2259_2885 207
2144 3300050512 nmdc:mga0n895_827543_c1 nmdc:mga0n895_827543_c1_108_731 207
2145 3300050513 nmdc:mga0rr50_18530_c1 nmdc:mga0rr50_18530_c1_1374_2000 207
2146 3300050513 nmdc:mga0rr50_59040_c1 nmdc:mga0rr50_59040_c1_1162_1785 207
2147 3300050513 nmdc:mga0rr50_65150_c1 nmdc:mga0rr50_65150_c1_39_665 207
2148 3300050513 nmdc:mga0rr50_72352_c1 nmdc:mga0rr50_72352_c1_206_829 207
2149 3300050514 nmdc:mga08x19_98054_c1 nmdc:mga08x19_98054_c1_96_740 207
2150 3300050515 nmdc:mga0a205_30157_c1 nmdc:mga0a205_30157_c1_2909_3532 207
2151 3300050515 nmdc:mga0a205_70120_c1 nmdc:mga0a205_70120_c1_815_1441 207
2152 3300050515 nmdc:mga0a205_70858_c1 nmdc:mga0a205_70858_c1_864_1487 207
2153 3300050515 nmdc:mga0a205_945_c1 nmdc:mga0a205_945_c1_16757_17383 207
2154 3300054114 Ga0501084_0041967 Ga0501084_0041967_2883_3566 207
2155 3300054114 Ga0501084_0381981 Ga0501084_0381981_407_1030 207
2156 3300059426 Ga0590077_018053 Ga0590077_018053_598_1278 207
2157 3300060353 Ga0501082_0017497 Ga0501082_0017497_2767_3450 207
2158 3300061734 Ga0530510_0041355 Ga0530510_0041355_1492_2175 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12917

YfbR-like

5'-deoxynucleotidase YfbR-like

64

183

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gz4-assembly1.cif.gz_C 1.5 a crystal structure of a protein of unknown function atu1052 from agrobacterium tumefaciens 0.9173 13 206
2gz4-assembly1.cif.gz_C 1.5 a crystal structure of a protein of unknown function atu1052 from agrobacterium tumefaciens 0.8948 13 206
6zpa-assembly1.cif.gz_A cyanophage s-2l hd phosphohydrolase (datz) bound to da and one catalytic zn2+ ion 0.5452 36 206
6zpa-assembly1.cif.gz_A cyanophage s-2l hd phosphohydrolase (datz) bound to da and one catalytic zn2+ ion 0.5289 36 206
2pau-assembly1.cif.gz_A crystal structure of the 5'-deoxynucleotidase yfbr mutant e72a complexed with co(2+) and damp 0.5203 40 204
ID Description Score Start End Superfamily
2gz4D00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9262 15 204 1.10.3210.10
2gz4D00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8805 15 204 1.10.3210.10
af_P76514_1_178_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8038 17 204 1.10.3210.10
af_P76514_1_178_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7627 17 204 1.10.3210.10
af_P76491_1_199_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5174 36 207 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A6L5FLB6-F1-model_v4 Hydrolase 0.9453 20 207 GO:0016787
AF-A0A6L5FLB6-F1-model_v4 Hydrolase 0.9404 20 207 GO:0016787
AF-A0A6B9FYH5-F1-model_v4 Hydrolase 0.938 20 207 GO:0016787
AF-A0A258K4A0-F1-model_v4 Hydrolase 0.9373 26 205 GO:0016787
AF-A0A2U8VYI4-F1-model_v4 Hydrolase 0.9373 20 206 GO:0016787

Feature Viewer

pLDDT pTM Quality
87.17 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map