F496420

General Info

Members Datasets Scaffolds Average Seq Length
2114 719 1981 447

Family's Representative Sequence

Representative Sequence 3300046680|Ga0495646_0082429|Ga0495646_0082429_239_1561
Length 426
Sequence LKKSSLPIVARSRFVSSAPADKEAKYVKLADEAVCIGPAPSNLSYLNMPALISAAEVTDAEAIHPGYGFLSENADFAERVEQSGFTFIGPRPETIRMMGDKVTAKQTMIKTGVPCVPGSEGALPEDPKEIVKIARQVGYPVIIKRGMRVVHTEAALVNAVNMTREEAGRAFGNPQVYMEKFLENPRHIEIQVLSDSFKNAVWLGERDCSMQRRHQKVIEEAPAPGIARRLIDRIGKKMGYLGAGTFEFLYENGEFYFIEMNTRVQVEHPVTELITGVDIVQEQIRIAAGEKLAFRQRDIVFKGHAIECRINAEDPFKFIPSPGRLTSWHMPGGPGIRVDSHAYNGYFVPPNYDSMIGKLIAYGATREQAIKRMRIALSEMVVEGIQTNIPLHRELMLDAKFVEGGTSIHYLENRLAAKLQAAPEEA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
11 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
12 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
13 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
14 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
15 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
16 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
17 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
18 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
19 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
20 2519103095 Burkholderia sp. KJ006 Isolate Nodule
21 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
22 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
23 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
24 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
25 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
26 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
27 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
28 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
29 2643221569 Achromobacter sp. Root565 Isolate Unclassified
30 2643221570 Acidovorax sp. Root568 Isolate Unclassified
31 2643221594 Achromobacter sp. Root170 Isolate Unclassified
32 2643221596 Acidovorax sp. Root70 Isolate Unclassified
33 2643221609 Acidovorax sp. Root217 Isolate Unclassified
34 2643221611 Acidovorax sp. Root219 Isolate Unclassified
35 2643221621 Achromobacter sp. Root83 Isolate Unclassified
36 2643221652 Acidovorax sp. Root402 Isolate Unclassified
37 2643221658 Variovorax sp. Root411 Isolate Unclassified
38 2643221672 Variovorax sp. Root434 Isolate Unclassified
39 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
40 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
41 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
42 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
43 2738541277 Variovorax sp. GV051 Isolate Unclassified
44 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
45 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
46 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
47 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
48 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
49 2738543012 Acidovorax sp. CF301 Isolate Unclassified
50 2738543013 Variovorax sp. BT01 Isolate Unclassified
51 2738543019 Variovorax sp. GV040 Isolate Unclassified
52 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
53 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
54 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
55 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
56 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
57 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
58 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
59 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
60 2816332133 Acidovorax radicis 2721A Isolate Unclassified
61 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
62 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
63 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
64 2818991446 Variovorax sp. 1180 Isolate Unclassified
65 2818991450 Burkholderia sp. 604 Isolate Unclassified
66 2818991452 Burkholderia cepacia 561 Isolate Unclassified
67 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
68 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
69 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
70 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
71 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
72 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
73 2842747753 Variovorax sp. R-72060 Isolate Unclassified
74 2855730933 Achromobacter sp. HZ28 Isolate Nodule
75 2855767633 Achromobacter sp. HZ34 Isolate Nodule
76 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
77 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
78 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
79 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
80 2858950400 Achromobacter sp. K91 Isolate Unclassified
81 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
82 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
83 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
84 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
85 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
86 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
87 2899924645 Variovorax sp. 369 Isolate Unclassified
88 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
89 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
90 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
91 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
92 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
93 2904564687 Burkholderia sp. 571 Isolate Unclassified
94 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
95 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
96 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
97 2928037797 Variovorax sp. 1126 Isolate Unclassified
98 2928044640 Variovorax sp. 1128 Isolate Unclassified
99 2928051484 Variovorax sp. 1133 Isolate Unclassified
100 2928058823 Ralstonia sp. 1138 Isolate Unclassified
101 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
102 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
103 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
104 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
105 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
106 2928163908 Burkholderia sp. 567 Isolate Unclassified
107 2928170801 Burkholderia sp. 572 Isolate Unclassified
108 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
109 2928536128 Burkholderia sola 565 Isolate Unclassified
110 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
111 2941479691
112 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
113 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
114 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
115 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
116 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
117 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
118 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
119 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
120 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
121 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
122 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
123 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
124 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
125 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
126 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
127 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
128 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
129 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
130 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
131 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
132 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
133 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
134 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
135 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
136 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
137 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
138 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
139 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
140 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
141 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
143 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
144 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
145 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
146 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
147 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
148 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
149 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
150 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
151 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
152 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
153 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
154 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
155 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
156 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
157 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
158 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
159 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
160 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
161 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
162 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
163 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
164 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
165 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
166 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
167 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
168 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
169 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
170 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
171 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
172 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
173 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
174 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
175 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
176 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
177 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
178 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
179 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
180 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
181 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
182 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
183 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
184 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
185 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
186 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
187 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
188 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
189 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
190 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
191 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
192 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
193 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
194 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
195 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
196 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
197 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
198 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
199 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
200 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
201 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
202 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
203 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
204 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
205 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
206 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
207 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
208 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
209 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
210 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
211 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
212 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
213 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
214 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
215 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
216 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
217 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
218 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
219 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
220 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
221 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
222 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
223 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
224 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
225 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
226 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
227 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
228 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
229 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
230 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
231 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
232 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
233 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
234 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
235 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
236 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
237 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
238 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
239 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
240 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
241 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
242 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
243 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
244 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
245 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
246 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
247 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
248 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
249 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
250 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
251 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
252 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
253 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
254 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
255 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
256 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
257 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
258 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
259 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
260 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
261 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
262 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
263 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
264 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
265 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
266 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
267 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
268 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
269 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
270 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
271 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
272 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
273 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
274 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
275 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
276 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
277 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
278 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
279 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
280 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
281 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
282 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
283 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
284 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
285 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
286 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
287 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
288 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
289 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
290 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
291 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
292 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
293 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
294 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
295 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
296 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
297 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
298 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
299 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
300 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
301 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
302 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
309 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
310 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
312 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
313 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
314 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
317 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
318 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
319 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
320 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
322 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
323 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
324 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
326 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
327 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
328 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
329 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
330 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
331 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
399 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
400 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
401 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
402 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
403 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
404 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
405 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
406 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
407 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
408 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
409 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
410 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
411 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
412 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
413 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
414 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
418 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
419 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
420 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
421 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
422 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
423 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
424 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
425 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
426 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
427 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
428 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
429 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
430 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
431 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
432 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
433 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
434 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
435 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
436 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
437 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
438 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
439 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
440 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
441 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
442 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
443 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
444 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
445 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
446 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
447 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
448 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
449 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
450 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
451 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
452 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
453 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
454 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
455 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
456 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
460 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
461 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
462 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
463 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
464 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
465 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
466 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
467 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
468 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
469 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
470 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
471 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
472 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
473 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
474 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
475 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
476 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
477 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
478 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
479 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
480 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
481 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
482 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
483 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
484 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
485 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
486 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
487 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
488 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
489 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
490 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
491 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
492 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
493 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
494 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
495 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
496 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
497 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
498 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
499 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
500 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
501 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
502 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
503 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
504 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
505 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
506 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
507 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
508 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
509 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
510 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
511 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
512 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
513 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
514 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
515 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
516 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
517 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
518 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
519 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
520 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
521 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
522 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
523 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
524 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
525 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
526 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
527 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
528 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
529 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
530 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
531 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
532 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
533 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
534 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
535 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
536 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
537 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
538 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
539 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
540 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
541 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
542 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
543 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
544 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
545 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
546 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
547 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
548 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
549 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
550 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
551 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
552 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
553 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
554 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
555 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
556 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
557 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
558 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
559 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
560 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
561 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
562 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
563 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
564 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
565 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
566 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
567 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
568 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
569 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
570 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
571 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
572 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
573 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
574 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
575 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
576 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
577 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
578 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
579 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
580 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
581 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
582 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
583 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
584 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
585 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
586 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
587 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
588 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
589 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
590 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
591 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
592 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
593 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
594 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
595 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
596 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
597 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
598 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
599 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
600 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
601 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
602 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
603 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
604 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
605 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
606 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
607 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
608 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
609 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
610 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
611 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
612 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
613 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
614 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
615 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
616 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
617 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
618 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
619 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
620 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
621 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
622 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
623 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
624 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
625 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
626 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
627 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
628 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
629 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
630 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
631 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
632 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
633 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
634 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
635 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
636 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
637 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
638 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
639 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
640 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
641 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
642 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
643 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
644 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
645 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
646 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
647 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
648 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
649 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
650 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
651 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
652 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
653 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
654 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
655 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
656 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
657 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
658 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
659 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
660 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
661 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
662 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
663 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
664 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
665 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
666 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
667 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
668 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
669 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
670 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
671 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
672 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
673 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
674 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
675 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
676 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
677 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
678 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
679 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
680 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
681 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
682 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
683 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
684 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
685 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
686 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
687 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
688 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
689 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
690 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
691 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
692 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
693 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
694 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
695 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
696 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
697 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
698 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
699 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
700 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
701 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
702 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
703 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
704 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
705 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
706 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
707 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
708 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
709 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
710 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
711 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
712 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
713 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
714 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
715 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
716 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
717 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
718 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
719 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.33
Metatranscriptomes 0.43
Isolates 6.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.66
Nodule 1.56
Rhizoplane 1.94
Rhizosphere 73.13
Stem 0
Stem Tuber 0
Unclassified 7.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000902 3300001979 Bacteria 13161
2 JGI24740J21852_10003089 3300001979 Bacteria 7349
3 JGI24740J21852_10012128 3300001979 Bacteria 3256
4 JGI24740J21852_10026257 3300001979 Bacteria 1953
5 JGI24739J22299_10001586 3300001989 Bacteria 8607
6 JGI24739J22299_10012346 3300001989 Bacteria 3138
7 JGI24739J22299_10013738 3300001989 Bacteria 2952
8 JGI24737J22298_10028174 3300001990 Bacteria 1767
9 JGI24735J21928_10000206 3300002067 Bacteria 20692
10 JGI24735J21928_10000832 3300002067 Bacteria 10968
11 JGI24735J21928_10001906 3300002067 Bacteria 7309
12 JGI24735J21928_10008427 3300002067 Bacteria 3332
13 JGI24735J21928_10035280 3300002067 Bacteria 1472
14 JGI24738J21930_10004100 3300002075 Bacteria 3598
15 JGI24744J21845_10011438 3300002077 Bacteria 1815
16 JGI25156J39149_1000481 3300002705 Bacteria 23983
17 JGI25156J39149_1000972 3300002705 Bacteria 13646
18 JGI25156J39149_1002143 3300002705 Bacteria 7428
19 JGI25156J39149_1003079 3300002705 Bacteria 5639
20 JGI25156J39149_1003106 3300002705 Bacteria 5610
21 JGI25156J39149_1010996 3300002705 Bacteria 2081
22 JGI25162J39368_1000032 3300002737 Bacteria 195871
23 JGI25162J39368_1006064 3300002737 Bacteria 2175
24 JGI25154J39366_1000364 3300002738 Bacteria 25312
25 JGI25154J39366_1000390 3300002738 Bacteria 23901
26 JGI25154J39366_1002246 3300002738 Bacteria 5291
27 JGI25154J39366_1002682 3300002738 Bacteria 4356
28 JGI25158J39367_1004866 3300002739 Bacteria 1993
29 JGI25157J39369_1000350 3300002741 Bacteria 32509
30 JGI25157J39369_1000363 3300002741 Bacteria 31296
31 JGI25157J39369_1000566 3300002741 Bacteria 22112
32 JGI25157J39369_1001087 3300002741 Bacteria 12192
33 JGI25164J39214_1002165 3300002772 Bacteria 3267
34 JGI25152J39213_1002601 3300002773 Bacteria 6730
35 JGI25152J39213_1003527 3300002773 Bacteria 5297
36 JGI25152J39213_1006782 3300002773 Bacteria 3045
37 JGI25150J39212_1004951 3300002774 Bacteria 2893
38 JGI25159J45721_1013925 3300002987 Bacteria 1837
39 JGI25151J46595_10000137 3300003187 Bacteria 96370
40 JGI25151J46595_10000972 3300003187 Bacteria 21720
41 JGI25151J46595_10005064 3300003187 Bacteria 6854
42 JGI25151J46595_10007385 3300003187 Bacteria 5392
43 JGI25151J46595_10010042 3300003187 Bacteria 4434
44 JGI25165J46597_1000067 3300003214 Bacteria 196411
45 JGI25165J46597_1001096 3300003214 Bacteria 17279
46 JGI25153J46596_10001778 3300003215 Bacteria 12789
47 JGI25153J46596_10006426 3300003215 Bacteria 5940
48 JGI25153J46596_10009699 3300003215 Bacteria 4434
49 JGI25153J46596_10010968 3300003215 Bacteria 4047
50 JGI26128J50194_1000229 3300003347 Bacteria 2718
51 JGI25160J50197_1000267 3300003354 Bacteria 39167
52 JGI25160J50197_1003487 3300003354 Bacteria 7022
53 JGI25161J50226_1006594 3300003374 Bacteria 2074
54 Ga0007409J51694_1023236 3300003575 Bacteria 4958
55 Ga0007416J51690_1023564 3300003577 Bacteria 5120
56 Ga0006562J51391_1008695 3300003578 Bacteria 7428
57 Ga0032354_1043026 3300003693 Bacteria 5023
58 Ga0055538_1000010 3300003751 Bacteria 376599
59 Ga0055538_1000033 3300003751 Bacteria 195914
60 Ga0055538_1000051 3300003751 Bacteria 129958
61 Ga0055539_1000015 3300003752 Bacteria 376599
62 Ga0055539_1000045 3300003752 Bacteria 195316
63 Ga0055539_1000076 3300003752 Bacteria 129958
64 Ga0055533_1000018 3300003756 Bacteria 376599
65 Ga0055533_1000033 3300003756 Bacteria 265716
66 Ga0055533_1000054 3300003756 Bacteria 195914
67 Ga0055533_1000082 3300003756 Bacteria 129958
68 Ga0055533_1001062 3300003756 Bacteria 7897
69 Ga0055532_1000018 3300003758 Bacteria 305466
70 Ga0055532_1000147 3300003758 Bacteria 68782
71 Ga0055525_1000004 3300003759 Bacteria 888039
72 Ga0055525_1000020 3300003759 Bacteria 376599
73 Ga0055525_1000065 3300003759 Bacteria 195779
74 Ga0055525_1000109 3300003759 Bacteria 129958
75 Ga0055525_1001526 3300003759 Bacteria 3910
76 Ga0055527_1000093 3300003760 Bacteria 68782
77 Ga0055535_1000094 3300003761 Bacteria 97073
78 Ga0055535_1000729 3300003761 Bacteria 24824
79 Ga0055535_1001191 3300003761 Bacteria 14998
80 Ga0055535_1004121 3300003761 Bacteria 3713
81 Ga0055542_1000051 3300003762 Bacteria 175242
82 Ga0055542_1000131 3300003762 Bacteria 97073
83 Ga0055529_1000127 3300003763 Bacteria 109148
84 Ga0055529_1000238 3300003763 Bacteria 68782
85 Ga0055529_1000486 3300003763 Bacteria 36917
86 Ga0055529_1000651 3300003763 Bacteria 25034
87 Ga0055526_1000111 3300003771 Bacteria 71834
88 Ga0055526_1000179 3300003771 Bacteria 56199
89 Ga0055526_1000556 3300003771 Bacteria 29488
90 Ga0055526_1001406 3300003771 Bacteria 17111
91 Ga0055537_1000056 3300003773 Bacteria 81623
92 Ga0055537_1003907 3300003773 Bacteria 4434
93 Ga0055537_1013107 3300003773 Bacteria 1575
94 Ga0055524_1000029 3300003775 Bacteria 201332
95 Ga0055524_1000044 3300003775 Bacteria 151631
96 Ga0055524_1000109 3300003775 Bacteria 100308
97 Ga0055524_1000146 3300003775 Bacteria 84190
98 Ga0055524_1003233 3300003775 Bacteria 7979
99 Ga0055536_1003791 3300003781 Bacteria 7969
100 Ga0055536_1004594 3300003781 Bacteria 6997
101 Ga0055536_1005018 3300003781 Bacteria 6576
102 Ga0055536_1026014 3300003781 Bacteria 1652
103 Ga0055534_1000178 3300003784 Bacteria 46872
104 Ga0055534_1001210 3300003784 Bacteria 10819
105 Ga0055534_1010660 3300003784 Bacteria 1910
106 Ga0055528_1000287 3300003790 Bacteria 43121
107 Ga0055528_1000297 3300003790 Bacteria 42261
108 Ga0055528_1002575 3300003790 Bacteria 9606
109 Ga0055528_1003822 3300003790 Bacteria 7410
110 Ga0055530_10002335 3300003791 Bacteria 12367
111 Ga0055530_10002509 3300003791 Bacteria 11727
112 Ga0055540_1000116 3300003792 Bacteria 83801
113 Ga0055540_1000401 3300003792 Bacteria 35216
114 Ga0055540_1002542 3300003792 Bacteria 9516
115 Ga0055540_1020118 3300003792 Bacteria 1776
116 Ga0055531_10000181 3300003794 Bacteria 71324
117 Ga0055531_10001209 3300003794 Bacteria 19790
118 Ga0055531_10003298 3300003794 Bacteria 10339
119 Ga0055531_10004112 3300003794 Bacteria 8996
120 Ga0055531_10008229 3300003794 Bacteria 5550
121 Ga0055541_1000011 3300003841 Bacteria 376599
122 Ga0055541_1000031 3300003841 Bacteria 195914
123 Ga0055541_1000053 3300003841 Bacteria 129958
124 Ga0058692_1002107 3300003856 Bacteria 6872
125 Ga0055543_1002745 3300004625 Bacteria 5599
126 Ga0055543_1003087 3300004625 Bacteria 5115
127 Ga0055543_1005447 3300004625 Bacteria 3246
128 Ga0055543_1008416 3300004625 Bacteria 2286
129 Ga0065165_1000016 3300005262 Bacteria 286248
130 Ga0065165_1000273 3300005262 Bacteria 87879
131 Ga0065165_1000447 3300005262 Bacteria 64800
132 Ga0065165_1000986 3300005262 Bacteria 35247
133 Ga0065165_1001067 3300005262 Bacteria 32780
134 Ga0065165_1007963 3300005262 Bacteria 5073
135 Ga0065165_1029917 3300005262 Bacteria 1738
136 Ga0065714_10067070 3300005288 Bacteria 5932
137 Ga0065714_10083375 3300005288 Bacteria 2254
138 Ga0065714_10101328 3300005288 Bacteria 1645
139 Ga0065704_10017042 3300005289 Bacteria 1662
140 Ga0065704_10080167 3300005289 Bacteria 3997
141 Ga0065704_10086996 3300005289 Bacteria 3065
142 Ga0065704_10087833 3300005289 Bacteria 2990
143 Ga0065715_10006304 3300005293 Bacteria 2923
144 Ga0070658_10029174 3300005327 Bacteria 4432
145 Ga0070658_10071691 3300005327 Bacteria 2838
146 Ga0070658_10073950 3300005327 Bacteria 2795
147 Ga0070676_10000960 3300005328 Bacteria 14331
148 Ga0070690_100000082 3300005330 Bacteria 46700
149 Ga0070690_100047034 3300005330 Bacteria 2744
150 Ga0070670_100005345 3300005331 Bacteria 10832
151 Ga0070670_100006913 3300005331 Bacteria 9618
152 Ga0070670_100014237 3300005331 Bacteria 6822
153 Ga0070670_100016165 3300005331 Bacteria 6404
154 Ga0070677_10000307 3300005333 Bacteria 17043
155 Ga0070677_10002708 3300005333 Bacteria 5664
156 Ga0070677_10017794 3300005333 Bacteria 2550
157 Ga0068869_100000044 3300005334 Bacteria 52351
158 Ga0068869_100001368 3300005334 Bacteria 14462
159 Ga0068869_100005133 3300005334 Bacteria 8210
160 Ga0068869_100008669 3300005334 Bacteria 6567
161 Ga0068869_100014536 3300005334 Bacteria 5261
162 Ga0068869_100097164 3300005334 Bacteria 2224
163 Ga0070666_10004926 3300005335 Bacteria 8165
164 Ga0070666_10019208 3300005335 Bacteria 4408
165 Ga0070666_10043834 3300005335 Bacteria 2996
166 Ga0070666_10047286 3300005335 Bacteria 2888
167 Ga0070666_10079698 3300005335 Bacteria 2237
168 Ga0070666_10103632 3300005335 Bacteria 1963
169 Ga0070680_100001218 3300005336 Bacteria 18539
170 Ga0070680_100002568 3300005336 Bacteria 13425
171 Ga0070680_100005437 3300005336 Bacteria 9639
172 Ga0068868_100000339 3300005338 Bacteria 31574
173 Ga0068868_100000458 3300005338 Bacteria 27113
174 Ga0068868_100007829 3300005338 Bacteria 7627
175 Ga0068868_100022592 3300005338 Bacteria 4750
176 Ga0070660_100000030 3300005339 Bacteria 86675
177 Ga0070660_100000501 3300005339 Bacteria 26152
178 Ga0070660_100002928 3300005339 Bacteria 11747
179 Ga0070660_100007268 3300005339 Bacteria 7712
180 Ga0070660_100043714 3300005339 Bacteria 3424
181 Ga0070689_100007655 3300005340 Bacteria 7566
182 Ga0070691_10000573 3300005341 Bacteria 14042
183 Ga0070687_100000034 3300005343 Bacteria 43229
184 Ga0070687_100019532 3300005343 Bacteria 3154
185 Ga0070687_100021465 3300005343 Bacteria 3036
186 Ga0070687_100099475 3300005343 Bacteria 1625
187 Ga0070661_100000191 3300005344 Bacteria 50550
188 Ga0070661_100000647 3300005344 Bacteria 25720
189 Ga0070661_100006151 3300005344 Bacteria 8271
190 Ga0070661_100010308 3300005344 Bacteria 6496
191 Ga0070661_100011300 3300005344 Bacteria 6222
192 Ga0070661_100043695 3300005344 Bacteria 3273
193 Ga0070661_100058700 3300005344 Bacteria 2820
194 Ga0070692_10004243 3300005345 Bacteria 5950
195 Ga0070692_10010496 3300005345 Bacteria 4218
196 Ga0070692_10016920 3300005345 Bacteria 3476
197 Ga0070692_10028522 3300005345 Bacteria 2775
198 Ga0070668_100002954 3300005347 Bacteria 12568
199 Ga0070668_100021104 3300005347 Bacteria 4923
200 Ga0070668_100036435 3300005347 Bacteria 3754
201 Ga0070668_100076508 3300005347 Bacteria 2614
202 Ga0070669_100029079 3300005353 Bacteria 3982
203 Ga0070669_100045722 3300005353 Bacteria 3191
204 Ga0070669_100065101 3300005353 Bacteria 2685
205 Ga0070669_100182885 3300005353 Bacteria 1641
206 Ga0070675_100005810 3300005354 Bacteria 9446
207 Ga0070675_100006640 3300005354 Bacteria 8894
208 Ga0070675_100042297 3300005354 Bacteria 3722
209 Ga0070675_100047673 3300005354 Bacteria 3511
210 Ga0070675_100153479 3300005354 Bacteria 1975
211 Ga0070671_100001559 3300005355 Bacteria 17239
212 Ga0070671_100004694 3300005355 Bacteria 10847
213 Ga0070671_100005899 3300005355 Bacteria 9760
214 Ga0070671_100010054 3300005355 Bacteria 7600
215 Ga0070671_100109552 3300005355 Bacteria 2319
216 Ga0070674_100000204 3300005356 Bacteria 28346
217 Ga0070674_100005354 3300005356 Bacteria 7400
218 Ga0070674_100013274 3300005356 Bacteria 5088
219 Ga0070674_100013813 3300005356 Bacteria 5002
220 Ga0070674_100036400 3300005356 Bacteria 3304
221 Ga0070674_100056525 3300005356 Bacteria 2721
222 Ga0070674_100111324 3300005356 Bacteria 2011
223 Ga0070674_100157400 3300005356 Bacteria 1720
224 Ga0070674_100163463 3300005356 Bacteria 1691
225 Ga0070673_100002026 3300005364 Bacteria 12223
226 Ga0070673_100023271 3300005364 Bacteria 4525
227 Ga0070673_100043240 3300005364 Bacteria 3480
228 Ga0070673_100058287 3300005364 Bacteria 3053
229 Ga0070673_100067600 3300005364 Bacteria 2858
230 Ga0070688_100000913 3300005365 Bacteria 14739
231 Ga0070659_100000124 3300005366 Bacteria 58501
232 Ga0070659_100001083 3300005366 Bacteria 19883
233 Ga0070659_100003383 3300005366 Bacteria 11356
234 Ga0070659_100008597 3300005366 Bacteria 7465
235 Ga0070659_100010328 3300005366 Bacteria 6867
236 Ga0070659_100034718 3300005366 Bacteria 3924
237 Ga0070659_100050574 3300005366 Bacteria 3267
238 Ga0070659_100100216 3300005366 Bacteria 2331
239 Ga0070659_100110159 3300005366 Bacteria 2222
240 Ga0070667_100001570 3300005367 Bacteria 20469
241 Ga0070667_100001846 3300005367 Bacteria 18841
242 Ga0070667_100002207 3300005367 Bacteria 17131
243 Ga0070667_100002920 3300005367 Bacteria 14684
244 Ga0070667_100021742 3300005367 Bacteria 5323
245 Ga0070667_100022407 3300005367 Bacteria 5239
246 Ga0070667_100095054 3300005367 Bacteria 2569
247 Ga0070667_100140356 3300005367 Bacteria 2116
248 Ga0070714_100000437 3300005435 Bacteria 30247
249 Ga0070714_100012010 3300005435 Bacteria 6893
250 Ga0070714_100070445 3300005435 Bacteria 3022
251 Ga0070714_100204497 3300005435 Bacteria 1808
252 Ga0070713_100000031 3300005436 Bacteria 88727
253 Ga0070713_100008696 3300005436 Bacteria 7221
254 Ga0070710_10029598 3300005437 Bacteria 2940
255 Ga0070701_10000346 3300005438 Bacteria 15392
256 Ga0070711_100011567 3300005439 Bacteria 5487
257 Ga0070711_100153242 3300005439 Bacteria 1740
258 Ga0070705_100000030 3300005440 Bacteria 71489
259 Ga0070705_100001918 3300005440 Bacteria 10686
260 Ga0070705_100010795 3300005440 Bacteria 4584
261 Ga0070705_100077309 3300005440 Bacteria 2032
262 Ga0070700_100000348 3300005441 Bacteria 23779
263 Ga0070700_100000552 3300005441 Bacteria 18819
264 Ga0070700_100003335 3300005441 Bacteria 8278
265 Ga0070700_100008875 3300005441 Bacteria 5496
266 Ga0070694_100000706 3300005444 Bacteria 18607
267 Ga0070694_100021470 3300005444 Bacteria 4126
268 Ga0070694_100027341 3300005444 Bacteria 3704
269 Ga0070694_100057397 3300005444 Bacteria 2646
270 Ga0070708_100000128 3300005445 Bacteria 51683
271 Ga0070663_100000037 3300005455 Bacteria 62561
272 Ga0070663_100000198 3300005455 Bacteria 29990
273 Ga0070663_100009567 3300005455 Bacteria 6006
274 Ga0070663_100018966 3300005455 Bacteria 4523
275 Ga0070663_100033511 3300005455 Bacteria 3549
276 Ga0070663_100034648 3300005455 Bacteria 3497
277 Ga0070663_100040977 3300005455 Bacteria 3245
278 Ga0070678_100003071 3300005456 Bacteria 9257
279 Ga0070678_100007119 3300005456 Bacteria 6617
280 Ga0070678_100051590 3300005456 Bacteria 2983
281 Ga0070678_100116146 3300005456 Bacteria 2102
282 Ga0070678_100219552 3300005456 Bacteria 1579
283 Ga0070662_100001463 3300005457 Bacteria 14552
284 Ga0070662_100001730 3300005457 Bacteria 13434
285 Ga0070662_100002390 3300005457 Bacteria 11527
286 Ga0070662_100033344 3300005457 Bacteria 3625
287 Ga0070662_100065736 3300005457 Bacteria 2659
288 Ga0070681_10000399 3300005458 Bacteria 35221
289 Ga0070681_10005361 3300005458 Bacteria 12381
290 Ga0070681_10009401 3300005458 Bacteria 9618
291 Ga0070681_10019143 3300005458 Bacteria 6851
292 Ga0068867_100000032 3300005459 Bacteria 84727
293 Ga0068867_100000126 3300005459 Bacteria 49231
294 Ga0068867_100000948 3300005459 Bacteria 19755
295 Ga0068867_100001405 3300005459 Bacteria 16635
296 Ga0068867_100006011 3300005459 Bacteria 8604
297 Ga0068867_100027830 3300005459 Bacteria 4066
298 Ga0068867_100029186 3300005459 Bacteria 3973
299 Ga0068867_100114817 3300005459 Bacteria 2073
300 Ga0070706_100001272 3300005467 Bacteria 26932
301 Ga0070706_100029906 3300005467 Bacteria 5017
302 Ga0070706_100213217 3300005467 Bacteria 1803
303 Ga0070707_100011654 3300005468 Bacteria 8203
304 Ga0070707_100026096 3300005468 Bacteria 5545
305 Ga0070698_100005922 3300005471 Bacteria 13337
306 Ga0070698_100026177 3300005471 Bacteria 6073
307 Ga0070699_100008578 3300005518 Bacteria 8857
308 Ga0070699_100016121 3300005518 Bacteria 6415
309 Ga0070699_100083057 3300005518 Bacteria 2793
310 Ga0070679_100003506 3300005530 Bacteria 14366
311 Ga0070679_100005754 3300005530 Bacteria 11499
312 Ga0070679_100021831 3300005530 Bacteria 6252
313 Ga0070679_100030740 3300005530 Bacteria 5304
314 Ga0070679_100031252 3300005530 Bacteria 5259
315 Ga0070679_100050438 3300005530 Bacteria 4146
316 Ga0070684_100013947 3300005535 Bacteria 6495
317 Ga0070684_100039111 3300005535 Bacteria 4079
318 Ga0070684_100062874 3300005535 Bacteria 3253
319 Ga0070684_100176184 3300005535 Bacteria 1943
320 Ga0070684_100186511 3300005535 Bacteria 1886
321 Ga0070697_100000648 3300005536 Bacteria 26304
322 Ga0070697_100000731 3300005536 Bacteria 24504
323 Ga0070697_100016650 3300005536 Bacteria 5783
324 Ga0070697_100040771 3300005536 Bacteria 3757
325 Ga0070697_100065711 3300005536 Bacteria 2964
326 Ga0068853_100000497 3300005539 Bacteria 26925
327 Ga0068853_100006025 3300005539 Bacteria 9591
328 Ga0068853_100007636 3300005539 Bacteria 8665
329 Ga0068853_100095644 3300005539 Bacteria 2619
330 Ga0068853_100118036 3300005539 Bacteria 2364
331 Ga0070672_100000561 3300005543 Bacteria 21760
332 Ga0070672_100003605 3300005543 Bacteria 10037
333 Ga0070672_100012934 3300005543 Bacteria 5882
334 Ga0070672_100042416 3300005543 Bacteria 3503
335 Ga0070672_100058086 3300005543 Bacteria 3039
336 Ga0070672_100174817 3300005543 Bacteria 1787
337 Ga0070672_100212159 3300005543 Bacteria 1622
338 Ga0070686_100001608 3300005544 Bacteria 12699
339 Ga0070695_100000514 3300005545 Bacteria 20333
340 Ga0070695_100007023 3300005545 Bacteria 6673
341 Ga0070695_100018182 3300005545 Bacteria 4267
342 Ga0070696_100000089 3300005546 Bacteria 44686
343 Ga0070696_100002259 3300005546 Bacteria 12698
344 Ga0070696_100004442 3300005546 Bacteria 9360
345 Ga0070693_100000100 3300005547 Bacteria 38176
346 Ga0070693_100045926 3300005547 Bacteria 2478
347 Ga0070693_100054114 3300005547 Bacteria 2306
348 Ga0070665_100001460 3300005548 Bacteria 27704
349 Ga0070665_100003522 3300005548 Bacteria 16646
350 Ga0070665_100009319 3300005548 Bacteria 9936
351 Ga0070665_100023904 3300005548 Bacteria 6156
352 Ga0070665_100024009 3300005548 Bacteria 6140
353 Ga0070704_100001681 3300005549 Bacteria 12024
354 Ga0070704_100002884 3300005549 Bacteria 9755
355 Ga0070704_100014962 3300005549 Bacteria 4858
356 Ga0070704_100027289 3300005549 Bacteria 3785
357 Ga0070704_100030144 3300005549 Bacteria 3632
358 Ga0068855_100000863 3300005563 Bacteria 37650
359 Ga0068855_100001358 3300005563 Bacteria 30324
360 Ga0068855_100002377 3300005563 Bacteria 23195
361 Ga0068855_100003246 3300005563 Bacteria 19887
362 Ga0068855_100019281 3300005563 Bacteria 8199
363 Ga0068855_100035614 3300005563 Bacteria 5928
364 Ga0068855_100075199 3300005563 Bacteria 3922
365 Ga0068855_100167174 3300005563 Bacteria 2492
366 Ga0068855_100187279 3300005563 Bacteria 2337
367 Ga0070664_100001381 3300005564 Bacteria 19335
368 Ga0070664_100007606 3300005564 Bacteria 8748
369 Ga0070664_100023353 3300005564 Bacteria 5107
370 Ga0070664_100042100 3300005564 Bacteria 3856
371 Ga0068857_100004082 3300005577 Bacteria 12300
372 Ga0068857_100017820 3300005577 Bacteria 6227
373 Ga0068857_100038246 3300005577 Bacteria 4249
374 Ga0068857_100048819 3300005577 Bacteria 3755
375 Ga0068857_100063787 3300005577 Bacteria 3275
376 Ga0068854_100002409 3300005578 Bacteria 11540
377 Ga0068854_100011019 3300005578 Bacteria 5869
378 Ga0068854_100029326 3300005578 Bacteria 3809
379 Ga0068854_100101330 3300005578 Bacteria 2159
380 Ga0068856_100000517 3300005614 Bacteria 42558
381 Ga0068856_100005435 3300005614 Bacteria 12560
382 Ga0068856_100006194 3300005614 Bacteria 11737
383 Ga0068856_100006477 3300005614 Bacteria 11480
384 Ga0068856_100276174 3300005614 Bacteria 1697
385 Ga0068856_100278654 3300005614 Bacteria 1689
386 Ga0070702_100000001 3300005615 Bacteria 87224
387 Ga0070702_100044523 3300005615 Bacteria 2506
388 Ga0068852_100000716 3300005616 Bacteria 21713
389 Ga0068852_100003761 3300005616 Bacteria 10642
390 Ga0068852_100041793 3300005616 Bacteria 3877
391 Ga0068852_100072729 3300005616 Bacteria 3022
392 Ga0068852_100074997 3300005616 Bacteria 2982
393 Ga0068852_100110265 3300005616 Bacteria 2501
394 Ga0068859_100000149 3300005617 Bacteria 66296
395 Ga0068859_100007841 3300005617 Bacteria 10835
396 Ga0068859_100029685 3300005617 Bacteria 5487
397 Ga0068859_100037248 3300005617 Bacteria 4882
398 Ga0068859_100047138 3300005617 Bacteria 4329
399 Ga0068859_100105815 3300005617 Bacteria 2873
400 Ga0068859_100217760 3300005617 Bacteria 1997
401 Ga0068864_100000322 3300005618 Bacteria 42202
402 Ga0068864_100000388 3300005618 Bacteria 38412
403 Ga0068864_100003242 3300005618 Bacteria 13444
404 Ga0068864_100007512 3300005618 Bacteria 8980
405 Ga0068864_100010993 3300005618 Bacteria 7485
406 Ga0068864_100016150 3300005618 Bacteria 6213
407 Ga0068864_100072581 3300005618 Bacteria 3000
408 Ga0068864_100130052 3300005618 Bacteria 2261
409 Ga0068864_100152970 3300005618 Bacteria 2091
410 Ga0068864_100243709 3300005618 Bacteria 1666
411 Ga0068866_10000326 3300005718 Bacteria 22539
412 Ga0068866_10000906 3300005718 Bacteria 13012
413 Ga0068866_10015900 3300005718 Bacteria 3352
414 Ga0068861_100000057 3300005719 Bacteria 52351
415 Ga0068861_100005473 3300005719 Bacteria 8605
416 Ga0068861_100006120 3300005719 Bacteria 8190
417 Ga0068861_100008694 3300005719 Bacteria 6986
418 Ga0068861_100018379 3300005719 Bacteria 4981
419 Ga0068861_100035853 3300005719 Bacteria 3677
420 Ga0068861_100076193 3300005719 Bacteria 2613
421 Ga0068851_10002652 3300005834 Bacteria 7881
422 Ga0068851_10004731 3300005834 Bacteria 6163
423 Ga0068851_10011745 3300005834 Bacteria 4112
424 Ga0068870_10001178 3300005840 Bacteria 10481
425 Ga0068863_100005418 3300005841 Bacteria 12569
426 Ga0068863_100006313 3300005841 Bacteria 11634
427 Ga0068863_100007074 3300005841 Bacteria 10998
428 Ga0068863_100041440 3300005841 Bacteria 4379
429 Ga0068863_100055644 3300005841 Bacteria 3746
430 Ga0068863_100070594 3300005841 Bacteria 3303
431 Ga0068863_100150022 3300005841 Bacteria 2230
432 Ga0068863_100225670 3300005841 Bacteria 1806
433 Ga0068863_100235595 3300005841 Bacteria 1766
434 Ga0068858_100000289 3300005842 Bacteria 54365
435 Ga0068858_100001615 3300005842 Bacteria 22986
436 Ga0068858_100001909 3300005842 Bacteria 21281
437 Ga0068858_100011373 3300005842 Bacteria 8404
438 Ga0068858_100141183 3300005842 Bacteria 2261
439 Ga0068860_100001090 3300005843 Bacteria 29921
440 Ga0068860_100027082 3300005843 Bacteria 5523
441 Ga0068860_100031255 3300005843 Bacteria 5119
442 Ga0068860_100081081 3300005843 Bacteria 3086
443 Ga0068860_100130770 3300005843 Bacteria 2408
444 Ga0068860_100149262 3300005843 Bacteria 2250
445 Ga0068862_100000409 3300005844 Bacteria 46422
446 Ga0068862_100001111 3300005844 Bacteria 25519
447 Ga0068862_100001722 3300005844 Bacteria 19792
448 Ga0068862_100017424 3300005844 Bacteria 5983
449 Ga0068862_100021753 3300005844 Bacteria 5363
450 Ga0068862_100037077 3300005844 Bacteria 4132
451 Ga0068862_100064188 3300005844 Bacteria 3161
452 Ga0068862_100075761 3300005844 Bacteria 2911
453 Ga0081539_10004364 3300005985 Bacteria 15760
454 Ga0081539_10005289 3300005985 Bacteria 13296
455 Ga0081539_10027865 3300005985 Bacteria 3567
456 Ga0075363_100027614 3300006048 Bacteria 2911
457 Ga0075364_10000662 3300006051 Bacteria 17856
458 Ga0075364_10011166 3300006051 Bacteria 5451
459 Ga0075364_10029759 3300006051 Bacteria 3502
460 Ga0075432_10001571 3300006058 Bacteria 7485
461 Ga0075362_10010413 3300006177 Bacteria 3630
462 Ga0075362_10039866 3300006177 Bacteria 2066
463 Ga0075367_10029930 3300006178 Bacteria 3118
464 Ga0075367_10039871 3300006178 Bacteria 2740
465 Ga0075366_10001081 3300006195 Bacteria 13387
466 Ga0075366_10001740 3300006195 Bacteria 10952
467 Ga0075366_10005214 3300006195 Bacteria 7032
468 Ga0075366_10008597 3300006195 Bacteria 5684
469 Ga0075366_10016355 3300006195 Bacteria 4264
470 Ga0075366_10026073 3300006195 Bacteria 3421
471 Ga0097621_100010942 3300006237 Bacteria 6662
472 Ga0097621_100036310 3300006237 Bacteria 3942
473 Ga0075370_10001068 3300006353 Bacteria 11409
474 Ga0075370_10001217 3300006353 Bacteria 10880
475 Ga0075370_10002553 3300006353 Bacteria 8473
476 Ga0075370_10004950 3300006353 Bacteria 6547
477 Ga0075370_10008610 3300006353 Bacteria 5259
478 Ga0075370_10016585 3300006353 Bacteria 3965
479 Ga0075370_10035597 3300006353 Bacteria 2794
480 Ga0075370_10078868 3300006353 Bacteria 1891
481 Ga0068871_100003330 3300006358 Bacteria 11032
482 Ga0068871_100003523 3300006358 Bacteria 10773
483 Ga0068871_100006832 3300006358 Bacteria 8118
484 Ga0068871_100011233 3300006358 Bacteria 6562
485 Ga0068871_100023453 3300006358 Bacteria 4774
486 Ga0068871_100195552 3300006358 Bacteria 1744
487 Ga0075428_100000083 3300006844 Bacteria 78689
488 Ga0075428_100018274 3300006844 Bacteria 7749
489 Ga0075428_100039526 3300006844 Bacteria 5192
490 Ga0075428_100060394 3300006844 Bacteria 4151
491 Ga0075430_100000550 3300006846 Bacteria 28484
492 Ga0075430_100006442 3300006846 Bacteria 9895
493 Ga0075430_100016189 3300006846 Bacteria 6352
494 Ga0075430_100063722 3300006846 Bacteria 3096
495 Ga0075430_100191502 3300006846 Bacteria 1700
496 Ga0075431_100061826 3300006847 Bacteria 3864
497 Ga0075431_100205109 3300006847 Bacteria 2016
498 Ga0075433_10001375 3300006852 Bacteria 17875
499 Ga0075433_10230264 3300006852 Bacteria 1646
500 Ga0075434_100000064 3300006871 Bacteria 54394
501 Ga0075434_100002419 3300006871 Bacteria 16392
502 Ga0075434_100193936 3300006871 Bacteria 2052
503 Ga0075429_100000480 3300006880 Bacteria 29845
504 Ga0075429_100000511 3300006880 Bacteria 29379
505 Ga0075429_100001780 3300006880 Bacteria 17837
506 Ga0068865_100000059 3300006881 Bacteria 58856
507 Ga0068865_100004033 3300006881 Bacteria 8818
508 Ga0068865_100004646 3300006881 Bacteria 8294
509 Ga0068865_100086611 3300006881 Bacteria 2262
510 Ga0075436_100000050 3300006914 Bacteria 71245
511 Ga0075436_100001875 3300006914 Bacteria 14444
512 Ga0075436_100012843 3300006914 Bacteria 5741
513 Ga0075436_100014805 3300006914 Bacteria 5344
514 Ga0075436_100046841 3300006914 Bacteria 2982
515 Ga0097620_100000149 3300006931 Bacteria 66296
516 Ga0097620_100007841 3300006931 Bacteria 10835
517 Ga0097620_100029687 3300006931 Bacteria 5487
518 Ga0097620_100037247 3300006931 Bacteria 4882
519 Ga0097620_100047142 3300006931 Bacteria 4329
520 Ga0097620_100105810 3300006931 Bacteria 2873
521 Ga0097620_100217765 3300006931 Bacteria 1997
522 Ga0099823_1000159 3300006944 Bacteria 36164
523 Ga0079104_1000001 3300006946 Bacteria 521847
524 Ga0079104_1007036 3300006946 Bacteria 4141
525 Ga0079104_1022477 3300006946 Bacteria 1696
526 Ga0099826_10000003 3300006948 Bacteria 1067817
527 Ga0075435_100001865 3300007076 Bacteria 13702
528 Ga0075435_100065736 3300007076 Bacteria 2949
529 Ga0075435_100093540 3300007076 Bacteria 2484
530 Ga0105251_10001046 3300009011 Bacteria 24248
531 Ga0105251_10001356 3300009011 Bacteria 21161
532 Ga0105251_10022391 3300009011 Bacteria 3281
533 Ga0105244_10000592 3300009036 Bacteria 32509
534 Ga0105244_10001171 3300009036 Bacteria 21696
535 Ga0105244_10004162 3300009036 Bacteria 10071
536 Ga0105240_10001607 3300009093 Bacteria 38298
537 Ga0105240_10001931 3300009093 Bacteria 34408
538 Ga0105240_10002138 3300009093 Bacteria 32275
539 Ga0105240_10005257 3300009093 Bacteria 19332
540 Ga0105240_10005432 3300009093 Bacteria 18999
541 Ga0105240_10005995 3300009093 Bacteria 17972
542 Ga0105240_10013131 3300009093 Bacteria 11396
543 Ga0105240_10022347 3300009093 Bacteria 8387
544 Ga0105240_10026304 3300009093 Bacteria 7634
545 Ga0105240_10048589 3300009093 Bacteria 5361
546 Ga0105240_10078473 3300009093 Bacteria 4066
547 Ga0105240_10164018 3300009093 Bacteria 2637
548 Ga0111539_10016839 3300009094 Bacteria 9053
549 Ga0111539_10036798 3300009094 Bacteria 5914
550 Ga0111539_10100722 3300009094 Bacteria 3392
551 Ga0105245_10000075 3300009098 Bacteria 103550
552 Ga0105245_10032246 3300009098 Bacteria 4639
553 Ga0105245_10062250 3300009098 Bacteria 3367
554 Ga0114129_10000210 3300009147 Bacteria 65476
555 Ga0114129_10002670 3300009147 Bacteria 24825
556 Ga0114129_10151522 3300009147 Bacteria 3173
557 Ga0105243_10000622 3300009148 Bacteria 35310
558 Ga0105243_10000717 3300009148 Bacteria 31849
559 Ga0105243_10004194 3300009148 Bacteria 11428
560 Ga0105243_10007352 3300009148 Bacteria 8468
561 Ga0105243_10007467 3300009148 Bacteria 8401
562 Ga0105242_10000407 3300009176 Bacteria 34281
563 Ga0105242_10009890 3300009176 Bacteria 7305
564 Ga0105248_10008736 3300009177 Bacteria 11130
565 Ga0105248_10017366 3300009177 Bacteria 7932
566 Ga0105248_10063230 3300009177 Bacteria 4154
567 Ga0105248_10066323 3300009177 Bacteria 4053
568 Ga0105248_10104261 3300009177 Bacteria 3197
569 Ga0105248_10123873 3300009177 Bacteria 2916
570 Ga0105237_10000556 3300009545 Bacteria 52272
571 Ga0105237_10007711 3300009545 Bacteria 11757
572 Ga0105237_10036643 3300009545 Bacteria 4963
573 Ga0105237_10246681 3300009545 Bacteria 1787
574 Ga0105237_10250797 3300009545 Bacteria 1772
575 Ga0105238_10000004 3300009551 Bacteria 390514
576 Ga0105238_10006909 3300009551 Bacteria 11336
577 Ga0105238_10007543 3300009551 Bacteria 10893
578 Ga0105238_10026268 3300009551 Bacteria 5935
579 Ga0105238_10027640 3300009551 Bacteria 5782
580 Ga0105238_10070671 3300009551 Bacteria 3490
581 Ga0105249_10047746 3300009553 Bacteria 3902
582 Ga0105249_10075013 3300009553 Bacteria 3132
583 Ga0105249_10080693 3300009553 Bacteria 3023
584 Ga0105249_10114522 3300009553 Bacteria 2553
585 Ga0105239_10003999 3300010375 Bacteria 17858
586 Ga0105239_10009186 3300010375 Bacteria 11180
587 Ga0105239_10009931 3300010375 Bacteria 10687
588 Ga0105239_10060840 3300010375 Bacteria 4145
589 Ga0105239_10068122 3300010375 Bacteria 3911
590 Ga0105239_10101258 3300010375 Bacteria 3187
591 Ga0105239_10120103 3300010375 Bacteria 2918
592 Ga0105239_10159066 3300010375 Bacteria 2523
593 Ga0105239_10248914 3300010375 Bacteria 1996
594 Ga0105246_10112071 3300011119 Bacteria 2006
595 Ga0157319_1000015 3300012497 Bacteria 130857
596 Ga0157373_10015749 3300013100 Bacteria 5522
597 Ga0157373_10031538 3300013100 Bacteria 3815
598 Ga0157373_10043565 3300013100 Bacteria 3206
599 Ga0157371_10000228 3300013102 Bacteria 81797
600 Ga0157370_10003689 3300013104 Bacteria 17894
601 Ga0157370_10004497 3300013104 Bacteria 15981
602 Ga0157370_10004787 3300013104 Bacteria 15389
603 Ga0157370_10008219 3300013104 Bacteria 11271
604 Ga0157370_10009919 3300013104 Bacteria 10088
605 Ga0157370_10044301 3300013104 Bacteria 4277
606 Ga0157369_10000416 3300013105 Bacteria 56361
607 Ga0157369_10001339 3300013105 Bacteria 30420
608 Ga0157369_10002445 3300013105 Bacteria 22301
609 Ga0157369_10009680 3300013105 Bacteria 11022
610 Ga0157369_10010537 3300013105 Bacteria 10523
611 Ga0157369_10010962 3300013105 Bacteria 10318
612 Ga0157369_10025224 3300013105 Bacteria 6600
613 Ga0157369_10047477 3300013105 Bacteria 4661
614 Ga0157369_10060216 3300013105 Bacteria 4094
615 Ga0157374_10000055 3300013296 Bacteria 120079
616 Ga0157374_10000204 3300013296 Bacteria 54552
617 Ga0157374_10040499 3300013296 Bacteria 4291
618 Ga0157374_10243168 3300013296 Bacteria 1770
619 Ga0157378_10000074 3300013297 Bacteria 90608
620 Ga0157378_10009359 3300013297 Bacteria 8535
621 Ga0163162_10011113 3300013306 Bacteria 8770
622 Ga0163162_10023858 3300013306 Bacteria 6036
623 Ga0157372_10001079 3300013307 Bacteria 29711
624 Ga0157372_10012931 3300013307 Bacteria 8898
625 Ga0157372_10014393 3300013307 Bacteria 8460
626 Ga0157372_10026826 3300013307 Bacteria 6271
627 Ga0157372_10027361 3300013307 Bacteria 6209
628 Ga0157375_10001806 3300013308 Bacteria 18332
629 Ga0157375_10004718 3300013308 Bacteria 11854
630 Ga0157375_10009296 3300013308 Bacteria 8627
631 Ga0157375_10029352 3300013308 Bacteria 5170
632 Ga0157375_10211826 3300013308 Bacteria 2095
633 Ga0163163_10001543 3300014325 Bacteria 19420
634 Ga0163163_10001899 3300014325 Bacteria 17673
635 Ga0163163_10075631 3300014325 Bacteria 3361
636 Ga0157380_10017092 3300014326 Bacteria 5362
637 Ga0157380_10019617 3300014326 Bacteria 5040
638 Ga0157380_10036826 3300014326 Bacteria 3788
639 Ga0182008_10001216 3300014497 Bacteria 17752
640 Ga0182008_10002832 3300014497 Bacteria 10726
641 Ga0182008_10003469 3300014497 Bacteria 9510
642 Ga0182008_10013211 3300014497 Bacteria 4342
643 Ga0182008_10061469 3300014497 Bacteria 1852
644 Ga0157377_10000032 3300014745 Bacteria 121003
645 Ga0157377_10088605 3300014745 Bacteria 1823
646 Ga0157377_10111166 3300014745 Bacteria 1647
647 Ga0157379_10000162 3300014968 Bacteria 50095
648 Ga0157379_10001262 3300014968 Bacteria 20560
649 Ga0157379_10002999 3300014968 Bacteria 14244
650 Ga0157379_10056012 3300014968 Bacteria 3524
651 Ga0157379_10057345 3300014968 Bacteria 3480
652 Ga0157379_10233282 3300014968 Bacteria 1668
653 Ga0157376_10008151 3300014969 Bacteria 7535
654 Ga0157376_10074457 3300014969 Bacteria 2894
655 Ga0157376_10087911 3300014969 Bacteria 2683
656 Ga0182006_1000046 3300015261 Bacteria 189544
657 Ga0182006_1000060 3300015261 Bacteria 161773
658 Ga0182006_1000937 3300015261 Bacteria 19449
659 Ga0182006_1023048 3300015261 Bacteria 2580
660 Ga0182006_1031361 3300015261 Bacteria 2142
661 Ga0182007_10000044 3300015262 Bacteria 106301
662 Ga0182007_10000419 3300015262 Bacteria 25979
663 Ga0182007_10002507 3300015262 Bacteria 9068
664 Ga0182007_10012132 3300015262 Bacteria 3326
665 Ga0182005_1000003 3300015265 Bacteria 683269
666 Ga0182005_1000032 3300015265 Bacteria 188517
667 Ga0182005_1000492 3300015265 Bacteria 20288
668 Ga0183362_10003 3300015683 Bacteria 977584
669 Ga0183361_10012 3300016635 Bacteria 203395
670 Ga0163161_10000564 3300017792 Bacteria 29865
671 Ga0163161_10003954 3300017792 Bacteria 10398
672 Ga0163161_10016204 3300017792 Bacteria 5202
673 Ga0163161_10030497 3300017792 Bacteria 3839
674 Ga0163161_10036569 3300017792 Bacteria 3516
675 Ga0163161_10118753 3300017792 Bacteria 1985
676 Ga0213872_10000081 3300021361 Bacteria 88397
677 Ga0213872_10000104 3300021361 Bacteria 78306
678 Ga0213872_10000713 3300021361 Bacteria 24995
679 Ga0213872_10001145 3300021361 Bacteria 18070
680 Ga0213872_10001309 3300021361 Bacteria 16550
681 Ga0213872_10002243 3300021361 Bacteria 11552
682 Ga0213876_10019645 3300021384 Bacteria 3569
683 Ga0224712_10000681 3300022467 Bacteria 6988
684 Ga0209435_100007 3300025206 Bacteria 516857
685 Ga0209435_100283 3300025206 Bacteria 12283
686 Ga0209760_101870 3300025207 Bacteria 2080
687 Ga0209436_100508 3300025208 Bacteria 17011
688 Ga0209436_100526 3300025208 Bacteria 16661
689 Ga0209436_109353 3300025208 Bacteria 1872
690 Ga0209784_100025 3300025224 Bacteria 376681
691 Ga0209784_100048 3300025224 Bacteria 198885
692 Ga0209784_100083 3300025224 Bacteria 131194
693 Ga0209566_100025 3300025225 Bacteria 376681
694 Ga0209566_100060 3300025225 Bacteria 198885
695 Ga0209566_100102 3300025225 Bacteria 131194
696 Ga0209566_102058 3300025225 Bacteria 4195
697 Ga0209674_100013 3300025226 Bacteria 813140
698 Ga0209674_100042 3300025226 Bacteria 376681
699 Ga0209674_100064 3300025226 Bacteria 265769
700 Ga0209674_100082 3300025226 Bacteria 198885
701 Ga0209674_100125 3300025226 Bacteria 131194
702 Ga0209674_100235 3300025226 Bacteria 48669
703 Ga0209672_100010 3300025228 Bacteria 873151
704 Ga0209672_100028 3300025228 Bacteria 341962
705 Ga0209672_100159 3300025228 Bacteria 57910
706 Ga0209672_101163 3300025228 Bacteria 10774
707 Ga0209147_100006 3300025229 Bacteria 873276
708 Ga0209147_100017 3300025229 Bacteria 516857
709 Ga0209147_100972 3300025229 Bacteria 12533
710 Ga0209563_100013 3300025230 Bacteria 941463
711 Ga0209563_100046 3300025230 Bacteria 376681
712 Ga0209563_100082 3300025230 Bacteria 198750
713 Ga0209563_100099 3300025230 Bacteria 153336
714 Ga0209563_100120 3300025230 Bacteria 131194
715 Ga0209563_101002 3300025230 Bacteria 8242
716 Ga0207427_100675 3300025231 Bacteria 16287
717 Ga0207427_102153 3300025231 Bacteria 5678
718 Ga0207427_106060 3300025231 Bacteria 1587
719 Ga0209437_100088 3300025233 Bacteria 251174
720 Ga0209437_100125 3300025233 Bacteria 198146
721 Ga0209437_102154 3300025233 Bacteria 3954
722 Ga0209258_100010 3300025242 Bacteria 873276
723 Ga0209258_100132 3300025242 Bacteria 175292
724 Ga0209258_100215 3300025242 Bacteria 114444
725 Ga0209258_100319 3300025242 Bacteria 74569
726 Ga0209258_100759 3300025242 Bacteria 20248
727 Ga0209258_107292 3300025242 Bacteria 1653
728 Ga0207425_1000006 3300025245 Bacteria 808854
729 Ga0207425_1000310 3300025245 Bacteria 35129
730 Ga0207425_1000663 3300025245 Bacteria 18873
731 Ga0207425_1005212 3300025245 Bacteria 3738
732 Ga0209646_1000044 3300025246 Bacteria 334596
733 Ga0209646_1000047 3300025246 Bacteria 323416
734 Ga0209646_1000060 3300025246 Bacteria 256386
735 Ga0209646_1000282 3300025246 Bacteria 44376
736 Ga0209646_1000287 3300025246 Bacteria 43455
737 Ga0209026_1000049 3300025250 Bacteria 255273
738 Ga0209026_1000353 3300025250 Bacteria 43358
739 Ga0209026_1000695 3300025250 Bacteria 19965
740 Ga0209677_100027 3300025253 Bacteria 376681
741 Ga0209677_100046 3300025253 Bacteria 198287
742 Ga0209677_100076 3300025253 Bacteria 131194
743 Ga0209677_100331 3300025253 Bacteria 30340
744 Ga0209148_1000007 3300025254 Bacteria 1592273
745 Ga0209148_1000081 3300025254 Bacteria 273676
746 Ga0209148_1000189 3300025254 Bacteria 116838
747 Ga0209759_1000192 3300025256 Bacteria 97685
748 Ga0209759_1000255 3300025256 Bacteria 78459
749 Ga0209759_1000272 3300025256 Bacteria 73495
750 Ga0209759_1000388 3300025256 Bacteria 54852
751 Ga0209759_1000406 3300025256 Bacteria 53034
752 Ga0209759_1000580 3300025256 Bacteria 36036
753 Ga0209759_1000994 3300025256 Bacteria 19456
754 Ga0209129_1000009 3300025258 Bacteria 633100
755 Ga0209129_1000084 3300025258 Bacteria 182554
756 Ga0209129_1000342 3300025258 Bacteria 40192
757 Ga0209233_1000138 3300025261 Bacteria 198287
758 Ga0209233_1000244 3300025261 Bacteria 90133
759 Ga0209565_1000006 3300025263 Bacteria 897294
760 Ga0209565_1000169 3300025263 Bacteria 84839
761 Ga0209565_1000200 3300025263 Bacteria 71490
762 Ga0209565_1000364 3300025263 Bacteria 38944
763 Ga0209565_1000456 3300025263 Bacteria 31480
764 Ga0209565_1006471 3300025263 Bacteria 3281
765 Ga0209565_1007556 3300025263 Bacteria 2921
766 Ga0209455_1000050 3300025272 Bacteria 373239
767 Ga0209455_1000051 3300025272 Bacteria 369818
768 Ga0209455_1000157 3300025272 Bacteria 119719
769 Ga0209455_1000162 3300025272 Bacteria 116963
770 Ga0209455_1002735 3300025272 Bacteria 6619
771 Ga0209673_1000004 3300025273 Bacteria 896155
772 Ga0209673_1000009 3300025273 Bacteria 620735
773 Ga0209673_1000012 3300025273 Bacteria 579480
774 Ga0209673_1000038 3300025273 Bacteria 312957
775 Ga0209673_1000114 3300025273 Bacteria 178557
776 Ga0209673_1000916 3300025273 Bacteria 37512
777 Ga0209673_1003435 3300025273 Bacteria 9352
778 Ga0209673_1007274 3300025273 Bacteria 5141
779 Ga0209673_1014384 3300025273 Bacteria 3063
780 Ga0209673_1017824 3300025273 Bacteria 2606
781 Ga0209130_1000437 3300025284 Bacteria 44427
782 Ga0209130_1000621 3300025284 Bacteria 33935
783 Ga0209130_1001722 3300025284 Bacteria 13115
784 Ga0209130_1002100 3300025284 Bacteria 10662
785 Ga0209130_1004203 3300025284 Bacteria 5613
786 Ga0209130_1007953 3300025284 Bacteria 3196
787 Ga0209130_1013792 3300025284 Bacteria 2056
788 Ga0209675_1000006 3300025291 Bacteria 732267
789 Ga0209675_1000062 3300025291 Bacteria 178557
790 Ga0209675_1000144 3300025291 Bacteria 94908
791 Ga0209675_1000890 3300025291 Bacteria 19177
792 Ga0209675_1001396 3300025291 Bacteria 14032
793 Ga0209675_1001454 3300025291 Bacteria 13668
794 Ga0209675_1002861 3300025291 Bacteria 8569
795 Ga0209675_1008682 3300025291 Bacteria 3693
796 Ga0209675_1015654 3300025291 Bacteria 2241
797 Ga0209676_1000051 3300025292 Bacteria 389016
798 Ga0209676_1000817 3300025292 Bacteria 40674
799 Ga0209676_1000999 3300025292 Bacteria 33230
800 Ga0209676_1001040 3300025292 Bacteria 32079
801 Ga0209676_1003523 3300025292 Bacteria 9547
802 Ga0209676_1006824 3300025292 Bacteria 5536
803 Ga0209676_1036809 3300025292 Bacteria 1419
804 Ga0209025_1000071 3300025294 Bacteria 287297
805 Ga0209025_1000678 3300025294 Bacteria 58460
806 Ga0209025_1000719 3300025294 Bacteria 56292
807 Ga0209025_1000861 3300025294 Bacteria 47942
808 Ga0209025_1005452 3300025294 Bacteria 10371
809 Ga0209025_1013789 3300025294 Bacteria 5044
810 Ga0209564_1000006 3300025295 Bacteria 1100927
811 Ga0209564_1000008 3300025295 Bacteria 953227
812 Ga0209564_1000085 3300025295 Bacteria 251509
813 Ga0209564_1000136 3300025295 Bacteria 185198
814 Ga0209564_1000146 3300025295 Bacteria 174811
815 Ga0209564_1000595 3300025295 Bacteria 56670
816 Ga0209564_1001058 3300025295 Bacteria 33490
817 Ga0209564_1001096 3300025295 Bacteria 32208
818 Ga0209564_1002960 3300025295 Bacteria 12246
819 Ga0209564_1003895 3300025295 Bacteria 9588
820 Ga0209564_1005340 3300025295 Bacteria 7378
821 Ga0209564_1024278 3300025295 Bacteria 2076
822 Ga0209758_1000045 3300025297 Bacteria 369174
823 Ga0209758_1000047 3300025297 Bacteria 360971
824 Ga0209758_1000275 3300025297 Bacteria 102404
825 Ga0209758_1000754 3300025297 Bacteria 46944
826 Ga0209758_1002048 3300025297 Bacteria 21627
827 Ga0209758_1005541 3300025297 Bacteria 9635
828 Ga0209758_1041057 3300025297 Bacteria 1735
829 Ga0209050_1000044 3300025298 Bacteria 391114
830 Ga0209050_1000052 3300025298 Bacteria 351785
831 Ga0209050_1000064 3300025298 Bacteria 314803
832 Ga0209050_1002554 3300025298 Bacteria 15213
833 Ga0209050_1002889 3300025298 Bacteria 13565
834 Ga0209050_1003404 3300025298 Bacteria 11791
835 Ga0209050_1004206 3300025298 Bacteria 9954
836 Ga0209050_1006424 3300025298 Bacteria 6965
837 Ga0209050_1025088 3300025298 Bacteria 2038
838 Ga0209256_1000003 3300025299 Bacteria 1661127
839 Ga0209256_1000013 3300025299 Bacteria 689442
840 Ga0209256_1000015 3300025299 Bacteria 622953
841 Ga0209256_1000179 3300025299 Bacteria 123865
842 Ga0209256_1000206 3300025299 Bacteria 111425
843 Ga0209256_1000239 3300025299 Bacteria 97580
844 Ga0209256_1000394 3300025299 Bacteria 69416
845 Ga0209256_1000428 3300025299 Bacteria 66020
846 Ga0209256_1020139 3300025299 Bacteria 2094
847 Ga0209256_1024797 3300025299 Bacteria 1759
848 Ga0207426_1000037 3300025302 Bacteria 442735
849 Ga0207426_1000049 3300025302 Bacteria 401954
850 Ga0207426_1000086 3300025302 Bacteria 292089
851 Ga0207426_1000346 3300025302 Bacteria 85832
852 Ga0207426_1002247 3300025302 Bacteria 12823
853 Ga0207426_1002871 3300025302 Bacteria 10224
854 Ga0207426_1003558 3300025302 Bacteria 8300
855 Ga0209051_1000015 3300025303 Bacteria 546798
856 Ga0209051_1000022 3300025303 Bacteria 474879
857 Ga0209051_1000025 3300025303 Bacteria 415397
858 Ga0209051_1000031 3300025303 Bacteria 391114
859 Ga0209051_1000420 3300025303 Bacteria 58383
860 Ga0209051_1000824 3300025303 Bacteria 32075
861 Ga0209051_1001151 3300025303 Bacteria 24034
862 Ga0209051_1001627 3300025303 Bacteria 18254
863 Ga0209051_1002289 3300025303 Bacteria 13991
864 Ga0209051_1003446 3300025303 Bacteria 10364
865 Ga0209051_1007105 3300025303 Bacteria 6186
866 Ga0209257_1000010 3300025304 Bacteria 1158682
867 Ga0209257_1000030 3300025304 Bacteria 689812
868 Ga0209257_1000037 3300025304 Bacteria 612915
869 Ga0209257_1000039 3300025304 Bacteria 591694
870 Ga0209257_1000053 3300025304 Bacteria 425160
871 Ga0209257_1000058 3300025304 Bacteria 381686
872 Ga0209257_1000977 3300025304 Bacteria 38863
873 Ga0209257_1001416 3300025304 Bacteria 28573
874 Ga0209257_1001902 3300025304 Bacteria 22569
875 Ga0209257_1004064 3300025304 Bacteria 11744
876 Ga0209257_1007014 3300025304 Bacteria 6989
877 Ga0209257_1013116 3300025304 Bacteria 3730
878 Ga0207697_10000237 3300025315 Bacteria 30060
879 Ga0207697_10038421 3300025315 Bacteria 1963
880 Ga0207697_10050144 3300025315 Bacteria 1723
881 Ga0207656_10000916 3300025321 Bacteria 9617
882 Ga0207656_10004511 3300025321 Bacteria 4869
883 Ga0207655_1001268 3300025728 Bacteria 24088
884 Ga0207713_1000247 3300025735 Bacteria 68982
885 Ga0207713_1004054 3300025735 Bacteria 9671
886 Ga0207682_10000059 3300025893 Bacteria 48172
887 Ga0207682_10000203 3300025893 Bacteria 26888
888 Ga0207692_10023582 3300025898 Bacteria 2848
889 Ga0207642_10008102 3300025899 Bacteria 3587
890 Ga0207642_10023475 3300025899 Bacteria 2464
891 Ga0207642_10040727 3300025899 Bacteria 2029
892 Ga0207688_10000362 3300025901 Bacteria 21159
893 Ga0207688_10067511 3300025901 Bacteria 2024
894 Ga0207688_10085517 3300025901 Bacteria 1806
895 Ga0207680_10029359 3300025903 Bacteria 3088
896 Ga0207680_10077724 3300025903 Bacteria 2077
897 Ga0207680_10152371 3300025903 Bacteria 1542
898 Ga0207647_10000869 3300025904 Bacteria 23399
899 Ga0207647_10011104 3300025904 Bacteria 6327
900 Ga0207647_10018831 3300025904 Bacteria 4656
901 Ga0207647_10033510 3300025904 Bacteria 3289
902 Ga0207699_10076602 3300025906 Bacteria 2061
903 Ga0207645_10000407 3300025907 Bacteria 35586
904 Ga0207645_10006246 3300025907 Bacteria 8560
905 Ga0207645_10014272 3300025907 Bacteria 5321
906 Ga0207645_10016625 3300025907 Bacteria 4867
907 Ga0207645_10061783 3300025907 Bacteria 2393
908 Ga0207643_10005194 3300025908 Bacteria 6965
909 Ga0207643_10009218 3300025908 Bacteria 5300
910 Ga0207643_10012148 3300025908 Bacteria 4654
911 Ga0207705_10000221 3300025909 Bacteria 56813
912 Ga0207705_10032643 3300025909 Bacteria 3721
913 Ga0207705_10109006 3300025909 Bacteria 2044
914 Ga0207684_10034034 3300025910 Bacteria 4331
915 Ga0207684_10054565 3300025910 Bacteria 3391
916 Ga0207684_10159246 3300025910 Bacteria 1943
917 Ga0207654_10008442 3300025911 Bacteria 5208
918 Ga0207654_10074864 3300025911 Bacteria 2022
919 Ga0207707_10008467 3300025912 Bacteria 8918
920 Ga0207707_10010999 3300025912 Bacteria 7874
921 Ga0207707_10040701 3300025912 Bacteria 4058
922 Ga0207707_10043068 3300025912 Bacteria 3939
923 Ga0207707_10085847 3300025912 Bacteria 2750
924 Ga0207707_10187953 3300025912 Bacteria 1802
925 Ga0207695_10000392 3300025913 Bacteria 98469
926 Ga0207695_10000965 3300025913 Bacteria 51285
927 Ga0207695_10003357 3300025913 Bacteria 22617
928 Ga0207695_10004740 3300025913 Bacteria 18409
929 Ga0207695_10008486 3300025913 Bacteria 12850
930 Ga0207695_10015091 3300025913 Bacteria 9113
931 Ga0207695_10023026 3300025913 Bacteria 7052
932 Ga0207695_10140627 3300025913 Bacteria 2363
933 Ga0207671_10001994 3300025914 Bacteria 22499
934 Ga0207671_10004733 3300025914 Bacteria 12846
935 Ga0207671_10009196 3300025914 Bacteria 8287
936 Ga0207671_10069753 3300025914 Bacteria 2619
937 Ga0207671_10102730 3300025914 Bacteria 2167
938 Ga0207671_10128700 3300025914 Bacteria 1942
939 Ga0207671_10159085 3300025914 Bacteria 1748
940 Ga0207693_10029267 3300025915 Bacteria 4352
941 Ga0207663_10123805 3300025916 Bacteria 1775
942 Ga0207660_10005914 3300025917 Bacteria 7945
943 Ga0207660_10072015 3300025917 Bacteria 2516
944 Ga0207660_10104478 3300025917 Bacteria 2121
945 Ga0207662_10000166 3300025918 Bacteria 31376
946 Ga0207662_10044611 3300025918 Bacteria 2618
947 Ga0207657_10000064 3300025919 Bacteria 99069
948 Ga0207657_10000350 3300025919 Bacteria 48975
949 Ga0207657_10002549 3300025919 Bacteria 19699
950 Ga0207657_10004640 3300025919 Bacteria 14511
951 Ga0207657_10012339 3300025919 Bacteria 8438
952 Ga0207657_10023410 3300025919 Bacteria 5751
953 Ga0207657_10177253 3300025919 Bacteria 1724
954 Ga0207649_10001361 3300025920 Bacteria 14506
955 Ga0207649_10004347 3300025920 Bacteria 7691
956 Ga0207649_10009525 3300025920 Bacteria 5317
957 Ga0207649_10017583 3300025920 Bacteria 4053
958 Ga0207652_10010094 3300025921 Bacteria 7608
959 Ga0207652_10015678 3300025921 Bacteria 6171
960 Ga0207652_10021072 3300025921 Bacteria 5377
961 Ga0207646_10035752 3300025922 Bacteria 4485
962 Ga0207646_10077412 3300025922 Bacteria 2972
963 Ga0207681_10002154 3300025923 Bacteria 12555
964 Ga0207681_10012285 3300025923 Bacteria 5282
965 Ga0207681_10070545 3300025923 Bacteria 2433
966 Ga0207694_10000021 3300025924 Bacteria 300246
967 Ga0207694_10006495 3300025924 Bacteria 8897
968 Ga0207694_10007840 3300025924 Bacteria 8085
969 Ga0207694_10027000 3300025924 Bacteria 4371
970 Ga0207694_10069262 3300025924 Bacteria 2756
971 Ga0207694_10079288 3300025924 Bacteria 2575
972 Ga0207694_10169174 3300025924 Bacteria 1769
973 Ga0207650_10002859 3300025925 Bacteria 11921
974 Ga0207650_10003696 3300025925 Bacteria 10462
975 Ga0207650_10004599 3300025925 Bacteria 9438
976 Ga0207650_10013196 3300025925 Bacteria 5719
977 Ga0207650_10029456 3300025925 Bacteria 3947
978 Ga0207650_10039595 3300025925 Bacteria 3444
979 Ga0207650_10050937 3300025925 Bacteria 3063
980 Ga0207650_10052579 3300025925 Bacteria 3018
981 Ga0207659_10001339 3300025926 Bacteria 14748
982 Ga0207659_10003636 3300025926 Bacteria 9288
983 Ga0207659_10004850 3300025926 Bacteria 8151
984 Ga0207659_10007572 3300025926 Bacteria 6689
985 Ga0207659_10066524 3300025926 Bacteria 2616
986 Ga0207659_10072969 3300025926 Bacteria 2511
987 Ga0207659_10141085 3300025926 Bacteria 1871
988 Ga0207687_10004570 3300025927 Bacteria 9210
989 Ga0207687_10073561 3300025927 Bacteria 2447
990 Ga0207700_10000084 3300025928 Bacteria 58386
991 Ga0207664_10000818 3300025929 Bacteria 21096
992 Ga0207664_10003381 3300025929 Bacteria 10612
993 Ga0207664_10082561 3300025929 Bacteria 2618
994 Ga0207664_10168082 3300025929 Bacteria 1875
995 Ga0207644_10000788 3300025931 Bacteria 20104
996 Ga0207644_10000991 3300025931 Bacteria 18125
997 Ga0207644_10022346 3300025931 Bacteria 4321
998 Ga0207644_10044579 3300025931 Bacteria 3151
999 Ga0207644_10053037 3300025931 Bacteria 2917
1000 Ga0207644_10062043 3300025931 Bacteria 2709
1001 Ga0207690_10000060 3300025932 Bacteria 99148
1002 Ga0207690_10000837 3300025932 Bacteria 19691
1003 Ga0207690_10001117 3300025932 Bacteria 17115
1004 Ga0207690_10001370 3300025932 Bacteria 15294
1005 Ga0207690_10003937 3300025932 Bacteria 8783
1006 Ga0207690_10006220 3300025932 Bacteria 7069
1007 Ga0207690_10010413 3300025932 Bacteria 5525
1008 Ga0207690_10015809 3300025932 Bacteria 4580
1009 Ga0207706_10000014 3300025933 Bacteria 177082
1010 Ga0207706_10000486 3300025933 Bacteria 42324
1011 Ga0207706_10001200 3300025933 Bacteria 26157
1012 Ga0207706_10008543 3300025933 Bacteria 9436
1013 Ga0207706_10021040 3300025933 Bacteria 5860
1014 Ga0207706_10023757 3300025933 Bacteria 5500
1015 Ga0207706_10153242 3300025933 Bacteria 2027
1016 Ga0207686_10000243 3300025934 Bacteria 41698
1017 Ga0207686_10019577 3300025934 Bacteria 3853
1018 Ga0207709_10000572 3300025935 Bacteria 31041
1019 Ga0207709_10000973 3300025935 Bacteria 21397
1020 Ga0207709_10001051 3300025935 Bacteria 20412
1021 Ga0207709_10001477 3300025935 Bacteria 16306
1022 Ga0207709_10003870 3300025935 Bacteria 8765
1023 Ga0207709_10026705 3300025935 Bacteria 3319
1024 Ga0207709_10121083 3300025935 Bacteria 1766
1025 Ga0207669_10015701 3300025937 Bacteria 3826
1026 Ga0207669_10036718 3300025937 Bacteria 2803
1027 Ga0207669_10043574 3300025937 Bacteria 2629
1028 Ga0207704_10000178 3300025938 Bacteria 33463
1029 Ga0207704_10002073 3300025938 Bacteria 8974
1030 Ga0207704_10007005 3300025938 Bacteria 5296
1031 Ga0207704_10046347 3300025938 Bacteria 2590
1032 Ga0207691_10000999 3300025940 Bacteria 28088
1033 Ga0207691_10001188 3300025940 Bacteria 25899
1034 Ga0207691_10003049 3300025940 Bacteria 16339
1035 Ga0207691_10004275 3300025940 Bacteria 13875
1036 Ga0207691_10004379 3300025940 Bacteria 13691
1037 Ga0207691_10023447 3300025940 Bacteria 5810
1038 Ga0207691_10034121 3300025940 Bacteria 4735
1039 Ga0207691_10064915 3300025940 Bacteria 3306
1040 Ga0207711_10003826 3300025941 Bacteria 12946
1041 Ga0207711_10013604 3300025941 Bacteria 6760
1042 Ga0207711_10013970 3300025941 Bacteria 6670
1043 Ga0207711_10015597 3300025941 Bacteria 6306
1044 Ga0207711_10055369 3300025941 Bacteria 3405
1045 Ga0207711_10097044 3300025941 Bacteria 2602
1046 Ga0207689_10000007 3300025942 Bacteria 132362
1047 Ga0207689_10000468 3300025942 Bacteria 37877
1048 Ga0207689_10002668 3300025942 Bacteria 16491
1049 Ga0207689_10003183 3300025942 Bacteria 15056
1050 Ga0207689_10005832 3300025942 Bacteria 10920
1051 Ga0207689_10016990 3300025942 Bacteria 6157
1052 Ga0207689_10021262 3300025942 Bacteria 5455
1053 Ga0207689_10023226 3300025942 Bacteria 5207
1054 Ga0207689_10042007 3300025942 Bacteria 3784
1055 Ga0207661_10035912 3300025944 Bacteria 3865
1056 Ga0207661_10131494 3300025944 Bacteria 2144
1057 Ga0207661_10132612 3300025944 Bacteria 2136
1058 Ga0207679_10000313 3300025945 Bacteria 36405
1059 Ga0207679_10000678 3300025945 Bacteria 22830
1060 Ga0207679_10009139 3300025945 Bacteria 6336
1061 Ga0207679_10176575 3300025945 Bacteria 1764
1062 Ga0207667_10001506 3300025949 Bacteria 29228
1063 Ga0207667_10002443 3300025949 Bacteria 23225
1064 Ga0207667_10009870 3300025949 Bacteria 11204
1065 Ga0207667_10021484 3300025949 Bacteria 7150
1066 Ga0207667_10021577 3300025949 Bacteria 7134
1067 Ga0207667_10054734 3300025949 Bacteria 4196
1068 Ga0207667_10086791 3300025949 Bacteria 3237
1069 Ga0207667_10153575 3300025949 Bacteria 2369
1070 Ga0207667_10165965 3300025949 Bacteria 2270
1071 Ga0207651_10000702 3300025960 Bacteria 14340
1072 Ga0207651_10012010 3300025960 Bacteria 4877
1073 Ga0207651_10018792 3300025960 Bacteria 4124
1074 Ga0207651_10024085 3300025960 Bacteria 3758
1075 Ga0207651_10028559 3300025960 Bacteria 3521
1076 Ga0207651_10041598 3300025960 Bacteria 3052
1077 Ga0207651_10062187 3300025960 Bacteria 2600
1078 Ga0207651_10157235 3300025960 Bacteria 1777
1079 Ga0207712_10025918 3300025961 Bacteria 3900
1080 Ga0207668_10002434 3300025972 Bacteria 10869
1081 Ga0207668_10006446 3300025972 Bacteria 6937
1082 Ga0207668_10017135 3300025972 Bacteria 4533
1083 Ga0207668_10030736 3300025972 Bacteria 3532
1084 Ga0207668_10037481 3300025972 Bacteria 3245
1085 Ga0207640_10008146 3300025981 Bacteria 5806
1086 Ga0207640_10026816 3300025981 Bacteria 3503
1087 Ga0207640_10037337 3300025981 Bacteria 3055
1088 Ga0207658_10006538 3300025986 Bacteria 7949
1089 Ga0207658_10013489 3300025986 Bacteria 5584
1090 Ga0207658_10021068 3300025986 Bacteria 4520
1091 Ga0207658_10024430 3300025986 Bacteria 4228
1092 Ga0207658_10032769 3300025986 Bacteria 3701
1093 Ga0207658_10033878 3300025986 Bacteria 3646
1094 Ga0207658_10111265 3300025986 Bacteria 2166
1095 Ga0207658_10167872 3300025986 Bacteria 1805
1096 Ga0207677_10001848 3300026023 Bacteria 11189
1097 Ga0207677_10015850 3300026023 Bacteria 4447
1098 Ga0207677_10028650 3300026023 Bacteria 3526
1099 Ga0207677_10030690 3300026023 Bacteria 3434
1100 Ga0207677_10040016 3300026023 Bacteria 3087
1101 Ga0207703_10001949 3300026035 Bacteria 18232
1102 Ga0207703_10009460 3300026035 Bacteria 7653
1103 Ga0207703_10019745 3300026035 Bacteria 5268
1104 Ga0207703_10022790 3300026035 Bacteria 4918
1105 Ga0207703_10023940 3300026035 Bacteria 4803
1106 Ga0207703_10049969 3300026035 Bacteria 3382
1107 Ga0207703_10061814 3300026035 Bacteria 3067
1108 Ga0207639_10008896 3300026041 Bacteria 6906
1109 Ga0207639_10018099 3300026041 Bacteria 5000
1110 Ga0207639_10020836 3300026041 Bacteria 4700
1111 Ga0207639_10061501 3300026041 Bacteria 2901
1112 Ga0207678_10000233 3300026067 Bacteria 49821
1113 Ga0207678_10000684 3300026067 Bacteria 31001
1114 Ga0207678_10001272 3300026067 Bacteria 23314
1115 Ga0207678_10007290 3300026067 Bacteria 9801
1116 Ga0207678_10021085 3300026067 Bacteria 5712
1117 Ga0207678_10027958 3300026067 Bacteria 4924
1118 Ga0207678_10028754 3300026067 Bacteria 4853
1119 Ga0207678_10029511 3300026067 Bacteria 4787
1120 Ga0207678_10048915 3300026067 Bacteria 3653
1121 Ga0207678_10194796 3300026067 Bacteria 1732
1122 Ga0207708_10000086 3300026075 Bacteria 73314
1123 Ga0207708_10000650 3300026075 Bacteria 26677
1124 Ga0207708_10000697 3300026075 Bacteria 25504
1125 Ga0207702_10000395 3300026078 Bacteria 49788
1126 Ga0207702_10006552 3300026078 Bacteria 10017
1127 Ga0207702_10016238 3300026078 Bacteria 6161
1128 Ga0207702_10019576 3300026078 Bacteria 5601
1129 Ga0207641_10008893 3300026088 Bacteria 8294
1130 Ga0207641_10013468 3300026088 Bacteria 6706
1131 Ga0207641_10029679 3300026088 Bacteria 4523
1132 Ga0207641_10041178 3300026088 Bacteria 3871
1133 Ga0207641_10043883 3300026088 Bacteria 3757
1134 Ga0207641_10044803 3300026088 Bacteria 3721
1135 Ga0207641_10059200 3300026088 Bacteria 3261
1136 Ga0207641_10065646 3300026088 Bacteria 3105
1137 Ga0207648_10000079 3300026089 Bacteria 92044
1138 Ga0207648_10000352 3300026089 Bacteria 50550
1139 Ga0207648_10000716 3300026089 Bacteria 37200
1140 Ga0207648_10000790 3300026089 Bacteria 35657
1141 Ga0207648_10001780 3300026089 Bacteria 23603
1142 Ga0207648_10001903 3300026089 Bacteria 22822
1143 Ga0207648_10035427 3300026089 Bacteria 4397
1144 Ga0207648_10046721 3300026089 Bacteria 3796
1145 Ga0207648_10264375 3300026089 Bacteria 1536
1146 Ga0207676_10008944 3300026095 Bacteria 7126
1147 Ga0207676_10011836 3300026095 Bacteria 6242
1148 Ga0207676_10040308 3300026095 Bacteria 3579
1149 Ga0207676_10042494 3300026095 Bacteria 3497
1150 Ga0207676_10045701 3300026095 Bacteria 3384
1151 Ga0207676_10133636 3300026095 Bacteria 2113
1152 Ga0207676_10136891 3300026095 Bacteria 2091
1153 Ga0207676_10224750 3300026095 Bacteria 1674
1154 Ga0207674_10000020 3300026116 Bacteria 162474
1155 Ga0207674_10000769 3300026116 Bacteria 41860
1156 Ga0207674_10003791 3300026116 Bacteria 18445
1157 Ga0207674_10007069 3300026116 Bacteria 13119
1158 Ga0207674_10023942 3300026116 Bacteria 6531
1159 Ga0207674_10038567 3300026116 Bacteria 4956
1160 Ga0207675_100000093 3300026118 Bacteria 70343
1161 Ga0207675_100000378 3300026118 Bacteria 42672
1162 Ga0207675_100000802 3300026118 Bacteria 31217
1163 Ga0207675_100003290 3300026118 Bacteria 15823
1164 Ga0207675_100007853 3300026118 Bacteria 10066
1165 Ga0207675_100057991 3300026118 Bacteria 3614
1166 Ga0207683_10000170 3300026121 Bacteria 56059
1167 Ga0207683_10002101 3300026121 Bacteria 17552
1168 Ga0207683_10004396 3300026121 Bacteria 12182
1169 Ga0207683_10011441 3300026121 Bacteria 7572
1170 Ga0207683_10077452 3300026121 Bacteria 2945
1171 Ga0207683_10115081 3300026121 Bacteria 2411
1172 Ga0207683_10141856 3300026121 Bacteria 2165
1173 Ga0207683_10276620 3300026121 Bacteria 1534
1174 Ga0207698_10003199 3300026142 Bacteria 9829
1175 Ga0207698_10004724 3300026142 Bacteria 8332
1176 Ga0207698_10006485 3300026142 Bacteria 7305
1177 Ga0207698_10024475 3300026142 Bacteria 4238
1178 Ga0207698_10026941 3300026142 Bacteria 4073
1179 Ga0207698_10029861 3300026142 Bacteria 3911
1180 Ga0207698_10094438 3300026142 Bacteria 2459
1181 Ga0207698_10121549 3300026142 Bacteria 2211
1182 Ga0207698_10209038 3300026142 Bacteria 1754
1183 Ga0209281_1000057 3300027111 Bacteria 307145
1184 Ga0209281_1006140 3300027111 Bacteria 3181
1185 Ga0209389_1026537 3300027296 Bacteria 5016
1186 Ga0209371_1000114 3300027312 Bacteria 139090
1187 Ga0209371_1001990 3300027312 Bacteria 12330
1188 Ga0209371_1005713 3300027312 Bacteria 4854
1189 Ga0209967_1004931 3300027364 Bacteria 1785
1190 Ga0209981_1004790 3300027378 Bacteria 1784
1191 Ga0209996_1002490 3300027395 Bacteria 2280
1192 Ga0209996_1004280 3300027395 Bacteria 1815
1193 Ga0209995_1004652 3300027471 Bacteria 2199
1194 Ga0209968_1000857 3300027526 Bacteria 4719
1195 Ga0209968_1006121 3300027526 Bacteria 1811
1196 Ga0209999_1002904 3300027543 Bacteria 3042
1197 Ga0209999_1004097 3300027543 Bacteria 2620
1198 Ga0209983_1003964 3300027665 Bacteria 3127
1199 Ga0209282_1000002 3300027666 Bacteria 1067825
1200 Ga0209971_1007688 3300027682 Bacteria 2558
1201 Ga0209971_1013112 3300027682 Bacteria 1965
1202 Ga0209971_1017142 3300027682 Bacteria 1718
1203 Ga0209966_1000138 3300027695 Bacteria 30805
1204 Ga0209966_1007455 3300027695 Bacteria 1919
1205 Ga0209813_10008471 3300027866 Bacteria 2600
1206 Ga0209974_10039970 3300027876 Bacteria 1560
1207 Ga0207428_10000321 3300027907 Bacteria 62664
1208 Ga0207428_10031423 3300027907 Bacteria 4379
1209 Ga0207428_10064540 3300027907 Bacteria 2890
1210 Ga0207428_10134229 3300027907 Bacteria 1893
1211 Ga0268266_10003715 3300028379 Bacteria 15019
1212 Ga0268266_10014332 3300028379 Bacteria 6817
1213 Ga0268266_10107471 3300028379 Bacteria 2467
1214 Ga0268265_10001027 3300028380 Bacteria 25172
1215 Ga0268265_10003358 3300028380 Bacteria 11562
1216 Ga0268265_10025603 3300028380 Bacteria 4191
1217 Ga0268265_10048781 3300028380 Bacteria 3181
1218 Ga0268265_10054205 3300028380 Bacteria 3041
1219 Ga0268265_10090837 3300028380 Bacteria 2440
1220 Ga0268265_10122718 3300028380 Bacteria 2143
1221 Ga0268264_10001077 3300028381 Bacteria 27026
1222 Ga0268264_10001231 3300028381 Bacteria 24597
1223 Ga0268264_10004863 3300028381 Bacteria 11381
1224 Ga0268264_10007640 3300028381 Bacteria 9011
1225 Ga0268264_10007924 3300028381 Bacteria 8838
1226 Ga0268264_10154094 3300028381 Bacteria 2063
1227 Ga0265336_10000040 3300028666 Bacteria 138266
1228 Ga0307515_10000080 3300028794 Bacteria 224941
1229 Ga0307515_10000278 3300028794 Bacteria 125493
1230 Ga0307515_10001625 3300028794 Bacteria 50019
1231 Ga0307515_10005665 3300028794 Bacteria 25226
1232 Ga0307515_10082381 3300028794 Bacteria 4163
1233 Ga0307515_10093201 3300028794 Bacteria 3738
1234 Ga0307515_10113995 3300028794 Bacteria 3128
1235 Ga0265338_10000409 3300028800 Bacteria 76989
1236 Ga0265324_10006429 3300029957 Bacteria 4901
1237 Ga0268256_1000177 3300030500 Bacteria 75500
1238 Ga0268256_1001738 3300030500 Bacteria 12330
1239 Ga0268256_1007033 3300030500 Bacteria 4085
1240 Ga0268256_1020993 3300030500 Bacteria 1748
1241 Ga0307511_10038018 3300030521 Bacteria 4144
1242 Ga0314311_1020849 3300030733 Bacteria 6091
1243 Ga0316183_1016227 3300030742 Bacteria 5537
1244 Ga0265330_10000044 3300031235 Bacteria 113679
1245 Ga0265330_10000832 3300031235 Bacteria 19375
1246 Ga0265330_10041829 3300031235 Bacteria 2031
1247 Ga0265332_10000023 3300031238 Bacteria 211994
1248 Ga0265332_10000046 3300031238 Bacteria 113777
1249 Ga0265332_10000286 3300031238 Bacteria 39704
1250 Ga0265332_10000449 3300031238 Bacteria 28929
1251 Ga0265332_10004610 3300031238 Bacteria 6449
1252 Ga0265332_10006133 3300031238 Bacteria 5485
1253 Ga0265328_10000223 3300031239 Bacteria 25984
1254 Ga0265328_10008157 3300031239 Bacteria 4335
1255 Ga0265328_10010974 3300031239 Bacteria 3631
1256 Ga0265325_10008283 3300031241 Bacteria 6141
1257 Ga0265329_10002563 3300031242 Bacteria 8198
1258 Ga0265331_10000259 3300031250 Bacteria 60879
1259 Ga0265331_10003487 3300031250 Bacteria 10140
1260 Ga0265331_10004055 3300031250 Bacteria 9217
1261 Ga0265331_10013276 3300031250 Bacteria 4435
1262 Ga0265327_10000178 3300031251 Bacteria 135732
1263 Ga0265327_10000475 3300031251 Bacteria 70831
1264 Ga0265327_10000491 3300031251 Bacteria 69450
1265 Ga0265327_10000595 3300031251 Bacteria 60289
1266 Ga0265327_10004926 3300031251 Bacteria 11504
1267 Ga0265327_10007227 3300031251 Bacteria 8624
1268 Ga0265327_10010623 3300031251 Bacteria 6445
1269 Ga0265327_10034612 3300031251 Bacteria 2801
1270 Ga0265327_10036734 3300031251 Bacteria 2689
1271 Ga0265316_10000180 3300031344 Bacteria 71764
1272 Ga0265316_10007895 3300031344 Bacteria 9959
1273 Ga0265316_10040479 3300031344 Bacteria 3736
1274 Ga0265316_10163950 3300031344 Bacteria 1661
1275 Ga0307513_10003483 3300031456 Bacteria 21298
1276 Ga0307513_10025212 3300031456 Bacteria 6896
1277 Ga0307513_10119363 3300031456 Bacteria 2609
1278 Ga0307509_10000009 3300031507 Bacteria 350890
1279 Ga0307509_10227077 3300031507 Bacteria 1674
1280 Ga0307408_100000023 3300031548 Bacteria 295931
1281 Ga0307408_100000120 3300031548 Bacteria 85916
1282 Ga0307408_100000229 3300031548 Bacteria 59103
1283 Ga0307408_100000311 3300031548 Bacteria 46654
1284 Ga0307408_100001734 3300031548 Bacteria 15949
1285 Ga0307408_100007808 3300031548 Bacteria 7071
1286 Ga0307408_100020155 3300031548 Bacteria 4495
1287 Ga0307408_100030047 3300031548 Bacteria 3770
1288 Ga0307408_100070284 3300031548 Bacteria 2584
1289 Ga0307408_100080507 3300031548 Bacteria 2433
1290 Ga0307408_100128374 3300031548 Bacteria 1975
1291 Ga0307408_100184344 3300031548 Bacteria 1676
1292 Ga0307514_10000850 3300031649 Bacteria 49169
1293 Ga0307514_10002962 3300031649 Bacteria 16858
1294 Ga0316575_10036668 3300031665 Bacteria 1929
1295 Ga0316575_10067404 3300031665 Bacteria 1434
1296 Ga0316579_10000567 3300031691 Bacteria 12322
1297 Ga0316579_10009350 3300031691 Bacteria 4118
1298 Ga0265314_10000130 3300031711 Bacteria 113776
1299 Ga0265314_10002601 3300031711 Bacteria 18259
1300 Ga0265314_10024716 3300031711 Bacteria 4548
1301 Ga0265314_10036975 3300031711 Bacteria 3542
1302 Ga0265342_10060454 3300031712 Bacteria 2234
1303 Ga0265342_10069711 3300031712 Bacteria 2052
1304 Ga0316576_10018835 3300031727 Bacteria 4721
1305 Ga0316578_10001810 3300031728 Bacteria 8986
1306 Ga0316578_10005698 3300031728 Bacteria 6068
1307 Ga0316578_10053709 3300031728 Bacteria 2361
1308 Ga0307516_10000419 3300031730 Bacteria 55599
1309 Ga0307516_10001407 3300031730 Bacteria 33232
1310 Ga0307410_10010063 3300031852 Bacteria 5340
1311 Ga0307410_10047850 3300031852 Bacteria 2860
1312 Ga0307406_10000591 3300031901 Bacteria 20868
1313 Ga0307406_10006447 3300031901 Bacteria 6477
1314 Ga0307406_10036487 3300031901 Bacteria 3029
1315 Ga0307406_10067178 3300031901 Bacteria 2336
1316 Ga0307407_10011388 3300031903 Bacteria 4232
1317 Ga0307407_10017978 3300031903 Bacteria 3562
1318 Ga0307407_10067303 3300031903 Bacteria 2116
1319 Ga0307412_10000044 3300031911 Bacteria 165237
1320 Ga0307412_10000137 3300031911 Bacteria 53231
1321 Ga0307412_10022497 3300031911 Bacteria 3865
1322 Ga0307412_10127583 3300031911 Bacteria 1842
1323 Ga0307409_100003205 3300031995 Bacteria 8806
1324 Ga0307416_100010461 3300032002 Bacteria 6128
1325 Ga0307416_100012135 3300032002 Bacteria 5787
1326 Ga0307416_100014397 3300032002 Bacteria 5419
1327 Ga0307416_100057427 3300032002 Bacteria 3148
1328 Ga0307416_100124260 3300032002 Bacteria 2308
1329 Ga0307416_100133080 3300032002 Bacteria 2243
1330 Ga0307414_10012205 3300032004 Bacteria 5069
1331 Ga0307414_10012514 3300032004 Bacteria 5019
1332 Ga0307414_10179986 3300032004 Bacteria 1699
1333 Ga0307411_10003633 3300032005 Bacteria 7210
1334 Ga0307411_10018996 3300032005 Bacteria 3958
1335 Ga0307411_10022933 3300032005 Bacteria 3686
1336 Ga0307411_10034976 3300032005 Bacteria 3132
1337 Ga0307411_10043625 3300032005 Bacteria 2870
1338 Ga0307411_10079628 3300032005 Bacteria 2250
1339 Ga0307415_100002384 3300032126 Bacteria 9365
1340 Ga0307415_100003949 3300032126 Bacteria 7623
1341 Ga0316583_10001121 3300032133 Bacteria 8738
1342 Ga0316583_10001803 3300032133 Bacteria 7278
1343 Ga0316585_10002606 3300032137 Bacteria 4881
1344 Ga0316580_10005764 3300032139 Bacteria 3632
1345 Ga0316593_10015723 3300032168 Bacteria 2282
1346 Ga0316586_1000593 3300033527 Bacteria 3607
1347 Ga0316596_1003572 3300033541 Bacteria 3423
1348 Ga0373959_0007189 3300034820 Bacteria 1868
1349 Ga0373934_0019182 3300035086 Bacteria 2623
1350 Ga0373952_0000877 3300035092 Bacteria 5479
1351 Ga0373932_0004126 3300035112 Bacteria 3451
1352 Ga0373939_0000022 3300035114 Bacteria 57022
1353 Ga0373939_0006811 3300035114 Bacteria 2761
1354 Ga0373941_0008176 3300035115 Bacteria 2590
1355 Ga0373954_0000002 3300035118 Bacteria 147478
1356 Ga0373957_0017327 3300035120 Bacteria 2506
1357 Ga0373960_0001755 3300035121 Bacteria 4859
1358 Ga0373942_0022941 3300035207 Bacteria 1589
1359 Ga0373961_0015144 3300035241 Bacteria 1968
1360 Ga0373961_0032401 3300035241 Bacteria 1465
1361 Ga0373962_0010486 3300035242 Bacteria 2311
1362 Ga0316574_0002445 3300035398 Bacteria 9334
1363 Ga0316574_0002826 3300035398 Bacteria 8807
1364 Ga0373931_0001704 3300035691 Bacteria 9526
1365 Ga0373931_0010523 3300035691 Bacteria 4447
1366 Ga0373931_0068171 3300035691 Bacteria 1935
1367 Ga0373935_0012403 3300035692 Bacteria 5127
1368 Ga0373935_0130526 3300035692 Bacteria 1688
1369 Ga0373927_0003837 3300035695 Bacteria 10678
1370 Ga0373933_0005419 3300035724 Bacteria 6942
1371 Ga0373947_0010334 3300035725 Bacteria 5356
1372 Ga0373937_0000646 3300036401 Bacteria 30603
1373 Ga0373937_0025916 3300036401 Bacteria 5296
1374 Ga0373937_0032248 3300036401 Bacteria 4751
1375 Ga0373937_0088470 3300036401 Bacteria 2867
1376 Ga0316582_0003627 3300036647 Bacteria 7615
1377 Ga0316582_0052967 3300036647 Bacteria 2580
1378 Ga0316584_0002856 3300036712 Bacteria 11080
1379 Ga0373925_0111281 3300037068 Bacteria 2116
1380 Ga0373925_0113661 3300037068 Bacteria 2094
1381 Ga0395899_0000008 3300037312 Bacteria 567572
1382 Ga0395899_0001004 3300037312 Bacteria 25887
1383 Ga0395899_0005885 3300037312 Bacteria 9515
1384 Ga0395899_0008814 3300037312 Bacteria 7763
1385 Ga0395899_0053745 3300037312 Bacteria 2981
1386 Ga0395899_0061853 3300037312 Bacteria 2757
1387 Ga0395900_0000055 3300037418 Bacteria 219875
1388 Ga0395900_0000058 3300037418 Bacteria 206785
1389 Ga0395900_0003080 3300037418 Bacteria 18130
1390 Ga0395900_0006242 3300037418 Bacteria 12437
1391 Ga0395900_0027441 3300037418 Bacteria 5832
1392 Ga0395900_0029137 3300037418 Bacteria 5663
1393 Ga0395900_0030417 3300037418 Bacteria 5545
1394 Ga0395900_0051909 3300037418 Bacteria 4223
1395 Ga0395900_0056382 3300037418 Bacteria 4044
1396 Ga0395900_0091031 3300037418 Bacteria 3135
1397 Ga0395900_0097540 3300037418 Bacteria 3020
1398 Ga0395898_0000119 3300037466 Bacteria 209937
1399 Ga0395898_0001022 3300037466 Bacteria 43575
1400 Ga0395898_0005866 3300037466 Bacteria 13211
1401 Ga0395898_0008920 3300037466 Bacteria 10562
1402 Ga0395898_0010179 3300037466 Bacteria 9844
1403 Ga0395898_0016842 3300037466 Bacteria 7465
1404 Ga0395898_0020307 3300037466 Bacteria 6747
1405 Ga0395898_0064271 3300037466 Bacteria 3559
1406 Ga0395898_0083311 3300037466 Bacteria 3082
1407 Ga0395905_0000071 3300037471 Bacteria 174580
1408 Ga0395905_0000088 3300037471 Bacteria 152506
1409 Ga0395905_0000201 3300037471 Bacteria 92923
1410 Ga0395905_0000256 3300037471 Bacteria 79866
1411 Ga0395905_0000573 3300037471 Bacteria 49867
1412 Ga0395905_0008405 3300037471 Bacteria 10178
1413 Ga0395905_0008958 3300037471 Bacteria 9823
1414 Ga0395905_0015439 3300037471 Bacteria 7260
1415 Ga0395905_0018061 3300037471 Bacteria 6696
1416 Ga0395905_0021495 3300037471 Bacteria 6101
1417 Ga0395905_0051424 3300037471 Bacteria 3859
1418 Ga0316581_0003650 3300037588 Bacteria 3851
1419 Ga0395901_0000003 3300038443 Bacteria 701538
1420 Ga0395901_0000186 3300038443 Bacteria 79718
1421 Ga0395901_0001180 3300038443 Bacteria 27770
1422 Ga0395901_0003137 3300038443 Bacteria 16603
1423 Ga0395901_0010386 3300038443 Bacteria 9430
1424 Ga0395901_0019567 3300038443 Bacteria 6919
1425 Ga0395901_0025819 3300038443 Bacteria 6032
1426 Ga0395901_0047486 3300038443 Bacteria 4458
1427 Ga0395901_0086646 3300038443 Bacteria 3274
1428 Ga0395901_0273385 3300038443 Bacteria 1757
1429 Ga0400483_148091 3300039062 Bacteria 10176
1430 Ga0436365_0582085 3300039437 Bacteria 4803
1431 Ga0436361_0011584 3300039447 Bacteria 19580
1432 Ga0436361_0026980 3300039447 Bacteria 37761
1433 Ga0436361_0107660 3300039447 Bacteria 63286
1434 Ga0436361_0143364 3300039447 Bacteria 5479
1435 Ga0436361_0419096 3300039447 Bacteria 4938
1436 Ga0436361_0525813 3300039447 Bacteria 3988
1437 Ga0436361_0606213 3300039447 Bacteria 11392
1438 Ga0436361_0745691 3300039447 Bacteria 89622
1439 Ga0436361_0811061 3300039447 Bacteria 135576
1440 Ga0436361_1002234 3300039447 Bacteria 1991
1441 Ga0436361_1073079 3300039447 Bacteria 3491
1442 Ga0436361_1206467 3300039447 Bacteria 80244
1443 Ga0436363_0150920 3300039450 Bacteria 1532
1444 Ga0439436_0029257 3300041404 Bacteria 1605
1445 Ga0439453_0008209 3300041408 Bacteria 1673
1446 Ga0439465_0000423 3300041413 Bacteria 12334
1447 Ga0439441_000065 3300042001 Bacteria 8054
1448 Ga0439441_000928 3300042001 Bacteria 3560
1449 Ga0439448_0004211 3300042005 Bacteria 4050
1450 Ga0439432_005010 3300042006 Bacteria 4789
1451 Ga0439449_0001562 3300042007 Bacteria 8969
1452 Ga0439449_0007914 3300042007 Bacteria 4036
1453 Ga0439451_011620 3300042009 Bacteria 1776
1454 Ga0450888_000059 3300042126 Bacteria 8096
1455 Ga0450891_000351 3300042129 Bacteria 4783
1456 Ga0450892_000308 3300042130 Bacteria 5743
1457 Ga0439458_0016570 3300042157 Bacteria 1677
1458 Ga0439434_0001264 3300042435 Bacteria 7275
1459 Ga0439435_0003299 3300042436 Bacteria 3339
1460 Ga0439459_0000260 3300042438 Bacteria 6189
1461 Ga0439460_0000389 3300042461 Bacteria 9321
1462 Ga0450918_000014 3300042531 Bacteria 34950
1463 Ga0450893_0002810 3300042532 Bacteria 2730
1464 Ga0451577_0000264 3300042876 Bacteria 103723
1465 Ga0451577_0006621 3300042876 Bacteria 11511
1466 Ga0451577_0012849 3300042876 Bacteria 7860
1467 Ga0451577_0094767 3300042876 Bacteria 2665
1468 Ga0466969_0000013 3300044656 Bacteria 111537
1469 Ga0466969_0001609 3300044656 Bacteria 12093
1470 Ga0466969_0013258 3300044656 Bacteria 4341
1471 Ga0466969_0037017 3300044656 Bacteria 2462
1472 Ga0466969_0044383 3300044656 Bacteria 2211
1473 Ga0466972_0000029 3300044658 Bacteria 165236
1474 Ga0466972_0009476 3300044658 Bacteria 4890
1475 Ga0453683_0002174 3300044673 Bacteria 15593
1476 Ga0453683_0005267 3300044673 Bacteria 9049
1477 Ga0453683_0106779 3300044673 Bacteria 1760
1478 Ga0466965_0006141 3300044683 Bacteria 5433
1479 Ga0466965_0016238 3300044683 Bacteria 3540
1480 Ga0466966_0000016 3300044684 Bacteria 127214
1481 Ga0466966_0009957 3300044684 Bacteria 6301
1482 Ga0466966_0016156 3300044684 Bacteria 4934
1483 Ga0466966_0018388 3300044684 Bacteria 4610
1484 Ga0466966_0020533 3300044684 Bacteria 4341
1485 Ga0466961_0000735 3300044693 Bacteria 20551
1486 Ga0466961_0001896 3300044693 Bacteria 13020
1487 Ga0466961_0006565 3300044693 Bacteria 7391
1488 Ga0466961_0010462 3300044693 Bacteria 5918
1489 Ga0466961_0044285 3300044693 Bacteria 2847
1490 Ga0466963_0004173 3300044694 Bacteria 8365
1491 Ga0453684_0000189 3300044712 Bacteria 269690
1492 Ga0453684_0000222 3300044712 Bacteria 249870
1493 Ga0453684_0000276 3300044712 Bacteria 222326
1494 Ga0453684_0002114 3300044712 Bacteria 50142
1495 Ga0453684_0003467 3300044712 Bacteria 35441
1496 Ga0453684_0006132 3300044712 Bacteria 23146
1497 Ga0453684_0034808 3300044712 Bacteria 6979
1498 Ga0466971_0000504 3300044719 Bacteria 15342
1499 Ga0466971_0014007 3300044719 Bacteria 3524
1500 Ga0466968_0001837 3300044735 Bacteria 7661
1501 Ga0466968_0014411 3300044735 Bacteria 3124
1502 Ga0466970_0031191 3300044765 Bacteria 2814
1503 Ga0466957_0000539 3300044842 Bacteria 19128
1504 Ga0466959_0000496 3300045049 Bacteria 22885
1505 Ga0466959_0002979 3300045049 Bacteria 10939
1506 Ga0466959_0014913 3300045049 Bacteria 5661
1507 Ga0451576_0000006 3300045051 Bacteria 949698
1508 Ga0451576_0000096 3300045051 Bacteria 221078
1509 Ga0451576_0000292 3300045051 Bacteria 122654
1510 Ga0451576_0000652 3300045051 Bacteria 71674
1511 Ga0451576_0001306 3300045051 Bacteria 43171
1512 Ga0451576_0009737 3300045051 Bacteria 11112
1513 Ga0451576_0011196 3300045051 Bacteria 10219
1514 Ga0451576_0016912 3300045051 Bacteria 8033
1515 Ga0451576_0028632 3300045051 Bacteria 5965
1516 Ga0451576_0059479 3300045051 Bacteria 3988
1517 Ga0466958_0001102 3300045836 Bacteria 12464
1518 Ga0466958_0002984 3300045836 Bacteria 8670
1519 Ga0466958_0008799 3300045836 Bacteria 5607
1520 Ga0466958_0014820 3300045836 Bacteria 4456
1521 Ga0466967_0026074 3300045976 Bacteria 4834
1522 Ga0466967_0108574 3300045976 Bacteria 2546
1523 Ga0495617_000002 3300046452 Bacteria 710121
1524 Ga0495617_000056 3300046452 Bacteria 100802
1525 Ga0495617_033429 3300046452 Bacteria 1725
1526 Ga0495627_000016 3300046453 Bacteria 318947
1527 Ga0495627_001427 3300046453 Bacteria 14061
1528 Ga0495592_0004682 3300046454 Bacteria 10028
1529 Ga0495603_0003557 3300046455 Bacteria 9277
1530 Ga0495603_0008435 3300046455 Bacteria 6223
1531 Ga0495603_0022521 3300046455 Bacteria 3813
1532 Ga0495590_0000035 3300046457 Bacteria 129481
1533 Ga0495590_0002529 3300046457 Bacteria 7562
1534 Ga0495590_0006501 3300046457 Bacteria 4560
1535 Ga0495629_0000435 3300046459 Bacteria 34798
1536 Ga0495629_0010284 3300046459 Bacteria 6814
1537 Ga0495629_0010993 3300046459 Bacteria 6574
1538 Ga0495629_0054282 3300046459 Bacteria 2802
1539 Ga0495638_0000172 3300046460 Bacteria 100572
1540 Ga0495651_0008923 3300046462 Bacteria 7700
1541 Ga0495653_0000007 3300046463 Bacteria 314281
1542 Ga0495653_0005547 3300046463 Bacteria 10285
1543 Ga0495653_0035367 3300046463 Bacteria 3942
1544 Ga0495653_0076714 3300046463 Bacteria 2483
1545 Ga0495650_0000056 3300046471 Bacteria 307565
1546 Ga0495650_0000105 3300046471 Bacteria 205855
1547 Ga0495650_0000551 3300046471 Bacteria 53445
1548 Ga0495650_0001315 3300046471 Bacteria 25079
1549 Ga0495650_0005799 3300046471 Bacteria 7882
1550 Ga0495580_0002727 3300046472 Bacteria 15255
1551 Ga0495580_0070938 3300046472 Bacteria 2433
1552 Ga0495580_0105644 3300046472 Bacteria 1956
1553 Ga0495580_0133247 3300046472 Bacteria 1723
1554 Ga0495582_0001028 3300046473 Bacteria 15630
1555 Ga0495605_0000015 3300046474 Bacteria 300227
1556 Ga0495605_0003727 3300046474 Bacteria 9047
1557 Ga0495605_0006706 3300046474 Bacteria 6589
1558 Ga0495605_0013928 3300046474 Bacteria 4417
1559 Ga0495664_0009421 3300046477 Bacteria 5464
1560 Ga0495664_0030686 3300046477 Bacteria 3149
1561 Ga0495584_0000022 3300046491 Bacteria 128471
1562 Ga0495584_0001400 3300046491 Bacteria 14525
1563 Ga0495584_0003124 3300046491 Bacteria 9197
1564 Ga0495584_0004978 3300046491 Bacteria 7077
1565 Ga0495584_0046315 3300046491 Bacteria 2194
1566 Ga0495585_0005510 3300046492 Bacteria 7968
1567 Ga0495585_0014494 3300046492 Bacteria 4591
1568 Ga0495594_0058875 3300046499 Bacteria 2123
1569 Ga0495596_0002563 3300046500 Bacteria 9668
1570 Ga0495596_0010252 3300046500 Bacteria 4086
1571 Ga0495596_0010316 3300046500 Bacteria 4070
1572 Ga0495607_0000077 3300046501 Bacteria 99190
1573 Ga0495607_0006325 3300046501 Bacteria 8345
1574 Ga0495607_0006614 3300046501 Bacteria 8130
1575 Ga0495607_0010586 3300046501 Bacteria 6190
1576 Ga0495583_0000004 3300046506 Bacteria 655287
1577 Ga0495583_0000046 3300046506 Bacteria 218059
1578 Ga0495583_0000257 3300046506 Bacteria 87964
1579 Ga0495583_0000892 3300046506 Bacteria 35776
1580 Ga0495583_0001786 3300046506 Bacteria 20452
1581 Ga0495583_0013210 3300046506 Bacteria 4619
1582 Ga0495606_0000673 3300046507 Bacteria 53474
1583 Ga0495606_0000739 3300046507 Bacteria 50567
1584 Ga0495606_0001991 3300046507 Bacteria 25186
1585 Ga0495606_0008434 3300046507 Bacteria 8954
1586 Ga0495606_0020707 3300046507 Bacteria 4839
1587 Ga0495606_0029341 3300046507 Bacteria 3864
1588 Ga0495606_0095149 3300046507 Bacteria 1824
1589 Ga0495610_0000004 3300046512 Bacteria 1006135
1590 Ga0495610_0000765 3300046512 Bacteria 30334
1591 Ga0495610_0003702 3300046512 Bacteria 11722
1592 Ga0495610_0009750 3300046512 Bacteria 6037
1593 Ga0495610_0009906 3300046512 Bacteria 5964
1594 Ga0495616_0056065 3300046513 Bacteria 1947
1595 Ga0495618_0004598 3300046514 Bacteria 8450
1596 Ga0495620_0020240 3300046515 Bacteria 3253
1597 Ga0495628_0005051 3300046516 Bacteria 11598
1598 Ga0495628_0014240 3300046516 Bacteria 6672
1599 Ga0495630_0000781 3300046517 Bacteria 22351
1600 Ga0495630_0009746 3300046517 Bacteria 6911
1601 Ga0495630_0134264 3300046517 Bacteria 1880
1602 Ga0495631_0057372 3300046518 Bacteria 1694
1603 Ga0495632_0000148 3300046519 Bacteria 72492
1604 Ga0495637_0000006 3300046520 Bacteria 435763
1605 Ga0495643_0000310 3300046522 Bacteria 67156
1606 Ga0495644_0007340 3300046523 Bacteria 4258
1607 Ga0495648_0000035 3300046524 Bacteria 196251
1608 Ga0495648_0005704 3300046524 Bacteria 10288
1609 Ga0495648_0051435 3300046524 Bacteria 2510
1610 Ga0495666_0000312 3300046526 Bacteria 21158
1611 Ga0495666_0000744 3300046526 Bacteria 14983
1612 Ga0495642_0000569 3300046528 Bacteria 18527
1613 Ga0495652_0016164 3300046529 Bacteria 6672
1614 Ga0495652_0016400 3300046529 Bacteria 6628
1615 Ga0495652_0036945 3300046529 Bacteria 4241
1616 Ga0495654_0000005 3300046530 Bacteria 491381
1617 Ga0495665_0001728 3300046531 Bacteria 11736
1618 Ga0495665_0051332 3300046531 Bacteria 2184
1619 Ga0495640_0052144 3300046533 Bacteria 2810
1620 Ga0495640_0057162 3300046533 Bacteria 2663
1621 Ga0495587_0037483 3300046536 Bacteria 2910
1622 Ga0495587_0053892 3300046536 Bacteria 2370
1623 Ga0495609_0001453 3300046538 Bacteria 15717
1624 Ga0495609_0016904 3300046538 Bacteria 3394
1625 Ga0495621_0003877 3300046539 Bacteria 4153
1626 Ga0495597_0000375 3300046542 Bacteria 39117
1627 Ga0495597_0000993 3300046542 Bacteria 21814
1628 Ga0495597_0002415 3300046542 Bacteria 11888
1629 Ga0495597_0025190 3300046542 Bacteria 2739
1630 Ga0495645_0004117 3300046543 Bacteria 9929
1631 Ga0495622_0001742 3300046557 Bacteria 10765
1632 Ga0495622_0011709 3300046557 Bacteria 4055
1633 Ga0495633_0000832 3300046558 Bacteria 27235
1634 Ga0495633_0001682 3300046558 Bacteria 16634
1635 Ga0495633_0004494 3300046558 Bacteria 8840
1636 Ga0495633_0034734 3300046558 Bacteria 2423
1637 Ga0495667_0015056 3300046559 Bacteria 5221
1638 Ga0495656_0000093 3300046615 Bacteria 38558
1639 Ga0495668_0000049 3300046616 Bacteria 217657
1640 Ga0495668_0000870 3300046616 Bacteria 34075
1641 Ga0495668_0020897 3300046616 Bacteria 3759
1642 Ga0495634_0007024 3300046642 Bacteria 8491
1643 Ga0495634_0051931 3300046642 Bacteria 2750
1644 Ga0495634_0066769 3300046642 Bacteria 2380
1645 Ga0495611_0001771 3300046648 Bacteria 10432
1646 Ga0495611_0010876 3300046648 Bacteria 3854
1647 Ga0495611_0079152 3300046648 Bacteria 1509
1648 Ga0495625_0004074 3300046660 Bacteria 13960
1649 Ga0495625_0006471 3300046660 Bacteria 10414
1650 Ga0495625_0055158 3300046660 Bacteria 2835
1651 Ga0495635_0030959 3300046663 Bacteria 3716
1652 Ga0495659_0000098 3300046664 Bacteria 38376
1653 Ga0495659_0011091 3300046664 Bacteria 2903
1654 Ga0495661_0008775 3300046665 Bacteria 6976
1655 Ga0495661_0018781 3300046665 Bacteria 4540
1656 Ga0495661_0032557 3300046665 Bacteria 3294
1657 Ga0495661_0043444 3300046665 Bacteria 2762
1658 Ga0495599_0013388 3300046678 Bacteria 5068
1659 Ga0495623_0012254 3300046679 Bacteria 5553
1660 Ga0495623_0017230 3300046679 Bacteria 4667
1661 Ga0495623_0049866 3300046679 Bacteria 2652
1662 Ga0495646_0038453 3300046680 Bacteria 2954
1663 Ga0495646_0082429 3300046680 Bacteria 1871
1664 Ga0495669_0000400 3300046684 Bacteria 21289
1665 Ga0495669_0015382 3300046684 Bacteria 3276
1666 Ga0495624_0005072 3300046690 Bacteria 9522
1667 Ga0495624_0040375 3300046690 Bacteria 2989
1668 Ga0495624_0041168 3300046690 Bacteria 2956
1669 Ga0495670_0008483 3300046691 Bacteria 5055
1670 Ga0495670_0015421 3300046691 Bacteria 3754
1671 Ga0495670_0032960 3300046691 Bacteria 2576
1672 Ga0495671_0001397 3300046692 Bacteria 16273
1673 Ga0495671_0007638 3300046692 Bacteria 6142
1674 Ga0495671_0018346 3300046692 Bacteria 3715
1675 Ga0495671_0023112 3300046692 Bacteria 3250
1676 Ga0495671_0039861 3300046692 Bacteria 2369
1677 Ga0495649_0011764 3300046694 Bacteria 5120
1678 Ga0495649_0014413 3300046694 Bacteria 4531
1679 Ga0495649_0067364 3300046694 Bacteria 1920
1680 Ga0495589_0002800 3300046794 Bacteria 9643
1681 Ga0495589_0010902 3300046794 Bacteria 4722
1682 Ga0495589_0019365 3300046794 Bacteria 3490
1683 Ga0495600_0003685 3300046809 Bacteria 9053
1684 Ga0495600_0004228 3300046809 Bacteria 8575
1685 Ga0495660_0003819 3300046810 Bacteria 9222
1686 Ga0495660_0010735 3300046810 Bacteria 5322
1687 Ga0495581_0002940 3300047315 Bacteria 9747
1688 Ga0495581_0005503 3300047315 Bacteria 7332
1689 Ga0495604_0005868 3300047317 Bacteria 9737
1690 Ga0495604_0030292 3300047317 Bacteria 4297
1691 Ga0495636_0003685 3300047318 Bacteria 5958
1692 Ga0495636_0003721 3300047318 Bacteria 5935
1693 Ga0495636_0006799 3300047318 Bacteria 4496
1694 Ga0495674_0008675 3300047319 Bacteria 9666
1695 Ga0495674_0010569 3300047319 Bacteria 8735
1696 Ga0495674_0025226 3300047319 Bacteria 5453
1697 Ga0495674_0034001 3300047319 Bacteria 4612
1698 Ga0495674_0172587 3300047319 Bacteria 1803
1699 Ga0495672_0000118 3300047320 Bacteria 124396
1700 Ga0495672_0000287 3300047320 Bacteria 69547
1701 Ga0495672_0004612 3300047320 Bacteria 11190
1702 Ga0495672_0015168 3300047320 Bacteria 5244
1703 Ga0495672_0052009 3300047320 Bacteria 2408
1704 Ga0495676_0008226 3300047321 Bacteria 9567
1705 Ga0495680_0011744 3300047322 Bacteria 7737
1706 Ga0495683_0005405 3300047323 Bacteria 7091
1707 Ga0495683_0066516 3300047323 Bacteria 1776
1708 Ga0495687_000032 3300047443 Bacteria 273607
1709 Ga0495687_000166 3300047443 Bacteria 98891
1710 Ga0495687_000210 3300047443 Bacteria 83884
1711 Ga0495687_000643 3300047443 Bacteria 40048
1712 Ga0495687_001343 3300047443 Bacteria 22915
1713 Ga0495687_001347 3300047443 Bacteria 22860
1714 Ga0495687_016457 3300047443 Bacteria 3718
1715 Ga0495687_051949 3300047443 Bacteria 1736
1716 Ga0495675_0006553 3300047444 Bacteria 7129
1717 Ga0495675_0019367 3300047444 Bacteria 4323
1718 Ga0495675_0028520 3300047444 Bacteria 3557
1719 Ga0495679_000586 3300047446 Bacteria 25086
1720 Ga0495679_000669 3300047446 Bacteria 22427
1721 Ga0495679_009541 3300047446 Bacteria 3879
1722 Ga0495685_000005 3300047447 Bacteria 112142
1723 Ga0495673_0000017 3300047469 Bacteria 574970
1724 Ga0495673_0000027 3300047469 Bacteria 475440
1725 Ga0495673_0000037 3300047469 Bacteria 307717
1726 Ga0495673_0020230 3300047469 Bacteria 3318
1727 Ga0495681_0011149 3300047470 Bacteria 5379
1728 Ga0495681_0023626 3300047470 Bacteria 3261
1729 Ga0495681_0059223 3300047470 Bacteria 1771
1730 Ga0495686_0000038 3300047472 Bacteria 306383
1731 Ga0495686_0006193 3300047472 Bacteria 9231
1732 Ga0495686_0006400 3300047472 Bacteria 9025
1733 Ga0495686_0028553 3300047472 Bacteria 3632
1734 Ga0495686_0083116 3300047472 Bacteria 1953
1735 Ga0495593_0005042 3300047673 Bacteria 7812
1736 Ga0495593_0008112 3300047673 Bacteria 6109
1737 Ga0495593_0008362 3300047673 Bacteria 6020
1738 Ga0495602_0023478 3300048088 Bacteria 6006
1739 Ga0495602_0023850 3300048088 Bacteria 5948
1740 Ga0495602_0134158 3300048088 Bacteria 1969
1741 Ga0495614_0000551 3300048089 Bacteria 15510
1742 Ga0495614_0005049 3300048089 Bacteria 5954
1743 Ga0495626_0000034 3300048091 Bacteria 183391
1744 Ga0495626_0013978 3300048091 Bacteria 4155
1745 Ga0496101_0005661 3300048904 Bacteria 7971
1746 Ga0496101_0067158 3300048904 Bacteria 2617
1747 Ga0496102_0001837 3300048905 Bacteria 18347
1748 Ga0496102_0003391 3300048905 Bacteria 13513
1749 Ga0496102_0006345 3300048905 Bacteria 10082
1750 Ga0496102_0007112 3300048905 Bacteria 9556
1751 Ga0496102_0026131 3300048905 Bacteria 5204
1752 Ga0496102_0027448 3300048905 Bacteria 5084
1753 Ga0496102_0174362 3300048905 Bacteria 2024
1754 Ga0496103_0003910 3300048906 Bacteria 9063
1755 Ga0496103_0005480 3300048906 Bacteria 7588
1756 Ga0496103_0045025 3300048906 Bacteria 2722
1757 Ga0496105_0004196 3300048908 Bacteria 10822
1758 Ga0496106_0000878 3300048909 Bacteria 21912
1759 Ga0496106_0001298 3300048909 Bacteria 18768
1760 Ga0496106_0050193 3300048909 Bacteria 3144
1761 Ga0496107_0012714 3300048910 Bacteria 5881
1762 Ga0496107_0051882 3300048910 Bacteria 2959
1763 Ga0496108_0042186 3300048911 Bacteria 3809
1764 Ga0496108_0044867 3300048911 Bacteria 3691
1765 Ga0496108_0118934 3300048911 Bacteria 2265
1766 Ga0496108_0143816 3300048911 Bacteria 2055
1767 Ga0496108_0219177 3300048911 Bacteria 1653
1768 Ga0496109_0007893 3300048912 Bacteria 9020
1769 Ga0496109_0047657 3300048912 Bacteria 3897
1770 Ga0496109_0150330 3300048912 Bacteria 2180
1771 Ga0496110_0015135 3300048913 Bacteria 6413
1772 Ga0496110_0028281 3300048913 Bacteria 4814
1773 Ga0496110_0033140 3300048913 Bacteria 4466
1774 Ga0496112_0004682 3300048915 Bacteria 11639
1775 Ga0496112_0013189 3300048915 Bacteria 7625
1776 Ga0496113_0088749 3300048916 Bacteria 2379
1777 Ga0496114_0013903 3300048917 Bacteria 6453
1778 Ga0496114_0032648 3300048917 Bacteria 4286
1779 Ga0496115_0188976 3300048918 Bacteria 1702
1780 Ga0496116_0044124 3300048919 Bacteria 3031
1781 Ga0496116_0132676 3300048919 Bacteria 1416
1782 Ga0496117_0000010 3300048920 Bacteria 611954
1783 Ga0496117_0007707 3300048920 Bacteria 10419
1784 Ga0496117_0011084 3300048920 Bacteria 8111
1785 Ga0496117_0016433 3300048920 Bacteria 6247
1786 Ga0496118_0000009 3300048921 Bacteria 611954
1787 Ga0496118_0003941 3300048921 Bacteria 18152
1788 Ga0496118_0005114 3300048921 Bacteria 15073
1789 Ga0496118_0015312 3300048921 Bacteria 7106
1790 Ga0496118_0027994 3300048921 Bacteria 4757
1791 Ga0496119_0019465 3300048922 Bacteria 4998
1792 Ga0496120_0001170 3300048923 Bacteria 33548
1793 Ga0496121_0002222 3300048924 Bacteria 30310
1794 Ga0496121_0004860 3300048924 Bacteria 17659
1795 Ga0496121_0008669 3300048924 Bacteria 11879
1796 Ga0496121_0020196 3300048924 Bacteria 6609
1797 Ga0496121_0023301 3300048924 Bacteria 5968
1798 Ga0496122_0001897 3300048925 Bacteria 31637
1799 Ga0496122_0009581 3300048925 Bacteria 10161
1800 Ga0496122_0043812 3300048925 Bacteria 3501
1801 Ga0496123_0000117 3300048926 Bacteria 161679
1802 Ga0496123_0004122 3300048926 Bacteria 15572
1803 Ga0496123_0005495 3300048926 Bacteria 12742
1804 Ga0496123_0024459 3300048926 Bacteria 4590
1805 Ga0496123_0123840 3300048926 Bacteria 1447
1806 Ga0496124_0015000 3300048927 Bacteria 7458
1807 Ga0496124_0026014 3300048927 Bacteria 5285
1808 Ga0496124_0047432 3300048927 Bacteria 3676
1809 Ga0496124_0095946 3300048927 Bacteria 2409
1810 Ga0496124_0157475 3300048927 Bacteria 1774
1811 Ga0496125_0000096 3300048928 Bacteria 205618
1812 Ga0496125_0002451 3300048928 Bacteria 24101
1813 Ga0496125_0005116 3300048928 Bacteria 14761
1814 Ga0496125_0005319 3300048928 Bacteria 14389
1815 Ga0496125_0007743 3300048928 Bacteria 11374
1816 Ga0496125_0007861 3300048928 Bacteria 11269
1817 Ga0496126_0000603 3300048929 Bacteria 67970
1818 Ga0496126_0000928 3300048929 Bacteria 50618
1819 Ga0496126_0014923 3300048929 Bacteria 7835
1820 Ga0496126_0053528 3300048929 Bacteria 3661
1821 Ga0496126_0156876 3300048929 Bacteria 1947
1822 Ga0501310_000576 3300049130 Bacteria 3222
1823 Ga0495678_000001 3300049459 Bacteria 1060340
1824 Ga0495678_006525 3300049459 Bacteria 6196
1825 Ga0495682_0008705 3300049460 Bacteria 3995
1826 Ga0495682_0032943 3300049460 Bacteria 1913
1827 Ga0495682_0042761 3300049460 Bacteria 1660
1828 Ga0501290_002103 3300049513 Bacteria 2605
1829 Ga0501031_0001760 3300049568 Bacteria 13585
1830 Ga0501032_0001745 3300049569 Bacteria 17187
1831 Ga0501033_0003409 3300049570 Bacteria 13089
1832 Ga0501033_0005381 3300049570 Bacteria 10142
1833 Ga0501034_0000812 3300049571 Bacteria 46479
1834 Ga0501034_0007877 3300049571 Bacteria 11323
1835 Ga0501034_0103580 3300049571 Bacteria 2839
1836 Ga0501036_0000045 3300049572 Bacteria 78277
1837 Ga0501036_0061591 3300049572 Bacteria 3178
1838 Ga0501037_0083974 3300049573 Bacteria 2307
1839 Ga0501038_0012263 3300049574 Bacteria 7828
1840 Ga0501038_0034042 3300049574 Bacteria 4482
1841 Ga0501039_0001384 3300049575 Bacteria 17796
1842 Ga0501039_0023246 3300049575 Bacteria 4757
1843 Ga0501039_0085773 3300049575 Bacteria 2452
1844 Ga0501040_0012175 3300049576 Bacteria 5632
1845 Ga0501040_0014965 3300049576 Bacteria 5124
1846 Ga0501040_0124323 3300049576 Bacteria 1811
1847 Ga0501041_0001055 3300049577 Bacteria 15067
1848 Ga0501041_0002782 3300049577 Bacteria 9983
1849 Ga0501042_0030606 3300049578 Bacteria 3803
1850 Ga0501042_0061681 3300049578 Bacteria 2679
1851 Ga0501043_0000057 3300049579 Bacteria 103997
1852 Ga0501043_0005247 3300049579 Bacteria 10471
1853 Ga0501046_0000075 3300049580 Bacteria 104000
1854 Ga0501046_0001396 3300049580 Bacteria 23254
1855 Ga0501046_0001765 3300049580 Bacteria 20669
1856 Ga0501046_0113030 3300049580 Bacteria 2073
1857 Ga0501047_0000081 3300049581 Bacteria 122697
1858 Ga0501047_0008921 3300049581 Bacteria 9467
1859 Ga0501048_0003347 3300049582 Bacteria 12191
1860 Ga0501068_0000043 3300049584 Bacteria 47781
1861 Ga0501068_0002871 3300049584 Bacteria 9171
1862 Ga0501068_0020903 3300049584 Bacteria 3820
1863 Ga0501069_0101324 3300049585 Bacteria 1635
1864 Ga0501070_0060939 3300049586 Bacteria 3127
1865 Ga0501071_0002251 3300049587 Bacteria 11619
1866 Ga0501071_0003110 3300049587 Bacteria 10302
1867 Ga0501071_0058471 3300049587 Bacteria 2788
1868 Ga0501072_0000916 3300049588 Bacteria 21646
1869 Ga0501072_0001577 3300049588 Bacteria 17020
1870 Ga0501072_0008637 3300049588 Bacteria 7733
1871 Ga0501072_0011235 3300049588 Bacteria 6838
1872 Ga0501072_0013576 3300049588 Bacteria 6234
1873 Ga0501072_0066852 3300049588 Bacteria 2836
1874 Ga0501072_0108403 3300049588 Bacteria 2210
1875 Ga0501073_0128095 3300049589 Bacteria 1759
1876 Ga0501074_0088890 3300049590 Bacteria 2212
1877 Ga0501075_0006991 3300049591 Bacteria 7797
1878 Ga0501075_0016691 3300049591 Bacteria 5294
1879 Ga0501075_0173575 3300049591 Bacteria 1645
1880 Ga0501076_0000485 3300049592 Bacteria 25067
1881 Ga0501076_0001817 3300049592 Bacteria 14485
1882 Ga0501076_0002115 3300049592 Bacteria 13620
1883 Ga0501076_0168690 3300049592 Bacteria 1784
1884 Ga0501198_000012 3300049649 Bacteria 113529
1885 Ga0501211_000908 3300049658 Bacteria 3096
1886 Ga0501222_000010 3300049662 Bacteria 113536
1887 Ga0501229_001568 3300049706 Bacteria 2677
1888 Ga0501079_0001013 3300049741 Bacteria 19484
1889 Ga0501079_0001659 3300049741 Bacteria 15841
1890 Ga0501079_0077296 3300049741 Bacteria 2575
1891 Ga0501080_0006292 3300049742 Bacteria 10656
1892 Ga0501080_0007117 3300049742 Bacteria 10102
1893 Ga0501080_0008627 3300049742 Bacteria 9249
1894 Ga0501080_0047336 3300049742 Bacteria 4003
1895 Ga0501080_0142423 3300049742 Bacteria 2216
1896 Ga0501081_0000006 3300049743 Bacteria 75365
1897 Ga0501081_0000370 3300049743 Bacteria 24563
1898 Ga0501081_0106763 3300049743 Bacteria 1985
1899 Ga0501083_0031792 3300049744 Bacteria 3622
1900 Ga0501083_0098652 3300049744 Bacteria 1927
1901 Ga0501035_0001267 3300049822 Bacteria 26211
1902 Ga0501035_0002689 3300049822 Bacteria 17298
1903 Ga0501035_0005291 3300049822 Bacteria 12216
1904 Ga0501035_0011535 3300049822 Bacteria 8189
1905 Ga0501044_0001149 3300049823 Bacteria 31351
1906 Ga0501044_0002780 3300049823 Bacteria 19930
1907 Ga0501044_0254155 3300049823 Bacteria 1697
1908 Ga0501045_0002844 3300049824 Bacteria 11819
1909 Ga0501045_0024826 3300049824 Bacteria 4305
1910 Ga0501045_0028422 3300049824 Bacteria 4034
1911 Ga0501045_0029267 3300049824 Bacteria 3980
1912 Ga0501045_0060674 3300049824 Bacteria 2773
1913 nmdc:mga00v17_14465_c1 3300050491 Bacteria 4404
1914 nmdc:mga00v17_3043_c1 3300050491 Bacteria 8620
1915 nmdc:mga00v17_6899_c1 3300050491 Bacteria 6037
1916 nmdc:mga0k408_10138_c1 3300050493 Bacteria 5092
1917 nmdc:mga0k408_25246_c1 3300050493 Bacteria 3365
1918 nmdc:mga0k408_3641_c1 3300050493 Bacteria 8158
1919 nmdc:mga0k408_4043_c1 3300050493 Bacteria 7783
1920 nmdc:mga07m45_13865_c1 3300050496 Bacteria 4283
1921 nmdc:mga07m45_3956_c1 3300050496 Bacteria 7202
1922 nmdc:mga07m45_4613_c1 3300050496 Bacteria 6756
1923 nmdc:mga07m45_4971_c1 3300050496 Bacteria 6562
1924 nmdc:mga07m45_5876_c1 3300050496 Bacteria 6159
1925 nmdc:mga07m45_7493_c1 3300050496 Bacteria 5578
1926 nmdc:mga05p37_132_c1 3300050507 Bacteria 68371
1927 nmdc:mga05p37_209_c1 3300050507 Bacteria 59030
1928 nmdc:mga05p37_82754_c1 3300050507 Bacteria 3955
1929 nmdc:mga09592_11912_c1 3300050508 Bacteria 7074
1930 nmdc:mga09592_150_c1 3300050508 Bacteria 47613
1931 nmdc:mga09592_418_c1 3300050508 Bacteria 31192
1932 nmdc:mga0qj67_14809_c1 3300050509 Bacteria 5898
1933 nmdc:mga06r32_25037_c1 3300050510 Bacteria 5546
1934 nmdc:mga06r32_88604_c1 3300050510 Bacteria 3021
1935 nmdc:mga08y16_2590_c1 3300050511 Bacteria 18584
1936 nmdc:mga08y16_28103_c1 3300050511 Bacteria 5930
1937 nmdc:mga08y16_72716_c1 3300050511 Bacteria 3583
1938 nmdc:mga0n895_12967_c1 3300050512 Bacteria 7496
1939 nmdc:mga0n895_142307_c1 3300050512 Bacteria 2427
1940 nmdc:mga0n895_43852_c1 3300050512 Bacteria 4360
1941 nmdc:mga0n895_960_c1 3300050512 Bacteria 20894
1942 nmdc:mga0rr50_1253_c1 3300050513 Bacteria 13821
1943 nmdc:mga0rr50_62672_c1 3300050513 Bacteria 2806
1944 nmdc:mga08x19_18940_c1 3300050514 Bacteria 4220
1945 nmdc:mga08x19_19190_c1 3300050514 Bacteria 4194
1946 nmdc:mga08x19_22183_c1 3300050514 Bacteria 3930
1947 nmdc:mga08x19_27396_c1 3300050514 Bacteria 3564
1948 nmdc:mga08x19_55_c1 3300050514 Bacteria 120851
1949 nmdc:mga0a205_1791_c1 3300050515 Bacteria 18571
1950 nmdc:mga0a205_2106_c1 3300050515 Bacteria 11100
1951 Ga0500610_0085524 3300053079 Bacteria 1641
1952 Ga0495619_0082136 3300053085 Bacteria 2171
1953 Ga0500578_0005345 3300053086 Bacteria 8753
1954 Ga0500651_0001184 3300053093 Bacteria 12929
1955 Ga0500651_0027777 3300053093 Bacteria 3558
1956 Ga0500607_004076 3300053121 Bacteria 10228
1957 Ga0500618_001245 3300053125 Bacteria 11916
1958 Ga0500642_0026379 3300053130 Bacteria 2371
1959 Ga0500658_0002407 3300053134 Bacteria 7249
1960 Ga0500658_0002684 3300053134 Bacteria 6841
1961 Ga0500568_0004052 3300053139 Bacteria 7934
1962 Ga0500568_0007818 3300053139 Bacteria 5208
1963 Ga0500574_000258 3300053141 Bacteria 6448
1964 Ga0500574_003808 3300053141 Bacteria 2725
1965 Ga0500622_0004298 3300053156 Bacteria 9024
1966 Ga0500622_0007377 3300053156 Bacteria 6250
1967 Ga0500636_0001052 3300053177 Bacteria 14818
1968 Ga0500645_002482 3300053730 Bacteria 8186
1969 Ga0500645_002742 3300053730 Bacteria 7636
1970 Ga0590075_023618 3300059424 Bacteria 1542
1971 Ga0590077_013586 3300059426 Bacteria 1694
1972 Ga0501082_0007944 3300060353 Bacteria 9162
1973 Ga0501082_0159063 3300060353 Bacteria 1963
1974 Ga0466962_0002133 3300061719 Bacteria 9343
1975 Ga0466962_0011852 3300061719 Bacteria 4195
1976 Ga0466962_0013444 3300061719 Bacteria 3941
1977 Ga0466962_0029531 3300061719 Bacteria 2624
1978 Ga0466962_0042982 3300061719 Bacteria 2163
1979 Ga0530510_0000308 3300061734 Bacteria 31232
1980 Ga0530510_0001081 3300061734 Bacteria 18085
1981 Ga0530510_0191393 3300061734 Bacteria 1519

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027682 Ga0209971_1013112 Ga0209971_10131123 388
2 3300031730 Ga0307516_10001407 Ga0307516_1000140727 411
3 3300032005 Ga0307411_10022933 Ga0307411_100229332 415
4 3300035207 Ga0373942_0022941 Ga0373942_0022941_234_1553 424
5 3300046680 Ga0495646_0082429 Ga0495646_0082429_239_1561 425
6 iso_pu_bacteria 2513020051 2513228289 430
7 iso_pu_bacteria 2513237150 2513954289 430
8 iso_pu_bacteria 2513237165 2514043025 430
9 iso_pu_bacteria 2643221569 2643861192 430
10 iso_pu_bacteria 2643221570 2643867269 430
11 iso_pu_bacteria 2643221594 2643983342 430
12 iso_pu_bacteria 2643221596 2643990186 430
13 iso_pu_bacteria 2643221609 2644059273 430
14 iso_pu_bacteria 2643221611 2644075689 430
15 iso_pu_bacteria 2643221621 2644124544 430
16 iso_pu_bacteria 2643221652 2644295677 430
17 iso_pu_bacteria 2643221658 2644324082 430
18 iso_pu_bacteria 2643221672 2644400732 430
19 iso_pu_bacteria 2738541277 2738720696 430
20 iso_pu_bacteria 2738543012 2739240767 430
21 iso_pu_bacteria 2738543013 2739251937 430
22 iso_pu_bacteria 2738543019 2739279895 430
23 iso_pu_bacteria 2808606395 2809032740 430
24 iso_pu_bacteria 2816332133 2816472154 430
25 iso_pu_bacteria 2818991446 2819601969 430
26 iso_pu_bacteria 2831265667 2831269798 430
27 iso_pu_bacteria 2838054893 2838055184 430
28 iso_pu_bacteria 2842718218 2842718387 430
29 iso_pu_bacteria 2842747753 2842749695 430
30 iso_pu_bacteria 2855730933 2855735086 430
31 iso_pu_bacteria 2855767633 2855770870 430
32 iso_pu_bacteria 2857537821 2857540557 430
33 iso_pu_bacteria 2858688981 2858692410 430
34 iso_pu_bacteria 2858950400 2858951346 430
35 iso_pu_bacteria 2881101125 2881103099 430
36 iso_pu_bacteria 2881412998 2881418259 430
37 iso_pu_bacteria 2899924645 2899927274 430
38 iso_pu_bacteria 2904541872 2904549911 430
39 iso_pu_bacteria 2928037797 2928042811 430
40 iso_pu_bacteria 2928044640 2928048762 430
41 iso_pu_bacteria 2928051484 2928055094 430
42 iso_pu_bacteria 2928064002 2928068520 430
43 iso_pu_bacteria 2928115317 2928117225 430
44 iso_pu_bacteria 2929160207 2929161342 430
45 iso_pu_bacteria 2941479691 2941485324 430
46 iso_pu_bacteria 2974320154 2974320649 430
47 iso_pu_bacteria 2990710928 2990711095 430
48 iso_pu_bacteria 644736347 644748963 430
49 3300006847 Ga0075431_100205109 Ga0075431_1002051092 431
50 3300032004 Ga0307414_10179986 Ga0307414_101799862 431
51 3300050510 nmdc:mga06r32_88604_c1 nmdc:mga06r32_88604_c1_1312_2664 431
52 3300006051 Ga0075364_10000662 Ga0075364_100006625 432
53 3300031691 Ga0316579_10009350 Ga0316579_100093503 432
54 3300031727 Ga0316576_10018835 Ga0316576_100188352 432
55 3300031728 Ga0316578_10001810 Ga0316578_100018102 432
56 3300031728 Ga0316578_10053709 Ga0316578_100537093 432
57 3300032137 Ga0316585_10002606 Ga0316585_100026065 432
58 3300032139 Ga0316580_10005764 Ga0316580_100057643 432
59 3300032168 Ga0316593_10015723 Ga0316593_100157233 432
60 3300033527 Ga0316586_1000593 Ga0316586_10005932 432
61 3300033541 Ga0316596_1003572 Ga0316596_10035723 432
62 3300035398 Ga0316574_0002826 Ga0316574_0002826_6033_7373 432
63 3300036647 Ga0316582_0052967 Ga0316582_0052967_222_1562 432
64 3300036712 Ga0316584_0002856 Ga0316584_0002856_9652_10992 432
65 3300039062 Ga0400483_148091 Ga0400483_148091_7071_8411 432
66 3300050491 nmdc:mga00v17_3043_c1 nmdc:mga00v17_3043_c1_2155_3501 432
67 3300005539 Ga0068853_100006025 Ga0068853_1000060259 433
68 3300009093 Ga0105240_10013131 Ga0105240_100131315 433
69 3300009545 Ga0105237_10036643 Ga0105237_100366431 433
70 3300025292 Ga0209676_1003523 Ga0209676_10035233 433
71 3300025298 Ga0209050_1003404 Ga0209050_10034047 433
72 3300025913 Ga0207695_10140627 Ga0207695_101406273 433
73 3300025914 Ga0207671_10128700 Ga0207671_101287002 433
74 3300026041 Ga0207639_10018099 Ga0207639_100180993 433
75 3300031665 Ga0316575_10067404 Ga0316575_100674041 433
76 3300048920 Ga0496117_0011084 Ga0496117_0011084_6675_8021 433
77 3300048929 Ga0496126_0000928 Ga0496126_0000928_4614_5960 433
78 3300001979 JGI24740J21852_10003089 JGI24740J21852_100030894 434
79 3300001979 JGI24740J21852_10012128 JGI24740J21852_100121284 434
80 3300002077 JGI24744J21845_10011438 JGI24744J21845_100114381 434
81 3300002705 JGI25156J39149_1000972 JGI25156J39149_10009729 434
82 3300002738 JGI25154J39366_1002682 JGI25154J39366_10026823 434
83 3300002739 JGI25158J39367_1004866 JGI25158J39367_10048661 434
84 3300002741 JGI25157J39369_1000566 JGI25157J39369_100056618 434
85 3300002772 JGI25164J39214_1002165 JGI25164J39214_10021654 434
86 3300002773 JGI25152J39213_1002601 JGI25152J39213_10026012 434
87 3300002773 JGI25152J39213_1003527 JGI25152J39213_10035271 434
88 3300002773 JGI25152J39213_1006782 JGI25152J39213_10067822 434
89 3300002987 JGI25159J45721_1013925 JGI25159J45721_10139252 434
90 3300003187 JGI25151J46595_10000137 JGI25151J46595_10000137103 434
91 3300003187 JGI25151J46595_10000972 JGI25151J46595_1000097216 434
92 3300003187 JGI25151J46595_10005064 JGI25151J46595_100050646 434
93 3300003187 JGI25151J46595_10007385 JGI25151J46595_100073851 434
94 3300003187 JGI25151J46595_10010042 JGI25151J46595_100100421 434
95 3300003215 JGI25153J46596_10001778 JGI25153J46596_100017786 434
96 3300003215 JGI25153J46596_10009699 JGI25153J46596_100096991 434
97 3300003215 JGI25153J46596_10010968 JGI25153J46596_100109683 434
98 3300003347 JGI26128J50194_1000229 JGI26128J50194_10002292 434
99 3300003354 JGI25160J50197_1003487 JGI25160J50197_10034877 434
100 3300003374 JGI25161J50226_1006594 JGI25161J50226_10065942 434
101 3300003578 Ga0006562J51391_1008695 Ga0006562J51391_10086957 434
102 3300003751 Ga0055538_1000051 Ga0055538_10000516 434
103 3300003752 Ga0055539_1000076 Ga0055539_10000766 434
104 3300003756 Ga0055533_1000033 Ga0055533_1000033195 434
105 3300003756 Ga0055533_1000082 Ga0055533_10000826 434
106 3300003759 Ga0055525_1000004 Ga0055525_1000004360 434
107 3300003759 Ga0055525_1000109 Ga0055525_10001096 434
108 3300003759 Ga0055525_1001526 Ga0055525_10015262 434
109 3300003761 Ga0055535_1000729 Ga0055535_10007298 434
110 3300003761 Ga0055535_1001191 Ga0055535_10011917 434
111 3300003761 Ga0055535_1004121 Ga0055535_10041212 434
112 3300003762 Ga0055542_1000051 Ga0055542_1000051128 434
113 3300003763 Ga0055529_1000486 Ga0055529_10004867 434
114 3300003763 Ga0055529_1000651 Ga0055529_100065119 434
115 3300003771 Ga0055526_1000556 Ga0055526_100055624 434
116 3300003771 Ga0055526_1001406 Ga0055526_10014067 434
117 3300003773 Ga0055537_1000056 Ga0055537_100005668 434
118 3300003773 Ga0055537_1003907 Ga0055537_10039071 434
119 3300003773 Ga0055537_1013107 Ga0055537_10131072 434
120 3300003775 Ga0055524_1000029 Ga0055524_100002916 434
121 3300003775 Ga0055524_1000044 Ga0055524_1000044105 434
122 3300003775 Ga0055524_1000109 Ga0055524_100010989 434
123 3300003775 Ga0055524_1000146 Ga0055524_10001462 434
124 3300003775 Ga0055524_1003233 Ga0055524_10032333 434
125 3300003781 Ga0055536_1003791 Ga0055536_10037916 434
126 3300003781 Ga0055536_1004594 Ga0055536_10045946 434
127 3300003781 Ga0055536_1005018 Ga0055536_10050182 434
128 3300003781 Ga0055536_1026014 Ga0055536_10260142 434
129 3300003784 Ga0055534_1000178 Ga0055534_100017814 434
130 3300003784 Ga0055534_1001210 Ga0055534_10012107 434
131 3300003784 Ga0055534_1010660 Ga0055534_10106602 434
132 3300003790 Ga0055528_1000287 Ga0055528_100028721 434
133 3300003790 Ga0055528_1000297 Ga0055528_100029725 434
134 3300003790 Ga0055528_1003822 Ga0055528_10038223 434
135 3300003791 Ga0055530_10002335 Ga0055530_100023356 434
136 3300003791 Ga0055530_10002509 Ga0055530_100025098 434
137 3300003792 Ga0055540_1000116 Ga0055540_100011671 434
138 3300003792 Ga0055540_1000401 Ga0055540_100040122 434
139 3300003792 Ga0055540_1002542 Ga0055540_10025427 434
140 3300003792 Ga0055540_1020118 Ga0055540_10201182 434
141 3300003794 Ga0055531_10000181 Ga0055531_1000018115 434
142 3300003794 Ga0055531_10001209 Ga0055531_1000120915 434
143 3300003794 Ga0055531_10003298 Ga0055531_100032986 434
144 3300003794 Ga0055531_10004112 Ga0055531_100041123 434
145 3300003794 Ga0055531_10008229 Ga0055531_100082292 434
146 3300003841 Ga0055541_1000053 Ga0055541_10000536 434
147 3300004625 Ga0055543_1002745 Ga0055543_10027451 434
148 3300004625 Ga0055543_1003087 Ga0055543_10030871 434
149 3300004625 Ga0055543_1005447 Ga0055543_10054472 434
150 3300004625 Ga0055543_1008416 Ga0055543_10084162 434
151 3300005262 Ga0065165_1000016 Ga0065165_1000016223 434
152 3300005262 Ga0065165_1000273 Ga0065165_10002739 434
153 3300005262 Ga0065165_1000447 Ga0065165_100044750 434
154 3300005262 Ga0065165_1007963 Ga0065165_10079635 434
155 3300005262 Ga0065165_1029917 Ga0065165_10299172 434
156 3300005288 Ga0065714_10067070 Ga0065714_100670703 434
157 3300005288 Ga0065714_10101328 Ga0065714_101013282 434
158 3300005289 Ga0065704_10080167 Ga0065704_100801674 434
159 3300005289 Ga0065704_10086996 Ga0065704_100869961 434
160 3300005289 Ga0065704_10087833 Ga0065704_100878332 434
161 3300005293 Ga0065715_10006304 Ga0065715_100063042 434
162 3300005327 Ga0070658_10029174 Ga0070658_100291742 434
163 3300005327 Ga0070658_10071691 Ga0070658_100716913 434
164 3300005328 Ga0070676_10000960 Ga0070676_100009603 434
165 3300005330 Ga0070690_100047034 Ga0070690_1000470343 434
166 3300005331 Ga0070670_100005345 Ga0070670_10000534512 434
167 3300005331 Ga0070670_100006913 Ga0070670_1000069137 434
168 3300005331 Ga0070670_100014237 Ga0070670_1000142374 434
169 3300005331 Ga0070670_100016165 Ga0070670_1000161652 434
170 3300005333 Ga0070677_10000307 Ga0070677_1000030712 434
171 3300005333 Ga0070677_10002708 Ga0070677_100027088 434
172 3300005333 Ga0070677_10017794 Ga0070677_100177942 434
173 3300005334 Ga0068869_100001368 Ga0068869_10000136813 434
174 3300005334 Ga0068869_100005133 Ga0068869_1000051333 434
175 3300005334 Ga0068869_100008669 Ga0068869_1000086696 434
176 3300005334 Ga0068869_100014536 Ga0068869_1000145367 434
177 3300005335 Ga0070666_10004926 Ga0070666_100049268 434
178 3300005335 Ga0070666_10043834 Ga0070666_100438342 434
179 3300005335 Ga0070666_10047286 Ga0070666_100472862 434
180 3300005335 Ga0070666_10079698 Ga0070666_100796982 434
181 3300005335 Ga0070666_10103632 Ga0070666_101036322 434
182 3300005336 Ga0070680_100002568 Ga0070680_1000025687 434
183 3300005336 Ga0070680_100005437 Ga0070680_1000054376 434
184 3300005338 Ga0068868_100000339 Ga0068868_10000033915 434
185 3300005338 Ga0068868_100007829 Ga0068868_1000078292 434
186 3300005338 Ga0068868_100022592 Ga0068868_1000225923 434
187 3300005339 Ga0070660_100007268 Ga0070660_1000072684 434
188 3300005339 Ga0070660_100043714 Ga0070660_1000437142 434
189 3300005343 Ga0070687_100019532 Ga0070687_1000195322 434
190 3300005343 Ga0070687_100021465 Ga0070687_1000214654 434
191 3300005344 Ga0070661_100000191 Ga0070661_10000019112 434
192 3300005344 Ga0070661_100000647 Ga0070661_1000006473 434
193 3300005344 Ga0070661_100006151 Ga0070661_1000061516 434
194 3300005344 Ga0070661_100011300 Ga0070661_1000113005 434
195 3300005344 Ga0070661_100043695 Ga0070661_1000436952 434
196 3300005344 Ga0070661_100058700 Ga0070661_1000587001 434
197 3300005345 Ga0070692_10016920 Ga0070692_100169202 434
198 3300005345 Ga0070692_10028522 Ga0070692_100285222 434
199 3300005347 Ga0070668_100002954 Ga0070668_1000029546 434
200 3300005347 Ga0070668_100021104 Ga0070668_1000211042 434
201 3300005347 Ga0070668_100036435 Ga0070668_1000364355 434
202 3300005347 Ga0070668_100076508 Ga0070668_1000765082 434
203 3300005353 Ga0070669_100045722 Ga0070669_1000457223 434
204 3300005353 Ga0070669_100065101 Ga0070669_1000651011 434
205 3300005353 Ga0070669_100182885 Ga0070669_1001828851 434
206 3300005354 Ga0070675_100005810 Ga0070675_1000058107 434
207 3300005354 Ga0070675_100006640 Ga0070675_1000066408 434
208 3300005354 Ga0070675_100042297 Ga0070675_1000422972 434
209 3300005354 Ga0070675_100047673 Ga0070675_1000476732 434
210 3300005354 Ga0070675_100153479 Ga0070675_1001534792 434
211 3300005355 Ga0070671_100001559 Ga0070671_1000015597 434
212 3300005355 Ga0070671_100004694 Ga0070671_1000046948 434
213 3300005355 Ga0070671_100005899 Ga0070671_1000058992 434
214 3300005355 Ga0070671_100010054 Ga0070671_1000100548 434
215 3300005355 Ga0070671_100109552 Ga0070671_1001095523 434
216 3300005356 Ga0070674_100000204 Ga0070674_10000020416 434
217 3300005356 Ga0070674_100005354 Ga0070674_1000053544 434
218 3300005356 Ga0070674_100013274 Ga0070674_1000132743 434
219 3300005356 Ga0070674_100013813 Ga0070674_1000138136 434
220 3300005356 Ga0070674_100036400 Ga0070674_1000364005 434
221 3300005356 Ga0070674_100056525 Ga0070674_1000565252 434
222 3300005356 Ga0070674_100111324 Ga0070674_1001113241 434
223 3300005356 Ga0070674_100157400 Ga0070674_1001574001 434
224 3300005356 Ga0070674_100163463 Ga0070674_1001634631 434
225 3300005364 Ga0070673_100002026 Ga0070673_1000020268 434
226 3300005364 Ga0070673_100023271 Ga0070673_1000232714 434
227 3300005364 Ga0070673_100043240 Ga0070673_1000432403 434
228 3300005364 Ga0070673_100058287 Ga0070673_1000582872 434
229 3300005364 Ga0070673_100067600 Ga0070673_1000676002 434
230 3300005365 Ga0070688_100000913 Ga0070688_1000009133 434
231 3300005366 Ga0070659_100001083 Ga0070659_10000108317 434
232 3300005366 Ga0070659_100003383 Ga0070659_10000338313 434
233 3300005366 Ga0070659_100008597 Ga0070659_1000085975 434
234 3300005366 Ga0070659_100034718 Ga0070659_1000347183 434
235 3300005366 Ga0070659_100050574 Ga0070659_1000505743 434
236 3300005366 Ga0070659_100110159 Ga0070659_1001101591 434
237 3300005367 Ga0070667_100001570 Ga0070667_1000015703 434
238 3300005367 Ga0070667_100001846 Ga0070667_1000018462 434
239 3300005367 Ga0070667_100002207 Ga0070667_1000022077 434
240 3300005367 Ga0070667_100002920 Ga0070667_10000292011 434
241 3300005367 Ga0070667_100021742 Ga0070667_1000217427 434
242 3300005367 Ga0070667_100022407 Ga0070667_1000224073 434
243 3300005367 Ga0070667_100095054 Ga0070667_1000950543 434
244 3300005367 Ga0070667_100140356 Ga0070667_1001403561 434
245 3300005435 Ga0070714_100000437 Ga0070714_10000043719 434
246 3300005435 Ga0070714_100012010 Ga0070714_10001201010 434
247 3300005435 Ga0070714_100204497 Ga0070714_1002044971 434
248 3300005436 Ga0070713_100000031 Ga0070713_10000003132 434
249 3300005436 Ga0070713_100008696 Ga0070713_1000086964 434
250 3300005437 Ga0070710_10029598 Ga0070710_100295982 434
251 3300005439 Ga0070711_100011567 Ga0070711_1000115674 434
252 3300005439 Ga0070711_100153242 Ga0070711_1001532422 434
253 3300005440 Ga0070705_100077309 Ga0070705_1000773092 434
254 3300005441 Ga0070700_100000348 Ga0070700_10000034818 434
255 3300005441 Ga0070700_100008875 Ga0070700_1000088751 434
256 3300005444 Ga0070694_100057397 Ga0070694_1000573972 434
257 3300005445 Ga0070708_100000128 Ga0070708_10000012831 434
258 3300005455 Ga0070663_100000198 Ga0070663_10000019817 434
259 3300005455 Ga0070663_100009567 Ga0070663_1000095674 434
260 3300005455 Ga0070663_100034648 Ga0070663_1000346482 434
261 3300005455 Ga0070663_100040977 Ga0070663_1000409773 434
262 3300005456 Ga0070678_100003071 Ga0070678_1000030714 434
263 3300005456 Ga0070678_100007119 Ga0070678_1000071197 434
264 3300005456 Ga0070678_100051590 Ga0070678_1000515904 434
265 3300005456 Ga0070678_100116146 Ga0070678_1001161462 434
266 3300005456 Ga0070678_100219552 Ga0070678_1002195522 434
267 3300005457 Ga0070662_100001463 Ga0070662_10000146311 434
268 3300005457 Ga0070662_100001730 Ga0070662_1000017308 434
269 3300005457 Ga0070662_100002390 Ga0070662_1000023906 434
270 3300005457 Ga0070662_100033344 Ga0070662_1000333443 434
271 3300005457 Ga0070662_100065736 Ga0070662_1000657362 434
272 3300005458 Ga0070681_10005361 Ga0070681_100053613 434
273 3300005458 Ga0070681_10009401 Ga0070681_100094017 434
274 3300005458 Ga0070681_10019143 Ga0070681_100191432 434
275 3300005459 Ga0068867_100000948 Ga0068867_1000009489 434
276 3300005459 Ga0068867_100001405 Ga0068867_1000014054 434
277 3300005459 Ga0068867_100006011 Ga0068867_1000060117 434
278 3300005459 Ga0068867_100027830 Ga0068867_1000278305 434
279 3300005459 Ga0068867_100029186 Ga0068867_1000291863 434
280 3300005459 Ga0068867_100114817 Ga0068867_1001148172 434
281 3300005467 Ga0070706_100001272 Ga0070706_1000012727 434
282 3300005467 Ga0070706_100029906 Ga0070706_1000299063 434
283 3300005467 Ga0070706_100213217 Ga0070706_1002132172 434
284 3300005468 Ga0070707_100011654 Ga0070707_1000116546 434
285 3300005468 Ga0070707_100026096 Ga0070707_1000260963 434
286 3300005471 Ga0070698_100026177 Ga0070698_1000261775 434
287 3300005518 Ga0070699_100016121 Ga0070699_1000161214 434
288 3300005518 Ga0070699_100083057 Ga0070699_1000830572 434
289 3300005530 Ga0070679_100005754 Ga0070679_1000057544 434
290 3300005530 Ga0070679_100030740 Ga0070679_1000307405 434
291 3300005530 Ga0070679_100031252 Ga0070679_1000312525 434
292 3300005530 Ga0070679_100050438 Ga0070679_1000504382 434
293 3300005535 Ga0070684_100013947 Ga0070684_1000139474 434
294 3300005535 Ga0070684_100039111 Ga0070684_1000391113 434
295 3300005535 Ga0070684_100062874 Ga0070684_1000628743 434
296 3300005535 Ga0070684_100176184 Ga0070684_1001761842 434
297 3300005536 Ga0070697_100016650 Ga0070697_1000166503 434
298 3300005536 Ga0070697_100040771 Ga0070697_1000407712 434
299 3300005536 Ga0070697_100065711 Ga0070697_1000657112 434
300 3300005539 Ga0068853_100000497 Ga0068853_10000049710 434
301 3300005539 Ga0068853_100007636 Ga0068853_1000076366 434
302 3300005543 Ga0070672_100000561 Ga0070672_1000005616 434
303 3300005543 Ga0070672_100003605 Ga0070672_10000360511 434
304 3300005543 Ga0070672_100012934 Ga0070672_1000129344 434
305 3300005543 Ga0070672_100042416 Ga0070672_1000424161 434
306 3300005543 Ga0070672_100058086 Ga0070672_1000580862 434
307 3300005543 Ga0070672_100174817 Ga0070672_1001748172 434
308 3300005543 Ga0070672_100212159 Ga0070672_1002121592 434
309 3300005546 Ga0070696_100002259 Ga0070696_1000022594 434
310 3300005547 Ga0070693_100045926 Ga0070693_1000459262 434
311 3300005547 Ga0070693_100054114 Ga0070693_1000541142 434
312 3300005548 Ga0070665_100001460 Ga0070665_1000014608 434
313 3300005548 Ga0070665_100003522 Ga0070665_10000352212 434
314 3300005548 Ga0070665_100023904 Ga0070665_1000239045 434
315 3300005548 Ga0070665_100024009 Ga0070665_1000240094 434
316 3300005549 Ga0070704_100014962 Ga0070704_1000149624 434
317 3300005549 Ga0070704_100030144 Ga0070704_1000301443 434
318 3300005563 Ga0068855_100000863 Ga0068855_1000008634 434
319 3300005563 Ga0068855_100019281 Ga0068855_1000192812 434
320 3300005563 Ga0068855_100035614 Ga0068855_1000356142 434
321 3300005563 Ga0068855_100075199 Ga0068855_1000751996 434
322 3300005563 Ga0068855_100167174 Ga0068855_1001671743 434
323 3300005563 Ga0068855_100187279 Ga0068855_1001872792 434
324 3300005564 Ga0070664_100001381 Ga0070664_10000138112 434
325 3300005564 Ga0070664_100007606 Ga0070664_1000076066 434
326 3300005564 Ga0070664_100023353 Ga0070664_1000233534 434
327 3300005564 Ga0070664_100042100 Ga0070664_1000421003 434
328 3300005577 Ga0068857_100004082 Ga0068857_10000408215 434
329 3300005577 Ga0068857_100017820 Ga0068857_1000178202 434
330 3300005577 Ga0068857_100038246 Ga0068857_1000382462 434
331 3300005577 Ga0068857_100048819 Ga0068857_1000488193 434
332 3300005577 Ga0068857_100063787 Ga0068857_1000637873 434
333 3300005578 Ga0068854_100011019 Ga0068854_1000110194 434
334 3300005578 Ga0068854_100029326 Ga0068854_1000293263 434
335 3300005578 Ga0068854_100101330 Ga0068854_1001013302 434
336 3300005614 Ga0068856_100000517 Ga0068856_10000051737 434
337 3300005614 Ga0068856_100005435 Ga0068856_1000054354 434
338 3300005614 Ga0068856_100006194 Ga0068856_1000061942 434
339 3300005614 Ga0068856_100006477 Ga0068856_1000064774 434
340 3300005614 Ga0068856_100278654 Ga0068856_1002786542 434
341 3300005615 Ga0070702_100044523 Ga0070702_1000445233 434
342 3300005616 Ga0068852_100003761 Ga0068852_10000376114 434
343 3300005616 Ga0068852_100041793 Ga0068852_1000417932 434
344 3300005616 Ga0068852_100072729 Ga0068852_1000727292 434
345 3300005617 Ga0068859_100007841 Ga0068859_1000078419 434
346 3300005617 Ga0068859_100029685 Ga0068859_1000296854 434
347 3300005617 Ga0068859_100037248 Ga0068859_1000372483 434
348 3300005617 Ga0068859_100047138 Ga0068859_1000471383 434
349 3300005617 Ga0068859_100105815 Ga0068859_1001058152 434
350 3300005617 Ga0068859_100217760 Ga0068859_1002177602 434
351 3300005618 Ga0068864_100000322 Ga0068864_10000032224 434
352 3300005618 Ga0068864_100000388 Ga0068864_10000038810 434
353 3300005618 Ga0068864_100003242 Ga0068864_10000324214 434
354 3300005618 Ga0068864_100007512 Ga0068864_1000075123 434
355 3300005618 Ga0068864_100010993 Ga0068864_1000109935 434
356 3300005618 Ga0068864_100016150 Ga0068864_1000161501 434
357 3300005618 Ga0068864_100072581 Ga0068864_1000725811 434
358 3300005618 Ga0068864_100130052 Ga0068864_1001300522 434
359 3300005618 Ga0068864_100152970 Ga0068864_1001529702 434
360 3300005618 Ga0068864_100243709 Ga0068864_1002437091 434
361 3300005718 Ga0068866_10000906 Ga0068866_100009067 434
362 3300005719 Ga0068861_100006120 Ga0068861_1000061203 434
363 3300005719 Ga0068861_100008694 Ga0068861_1000086943 434
364 3300005719 Ga0068861_100018379 Ga0068861_1000183796 434
365 3300005719 Ga0068861_100035853 Ga0068861_1000358532 434
366 3300005719 Ga0068861_100076193 Ga0068861_1000761933 434
367 3300005834 Ga0068851_10002652 Ga0068851_100026523 434
368 3300005834 Ga0068851_10004731 Ga0068851_100047313 434
369 3300005834 Ga0068851_10011745 Ga0068851_100117454 434
370 3300005840 Ga0068870_10001178 Ga0068870_100011789 434
371 3300005841 Ga0068863_100005418 Ga0068863_1000054187 434
372 3300005841 Ga0068863_100006313 Ga0068863_1000063134 434
373 3300005841 Ga0068863_100007074 Ga0068863_1000070742 434
374 3300005841 Ga0068863_100041440 Ga0068863_1000414404 434
375 3300005841 Ga0068863_100055644 Ga0068863_1000556442 434
376 3300005841 Ga0068863_100070594 Ga0068863_1000705945 434
377 3300005841 Ga0068863_100150022 Ga0068863_1001500222 434
378 3300005841 Ga0068863_100235595 Ga0068863_1002355951 434
379 3300005842 Ga0068858_100001615 Ga0068858_10000161525 434
380 3300005842 Ga0068858_100001909 Ga0068858_1000019093 434
381 3300005842 Ga0068858_100011373 Ga0068858_1000113738 434
382 3300005842 Ga0068858_100141183 Ga0068858_1001411832 434
383 3300005843 Ga0068860_100027082 Ga0068860_1000270821 434
384 3300005843 Ga0068860_100031255 Ga0068860_1000312553 434
385 3300005843 Ga0068860_100130770 Ga0068860_1001307702 434
386 3300005843 Ga0068860_100149262 Ga0068860_1001492622 434
387 3300005844 Ga0068862_100001722 Ga0068862_1000017229 434
388 3300005844 Ga0068862_100017424 Ga0068862_1000174247 434
389 3300005844 Ga0068862_100021753 Ga0068862_1000217534 434
390 3300005844 Ga0068862_100037077 Ga0068862_1000370776 434
391 3300005844 Ga0068862_100064188 Ga0068862_1000641884 434
392 3300005844 Ga0068862_100075761 Ga0068862_1000757612 434
393 3300005985 Ga0081539_10027865 Ga0081539_100278655 434
394 3300006048 Ga0075363_100027614 Ga0075363_1000276144 434
395 3300006051 Ga0075364_10011166 Ga0075364_100111663 434
396 3300006058 Ga0075432_10001571 Ga0075432_100015716 434
397 3300006177 Ga0075362_10010413 Ga0075362_100104133 434
398 3300006177 Ga0075362_10039866 Ga0075362_100398662 434
399 3300006178 Ga0075367_10029930 Ga0075367_100299303 434
400 3300006178 Ga0075367_10039871 Ga0075367_100398713 434
401 3300006195 Ga0075366_10001740 Ga0075366_100017406 434
402 3300006195 Ga0075366_10005214 Ga0075366_100052142 434
403 3300006195 Ga0075366_10008597 Ga0075366_100085975 434
404 3300006195 Ga0075366_10016355 Ga0075366_100163552 434
405 3300006195 Ga0075366_10026073 Ga0075366_100260733 434
406 3300006237 Ga0097621_100010942 Ga0097621_1000109422 434
407 3300006237 Ga0097621_100036310 Ga0097621_1000363101 434
408 3300006353 Ga0075370_10001068 Ga0075370_100010689 434
409 3300006353 Ga0075370_10001217 Ga0075370_100012175 434
410 3300006353 Ga0075370_10002553 Ga0075370_100025535 434
411 3300006353 Ga0075370_10004950 Ga0075370_100049504 434
412 3300006353 Ga0075370_10008610 Ga0075370_100086102 434
413 3300006353 Ga0075370_10016585 Ga0075370_100165853 434
414 3300006353 Ga0075370_10035597 Ga0075370_100355973 434
415 3300006353 Ga0075370_10078868 Ga0075370_100788682 434
416 3300006358 Ga0068871_100003330 Ga0068871_1000033302 434
417 3300006358 Ga0068871_100006832 Ga0068871_1000068326 434
418 3300006358 Ga0068871_100011233 Ga0068871_1000112336 434
419 3300006358 Ga0068871_100023453 Ga0068871_1000234536 434
420 3300006358 Ga0068871_100195552 Ga0068871_1001955522 434
421 3300006846 Ga0075430_100063722 Ga0075430_1000637223 434
422 3300006871 Ga0075434_100002419 Ga0075434_10000241919 434
423 3300006871 Ga0075434_100193936 Ga0075434_1001939362 434
424 3300006880 Ga0075429_100001780 Ga0075429_1000017802 434
425 3300006881 Ga0068865_100004033 Ga0068865_1000040333 434
426 3300006881 Ga0068865_100086611 Ga0068865_1000866112 434
427 3300006931 Ga0097620_100007841 Ga0097620_1000078419 434
428 3300006931 Ga0097620_100029687 Ga0097620_1000296874 434
429 3300006931 Ga0097620_100037247 Ga0097620_1000372474 434
430 3300006931 Ga0097620_100047142 Ga0097620_1000471423 434
431 3300006931 Ga0097620_100105810 Ga0097620_1001058102 434
432 3300006931 Ga0097620_100217765 Ga0097620_1002177652 434
433 3300006944 Ga0099823_1000159 Ga0099823_100015924 434
434 3300006946 Ga0079104_1000001 Ga0079104_1000001297 434
435 3300006948 Ga0099826_10000003 Ga0099826_10000003583 434
436 3300007076 Ga0075435_100065736 Ga0075435_1000657363 434
437 3300007076 Ga0075435_100093540 Ga0075435_1000935402 434
438 3300009036 Ga0105244_10004162 Ga0105244_100041625 434
439 3300009093 Ga0105240_10005257 Ga0105240_1000525721 434
440 3300009093 Ga0105240_10005432 Ga0105240_100054321 434
441 3300009093 Ga0105240_10005995 Ga0105240_1000599515 434
442 3300009093 Ga0105240_10026304 Ga0105240_100263048 434
443 3300009093 Ga0105240_10078473 Ga0105240_100784732 434
444 3300009094 Ga0111539_10036798 Ga0111539_100367984 434
445 3300009098 Ga0105245_10032246 Ga0105245_100322465 434
446 3300009098 Ga0105245_10062250 Ga0105245_100622504 434
447 3300009147 Ga0114129_10151522 Ga0114129_101515222 434
448 3300009148 Ga0105243_10000717 Ga0105243_100007178 434
449 3300009148 Ga0105243_10004194 Ga0105243_100041949 434
450 3300009148 Ga0105243_10007467 Ga0105243_100074675 434
451 3300009176 Ga0105242_10009890 Ga0105242_100098906 434
452 3300009177 Ga0105248_10008736 Ga0105248_100087367 434
453 3300009177 Ga0105248_10017366 Ga0105248_100173663 434
454 3300009177 Ga0105248_10066323 Ga0105248_100663233 434
455 3300009177 Ga0105248_10104261 Ga0105248_101042614 434
456 3300009177 Ga0105248_10123873 Ga0105248_101238732 434
457 3300009545 Ga0105237_10000556 Ga0105237_1000055627 434
458 3300009545 Ga0105237_10246681 Ga0105237_102466812 434
459 3300009551 Ga0105238_10007543 Ga0105238_100075433 434
460 3300009551 Ga0105238_10026268 Ga0105238_100262686 434
461 3300009551 Ga0105238_10027640 Ga0105238_100276403 434
462 3300009551 Ga0105238_10070671 Ga0105238_100706713 434
463 3300009553 Ga0105249_10075013 Ga0105249_100750132 434
464 3300009553 Ga0105249_10080693 Ga0105249_100806933 434
465 3300009553 Ga0105249_10114522 Ga0105249_101145221 434
466 3300010375 Ga0105239_10060840 Ga0105239_100608403 434
467 3300010375 Ga0105239_10068122 Ga0105239_100681225 434
468 3300010375 Ga0105239_10120103 Ga0105239_101201031 434
469 3300010375 Ga0105239_10159066 Ga0105239_101590662 434
470 3300010375 Ga0105239_10248914 Ga0105239_102489142 434
471 3300011119 Ga0105246_10112071 Ga0105246_101120712 434
472 3300012497 Ga0157319_1000015 Ga0157319_100001561 434
473 3300013100 Ga0157373_10015749 Ga0157373_100157496 434
474 3300013100 Ga0157373_10031538 Ga0157373_100315382 434
475 3300013100 Ga0157373_10043565 Ga0157373_100435652 434
476 3300013102 Ga0157371_10000228 Ga0157371_1000022847 434
477 3300013104 Ga0157370_10004497 Ga0157370_100044974 434
478 3300013104 Ga0157370_10008219 Ga0157370_100082199 434
479 3300013104 Ga0157370_10009919 Ga0157370_1000991910 434
480 3300013104 Ga0157370_10044301 Ga0157370_100443015 434
481 3300013105 Ga0157369_10001339 Ga0157369_100013397 434
482 3300013105 Ga0157369_10010962 Ga0157369_100109626 434
483 3300013105 Ga0157369_10025224 Ga0157369_100252248 434
484 3300013105 Ga0157369_10060216 Ga0157369_100602162 434
485 3300013296 Ga0157374_10000204 Ga0157374_100002043 434
486 3300013296 Ga0157374_10040499 Ga0157374_100404994 434
487 3300013296 Ga0157374_10243168 Ga0157374_102431682 434
488 3300013297 Ga0157378_10009359 Ga0157378_100093594 434
489 3300013306 Ga0163162_10023858 Ga0163162_100238585 434
490 3300013307 Ga0157372_10012931 Ga0157372_1001293110 434
491 3300013307 Ga0157372_10014393 Ga0157372_100143936 434
492 3300013307 Ga0157372_10027361 Ga0157372_100273618 434
493 3300013308 Ga0157375_10001806 Ga0157375_1000180617 434
494 3300013308 Ga0157375_10009296 Ga0157375_100092964 434
495 3300013308 Ga0157375_10029352 Ga0157375_100293524 434
496 3300014325 Ga0163163_10001543 Ga0163163_1000154318 434
497 3300014325 Ga0163163_10001899 Ga0163163_1000189916 434
498 3300014325 Ga0163163_10075631 Ga0163163_100756313 434
499 3300014326 Ga0157380_10017092 Ga0157380_100170927 434
500 3300014326 Ga0157380_10019617 Ga0157380_100196174 434
501 3300014326 Ga0157380_10036826 Ga0157380_100368264 434
502 3300014497 Ga0182008_10001216 Ga0182008_1000121615 434
503 3300014497 Ga0182008_10002832 Ga0182008_100028326 434
504 3300014497 Ga0182008_10003469 Ga0182008_100034697 434
505 3300014497 Ga0182008_10013211 Ga0182008_100132113 434
506 3300014745 Ga0157377_10000032 Ga0157377_1000003276 434
507 3300014745 Ga0157377_10111166 Ga0157377_101111662 434
508 3300014968 Ga0157379_10000162 Ga0157379_1000016238 434
509 3300014968 Ga0157379_10001262 Ga0157379_1000126220 434
510 3300014968 Ga0157379_10002999 Ga0157379_100029997 434
511 3300014968 Ga0157379_10056012 Ga0157379_100560123 434
512 3300014968 Ga0157379_10057345 Ga0157379_100573452 434
513 3300014968 Ga0157379_10233282 Ga0157379_102332822 434
514 3300014969 Ga0157376_10074457 Ga0157376_100744574 434
515 3300014969 Ga0157376_10087911 Ga0157376_100879112 434
516 3300015261 Ga0182006_1000937 Ga0182006_100093714 434
517 3300015261 Ga0182006_1023048 Ga0182006_10230483 434
518 3300015262 Ga0182007_10000419 Ga0182007_100004193 434
519 3300015262 Ga0182007_10012132 Ga0182007_100121323 434
520 3300015683 Ga0183362_10003 Ga0183362_10003855 434
521 3300017792 Ga0163161_10000564 Ga0163161_100005645 434
522 3300017792 Ga0163161_10003954 Ga0163161_100039544 434
523 3300017792 Ga0163161_10030497 Ga0163161_100304973 434
524 3300017792 Ga0163161_10036569 Ga0163161_100365692 434
525 3300017792 Ga0163161_10118753 Ga0163161_101187531 434
526 3300021361 Ga0213872_10000081 Ga0213872_1000008184 434
527 3300021361 Ga0213872_10000104 Ga0213872_1000010442 434
528 3300021361 Ga0213872_10000713 Ga0213872_1000071317 434
529 3300021361 Ga0213872_10001309 Ga0213872_1000130911 434
530 3300021361 Ga0213872_10002243 Ga0213872_100022433 434
531 3300021384 Ga0213876_10019645 Ga0213876_100196452 434
532 3300025208 Ga0209436_100508 Ga0209436_10050817 434
533 3300025208 Ga0209436_100526 Ga0209436_10052617 434
534 3300025208 Ga0209436_109353 Ga0209436_1093531 434
535 3300025224 Ga0209784_100083 Ga0209784_1000837 434
536 3300025225 Ga0209566_100102 Ga0209566_1001027 434
537 3300025226 Ga0209674_100064 Ga0209674_10006453 434
538 3300025226 Ga0209674_100125 Ga0209674_1001257 434
539 3300025229 Ga0209147_100972 Ga0209147_1009729 434
540 3300025230 Ga0209563_100013 Ga0209563_100013360 434
541 3300025230 Ga0209563_100099 Ga0209563_10009953 434
542 3300025230 Ga0209563_100120 Ga0209563_1001207 434
543 3300025231 Ga0207427_102153 Ga0207427_1021533 434
544 3300025242 Ga0209258_100132 Ga0209258_100132127 434
545 3300025242 Ga0209258_100319 Ga0209258_1003197 434
546 3300025242 Ga0209258_100759 Ga0209258_1007593 434
547 3300025242 Ga0209258_107292 Ga0209258_1072921 434
548 3300025245 Ga0207425_1000006 Ga0207425_1000006222 434
549 3300025245 Ga0207425_1000310 Ga0207425_100031027 434
550 3300025245 Ga0207425_1000663 Ga0207425_100066314 434
551 3300025246 Ga0209646_1000060 Ga0209646_1000060191 434
552 3300025250 Ga0209026_1000049 Ga0209026_1000049189 434
553 3300025253 Ga0209677_100076 Ga0209677_1000767 434
554 3300025253 Ga0209677_100331 Ga0209677_10033122 434
555 3300025254 Ga0209148_1000007 Ga0209148_10000071218 434
556 3300025256 Ga0209759_1000272 Ga0209759_100027220 434
557 3300025256 Ga0209759_1000994 Ga0209759_100099415 434
558 3300025258 Ga0209129_1000009 Ga0209129_100000951 434
559 3300025258 Ga0209129_1000084 Ga0209129_10000845 434
560 3300025258 Ga0209129_1000342 Ga0209129_100034228 434
561 3300025263 Ga0209565_1000006 Ga0209565_1000006300 434
562 3300025263 Ga0209565_1000169 Ga0209565_10001696 434
563 3300025263 Ga0209565_1000200 Ga0209565_100020043 434
564 3300025263 Ga0209565_1000364 Ga0209565_10003645 434
565 3300025263 Ga0209565_1000456 Ga0209565_10004565 434
566 3300025263 Ga0209565_1006471 Ga0209565_10064713 434
567 3300025263 Ga0209565_1007556 Ga0209565_10075562 434
568 3300025272 Ga0209455_1000157 Ga0209455_100015746 434
569 3300025273 Ga0209673_1000004 Ga0209673_1000004529 434
570 3300025273 Ga0209673_1000009 Ga0209673_1000009466 434
571 3300025273 Ga0209673_1000012 Ga0209673_1000012367 434
572 3300025273 Ga0209673_1000114 Ga0209673_10001146 434
573 3300025273 Ga0209673_1000916 Ga0209673_100091632 434
574 3300025273 Ga0209673_1003435 Ga0209673_10034357 434
575 3300025273 Ga0209673_1007274 Ga0209673_10072743 434
576 3300025273 Ga0209673_1014384 Ga0209673_10143844 434
577 3300025273 Ga0209673_1017824 Ga0209673_10178242 434
578 3300025284 Ga0209130_1000437 Ga0209130_100043728 434
579 3300025284 Ga0209130_1000621 Ga0209130_10006215 434
580 3300025284 Ga0209130_1001722 Ga0209130_10017225 434
581 3300025284 Ga0209130_1002100 Ga0209130_10021007 434
582 3300025284 Ga0209130_1004203 Ga0209130_10042033 434
583 3300025284 Ga0209130_1007953 Ga0209130_10079533 434
584 3300025284 Ga0209130_1013792 Ga0209130_10137922 434
585 3300025291 Ga0209675_1000006 Ga0209675_1000006299 434
586 3300025291 Ga0209675_1000062 Ga0209675_10000626 434
587 3300025291 Ga0209675_1000144 Ga0209675_100014431 434
588 3300025291 Ga0209675_1000890 Ga0209675_100089020 434
589 3300025291 Ga0209675_1001396 Ga0209675_10013965 434
590 3300025291 Ga0209675_1001454 Ga0209675_10014545 434
591 3300025291 Ga0209675_1002861 Ga0209675_10028616 434
592 3300025291 Ga0209675_1008682 Ga0209675_10086823 434
593 3300025291 Ga0209675_1015654 Ga0209675_10156542 434
594 3300025292 Ga0209676_1000051 Ga0209676_1000051231 434
595 3300025292 Ga0209676_1000817 Ga0209676_100081732 434
596 3300025292 Ga0209676_1000999 Ga0209676_100099927 434
597 3300025292 Ga0209676_1001040 Ga0209676_10010406 434
598 3300025292 Ga0209676_1006824 Ga0209676_10068242 434
599 3300025292 Ga0209676_1036809 Ga0209676_10368091 434
600 3300025294 Ga0209025_1000071 Ga0209025_1000071157 434
601 3300025294 Ga0209025_1000678 Ga0209025_100067825 434
602 3300025294 Ga0209025_1000719 Ga0209025_100071916 434
603 3300025294 Ga0209025_1000861 Ga0209025_10008617 434
604 3300025294 Ga0209025_1005452 Ga0209025_10054527 434
605 3300025294 Ga0209025_1013789 Ga0209025_10137894 434
606 3300025295 Ga0209564_1000008 Ga0209564_1000008318 434
607 3300025295 Ga0209564_1000085 Ga0209564_100008524 434
608 3300025295 Ga0209564_1000136 Ga0209564_100013653 434
609 3300025295 Ga0209564_1000146 Ga0209564_100014677 434
610 3300025295 Ga0209564_1001058 Ga0209564_100105827 434
611 3300025295 Ga0209564_1001096 Ga0209564_100109627 434
612 3300025295 Ga0209564_1003895 Ga0209564_10038953 434
613 3300025295 Ga0209564_1024278 Ga0209564_10242781 434
614 3300025297 Ga0209758_1000045 Ga0209758_1000045342 434
615 3300025297 Ga0209758_1000047 Ga0209758_1000047118 434
616 3300025297 Ga0209758_1000275 Ga0209758_10002752 434
617 3300025297 Ga0209758_1000754 Ga0209758_100075417 434
618 3300025297 Ga0209758_1005541 Ga0209758_10055417 434
619 3300025297 Ga0209758_1041057 Ga0209758_10410571 434
620 3300025298 Ga0209050_1000044 Ga0209050_1000044115 434
621 3300025298 Ga0209050_1000052 Ga0209050_10000527 434
622 3300025298 Ga0209050_1000064 Ga0209050_1000064241 434
623 3300025298 Ga0209050_1002554 Ga0209050_100255411 434
624 3300025298 Ga0209050_1002889 Ga0209050_10028896 434
625 3300025298 Ga0209050_1004206 Ga0209050_10042069 434
626 3300025298 Ga0209050_1006424 Ga0209050_10064243 434
627 3300025298 Ga0209050_1025088 Ga0209050_10250882 434
628 3300025299 Ga0209256_1000003 Ga0209256_1000003621 434
629 3300025299 Ga0209256_1000013 Ga0209256_1000013187 434
630 3300025299 Ga0209256_1000015 Ga0209256_1000015389 434
631 3300025299 Ga0209256_1000179 Ga0209256_100017914 434
632 3300025299 Ga0209256_1000206 Ga0209256_100020642 434
633 3300025299 Ga0209256_1000239 Ga0209256_10002395 434
634 3300025299 Ga0209256_1000394 Ga0209256_10003947 434
635 3300025299 Ga0209256_1000428 Ga0209256_10004289 434
636 3300025299 Ga0209256_1020139 Ga0209256_10201392 434
637 3300025299 Ga0209256_1024797 Ga0209256_10247972 434
638 3300025302 Ga0207426_1000049 Ga0207426_1000049178 434
639 3300025302 Ga0207426_1000086 Ga0207426_10000866 434
640 3300025302 Ga0207426_1000346 Ga0207426_10003465 434
641 3300025302 Ga0207426_1002247 Ga0207426_10022473 434
642 3300025302 Ga0207426_1003558 Ga0207426_10035586 434
643 3300025303 Ga0209051_1000015 Ga0209051_1000015453 434
644 3300025303 Ga0209051_1000022 Ga0209051_100002221 434
645 3300025303 Ga0209051_1000025 Ga0209051_1000025318 434
646 3300025303 Ga0209051_1000031 Ga0209051_1000031115 434
647 3300025303 Ga0209051_1000420 Ga0209051_100042047 434
648 3300025303 Ga0209051_1000824 Ga0209051_10008246 434
649 3300025303 Ga0209051_1001151 Ga0209051_100115120 434
650 3300025303 Ga0209051_1001627 Ga0209051_100162718 434
651 3300025303 Ga0209051_1002289 Ga0209051_10022896 434
652 3300025303 Ga0209051_1003446 Ga0209051_100344611 434
653 3300025303 Ga0209051_1007105 Ga0209051_10071052 434
654 3300025304 Ga0209257_1000010 Ga0209257_1000010601 434
655 3300025304 Ga0209257_1000030 Ga0209257_1000030218 434
656 3300025304 Ga0209257_1000037 Ga0209257_1000037292 434
657 3300025304 Ga0209257_1000039 Ga0209257_1000039290 434
658 3300025304 Ga0209257_1000053 Ga0209257_100005319 434
659 3300025304 Ga0209257_1000058 Ga0209257_1000058109 434
660 3300025304 Ga0209257_1000977 Ga0209257_100097720 434
661 3300025304 Ga0209257_1001416 Ga0209257_100141614 434
662 3300025304 Ga0209257_1001902 Ga0209257_100190210 434
663 3300025304 Ga0209257_1004064 Ga0209257_10040645 434
664 3300025304 Ga0209257_1007014 Ga0209257_10070143 434
665 3300025304 Ga0209257_1013116 Ga0209257_10131164 434
666 3300025315 Ga0207697_10000237 Ga0207697_1000023716 434
667 3300025315 Ga0207697_10038421 Ga0207697_100384212 434
668 3300025315 Ga0207697_10050144 Ga0207697_100501442 434
669 3300025321 Ga0207656_10000916 Ga0207656_100009164 434
670 3300025321 Ga0207656_10004511 Ga0207656_100045116 434
671 3300025728 Ga0207655_1001268 Ga0207655_100126813 434
672 3300025893 Ga0207682_10000059 Ga0207682_1000005919 434
673 3300025893 Ga0207682_10000203 Ga0207682_1000020311 434
674 3300025899 Ga0207642_10008102 Ga0207642_100081025 434
675 3300025899 Ga0207642_10040727 Ga0207642_100407272 434
676 3300025901 Ga0207688_10000362 Ga0207688_1000036213 434
677 3300025901 Ga0207688_10067511 Ga0207688_100675111 434
678 3300025903 Ga0207680_10029359 Ga0207680_100293593 434
679 3300025903 Ga0207680_10077724 Ga0207680_100777242 434
680 3300025903 Ga0207680_10152371 Ga0207680_101523711 434
681 3300025906 Ga0207699_10076602 Ga0207699_100766023 434
682 3300025907 Ga0207645_10000407 Ga0207645_1000040723 434
683 3300025907 Ga0207645_10006246 Ga0207645_1000624610 434
684 3300025907 Ga0207645_10014272 Ga0207645_100142727 434
685 3300025907 Ga0207645_10016625 Ga0207645_100166254 434
686 3300025908 Ga0207643_10005194 Ga0207643_100051948 434
687 3300025908 Ga0207643_10009218 Ga0207643_100092183 434
688 3300025909 Ga0207705_10109006 Ga0207705_101090062 434
689 3300025910 Ga0207684_10034034 Ga0207684_100340342 434
690 3300025910 Ga0207684_10054565 Ga0207684_100545651 434
691 3300025910 Ga0207684_10159246 Ga0207684_101592462 434
692 3300025911 Ga0207654_10074864 Ga0207654_100748641 434
693 3300025912 Ga0207707_10008467 Ga0207707_100084677 434
694 3300025912 Ga0207707_10040701 Ga0207707_100407014 434
695 3300025912 Ga0207707_10043068 Ga0207707_100430681 434
696 3300025912 Ga0207707_10085847 Ga0207707_100858472 434
697 3300025912 Ga0207707_10187953 Ga0207707_101879532 434
698 3300025913 Ga0207695_10008486 Ga0207695_100084864 434
699 3300025913 Ga0207695_10023026 Ga0207695_100230269 434
700 3300025914 Ga0207671_10001994 Ga0207671_1000199420 434
701 3300025914 Ga0207671_10069753 Ga0207671_100697532 434
702 3300025914 Ga0207671_10102730 Ga0207671_101027302 434
703 3300025915 Ga0207693_10029267 Ga0207693_100292672 434
704 3300025916 Ga0207663_10123805 Ga0207663_101238052 434
705 3300025917 Ga0207660_10072015 Ga0207660_100720152 434
706 3300025917 Ga0207660_10104478 Ga0207660_101044782 434
707 3300025919 Ga0207657_10002549 Ga0207657_1000254915 434
708 3300025919 Ga0207657_10012339 Ga0207657_100123397 434
709 3300025919 Ga0207657_10023410 Ga0207657_100234103 434
710 3300025919 Ga0207657_10177253 Ga0207657_101772532 434
711 3300025920 Ga0207649_10001361 Ga0207649_1000136112 434
712 3300025920 Ga0207649_10004347 Ga0207649_100043478 434
713 3300025920 Ga0207649_10017583 Ga0207649_100175833 434
714 3300025921 Ga0207652_10021072 Ga0207652_100210727 434
715 3300025922 Ga0207646_10035752 Ga0207646_100357524 434
716 3300025922 Ga0207646_10077412 Ga0207646_100774123 434
717 3300025923 Ga0207681_10012285 Ga0207681_100122852 434
718 3300025923 Ga0207681_10070545 Ga0207681_100705451 434
719 3300025924 Ga0207694_10007840 Ga0207694_100078402 434
720 3300025924 Ga0207694_10069262 Ga0207694_100692623 434
721 3300025924 Ga0207694_10169174 Ga0207694_101691741 434
722 3300025925 Ga0207650_10002859 Ga0207650_100028598 434
723 3300025925 Ga0207650_10003696 Ga0207650_100036967 434
724 3300025925 Ga0207650_10004599 Ga0207650_100045997 434
725 3300025925 Ga0207650_10013196 Ga0207650_100131964 434
726 3300025925 Ga0207650_10029456 Ga0207650_100294563 434
727 3300025925 Ga0207650_10039595 Ga0207650_100395952 434
728 3300025925 Ga0207650_10050937 Ga0207650_100509373 434
729 3300025925 Ga0207650_10052579 Ga0207650_100525793 434
730 3300025926 Ga0207659_10001339 Ga0207659_100013397 434
731 3300025926 Ga0207659_10003636 Ga0207659_100036362 434
732 3300025926 Ga0207659_10004850 Ga0207659_100048501 434
733 3300025926 Ga0207659_10007572 Ga0207659_100075723 434
734 3300025926 Ga0207659_10066524 Ga0207659_100665242 434
735 3300025926 Ga0207659_10072969 Ga0207659_100729691 434
736 3300025926 Ga0207659_10141085 Ga0207659_101410852 434
737 3300025927 Ga0207687_10073561 Ga0207687_100735613 434
738 3300025928 Ga0207700_10000084 Ga0207700_1000008427 434
739 3300025929 Ga0207664_10000818 Ga0207664_100008189 434
740 3300025929 Ga0207664_10003381 Ga0207664_100033813 434
741 3300025929 Ga0207664_10168082 Ga0207664_101680821 434
742 3300025931 Ga0207644_10000788 Ga0207644_1000078819 434
743 3300025931 Ga0207644_10000991 Ga0207644_100009914 434
744 3300025931 Ga0207644_10022346 Ga0207644_100223463 434
745 3300025931 Ga0207644_10044579 Ga0207644_100445793 434
746 3300025931 Ga0207644_10053037 Ga0207644_100530372 434
747 3300025931 Ga0207644_10062043 Ga0207644_100620432 434
748 3300025932 Ga0207690_10000837 Ga0207690_1000083710 434
749 3300025932 Ga0207690_10001370 Ga0207690_100013709 434
750 3300025932 Ga0207690_10010413 Ga0207690_100104132 434
751 3300025932 Ga0207690_10015809 Ga0207690_100158092 434
752 3300025933 Ga0207706_10000014 Ga0207706_1000001497 434
753 3300025933 Ga0207706_10000486 Ga0207706_1000048613 434
754 3300025933 Ga0207706_10001200 Ga0207706_1000120019 434
755 3300025933 Ga0207706_10008543 Ga0207706_100085436 434
756 3300025933 Ga0207706_10021040 Ga0207706_100210403 434
757 3300025933 Ga0207706_10023757 Ga0207706_100237572 434
758 3300025933 Ga0207706_10153242 Ga0207706_101532422 434
759 3300025934 Ga0207686_10019577 Ga0207686_100195772 434
760 3300025935 Ga0207709_10000572 Ga0207709_1000057226 434
761 3300025935 Ga0207709_10001051 Ga0207709_100010514 434
762 3300025935 Ga0207709_10001477 Ga0207709_1000147710 434
763 3300025935 Ga0207709_10026705 Ga0207709_100267051 434
764 3300025935 Ga0207709_10121083 Ga0207709_101210832 434
765 3300025937 Ga0207669_10015701 Ga0207669_100157014 434
766 3300025937 Ga0207669_10036718 Ga0207669_100367183 434
767 3300025937 Ga0207669_10043574 Ga0207669_100435742 434
768 3300025938 Ga0207704_10007005 Ga0207704_100070052 434
769 3300025938 Ga0207704_10046347 Ga0207704_100463472 434
770 3300025940 Ga0207691_10000999 Ga0207691_1000099920 434
771 3300025940 Ga0207691_10001188 Ga0207691_100011888 434
772 3300025940 Ga0207691_10003049 Ga0207691_100030493 434
773 3300025940 Ga0207691_10004275 Ga0207691_1000427516 434
774 3300025940 Ga0207691_10004379 Ga0207691_1000437912 434
775 3300025940 Ga0207691_10023447 Ga0207691_100234474 434
776 3300025940 Ga0207691_10034121 Ga0207691_100341213 434
777 3300025940 Ga0207691_10064915 Ga0207691_100649152 434
778 3300025941 Ga0207711_10003826 Ga0207711_100038267 434
779 3300025941 Ga0207711_10013604 Ga0207711_100136046 434
780 3300025941 Ga0207711_10013970 Ga0207711_100139705 434
781 3300025941 Ga0207711_10015597 Ga0207711_100155973 434
782 3300025941 Ga0207711_10055369 Ga0207711_100553692 434
783 3300025942 Ga0207689_10000468 Ga0207689_1000046821 434
784 3300025942 Ga0207689_10002668 Ga0207689_1000266815 434
785 3300025942 Ga0207689_10003183 Ga0207689_100031834 434
786 3300025942 Ga0207689_10005832 Ga0207689_100058327 434
787 3300025942 Ga0207689_10016990 Ga0207689_100169901 434
788 3300025942 Ga0207689_10021262 Ga0207689_100212622 434
789 3300025942 Ga0207689_10023226 Ga0207689_100232263 434
790 3300025944 Ga0207661_10035912 Ga0207661_100359123 434
791 3300025944 Ga0207661_10131494 Ga0207661_101314942 434
792 3300025945 Ga0207679_10000313 Ga0207679_1000031332 434
793 3300025945 Ga0207679_10009139 Ga0207679_100091392 434
794 3300025945 Ga0207679_10176575 Ga0207679_101765751 434
795 3300025949 Ga0207667_10001506 Ga0207667_1000150623 434
796 3300025949 Ga0207667_10009870 Ga0207667_100098704 434
797 3300025949 Ga0207667_10054734 Ga0207667_100547345 434
798 3300025949 Ga0207667_10153575 Ga0207667_101535751 434
799 3300025949 Ga0207667_10165965 Ga0207667_101659652 434
800 3300025960 Ga0207651_10000702 Ga0207651_100007023 434
801 3300025960 Ga0207651_10012010 Ga0207651_100120102 434
802 3300025960 Ga0207651_10018792 Ga0207651_100187921 434
803 3300025960 Ga0207651_10024085 Ga0207651_100240853 434
804 3300025960 Ga0207651_10028559 Ga0207651_100285593 434
805 3300025960 Ga0207651_10041598 Ga0207651_100415982 434
806 3300025960 Ga0207651_10062187 Ga0207651_100621872 434
807 3300025960 Ga0207651_10157235 Ga0207651_101572352 434
808 3300025972 Ga0207668_10006446 Ga0207668_100064465 434
809 3300025972 Ga0207668_10017135 Ga0207668_100171353 434
810 3300025972 Ga0207668_10030736 Ga0207668_100307362 434
811 3300025972 Ga0207668_10037481 Ga0207668_100374811 434
812 3300025981 Ga0207640_10026816 Ga0207640_100268163 434
813 3300025981 Ga0207640_10037337 Ga0207640_100373373 434
814 3300025986 Ga0207658_10006538 Ga0207658_100065381 434
815 3300025986 Ga0207658_10013489 Ga0207658_100134893 434
816 3300025986 Ga0207658_10021068 Ga0207658_100210682 434
817 3300025986 Ga0207658_10024430 Ga0207658_100244303 434
818 3300025986 Ga0207658_10032769 Ga0207658_100327691 434
819 3300025986 Ga0207658_10111265 Ga0207658_101112651 434
820 3300025986 Ga0207658_10167872 Ga0207658_101678722 434
821 3300026023 Ga0207677_10015850 Ga0207677_100158502 434
822 3300026023 Ga0207677_10028650 Ga0207677_100286501 434
823 3300026023 Ga0207677_10030690 Ga0207677_100306902 434
824 3300026023 Ga0207677_10040016 Ga0207677_100400162 434
825 3300026035 Ga0207703_10001949 Ga0207703_100019499 434
826 3300026035 Ga0207703_10009460 Ga0207703_100094603 434
827 3300026035 Ga0207703_10019745 Ga0207703_100197451 434
828 3300026035 Ga0207703_10022790 Ga0207703_100227904 434
829 3300026035 Ga0207703_10049969 Ga0207703_100499692 434
830 3300026035 Ga0207703_10061814 Ga0207703_100618144 434
831 3300026041 Ga0207639_10008896 Ga0207639_100088962 434
832 3300026041 Ga0207639_10020836 Ga0207639_100208363 434
833 3300026041 Ga0207639_10061501 Ga0207639_100615013 434
834 3300026067 Ga0207678_10000684 Ga0207678_1000068413 434
835 3300026067 Ga0207678_10001272 Ga0207678_100012724 434
836 3300026067 Ga0207678_10007290 Ga0207678_100072908 434
837 3300026067 Ga0207678_10021085 Ga0207678_100210853 434
838 3300026067 Ga0207678_10029511 Ga0207678_100295113 434
839 3300026067 Ga0207678_10194796 Ga0207678_101947961 434
840 3300026075 Ga0207708_10000650 Ga0207708_100006506 434
841 3300026078 Ga0207702_10000395 Ga0207702_1000039540 434
842 3300026078 Ga0207702_10006552 Ga0207702_100065524 434
843 3300026078 Ga0207702_10016238 Ga0207702_100162387 434
844 3300026088 Ga0207641_10008893 Ga0207641_100088937 434
845 3300026088 Ga0207641_10013468 Ga0207641_100134682 434
846 3300026088 Ga0207641_10029679 Ga0207641_100296795 434
847 3300026088 Ga0207641_10043883 Ga0207641_100438835 434
848 3300026088 Ga0207641_10044803 Ga0207641_100448033 434
849 3300026088 Ga0207641_10059200 Ga0207641_100592003 434
850 3300026088 Ga0207641_10065646 Ga0207641_100656462 434
851 3300026089 Ga0207648_10000716 Ga0207648_100007169 434
852 3300026089 Ga0207648_10000790 Ga0207648_100007907 434
853 3300026089 Ga0207648_10001780 Ga0207648_100017809 434
854 3300026089 Ga0207648_10001903 Ga0207648_1000190313 434
855 3300026089 Ga0207648_10035427 Ga0207648_100354274 434
856 3300026089 Ga0207648_10046721 Ga0207648_100467214 434
857 3300026089 Ga0207648_10264375 Ga0207648_102643751 434
858 3300026095 Ga0207676_10008944 Ga0207676_100089443 434
859 3300026095 Ga0207676_10011836 Ga0207676_100118367 434
860 3300026095 Ga0207676_10040308 Ga0207676_100403083 434
861 3300026095 Ga0207676_10042494 Ga0207676_100424943 434
862 3300026095 Ga0207676_10045701 Ga0207676_100457013 434
863 3300026095 Ga0207676_10133636 Ga0207676_101336362 434
864 3300026095 Ga0207676_10136891 Ga0207676_101368912 434
865 3300026095 Ga0207676_10224750 Ga0207676_102247502 434
866 3300026116 Ga0207674_10000020 Ga0207674_10000020111 434
867 3300026116 Ga0207674_10000769 Ga0207674_1000076923 434
868 3300026116 Ga0207674_10003791 Ga0207674_1000379115 434
869 3300026116 Ga0207674_10007069 Ga0207674_1000706915 434
870 3300026116 Ga0207674_10023942 Ga0207674_100239427 434
871 3300026116 Ga0207674_10038567 Ga0207674_100385673 434
872 3300026118 Ga0207675_100000378 Ga0207675_1000003784 434
873 3300026118 Ga0207675_100003290 Ga0207675_10000329013 434
874 3300026118 Ga0207675_100007853 Ga0207675_1000078537 434
875 3300026118 Ga0207675_100057991 Ga0207675_1000579911 434
876 3300026121 Ga0207683_10000170 Ga0207683_1000017043 434
877 3300026121 Ga0207683_10002101 Ga0207683_1000210110 434
878 3300026121 Ga0207683_10004396 Ga0207683_1000439613 434
879 3300026121 Ga0207683_10011441 Ga0207683_100114417 434
880 3300026121 Ga0207683_10077452 Ga0207683_100774524 434
881 3300026121 Ga0207683_10115081 Ga0207683_101150812 434
882 3300026121 Ga0207683_10141856 Ga0207683_101418561 434
883 3300026121 Ga0207683_10276620 Ga0207683_102766202 434
884 3300026142 Ga0207698_10003199 Ga0207698_1000319910 434
885 3300026142 Ga0207698_10024475 Ga0207698_100244751 434
886 3300026142 Ga0207698_10026941 Ga0207698_100269412 434
887 3300026142 Ga0207698_10029861 Ga0207698_100298613 434
888 3300026142 Ga0207698_10121549 Ga0207698_101215492 434
889 3300026142 Ga0207698_10209038 Ga0207698_102090382 434
890 3300027111 Ga0209281_1000057 Ga0209281_100005722 434
891 3300027296 Ga0209389_1026537 Ga0209389_10265373 434
892 3300027312 Ga0209371_1005713 Ga0209371_10057132 434
893 3300027395 Ga0209996_1002490 Ga0209996_10024902 434
894 3300027471 Ga0209995_1004652 Ga0209995_10046522 434
895 3300027526 Ga0209968_1000857 Ga0209968_10008574 434
896 3300027543 Ga0209999_1004097 Ga0209999_10040972 434
897 3300027666 Ga0209282_1000002 Ga0209282_1000002415 434
898 3300027682 Ga0209971_1017142 Ga0209971_10171422 434
899 3300027695 Ga0209966_1000138 Ga0209966_10001388 434
900 3300027866 Ga0209813_10008471 Ga0209813_100084713 434
901 3300027876 Ga0209974_10039970 Ga0209974_100399701 434
902 3300027907 Ga0207428_10031423 Ga0207428_100314236 434
903 3300028379 Ga0268266_10003715 Ga0268266_100037153 434
904 3300028379 Ga0268266_10014332 Ga0268266_100143325 434
905 3300028379 Ga0268266_10107471 Ga0268266_101074712 434
906 3300028380 Ga0268265_10003358 Ga0268265_100033588 434
907 3300028380 Ga0268265_10025603 Ga0268265_100256034 434
908 3300028380 Ga0268265_10048781 Ga0268265_100487814 434
909 3300028380 Ga0268265_10054205 Ga0268265_100542054 434
910 3300028380 Ga0268265_10090837 Ga0268265_100908372 434
911 3300028381 Ga0268264_10001231 Ga0268264_1000123116 434
912 3300028381 Ga0268264_10004863 Ga0268264_100048633 434
913 3300028381 Ga0268264_10007640 Ga0268264_100076405 434
914 3300028381 Ga0268264_10007924 Ga0268264_100079242 434
915 3300028666 Ga0265336_10000040 Ga0265336_1000004082 434
916 3300028794 Ga0307515_10000080 Ga0307515_1000008028 434
917 3300028794 Ga0307515_10000278 Ga0307515_1000027840 434
918 3300028794 Ga0307515_10001625 Ga0307515_100016257 434
919 3300028794 Ga0307515_10005665 Ga0307515_100056657 434
920 3300028794 Ga0307515_10082381 Ga0307515_100823816 434
921 3300028794 Ga0307515_10093201 Ga0307515_100932013 434
922 3300028794 Ga0307515_10113995 Ga0307515_101139955 434
923 3300029957 Ga0265324_10006429 Ga0265324_100064292 434
924 3300030500 Ga0268256_1007033 Ga0268256_10070332 434
925 3300030500 Ga0268256_1020993 Ga0268256_10209932 434
926 3300030521 Ga0307511_10038018 Ga0307511_100380183 434
927 3300030733 Ga0314311_1020849 Ga0314311_10208495 434
928 3300030742 Ga0316183_1016227 Ga0316183_10162274 434
929 3300031235 Ga0265330_10000044 Ga0265330_100000448 434
930 3300031235 Ga0265330_10000832 Ga0265330_100008326 434
931 3300031235 Ga0265330_10041829 Ga0265330_100418292 434
932 3300031238 Ga0265332_10000023 Ga0265332_1000002381 434
933 3300031238 Ga0265332_10000046 Ga0265332_1000004688 434
934 3300031238 Ga0265332_10000449 Ga0265332_100004496 434
935 3300031238 Ga0265332_10004610 Ga0265332_100046103 434
936 3300031239 Ga0265328_10000223 Ga0265328_100002236 434
937 3300031239 Ga0265328_10008157 Ga0265328_100081572 434
938 3300031239 Ga0265328_10010974 Ga0265328_100109744 434
939 3300031241 Ga0265325_10008283 Ga0265325_100082833 434
940 3300031242 Ga0265329_10002563 Ga0265329_100025634 434
941 3300031250 Ga0265331_10000259 Ga0265331_1000025936 434
942 3300031250 Ga0265331_10003487 Ga0265331_100034878 434
943 3300031250 Ga0265331_10004055 Ga0265331_100040558 434
944 3300031250 Ga0265331_10013276 Ga0265331_100132765 434
945 3300031251 Ga0265327_10000178 Ga0265327_1000017890 434
946 3300031251 Ga0265327_10000475 Ga0265327_1000047536 434
947 3300031251 Ga0265327_10000491 Ga0265327_1000049122 434
948 3300031251 Ga0265327_10000595 Ga0265327_1000059533 434
949 3300031251 Ga0265327_10004926 Ga0265327_1000492612 434
950 3300031251 Ga0265327_10007227 Ga0265327_100072272 434
951 3300031251 Ga0265327_10010623 Ga0265327_100106237 434
952 3300031251 Ga0265327_10034612 Ga0265327_100346122 434
953 3300031251 Ga0265327_10036734 Ga0265327_100367341 434
954 3300031344 Ga0265316_10000180 Ga0265316_1000018049 434
955 3300031456 Ga0307513_10003483 Ga0307513_100034837 434
956 3300031456 Ga0307513_10025212 Ga0307513_100252125 434
957 3300031456 Ga0307513_10119363 Ga0307513_101193632 434
958 3300031507 Ga0307509_10227077 Ga0307509_102270771 434
959 3300031548 Ga0307408_100000023 Ga0307408_100000023128 434
960 3300031548 Ga0307408_100000120 Ga0307408_10000012045 434
961 3300031548 Ga0307408_100000229 Ga0307408_10000022914 434
962 3300031548 Ga0307408_100000311 Ga0307408_10000031121 434
963 3300031548 Ga0307408_100007808 Ga0307408_1000078086 434
964 3300031548 Ga0307408_100020155 Ga0307408_1000201552 434
965 3300031548 Ga0307408_100030047 Ga0307408_1000300473 434
966 3300031548 Ga0307408_100070284 Ga0307408_1000702841 434
967 3300031548 Ga0307408_100080507 Ga0307408_1000805072 434
968 3300031548 Ga0307408_100184344 Ga0307408_1001843442 434
969 3300031649 Ga0307514_10000850 Ga0307514_100008507 434
970 3300031649 Ga0307514_10002962 Ga0307514_1000296213 434
971 3300031711 Ga0265314_10000130 Ga0265314_100001308 434
972 3300031711 Ga0265314_10002601 Ga0265314_1000260111 434
973 3300031711 Ga0265314_10024716 Ga0265314_100247163 434
974 3300031712 Ga0265342_10060454 Ga0265342_100604542 434
975 3300031712 Ga0265342_10069711 Ga0265342_100697112 434
976 3300031730 Ga0307516_10000419 Ga0307516_1000041946 434
977 3300031852 Ga0307410_10010063 Ga0307410_100100632 434
978 3300031852 Ga0307410_10047850 Ga0307410_100478503 434
979 3300031901 Ga0307406_10000591 Ga0307406_1000059114 434
980 3300031901 Ga0307406_10006447 Ga0307406_100064476 434
981 3300031901 Ga0307406_10036487 Ga0307406_100364872 434
982 3300031901 Ga0307406_10067178 Ga0307406_100671781 434
983 3300031903 Ga0307407_10011388 Ga0307407_100113887 434
984 3300031903 Ga0307407_10017978 Ga0307407_100179783 434
985 3300031903 Ga0307407_10067303 Ga0307407_100673032 434
986 3300031911 Ga0307412_10000137 Ga0307412_100001373 434
987 3300031911 Ga0307412_10022497 Ga0307412_100224973 434
988 3300031995 Ga0307409_100003205 Ga0307409_1000032054 434
989 3300032002 Ga0307416_100010461 Ga0307416_1000104618 434
990 3300032002 Ga0307416_100012135 Ga0307416_1000121352 434
991 3300032002 Ga0307416_100014397 Ga0307416_1000143976 434
992 3300032002 Ga0307416_100057427 Ga0307416_1000574272 434
993 3300032004 Ga0307414_10012205 Ga0307414_100122053 434
994 3300032005 Ga0307411_10003633 Ga0307411_100036336 434
995 3300032005 Ga0307411_10018996 Ga0307411_100189962 434
996 3300032005 Ga0307411_10034976 Ga0307411_100349763 434
997 3300032005 Ga0307411_10043625 Ga0307411_100436252 434
998 3300032005 Ga0307411_10079628 Ga0307411_100796282 434
999 3300032126 Ga0307415_100002384 Ga0307415_1000023846 434
1000 3300032126 Ga0307415_100003949 Ga0307415_1000039493 434
1001 3300035086 Ga0373934_0019182 Ga0373934_0019182_888_2237 434
1002 3300035114 Ga0373939_0000022 Ga0373939_0000022_50004_51353 434
1003 3300035121 Ga0373960_0001755 Ga0373960_0001755_1196_2545 434
1004 3300035241 Ga0373961_0032401 Ga0373961_0032401_71_1420 434
1005 3300035242 Ga0373962_0010486 Ga0373962_0010486_631_1980 434
1006 3300035691 Ga0373931_0001704 Ga0373931_0001704_6993_8342 434
1007 3300035691 Ga0373931_0010523 Ga0373931_0010523_2520_3869 434
1008 3300035691 Ga0373931_0068171 Ga0373931_0068171_49_1398 434
1009 3300035692 Ga0373935_0012403 Ga0373935_0012403_2894_4273 434
1010 3300035692 Ga0373935_0130526 Ga0373935_0130526_135_1514 434
1011 3300035695 Ga0373927_0003837 Ga0373927_0003837_4524_5903 434
1012 3300035725 Ga0373947_0010334 Ga0373947_0010334_3247_4626 434
1013 3300036401 Ga0373937_0025916 Ga0373937_0025916_2705_4054 434
1014 3300036401 Ga0373937_0088470 Ga0373937_0088470_1147_2526 434
1015 3300037068 Ga0373925_0111281 Ga0373925_0111281_698_2077 434
1016 3300037068 Ga0373925_0113661 Ga0373925_0113661_627_2006 434
1017 3300037312 Ga0395899_0005885 Ga0395899_0005885_7013_8362 434
1018 3300037418 Ga0395900_0000058 Ga0395900_0000058_203900_205249 434
1019 3300037418 Ga0395900_0029137 Ga0395900_0029137_1199_2548 434
1020 3300037418 Ga0395900_0030417 Ga0395900_0030417_3572_4921 434
1021 3300037418 Ga0395900_0056382 Ga0395900_0056382_536_1885 434
1022 3300037418 Ga0395900_0097540 Ga0395900_0097540_367_1722 434
1023 3300037466 Ga0395898_0008920 Ga0395898_0008920_4137_5486 434
1024 3300037466 Ga0395898_0010179 Ga0395898_0010179_5834_7183 434
1025 3300037466 Ga0395898_0016842 Ga0395898_0016842_4398_5765 434
1026 3300037466 Ga0395898_0083311 Ga0395898_0083311_98_1447 434
1027 3300037471 Ga0395905_0000071 Ga0395905_0000071_130225_131574 434
1028 3300037471 Ga0395905_0000088 Ga0395905_0000088_64079_65428 434
1029 3300037471 Ga0395905_0000573 Ga0395905_0000573_25889_27238 434
1030 3300037471 Ga0395905_0015439 Ga0395905_0015439_3103_4452 434
1031 3300037471 Ga0395905_0018061 Ga0395905_0018061_3916_5265 434
1032 3300037471 Ga0395905_0051424 Ga0395905_0051424_1487_2836 434
1033 3300038443 Ga0395901_0001180 Ga0395901_0001180_15228_16577 434
1034 3300038443 Ga0395901_0003137 Ga0395901_0003137_13471_14838 434
1035 3300038443 Ga0395901_0025819 Ga0395901_0025819_3752_5101 434
1036 3300038443 Ga0395901_0047486 Ga0395901_0047486_1641_2990 434
1037 3300039437 Ga0436365_0582085 Ga0436365_0582085_2561_3910 434
1038 3300039447 Ga0436361_0011584 Ga0436361_0011584_13957_15306 434
1039 3300039447 Ga0436361_0107660 Ga0436361_0107660_34730_36079 434
1040 3300039447 Ga0436361_0419096 Ga0436361_0419096_66_1424 434
1041 3300039447 Ga0436361_0606213 Ga0436361_0606213_4106_5455 434
1042 3300039447 Ga0436361_0745691 Ga0436361_0745691_18635_19984 434
1043 3300039447 Ga0436361_1002234 Ga0436361_1002234_218_1567 434
1044 3300039447 Ga0436361_1206467 Ga0436361_1206467_69228_70577 434
1045 3300039450 Ga0436363_0150920 Ga0436363_0150920_64_1413 434
1046 3300041404 Ga0439436_0029257 Ga0439436_0029257_235_1584 434
1047 3300041413 Ga0439465_0000423 Ga0439465_0000423_4498_5847 434
1048 3300042006 Ga0439432_005010 Ga0439432_005010_3206_4555 434
1049 3300042007 Ga0439449_0001562 Ga0439449_0001562_3133_4482 434
1050 3300042007 Ga0439449_0007914 Ga0439449_0007914_1929_3278 434
1051 3300042126 Ga0450888_000059 Ga0450888_000059_2014_3363 434
1052 3300042129 Ga0450891_000351 Ga0450891_000351_1342_2691 434
1053 3300042130 Ga0450892_000308 Ga0450892_000308_2916_4265 434
1054 3300042157 Ga0439458_0016570 Ga0439458_0016570_163_1536 434
1055 3300042438 Ga0439459_0000260 Ga0439459_0000260_1456_2805 434
1056 3300042531 Ga0450918_000014 Ga0450918_000014_6090_7439 434
1057 3300042532 Ga0450893_0002810 Ga0450893_0002810_1047_2396 434
1058 3300042876 Ga0451577_0006621 Ga0451577_0006621_5182_6585 434
1059 3300042876 Ga0451577_0012849 Ga0451577_0012849_2378_3736 434
1060 3300042876 Ga0451577_0094767 Ga0451577_0094767_88_1440 434
1061 3300044656 Ga0466969_0000013 Ga0466969_0000013_106327_107676 434
1062 3300044656 Ga0466969_0037017 Ga0466969_0037017_602_1951 434
1063 3300044656 Ga0466969_0044383 Ga0466969_0044383_370_1719 434
1064 3300044673 Ga0453683_0002174 Ga0453683_0002174_13345_14694 434
1065 3300044673 Ga0453683_0005267 Ga0453683_0005267_2470_3819 434
1066 3300044673 Ga0453683_0106779 Ga0453683_0106779_115_1518 434
1067 3300044683 Ga0466965_0006141 Ga0466965_0006141_2036_3385 434
1068 3300044684 Ga0466966_0009957 Ga0466966_0009957_4383_5732 434
1069 3300044684 Ga0466966_0018388 Ga0466966_0018388_1474_2823 434
1070 3300044693 Ga0466961_0044285 Ga0466961_0044285_380_1729 434
1071 3300044694 Ga0466963_0004173 Ga0466963_0004173_6153_7502 434
1072 3300044712 Ga0453684_0002114 Ga0453684_0002114_46960_48363 434
1073 3300044719 Ga0466971_0014007 Ga0466971_0014007_155_1504 434
1074 3300044735 Ga0466968_0001837 Ga0466968_0001837_3195_4544 434
1075 3300045049 Ga0466959_0000496 Ga0466959_0000496_1729_3078 434
1076 3300045051 Ga0451576_0000006 Ga0451576_0000006_360320_361675 434
1077 3300045051 Ga0451576_0000652 Ga0451576_0000652_20578_21981 434
1078 3300045051 Ga0451576_0009737 Ga0451576_0009737_7480_8883 434
1079 3300045051 Ga0451576_0028632 Ga0451576_0028632_3078_4427 434
1080 3300045051 Ga0451576_0059479 Ga0451576_0059479_876_2225 434
1081 3300045836 Ga0466958_0014820 Ga0466958_0014820_1273_2622 434
1082 3300045976 Ga0466967_0108574 Ga0466967_0108574_828_2177 434
1083 3300046452 Ga0495617_033429 Ga0495617_033429_126_1568 434
1084 3300046472 Ga0495580_0133247 Ga0495580_0133247_289_1641 434
1085 3300046491 Ga0495584_0001400 Ga0495584_0001400_118_1560 434
1086 3300046491 Ga0495584_0004978 Ga0495584_0004978_3396_4838 434
1087 3300046501 Ga0495607_0000077 Ga0495607_0000077_35691_37040 434
1088 3300046501 Ga0495607_0010586 Ga0495607_0010586_1669_3111 434
1089 3300046506 Ga0495583_0000004 Ga0495583_0000004_137336_138694 434
1090 3300046506 Ga0495583_0000046 Ga0495583_0000046_16700_18049 434
1091 3300046506 Ga0495583_0013210 Ga0495583_0013210_967_2409 434
1092 3300046507 Ga0495606_0020707 Ga0495606_0020707_2783_4132 434
1093 3300046538 Ga0495609_0001453 Ga0495609_0001453_2265_3623 434
1094 3300046539 Ga0495621_0003877 Ga0495621_0003877_1974_3323 434
1095 3300046542 Ga0495597_0000375 Ga0495597_0000375_11175_12530 434
1096 3300046558 Ga0495633_0004494 Ga0495633_0004494_4159_5514 434
1097 3300046615 Ga0495656_0000093 Ga0495656_0000093_5880_7229 434
1098 3300046616 Ga0495668_0000049 Ga0495668_0000049_203319_204764 434
1099 3300046648 Ga0495611_0079152 Ga0495611_0079152_45_1403 434
1100 3300046660 Ga0495625_0004074 Ga0495625_0004074_8980_10338 434
1101 3300046660 Ga0495625_0006471 Ga0495625_0006471_4283_5632 434
1102 3300046664 Ga0495659_0000098 Ga0495659_0000098_8704_10062 434
1103 3300046665 Ga0495661_0043444 Ga0495661_0043444_1068_2510 434
1104 3300046691 Ga0495670_0008483 Ga0495670_0008483_254_1696 434
1105 3300046692 Ga0495671_0007638 Ga0495671_0007638_2592_3941 434
1106 3300046694 Ga0495649_0011764 Ga0495649_0011764_3379_4821 434
1107 3300046794 Ga0495589_0010902 Ga0495589_0010902_3273_4622 434
1108 3300046810 Ga0495660_0010735 Ga0495660_0010735_3907_5265 434
1109 3300047318 Ga0495636_0003721 Ga0495636_0003721_2731_4173 434
1110 3300047320 Ga0495672_0000287 Ga0495672_0000287_34908_36266 434
1111 3300047320 Ga0495672_0015168 Ga0495672_0015168_2275_3633 434
1112 3300047321 Ga0495676_0008226 Ga0495676_0008226_2768_4117 434
1113 3300047443 Ga0495687_000643 Ga0495687_000643_18016_19374 434
1114 3300047447 Ga0495685_000005 Ga0495685_000005_79818_81176 434
1115 3300047472 Ga0495686_0006193 Ga0495686_0006193_6189_7634 434
1116 3300047472 Ga0495686_0083116 Ga0495686_0083116_172_1521 434
1117 3300048904 Ga0496101_0005661 Ga0496101_0005661_6369_7748 434
1118 3300048905 Ga0496102_0001837 Ga0496102_0001837_4609_5988 434
1119 3300048905 Ga0496102_0006345 Ga0496102_0006345_4285_5634 434
1120 3300048905 Ga0496102_0027448 Ga0496102_0027448_2902_4293 434
1121 3300048905 Ga0496102_0174362 Ga0496102_0174362_133_1512 434
1122 3300048906 Ga0496103_0045025 Ga0496103_0045025_1040_2419 434
1123 3300048908 Ga0496105_0004196 Ga0496105_0004196_6943_8322 434
1124 3300048909 Ga0496106_0001298 Ga0496106_0001298_13245_14624 434
1125 3300048909 Ga0496106_0050193 Ga0496106_0050193_101_1480 434
1126 3300048911 Ga0496108_0042186 Ga0496108_0042186_1130_2521 434
1127 3300048911 Ga0496108_0044867 Ga0496108_0044867_650_1999 434
1128 3300048911 Ga0496108_0118934 Ga0496108_0118934_224_1573 434
1129 3300048911 Ga0496108_0143816 Ga0496108_0143816_567_1916 434
1130 3300048911 Ga0496108_0219177 Ga0496108_0219177_212_1591 434
1131 3300048912 Ga0496109_0007893 Ga0496109_0007893_218_1567 434
1132 3300048912 Ga0496109_0047657 Ga0496109_0047657_1756_3105 434
1133 3300048912 Ga0496109_0150330 Ga0496109_0150330_211_1602 434
1134 3300048913 Ga0496110_0028281 Ga0496110_0028281_2085_3464 434
1135 3300048913 Ga0496110_0033140 Ga0496110_0033140_1743_3092 434
1136 3300048915 Ga0496112_0004682 Ga0496112_0004682_6046_7395 434
1137 3300048915 Ga0496112_0013189 Ga0496112_0013189_5155_6534 434
1138 3300048916 Ga0496113_0088749 Ga0496113_0088749_11_1360 434
1139 3300048917 Ga0496114_0013903 Ga0496114_0013903_3916_5277 434
1140 3300048917 Ga0496114_0032648 Ga0496114_0032648_1136_2497 434
1141 3300048918 Ga0496115_0188976 Ga0496115_0188976_52_1428 434
1142 3300048919 Ga0496116_0044124 Ga0496116_0044124_35_1384 434
1143 3300048919 Ga0496116_0132676 Ga0496116_0132676_51_1397 434
1144 3300048921 Ga0496118_0015312 Ga0496118_0015312_4616_5965 434
1145 3300048922 Ga0496119_0019465 Ga0496119_0019465_2611_3957 434
1146 3300048923 Ga0496120_0001170 Ga0496120_0001170_3146_4492 434
1147 3300048924 Ga0496121_0002222 Ga0496121_0002222_2031_3377 434
1148 3300048925 Ga0496122_0001897 Ga0496122_0001897_19700_21046 434
1149 3300048925 Ga0496122_0009581 Ga0496122_0009581_8284_9633 434
1150 3300048926 Ga0496123_0000117 Ga0496123_0000117_4153_5502 434
1151 3300048926 Ga0496123_0004122 Ga0496123_0004122_13218_14564 434
1152 3300048926 Ga0496123_0123840 Ga0496123_0123840_17_1363 434
1153 3300048927 Ga0496124_0015000 Ga0496124_0015000_696_2045 434
1154 3300048927 Ga0496124_0026014 Ga0496124_0026014_3555_4904 434
1155 3300048927 Ga0496124_0095946 Ga0496124_0095946_569_1915 434
1156 3300048927 Ga0496124_0157475 Ga0496124_0157475_51_1397 434
1157 3300048928 Ga0496125_0000096 Ga0496125_0000096_26105_27451 434
1158 3300048928 Ga0496125_0002451 Ga0496125_0002451_4120_5478 434
1159 3300048928 Ga0496125_0005116 Ga0496125_0005116_4877_6238 434
1160 3300048928 Ga0496125_0005319 Ga0496125_0005319_4872_6221 434
1161 3300048928 Ga0496125_0007743 Ga0496125_0007743_5500_6849 434
1162 3300048929 Ga0496126_0053528 Ga0496126_0053528_690_2051 434
1163 3300049130 Ga0501310_000576 Ga0501310_000576_1515_2939 434
1164 3300049460 Ga0495682_0008705 Ga0495682_0008705_1500_2858 434
1165 3300049568 Ga0501031_0001760 Ga0501031_0001760_1737_3083 434
1166 3300049569 Ga0501032_0001745 Ga0501032_0001745_601_1947 434
1167 3300049570 Ga0501033_0003409 Ga0501033_0003409_5597_6943 434
1168 3300049571 Ga0501034_0000812 Ga0501034_0000812_35349_36704 434
1169 3300049571 Ga0501034_0007877 Ga0501034_0007877_6562_7908 434
1170 3300049571 Ga0501034_0103580 Ga0501034_0103580_801_2150 434
1171 3300049572 Ga0501036_0000045 Ga0501036_0000045_36917_38263 434
1172 3300049572 Ga0501036_0061591 Ga0501036_0061591_266_1621 434
1173 3300049573 Ga0501037_0083974 Ga0501037_0083974_876_2234 434
1174 3300049574 Ga0501038_0034042 Ga0501038_0034042_384_1730 434
1175 3300049575 Ga0501039_0023246 Ga0501039_0023246_1851_3206 434
1176 3300049576 Ga0501040_0012175 Ga0501040_0012175_2824_4179 434
1177 3300049577 Ga0501041_0001055 Ga0501041_0001055_1928_3283 434
1178 3300049579 Ga0501043_0000057 Ga0501043_0000057_102468_103817 434
1179 3300049579 Ga0501043_0005247 Ga0501043_0005247_7776_9122 434
1180 3300049580 Ga0501046_0000075 Ga0501046_0000075_102468_103817 434
1181 3300049580 Ga0501046_0001765 Ga0501046_0001765_341_1687 434
1182 3300049581 Ga0501047_0000081 Ga0501047_0000081_102468_103817 434
1183 3300049581 Ga0501047_0008921 Ga0501047_0008921_4910_6256 434
1184 3300049584 Ga0501068_0000043 Ga0501068_0000043_44621_45976 434
1185 3300049584 Ga0501068_0020903 Ga0501068_0020903_890_2245 434
1186 3300049585 Ga0501069_0101324 Ga0501069_0101324_63_1442 434
1187 3300049586 Ga0501070_0060939 Ga0501070_0060939_161_1537 434
1188 3300049588 Ga0501072_0008637 Ga0501072_0008637_6123_7478 434
1189 3300049588 Ga0501072_0011235 Ga0501072_0011235_3069_4424 434
1190 3300049589 Ga0501073_0128095 Ga0501073_0128095_70_1425 434
1191 3300049591 Ga0501075_0006991 Ga0501075_0006991_728_2083 434
1192 3300049592 Ga0501076_0000485 Ga0501076_0000485_9750_11105 434
1193 3300049649 Ga0501198_000012 Ga0501198_000012_63101_64450 434
1194 3300049658 Ga0501211_000908 Ga0501211_000908_1055_2404 434
1195 3300049662 Ga0501222_000010 Ga0501222_000010_63107_64456 434
1196 3300049706 Ga0501229_001568 Ga0501229_001568_440_1789 434
1197 3300049741 Ga0501079_0001659 Ga0501079_0001659_2855_4210 434
1198 3300049742 Ga0501080_0007117 Ga0501080_0007117_7935_9290 434
1199 3300049742 Ga0501080_0008627 Ga0501080_0008627_291_1667 434
1200 3300049742 Ga0501080_0142423 Ga0501080_0142423_352_1707 434
1201 3300049743 Ga0501081_0000006 Ga0501081_0000006_47522_48877 434
1202 3300049744 Ga0501083_0031792 Ga0501083_0031792_945_2321 434
1203 3300049744 Ga0501083_0098652 Ga0501083_0098652_179_1534 434
1204 3300049822 Ga0501035_0001267 Ga0501035_0001267_14335_15681 434
1205 3300049822 Ga0501035_0002689 Ga0501035_0002689_14006_15352 434
1206 3300049822 Ga0501035_0011535 Ga0501035_0011535_5354_6700 434
1207 3300049823 Ga0501044_0001149 Ga0501044_0001149_27123_28472 434
1208 3300049823 Ga0501044_0002780 Ga0501044_0002780_6806_8152 434
1209 3300049823 Ga0501044_0254155 Ga0501044_0254155_111_1460 434
1210 3300049824 Ga0501045_0024826 Ga0501045_0024826_2827_4176 434
1211 3300049824 Ga0501045_0060674 Ga0501045_0060674_697_2052 434
1212 3300050491 nmdc:mga00v17_14465_c1 nmdc:mga00v17_14465_c1_1113_2459 434
1213 3300050491 nmdc:mga00v17_6899_c1 nmdc:mga00v17_6899_c1_2073_3419 434
1214 3300050493 nmdc:mga0k408_25246_c1 nmdc:mga0k408_25246_c1_1114_2463 434
1215 3300050493 nmdc:mga0k408_3641_c1 nmdc:mga0k408_3641_c1_5674_7023 434
1216 3300050493 nmdc:mga0k408_4043_c1 nmdc:mga0k408_4043_c1_4873_6222 434
1217 3300050496 nmdc:mga07m45_13865_c1 nmdc:mga07m45_13865_c1_1601_2950 434
1218 3300050496 nmdc:mga07m45_3956_c1 nmdc:mga07m45_3956_c1_4648_5997 434
1219 3300050496 nmdc:mga07m45_4613_c1 nmdc:mga07m45_4613_c1_2881_4230 434
1220 3300050496 nmdc:mga07m45_4971_c1 nmdc:mga07m45_4971_c1_4808_6157 434
1221 3300050496 nmdc:mga07m45_5876_c1 nmdc:mga07m45_5876_c1_903_2252 434
1222 3300050496 nmdc:mga07m45_7493_c1 nmdc:mga07m45_7493_c1_3096_4445 434
1223 3300050508 nmdc:mga09592_11912_c1 nmdc:mga09592_11912_c1_5337_6686 434
1224 3300050511 nmdc:mga08y16_72716_c1 nmdc:mga08y16_72716_c1_576_1955 434
1225 3300050512 nmdc:mga0n895_12967_c1 nmdc:mga0n895_12967_c1_5732_7111 434
1226 3300050512 nmdc:mga0n895_142307_c1 nmdc:mga0n895_142307_c1_1007_2383 434
1227 3300050512 nmdc:mga0n895_43852_c1 nmdc:mga0n895_43852_c1_2431_3804 434
1228 3300050515 nmdc:mga0a205_2106_c1 nmdc:mga0a205_2106_c1_8561_9940 434
1229 3300053079 Ga0500610_0085524 Ga0500610_0085524_194_1543 434
1230 3300053085 Ga0495619_0082136 Ga0495619_0082136_101_1453 434
1231 3300053086 Ga0500578_0005345 Ga0500578_0005345_2585_3934 434
1232 3300053093 Ga0500651_0001184 Ga0500651_0001184_5398_6747 434
1233 3300053093 Ga0500651_0027777 Ga0500651_0027777_776_2125 434
1234 3300053121 Ga0500607_004076 Ga0500607_004076_4125_5474 434
1235 3300053130 Ga0500642_0026379 Ga0500642_0026379_889_2238 434
1236 3300053134 Ga0500658_0002407 Ga0500658_0002407_814_2163 434
1237 3300053134 Ga0500658_0002684 Ga0500658_0002684_814_2163 434
1238 3300053139 Ga0500568_0004052 Ga0500568_0004052_2110_3459 434
1239 3300053139 Ga0500568_0007818 Ga0500568_0007818_1726_3075 434
1240 3300053141 Ga0500574_003808 Ga0500574_003808_918_2267 434
1241 3300053156 Ga0500622_0004298 Ga0500622_0004298_1953_3302 434
1242 3300053156 Ga0500622_0007377 Ga0500622_0007377_1421_2770 434
1243 3300053730 Ga0500645_002482 Ga0500645_002482_3100_4449 434
1244 3300053730 Ga0500645_002742 Ga0500645_002742_2236_3585 434
1245 3300060353 Ga0501082_0159063 Ga0501082_0159063_200_1555 434
1246 3300061719 Ga0466962_0002133 Ga0466962_0002133_1412_2761 434
1247 3300061734 Ga0530510_0191393 Ga0530510_0191393_67_1422 434
1248 3300005539 Ga0068853_100095644 Ga0068853_1000956441 435
1249 3300031238 Ga0265332_10006133 Ga0265332_100061331 435
1250 iso_pu_bacteria 2599185178 2599446463 435
1251 iso_pu_bacteria 2721755763 2723879473 435
1252 iso_pu_bacteria 2900577576 2900579506 435
1253 iso_pu_bacteria 2928058823 2928061527 435
1254 3300002737 JGI25162J39368_1000032 JGI25162J39368_100003272 436
1255 3300003214 JGI25165J46597_1000067 JGI25165J46597_100006772 436
1256 3300003575 Ga0007409J51694_1023236 Ga0007409J51694_10232365 436
1257 3300003577 Ga0007416J51690_1023564 Ga0007416J51690_10235645 436
1258 3300003693 Ga0032354_1043026 Ga0032354_10430265 436
1259 3300003751 Ga0055538_1000033 Ga0055538_100003372 436
1260 3300003752 Ga0055539_1000045 Ga0055539_100004571 436
1261 3300003756 Ga0055533_1000054 Ga0055533_100005472 436
1262 3300003759 Ga0055525_1000065 Ga0055525_100006572 436
1263 3300003841 Ga0055541_1000031 Ga0055541_100003172 436
1264 3300005535 Ga0070684_100186511 Ga0070684_1001865111 436
1265 3300005539 Ga0068853_100118036 Ga0068853_1001180362 436
1266 3300005548 Ga0070665_100009319 Ga0070665_1000093196 436
1267 3300005614 Ga0068856_100276174 Ga0068856_1002761742 436
1268 3300005616 Ga0068852_100074997 Ga0068852_1000749972 436
1269 3300006051 Ga0075364_10029759 Ga0075364_100297594 436
1270 3300006195 Ga0075366_10001081 Ga0075366_100010818 436
1271 3300013307 Ga0157372_10001079 Ga0157372_100010799 436
1272 3300013307 Ga0157372_10026826 Ga0157372_100268263 436
1273 3300015261 Ga0182006_1031361 Ga0182006_10313612 436
1274 3300015265 Ga0182005_1000492 Ga0182005_10004927 436
1275 3300021361 Ga0213872_10001145 Ga0213872_1000114515 436
1276 3300025207 Ga0209760_101870 Ga0209760_1018701 436
1277 3300025224 Ga0209784_100048 Ga0209784_10004872 436
1278 3300025225 Ga0209566_100060 Ga0209566_10006072 436
1279 3300025226 Ga0209674_100082 Ga0209674_10008272 436
1280 3300025230 Ga0209563_100082 Ga0209563_10008272 436
1281 3300025231 Ga0207427_106060 Ga0207427_1060602 436
1282 3300025233 Ga0209437_100125 Ga0209437_10012571 436
1283 3300025253 Ga0209677_100046 Ga0209677_10004671 436
1284 3300025261 Ga0209233_1000138 Ga0209233_100013871 436
1285 3300025911 Ga0207654_10008442 Ga0207654_100084422 436
1286 3300025924 Ga0207694_10027000 Ga0207694_100270002 436
1287 3300025944 Ga0207661_10132612 Ga0207661_101326122 436
1288 3300026142 Ga0207698_10094438 Ga0207698_100944381 436
1289 3300031344 Ga0265316_10007895 Ga0265316_100078952 436
1290 3300031344 Ga0265316_10040479 Ga0265316_100404792 436
1291 3300031344 Ga0265316_10163950 Ga0265316_101639502 436
1292 3300031507 Ga0307509_10000009 Ga0307509_10000009104 436
1293 3300032133 Ga0316583_10001121 Ga0316583_100011216 436
1294 3300035092 Ga0373952_0000877 Ga0373952_0000877_3395_4750 436
1295 3300037312 Ga0395899_0061853 Ga0395899_0061853_1233_2597 436
1296 3300037418 Ga0395900_0051909 Ga0395900_0051909_914_2281 436
1297 3300037471 Ga0395905_0008958 Ga0395905_0008958_7461_8825 436
1298 3300037471 Ga0395905_0021495 Ga0395905_0021495_1520_2887 436
1299 3300038443 Ga0395901_0273385 Ga0395901_0273385_284_1651 436
1300 3300039447 Ga0436361_0811061 Ga0436361_0811061_24011_25393 436
1301 3300042876 Ga0451577_0000264 Ga0451577_0000264_21780_23138 436
1302 3300044712 Ga0453684_0000189 Ga0453684_0000189_171513_172871 436
1303 3300044712 Ga0453684_0000222 Ga0453684_0000222_182208_183566 436
1304 3300044712 Ga0453684_0003467 Ga0453684_0003467_8749_10113 436
1305 3300044712 Ga0453684_0006132 Ga0453684_0006132_8530_9888 436
1306 3300044712 Ga0453684_0034808 Ga0453684_0034808_886_2250 436
1307 3300045051 Ga0451576_0000096 Ga0451576_0000096_84520_85878 436
1308 3300046462 Ga0495651_0008923 Ga0495651_0008923_1796_3184 436
1309 3300046463 Ga0495653_0005547 Ga0495653_0005547_1719_3101 436
1310 3300046665 Ga0495661_0018781 Ga0495661_0018781_1328_2695 436
1311 3300046690 Ga0495624_0040375 Ga0495624_0040375_1092_2474 436
1312 3300046809 Ga0495600_0003685 Ga0495600_0003685_4009_5391 436
1313 3300047443 Ga0495687_016457 Ga0495687_016457_1554_2921 436
1314 3300049513 Ga0501290_002103 Ga0501290_002103_304_1668 436
1315 3300050493 nmdc:mga0k408_10138_c1 nmdc:mga0k408_10138_c1_815_2179 436
1316 3300053141 Ga0500574_000258 Ga0500574_000258_1217_2599 436
1317 3300053177 Ga0500636_0001052 Ga0500636_0001052_5007_6368 436
1318 iso_pu_bacteria 2510065045 2510252373 436
1319 iso_pu_bacteria 2512047030 2512344702 436
1320 iso_pu_bacteria 2515154122 2515682486 436
1321 iso_pu_bacteria 2718217991 2719641465 436
1322 iso_pu_bacteria 2885270888 2885279729 436
1323 iso_pu_bacteria 2902682994 2902691247 436
1324 3300002705 JGI25156J39149_1000481 JGI25156J39149_100048118 437
1325 3300002705 JGI25156J39149_1010996 JGI25156J39149_10109962 437
1326 3300002737 JGI25162J39368_1006064 JGI25162J39368_10060642 437
1327 3300002738 JGI25154J39366_1000364 JGI25154J39366_100036419 437
1328 3300002738 JGI25154J39366_1000390 JGI25154J39366_100039018 437
1329 3300002741 JGI25157J39369_1000350 JGI25157J39369_10003507 437
1330 3300002741 JGI25157J39369_1000363 JGI25157J39369_100036327 437
1331 3300002741 JGI25157J39369_1001087 JGI25157J39369_10010877 437
1332 3300003751 Ga0055538_1000010 Ga0055538_100001028 437
1333 3300003752 Ga0055539_1000015 Ga0055539_100001528 437
1334 3300003756 Ga0055533_1000018 Ga0055533_100001828 437
1335 3300003758 Ga0055532_1000018 Ga0055532_100001849 437
1336 3300003759 Ga0055525_1000020 Ga0055525_100002028 437
1337 3300003841 Ga0055541_1000011 Ga0055541_100001128 437
1338 3300005289 Ga0065704_10017042 Ga0065704_100170422 437
1339 3300005330 Ga0070690_100000082 Ga0070690_10000008242 437
1340 3300005334 Ga0068869_100000044 Ga0068869_10000004437 437
1341 3300005334 Ga0068869_100097164 Ga0068869_1000971642 437
1342 3300005336 Ga0070680_100001218 Ga0070680_1000012184 437
1343 3300005338 Ga0068868_100000458 Ga0068868_10000045822 437
1344 3300005340 Ga0070689_100007655 Ga0070689_1000076554 437
1345 3300005341 Ga0070691_10000573 Ga0070691_1000057312 437
1346 3300005343 Ga0070687_100000034 Ga0070687_10000003418 437
1347 3300005343 Ga0070687_100099475 Ga0070687_1000994752 437
1348 3300005345 Ga0070692_10004243 Ga0070692_100042437 437
1349 3300005345 Ga0070692_10010496 Ga0070692_100104962 437
1350 3300005353 Ga0070669_100029079 Ga0070669_1000290794 437
1351 3300005435 Ga0070714_100070445 Ga0070714_1000704453 437
1352 3300005438 Ga0070701_10000346 Ga0070701_100003468 437
1353 3300005440 Ga0070705_100000030 Ga0070705_10000003069 437
1354 3300005440 Ga0070705_100001918 Ga0070705_1000019184 437
1355 3300005440 Ga0070705_100010795 Ga0070705_1000107952 437
1356 3300005441 Ga0070700_100000552 Ga0070700_10000055212 437
1357 3300005441 Ga0070700_100003335 Ga0070700_1000033351 437
1358 3300005444 Ga0070694_100000706 Ga0070694_10000070611 437
1359 3300005444 Ga0070694_100021470 Ga0070694_1000214703 437
1360 3300005444 Ga0070694_100027341 Ga0070694_1000273414 437
1361 3300005458 Ga0070681_10000399 Ga0070681_1000039928 437
1362 3300005459 Ga0068867_100000032 Ga0068867_10000003240 437
1363 3300005459 Ga0068867_100000126 Ga0068867_10000012646 437
1364 3300005471 Ga0070698_100005922 Ga0070698_1000059227 437
1365 3300005518 Ga0070699_100008578 Ga0070699_1000085785 437
1366 3300005530 Ga0070679_100003506 Ga0070679_1000035065 437
1367 3300005530 Ga0070679_100021831 Ga0070679_1000218312 437
1368 3300005536 Ga0070697_100000648 Ga0070697_10000064825 437
1369 3300005536 Ga0070697_100000731 Ga0070697_1000007313 437
1370 3300005544 Ga0070686_100001608 Ga0070686_10000160810 437
1371 3300005545 Ga0070695_100000514 Ga0070695_10000051411 437
1372 3300005545 Ga0070695_100007023 Ga0070695_1000070233 437
1373 3300005545 Ga0070695_100018182 Ga0070695_1000181824 437
1374 3300005546 Ga0070696_100000089 Ga0070696_10000008920 437
1375 3300005546 Ga0070696_100004442 Ga0070696_10000444211 437
1376 3300005547 Ga0070693_100000100 Ga0070693_1000001004 437
1377 3300005549 Ga0070704_100001681 Ga0070704_10000168112 437
1378 3300005549 Ga0070704_100002884 Ga0070704_1000028848 437
1379 3300005549 Ga0070704_100027289 Ga0070704_1000272892 437
1380 3300005563 Ga0068855_100002377 Ga0068855_1000023774 437
1381 3300005578 Ga0068854_100002409 Ga0068854_1000024098 437
1382 3300005615 Ga0070702_100000001 Ga0070702_10000000150 437
1383 3300005616 Ga0068852_100000716 Ga0068852_1000007165 437
1384 3300005616 Ga0068852_100110265 Ga0068852_1001102652 437
1385 3300005617 Ga0068859_100000149 Ga0068859_10000014955 437
1386 3300005718 Ga0068866_10000326 Ga0068866_100003262 437
1387 3300005718 Ga0068866_10015900 Ga0068866_100159002 437
1388 3300005719 Ga0068861_100000057 Ga0068861_10000005737 437
1389 3300005719 Ga0068861_100005473 Ga0068861_1000054732 437
1390 3300005841 Ga0068863_100225670 Ga0068863_1002256702 437
1391 3300005842 Ga0068858_100000289 Ga0068858_10000028941 437
1392 3300005843 Ga0068860_100001090 Ga0068860_10000109027 437
1393 3300005843 Ga0068860_100081081 Ga0068860_1000810813 437
1394 3300005844 Ga0068862_100000409 Ga0068862_1000004098 437
1395 3300005844 Ga0068862_100001111 Ga0068862_10000111128 437
1396 3300005985 Ga0081539_10004364 Ga0081539_100043642 437
1397 3300005985 Ga0081539_10005289 Ga0081539_1000528910 437
1398 3300006358 Ga0068871_100003523 Ga0068871_1000035237 437
1399 3300006844 Ga0075428_100000083 Ga0075428_10000008329 437
1400 3300006844 Ga0075428_100018274 Ga0075428_1000182747 437
1401 3300006844 Ga0075428_100039526 Ga0075428_1000395262 437
1402 3300006844 Ga0075428_100060394 Ga0075428_1000603945 437
1403 3300006846 Ga0075430_100000550 Ga0075430_10000055032 437
1404 3300006846 Ga0075430_100006442 Ga0075430_1000064422 437
1405 3300006846 Ga0075430_100016189 Ga0075430_1000161895 437
1406 3300006846 Ga0075430_100191502 Ga0075430_1001915022 437
1407 3300006847 Ga0075431_100061826 Ga0075431_1000618264 437
1408 3300006852 Ga0075433_10001375 Ga0075433_1000137510 437
1409 3300006852 Ga0075433_10230264 Ga0075433_102302641 437
1410 3300006871 Ga0075434_100000064 Ga0075434_10000006447 437
1411 3300006880 Ga0075429_100000480 Ga0075429_10000048025 437
1412 3300006880 Ga0075429_100000511 Ga0075429_1000005119 437
1413 3300006881 Ga0068865_100000059 Ga0068865_10000005948 437
1414 3300006881 Ga0068865_100004646 Ga0068865_1000046461 437
1415 3300006914 Ga0075436_100000050 Ga0075436_10000005016 437
1416 3300006914 Ga0075436_100001875 Ga0075436_10000187510 437
1417 3300006914 Ga0075436_100012843 Ga0075436_1000128432 437
1418 3300006914 Ga0075436_100014805 Ga0075436_1000148052 437
1419 3300006914 Ga0075436_100046841 Ga0075436_1000468413 437
1420 3300006931 Ga0097620_100000149 Ga0097620_10000014920 437
1421 3300006946 Ga0079104_1022477 Ga0079104_10224772 437
1422 3300007076 Ga0075435_100001865 Ga0075435_10000186510 437
1423 3300009093 Ga0105240_10001931 Ga0105240_100019318 437
1424 3300009093 Ga0105240_10002138 Ga0105240_1000213829 437
1425 3300009093 Ga0105240_10048589 Ga0105240_100485896 437
1426 3300009094 Ga0111539_10016839 Ga0111539_100168392 437
1427 3300009094 Ga0111539_10100722 Ga0111539_101007222 437
1428 3300009098 Ga0105245_10000075 Ga0105245_1000007541 437
1429 3300009147 Ga0114129_10000210 Ga0114129_1000021023 437
1430 3300009147 Ga0114129_10002670 Ga0114129_1000267024 437
1431 3300009148 Ga0105243_10000622 Ga0105243_1000062212 437
1432 3300009148 Ga0105243_10007352 Ga0105243_100073522 437
1433 3300009176 Ga0105242_10000407 Ga0105242_1000040712 437
1434 3300009177 Ga0105248_10063230 Ga0105248_100632304 437
1435 3300009551 Ga0105238_10000004 Ga0105238_1000000490 437
1436 3300009553 Ga0105249_10047746 Ga0105249_100477462 437
1437 3300010375 Ga0105239_10003999 Ga0105239_1000399916 437
1438 3300010375 Ga0105239_10101258 Ga0105239_101012582 437
1439 3300013297 Ga0157378_10000074 Ga0157378_1000007454 437
1440 3300013308 Ga0157375_10211826 Ga0157375_102118262 437
1441 3300014745 Ga0157377_10088605 Ga0157377_100886052 437
1442 3300014969 Ga0157376_10008151 Ga0157376_100081517 437
1443 3300025206 Ga0209435_100007 Ga0209435_100007242 437
1444 3300025206 Ga0209435_100283 Ga0209435_1002836 437
1445 3300025224 Ga0209784_100025 Ga0209784_10002528 437
1446 3300025225 Ga0209566_100025 Ga0209566_10002528 437
1447 3300025226 Ga0209674_100042 Ga0209674_10004228 437
1448 3300025229 Ga0209147_100017 Ga0209147_100017230 437
1449 3300025230 Ga0209563_100046 Ga0209563_10004628 437
1450 3300025233 Ga0209437_100088 Ga0209437_10008857 437
1451 3300025242 Ga0209258_100215 Ga0209258_10021562 437
1452 3300025246 Ga0209646_1000044 Ga0209646_100004471 437
1453 3300025246 Ga0209646_1000282 Ga0209646_100028239 437
1454 3300025246 Ga0209646_1000287 Ga0209646_100028739 437
1455 3300025250 Ga0209026_1000353 Ga0209026_10003537 437
1456 3300025250 Ga0209026_1000695 Ga0209026_10006952 437
1457 3300025253 Ga0209677_100027 Ga0209677_10002728 437
1458 3300025256 Ga0209759_1000255 Ga0209759_100025539 437
1459 3300025256 Ga0209759_1000388 Ga0209759_100038839 437
1460 3300025272 Ga0209455_1002735 Ga0209455_10027353 437
1461 3300025898 Ga0207692_10023582 Ga0207692_100235823 437
1462 3300025899 Ga0207642_10023475 Ga0207642_100234752 437
1463 3300025901 Ga0207688_10085517 Ga0207688_100855172 437
1464 3300025907 Ga0207645_10061783 Ga0207645_100617832 437
1465 3300025908 Ga0207643_10012148 Ga0207643_100121484 437
1466 3300025912 Ga0207707_10010999 Ga0207707_100109998 437
1467 3300025913 Ga0207695_10000392 Ga0207695_1000039278 437
1468 3300025913 Ga0207695_10000965 Ga0207695_1000096528 437
1469 3300025913 Ga0207695_10003357 Ga0207695_1000335718 437
1470 3300025914 Ga0207671_10004733 Ga0207671_100047339 437
1471 3300025917 Ga0207660_10005914 Ga0207660_100059146 437
1472 3300025918 Ga0207662_10000166 Ga0207662_1000016620 437
1473 3300025918 Ga0207662_10044611 Ga0207662_100446111 437
1474 3300025921 Ga0207652_10010094 Ga0207652_100100943 437
1475 3300025921 Ga0207652_10015678 Ga0207652_100156786 437
1476 3300025923 Ga0207681_10002154 Ga0207681_100021541 437
1477 3300025924 Ga0207694_10000021 Ga0207694_100000218 437
1478 3300025924 Ga0207694_10079288 Ga0207694_100792883 437
1479 3300025927 Ga0207687_10004570 Ga0207687_100045705 437
1480 3300025929 Ga0207664_10082561 Ga0207664_100825612 437
1481 3300025934 Ga0207686_10000243 Ga0207686_1000024338 437
1482 3300025935 Ga0207709_10000973 Ga0207709_1000097320 437
1483 3300025935 Ga0207709_10003870 Ga0207709_100038702 437
1484 3300025938 Ga0207704_10000178 Ga0207704_1000017820 437
1485 3300025938 Ga0207704_10002073 Ga0207704_1000207311 437
1486 3300025941 Ga0207711_10097044 Ga0207711_100970442 437
1487 3300025942 Ga0207689_10000007 Ga0207689_1000000799 437
1488 3300025942 Ga0207689_10042007 Ga0207689_100420072 437
1489 3300025949 Ga0207667_10086791 Ga0207667_100867912 437
1490 3300025961 Ga0207712_10025918 Ga0207712_100259184 437
1491 3300025972 Ga0207668_10002434 Ga0207668_1000243413 437
1492 3300025981 Ga0207640_10008146 Ga0207640_100081466 437
1493 3300026023 Ga0207677_10001848 Ga0207677_100018485 437
1494 3300026035 Ga0207703_10023940 Ga0207703_100239404 437
1495 3300026075 Ga0207708_10000086 Ga0207708_1000008633 437
1496 3300026075 Ga0207708_10000697 Ga0207708_1000069727 437
1497 3300026078 Ga0207702_10019576 Ga0207702_100195762 437
1498 3300026088 Ga0207641_10041178 Ga0207641_100411784 437
1499 3300026089 Ga0207648_10000079 Ga0207648_1000007940 437
1500 3300026089 Ga0207648_10000352 Ga0207648_1000035221 437
1501 3300026118 Ga0207675_100000093 Ga0207675_10000009342 437
1502 3300026118 Ga0207675_100000802 Ga0207675_10000080210 437
1503 3300026142 Ga0207698_10006485 Ga0207698_100064854 437
1504 3300027111 Ga0209281_1006140 Ga0209281_10061401 437
1505 3300027364 Ga0209967_1004931 Ga0209967_10049312 437
1506 3300027378 Ga0209981_1004790 Ga0209981_10047902 437
1507 3300027395 Ga0209996_1004280 Ga0209996_10042802 437
1508 3300027526 Ga0209968_1006121 Ga0209968_10061212 437
1509 3300027543 Ga0209999_1002904 Ga0209999_10029042 437
1510 3300027665 Ga0209983_1003964 Ga0209983_10039644 437
1511 3300027682 Ga0209971_1007688 Ga0209971_10076882 437
1512 3300027695 Ga0209966_1007455 Ga0209966_10074552 437
1513 3300027907 Ga0207428_10000321 Ga0207428_1000032131 437
1514 3300027907 Ga0207428_10064540 Ga0207428_100645402 437
1515 3300027907 Ga0207428_10134229 Ga0207428_101342291 437
1516 3300028380 Ga0268265_10001027 Ga0268265_100010272 437
1517 3300028380 Ga0268265_10122718 Ga0268265_101227183 437
1518 3300028381 Ga0268264_10001077 Ga0268264_100010776 437
1519 3300028381 Ga0268264_10154094 Ga0268264_101540941 437
1520 3300031238 Ga0265332_10000286 Ga0265332_1000028610 437
1521 3300031548 Ga0307408_100128374 Ga0307408_1001283742 437
1522 3300031665 Ga0316575_10036668 Ga0316575_100366682 437
1523 3300031691 Ga0316579_10000567 Ga0316579_1000056710 437
1524 3300031728 Ga0316578_10005698 Ga0316578_100056987 437
1525 3300032002 Ga0307416_100124260 Ga0307416_1001242601 437
1526 3300032002 Ga0307416_100133080 Ga0307416_1001330802 437
1527 3300032133 Ga0316583_10001803 Ga0316583_100018038 437
1528 3300034820 Ga0373959_0007189 Ga0373959_0007189_132_1508 437
1529 3300035112 Ga0373932_0004126 Ga0373932_0004126_764_2122 437
1530 3300035115 Ga0373941_0008176 Ga0373941_0008176_587_1945 437
1531 3300035118 Ga0373954_0000002 Ga0373954_0000002_81804_83162 437
1532 3300035120 Ga0373957_0017327 Ga0373957_0017327_731_2089 437
1533 3300035241 Ga0373961_0015144 Ga0373961_0015144_339_1697 437
1534 3300035398 Ga0316574_0002445 Ga0316574_0002445_7313_8671 437
1535 3300035724 Ga0373933_0005419 Ga0373933_0005419_2442_3800 437
1536 3300036401 Ga0373937_0000646 Ga0373937_0000646_27397_28755 437
1537 3300036401 Ga0373937_0032248 Ga0373937_0032248_3053_4411 437
1538 3300036647 Ga0316582_0003627 Ga0316582_0003627_764_2125 437
1539 3300037588 Ga0316581_0003650 Ga0316581_0003650_1360_2721 437
1540 3300039447 Ga0436361_0525813 Ga0436361_0525813_1129_2508 437
1541 3300041408 Ga0439453_0008209 Ga0439453_0008209_264_1622 437
1542 3300042001 Ga0439441_000065 Ga0439441_000065_2166_3524 437
1543 3300042001 Ga0439441_000928 Ga0439441_000928_147_1511 437
1544 3300042009 Ga0439451_011620 Ga0439451_011620_384_1742 437
1545 3300042435 Ga0439434_0001264 Ga0439434_0001264_572_1930 437
1546 3300042436 Ga0439435_0003299 Ga0439435_0003299_1330_2688 437
1547 3300042461 Ga0439460_0000389 Ga0439460_0000389_3727_5085 437
1548 3300044712 Ga0453684_0000276 Ga0453684_0000276_172648_174012 437
1549 3300045051 Ga0451576_0000292 Ga0451576_0000292_89640_91004 437
1550 3300045051 Ga0451576_0001306 Ga0451576_0001306_20343_21701 437
1551 3300045051 Ga0451576_0011196 Ga0451576_0011196_611_1969 437
1552 3300045051 Ga0451576_0016912 Ga0451576_0016912_1080_2444 437
1553 3300045976 Ga0466967_0026074 Ga0466967_0026074_1085_2443 437
1554 3300046454 Ga0495592_0004682 Ga0495592_0004682_3527_4885 437
1555 3300046491 Ga0495584_0046315 Ga0495584_0046315_269_1627 437
1556 3300046516 Ga0495628_0005051 Ga0495628_0005051_5211_6569 437
1557 3300046559 Ga0495667_0015056 Ga0495667_0015056_30_1388 437
1558 3300046664 Ga0495659_0011091 Ga0495659_0011091_292_1650 437
1559 3300046684 Ga0495669_0015382 Ga0495669_0015382_846_2204 437
1560 3300047317 Ga0495604_0005868 Ga0495604_0005868_1184_2542 437
1561 3300049570 Ga0501033_0005381 Ga0501033_0005381_4543_5901 437
1562 3300049574 Ga0501038_0012263 Ga0501038_0012263_555_1913 437
1563 3300049575 Ga0501039_0001384 Ga0501039_0001384_9405_10763 437
1564 3300049575 Ga0501039_0085773 Ga0501039_0085773_304_1662 437
1565 3300049576 Ga0501040_0014965 Ga0501040_0014965_2019_3377 437
1566 3300049576 Ga0501040_0124323 Ga0501040_0124323_336_1694 437
1567 3300049577 Ga0501041_0002782 Ga0501041_0002782_6850_8208 437
1568 3300049578 Ga0501042_0030606 Ga0501042_0030606_463_1821 437
1569 3300049578 Ga0501042_0061681 Ga0501042_0061681_801_2159 437
1570 3300049580 Ga0501046_0001396 Ga0501046_0001396_7182_8540 437
1571 3300049580 Ga0501046_0113030 Ga0501046_0113030_439_1797 437
1572 3300049582 Ga0501048_0003347 Ga0501048_0003347_9215_10573 437
1573 3300049584 Ga0501068_0002871 Ga0501068_0002871_5728_7086 437
1574 3300049587 Ga0501071_0002251 Ga0501071_0002251_3267_4625 437
1575 3300049587 Ga0501071_0003110 Ga0501071_0003110_138_1499 437
1576 3300049587 Ga0501071_0058471 Ga0501071_0058471_932_2290 437
1577 3300049588 Ga0501072_0000916 Ga0501072_0000916_14806_16164 437
1578 3300049588 Ga0501072_0001577 Ga0501072_0001577_3969_5327 437
1579 3300049588 Ga0501072_0013576 Ga0501072_0013576_1753_3111 437
1580 3300049588 Ga0501072_0066852 Ga0501072_0066852_1352_2710 437
1581 3300049588 Ga0501072_0108403 Ga0501072_0108403_308_1669 437
1582 3300049590 Ga0501074_0088890 Ga0501074_0088890_124_1482 437
1583 3300049591 Ga0501075_0016691 Ga0501075_0016691_1414_2772 437
1584 3300049591 Ga0501075_0173575 Ga0501075_0173575_210_1568 437
1585 3300049592 Ga0501076_0001817 Ga0501076_0001817_904_2262 437
1586 3300049592 Ga0501076_0002115 Ga0501076_0002115_5445_6803 437
1587 3300049592 Ga0501076_0168690 Ga0501076_0168690_220_1578 437
1588 3300049741 Ga0501079_0001013 Ga0501079_0001013_15482_16840 437
1589 3300049741 Ga0501079_0077296 Ga0501079_0077296_382_1743 437
1590 3300049742 Ga0501080_0006292 Ga0501080_0006292_2988_4349 437
1591 3300049742 Ga0501080_0047336 Ga0501080_0047336_2175_3533 437
1592 3300049743 Ga0501081_0000370 Ga0501081_0000370_14965_16323 437
1593 3300049743 Ga0501081_0106763 Ga0501081_0106763_532_1893 437
1594 3300049822 Ga0501035_0005291 Ga0501035_0005291_2945_4303 437
1595 3300049824 Ga0501045_0002844 Ga0501045_0002844_5107_6465 437
1596 3300049824 Ga0501045_0028422 Ga0501045_0028422_1730_3088 437
1597 3300049824 Ga0501045_0029267 Ga0501045_0029267_2191_3549 437
1598 3300050507 nmdc:mga05p37_132_c1 nmdc:mga05p37_132_c1_17846_19204 437
1599 3300050507 nmdc:mga05p37_209_c1 nmdc:mga05p37_209_c1_24418_25776 437
1600 3300050507 nmdc:mga05p37_82754_c1 nmdc:mga05p37_82754_c1_80_1444 437
1601 3300050508 nmdc:mga09592_150_c1 nmdc:mga09592_150_c1_25339_26697 437
1602 3300050508 nmdc:mga09592_418_c1 nmdc:mga09592_418_c1_14055_15413 437
1603 3300050509 nmdc:mga0qj67_14809_c1 nmdc:mga0qj67_14809_c1_1915_3273 437
1604 3300050510 nmdc:mga06r32_25037_c1 nmdc:mga06r32_25037_c1_61_1419 437
1605 3300050511 nmdc:mga08y16_2590_c1 nmdc:mga08y16_2590_c1_3333_4691 437
1606 3300050511 nmdc:mga08y16_28103_c1 nmdc:mga08y16_28103_c1_3242_4600 437
1607 3300050512 nmdc:mga0n895_960_c1 nmdc:mga0n895_960_c1_10097_11455 437
1608 3300050513 nmdc:mga0rr50_1253_c1 nmdc:mga0rr50_1253_c1_9440_10798 437
1609 3300050513 nmdc:mga0rr50_62672_c1 nmdc:mga0rr50_62672_c1_400_1758 437
1610 3300050514 nmdc:mga08x19_18940_c1 nmdc:mga08x19_18940_c1_1581_2939 437
1611 3300050514 nmdc:mga08x19_19190_c1 nmdc:mga08x19_19190_c1_663_2021 437
1612 3300050514 nmdc:mga08x19_22183_c1 nmdc:mga08x19_22183_c1_1128_2486 437
1613 3300050514 nmdc:mga08x19_27396_c1 nmdc:mga08x19_27396_c1_2117_3475 437
1614 3300050514 nmdc:mga08x19_55_c1 nmdc:mga08x19_55_c1_65221_66579 437
1615 3300050515 nmdc:mga0a205_1791_c1 nmdc:mga0a205_1791_c1_15553_16911 437
1616 3300059424 Ga0590075_023618 Ga0590075_023618_77_1435 437
1617 3300059426 Ga0590077_013586 Ga0590077_013586_22_1380 437
1618 3300060353 Ga0501082_0007944 Ga0501082_0007944_1610_2968 437
1619 3300061734 Ga0530510_0000308 Ga0530510_0000308_19220_20578 437
1620 3300061734 Ga0530510_0001081 Ga0530510_0001081_10555_11913 437
1621 iso_pu_bacteria 2501025501 2501072997 437
1622 iso_pu_bacteria 2501025502 2501081594 437
1623 iso_pu_bacteria 2501025504 2501407927 437
1624 iso_pu_bacteria 2508501125 2509131085 437
1625 iso_pu_bacteria 2510917013 2511085532 437
1626 iso_pu_bacteria 2510917014 2511095673 437
1627 iso_pu_bacteria 2510917015 2511103574 437
1628 iso_pu_bacteria 2513237082 2513556982 437
1629 iso_pu_bacteria 2513237083 2513564514 437
1630 iso_pu_bacteria 2513237151 2513963009 437
1631 iso_pu_bacteria 2513237166 2514046153 437
1632 iso_pu_bacteria 2515154123 2515690346 437
1633 iso_pu_bacteria 2515154189 2516023752 437
1634 iso_pu_bacteria 2519103095 2519457754 437
1635 iso_pu_bacteria 2526164713 2527080123 437
1636 iso_pu_bacteria 2562617112 2563061770 437
1637 iso_pu_bacteria 2582581311 2585294559 437
1638 iso_pu_bacteria 2599185239 2599736874 437
1639 iso_pu_bacteria 2599185240 2599743006 437
1640 iso_pu_bacteria 2599185355 2600205124 437
1641 iso_pu_bacteria 2600255067 2600813723 437
1642 iso_pu_bacteria 2675903129 2676742113 437
1643 iso_pu_bacteria 2711768613 2713478396 437
1644 iso_pu_bacteria 2738541296 2738824428 437
1645 iso_pu_bacteria 2738541298 2738836837 437
1646 iso_pu_bacteria 2738541306 2738878368 437
1647 iso_pu_bacteria 2738543002 2739190060 437
1648 iso_pu_bacteria 2738543008 2739224961 437
1649 iso_pu_bacteria 2744054900 2746088882 437
1650 iso_pu_bacteria 2744054901 2746096492 437
1651 iso_pu_bacteria 2751185846 2753569606 437
1652 iso_pu_bacteria 2791355137 2792835763 437
1653 iso_pu_bacteria 2808606384 2808971712 437
1654 iso_pu_bacteria 2808606390 2809006541 437
1655 iso_pu_bacteria 2808606391 2809013541 437
1656 iso_pu_bacteria 2816332253 2817259941 437
1657 iso_pu_bacteria 2816332256 2817277604 437
1658 iso_pu_bacteria 2816332286 2817456983 437
1659 iso_pu_bacteria 2818991450 2819623459 437
1660 iso_pu_bacteria 2818991452 2819632375 437
1661 iso_pu_bacteria 2842324504 2842324564 437
1662 iso_pu_bacteria 2842348783 2842348843 437
1663 iso_pu_bacteria 2842454564 2842457451 437
1664 iso_pu_bacteria 2856287931 2856290934 437
1665 iso_pu_bacteria 2857357740 2857363681 437
1666 iso_pu_bacteria 2863421361 2863421419 437
1667 iso_pu_bacteria 2870068957 2870069153 437
1668 iso_pu_bacteria 2883087390 2883095330 437
1669 iso_pu_bacteria 2900634093 2900637278 437
1670 iso_pu_bacteria 2904483920 2904487889 437
1671 iso_pu_bacteria 2904564687 2904565600 437
1672 iso_pu_bacteria 2904571731 2904572643 437
1673 iso_pu_bacteria 2904615490 2904619013 437
1674 iso_pu_bacteria 2919527303 2919529193 437
1675 iso_pu_bacteria 2928108538 2928113604 437
1676 iso_pu_bacteria 2928135762 2928140683 437
1677 iso_pu_bacteria 2928157003 2928159992 437
1678 iso_pu_bacteria 2928163908 2928163967 437
1679 iso_pu_bacteria 2928170801 2928177177 437
1680 iso_pu_bacteria 2928503688 2928506200 437
1681 iso_pu_bacteria 2928536128 2928538834 437
1682 iso_pu_bacteria 2945934425 2945938168 437
1683 iso_pu_bacteria 2981990288 2981994433 437
1684 iso_pu_bacteria 2990703756 2990705114 437
1685 iso_pu_bacteria 641736151 642426169 437
1686 iso_pu_bacteria 641736154 642416976 437
1687 iso_pu_bacteria 642555113 642623000 437
1688 iso_pu_bacteria 8003955200 8003960979 437
1689 iso_pu_bacteria 8018845410 8018849509 437
1690 iso_pu_bacteria 8020807995 8020809943 437
1691 iso_pu_bacteria 8020938398 8020939505 437
1692 iso_pu_bacteria 8020945358 8020947552 437
1693 iso_pu_bacteria 8020953355 8020953913 437
1694 iso_pu_bacteria 8021120328 8021126884 437
1695 iso_pu_bacteria 8039098773 8039099832 437
1696 iso_pu_bacteria 8040167225 8040170863 437
1697 iso_pu_bacteria 8040173305 8040175223 437
1698 iso_pu_bacteria 8055266321 8055267473 437
1699 iso_pu_bacteria 8055301274 8055308196 437
1700 3300002067 JGI24735J21928_10000832 JGI24735J21928_100008325 438
1701 3300005339 Ga0070660_100002928 Ga0070660_1000029289 438
1702 3300005563 Ga0068855_100003246 Ga0068855_10000324610 438
1703 3300009036 Ga0105244_10001171 Ga0105244_100011718 438
1704 3300009093 Ga0105240_10001607 Ga0105240_1000160714 438
1705 3300009545 Ga0105237_10007711 Ga0105237_100077117 438
1706 3300010375 Ga0105239_10009931 Ga0105239_100099318 438
1707 3300013104 Ga0157370_10004787 Ga0157370_100047879 438
1708 3300013105 Ga0157369_10010537 Ga0157369_1001053710 438
1709 3300013296 Ga0157374_10000055 Ga0157374_1000005555 438
1710 3300014497 Ga0182008_10061469 Ga0182008_100614692 438
1711 3300025904 Ga0207647_10000869 Ga0207647_1000086914 438
1712 3300025913 Ga0207695_10004740 Ga0207695_1000474014 438
1713 3300025914 Ga0207671_10009196 Ga0207671_100091965 438
1714 3300025919 Ga0207657_10004640 Ga0207657_100046409 438
1715 3300025949 Ga0207667_10002443 Ga0207667_1000244314 438
1716 3300037418 Ga0395900_0091031 Ga0395900_0091031_442_1809 438
1717 3300042005 Ga0439448_0004211 Ga0439448_0004211_662_2029 438
1718 3300047469 Ga0495673_0000037 Ga0495673_0000037_296199_297578 438
1719 3300005339 Ga0070660_100000501 Ga0070660_1000005011 439
1720 3300005344 Ga0070661_100010308 Ga0070661_1000103086 439
1721 3300005366 Ga0070659_100100216 Ga0070659_1001002162 439
1722 3300025919 Ga0207657_10000350 Ga0207657_100003503 439
1723 3300025920 Ga0207649_10009525 Ga0207649_100095254 439
1724 3300025932 Ga0207690_10001117 Ga0207690_1000111711 439
1725 3300025932 Ga0207690_10003937 Ga0207690_100039376 439
1726 3300025945 Ga0207679_10000678 Ga0207679_1000067811 439
1727 3300037312 Ga0395899_0001004 Ga0395899_0001004_2761_4140 439
1728 3300037312 Ga0395899_0008814 Ga0395899_0008814_5348_6727 439
1729 3300037312 Ga0395899_0053745 Ga0395899_0053745_989_2374 439
1730 3300037418 Ga0395900_0003080 Ga0395900_0003080_8976_10355 439
1731 3300037466 Ga0395898_0005866 Ga0395898_0005866_6460_7839 439
1732 3300037471 Ga0395905_0000256 Ga0395905_0000256_43409_44788 439
1733 3300037471 Ga0395905_0008405 Ga0395905_0008405_2158_3537 439
1734 3300038443 Ga0395901_0019567 Ga0395901_0019567_3634_5013 439
1735 3300044658 Ga0466972_0009476 Ga0466972_0009476_2114_3481 439
1736 3300044693 Ga0466961_0000735 Ga0466961_0000735_3511_4878 439
1737 3300044735 Ga0466968_0014411 Ga0466968_0014411_1390_2757 439
1738 3300046452 Ga0495617_000056 Ga0495617_000056_30764_32140 439
1739 3300046463 Ga0495653_0000007 Ga0495653_0000007_282382_283758 439
1740 3300046471 Ga0495650_0000551 Ga0495650_0000551_8746_10122 439
1741 3300046512 Ga0495610_0000004 Ga0495610_0000004_826533_827909 439
1742 3300046692 Ga0495671_0001397 Ga0495671_0001397_12231_13607 439
1743 3300047446 Ga0495679_009541 Ga0495679_009541_1491_2867 439
1744 3300047469 Ga0495673_0000017 Ga0495673_0000017_512568_513944 439
1745 3300047469 Ga0495673_0000027 Ga0495673_0000027_331973_333349 439
1746 3300048926 Ga0496123_0005495 Ga0496123_0005495_10140_11516 439
1747 3300061719 Ga0466962_0042982 Ga0466962_0042982_151_1530 439
1748 3300002067 JGI24735J21928_10000206 JGI24735J21928_100002064 440
1749 3300002738 JGI25154J39366_1002246 JGI25154J39366_10022462 440
1750 3300002774 JGI25150J39212_1004951 JGI25150J39212_10049512 440
1751 3300003215 JGI25153J46596_10006426 JGI25153J46596_100064264 440
1752 3300003763 Ga0055529_1000127 Ga0055529_1000127103 440
1753 3300003771 Ga0055526_1000111 Ga0055526_10001119 440
1754 3300003771 Ga0055526_1000179 Ga0055526_100017910 440
1755 3300005262 Ga0065165_1000986 Ga0065165_10009869 440
1756 3300005288 Ga0065714_10083375 Ga0065714_100833752 440
1757 3300006946 Ga0079104_1007036 Ga0079104_10070363 440
1758 3300009011 Ga0105251_10001046 Ga0105251_1000104616 440
1759 3300009036 Ga0105244_10000592 Ga0105244_100005926 440
1760 3300015261 Ga0182006_1000046 Ga0182006_100004681 440
1761 3300015261 Ga0182006_1000060 Ga0182006_1000060112 440
1762 3300015262 Ga0182007_10000044 Ga0182007_1000004421 440
1763 3300015265 Ga0182005_1000003 Ga0182005_1000003415 440
1764 3300015265 Ga0182005_1000032 Ga0182005_100003280 440
1765 3300017792 Ga0163161_10016204 Ga0163161_100162044 440
1766 3300025233 Ga0209437_102154 Ga0209437_1021542 440
1767 3300025245 Ga0207425_1005212 Ga0207425_10052122 440
1768 3300025246 Ga0209646_1000047 Ga0209646_1000047119 440
1769 3300025272 Ga0209455_1000051 Ga0209455_1000051120 440
1770 3300025295 Ga0209564_1000006 Ga0209564_1000006498 440
1771 3300025295 Ga0209564_1000595 Ga0209564_100059511 440
1772 3300025297 Ga0209758_1002048 Ga0209758_100204818 440
1773 3300025302 Ga0207426_1002871 Ga0207426_100287111 440
1774 3300025735 Ga0207713_1004054 Ga0207713_10040543 440
1775 3300025904 Ga0207647_10033510 Ga0207647_100335104 440
1776 3300031711 Ga0265314_10036975 Ga0265314_100369753 440
1777 3300032004 Ga0307414_10012514 Ga0307414_100125143 440
1778 3300035114 Ga0373939_0006811 Ga0373939_0006811_523_1902 440
1779 3300037466 Ga0395898_0064271 Ga0395898_0064271_1884_3284 440
1780 3300039447 Ga0436361_0026980 Ga0436361_0026980_10843_12228 440
1781 3300039447 Ga0436361_0143364 Ga0436361_0143364_1524_2909 440
1782 3300044658 Ga0466972_0000029 Ga0466972_0000029_144930_146312 440
1783 3300046452 Ga0495617_000002 Ga0495617_000002_221801_223216 440
1784 3300046453 Ga0495627_000016 Ga0495627_000016_309315_310700 440
1785 3300046453 Ga0495627_001427 Ga0495627_001427_1150_2565 440
1786 3300046455 Ga0495603_0022521 Ga0495603_0022521_620_2032 440
1787 3300046457 Ga0495590_0000035 Ga0495590_0000035_98629_100014 440
1788 3300046459 Ga0495629_0054282 Ga0495629_0054282_1012_2424 440
1789 3300046460 Ga0495638_0000172 Ga0495638_0000172_18369_19754 440
1790 3300046460 Ga0495638_0000172 Ga0495638_0000172_80819_82204 440
1791 3300046463 Ga0495653_0035367 Ga0495653_0035367_1204_2607 440
1792 3300046471 Ga0495650_0000056 Ga0495650_0000056_250566_251951 440
1793 3300046471 Ga0495650_0000105 Ga0495650_0000105_166550_167938 440
1794 3300046471 Ga0495650_0001315 Ga0495650_0001315_12596_13975 440
1795 3300046473 Ga0495582_0001028 Ga0495582_0001028_9361_10761 440
1796 3300046474 Ga0495605_0000015 Ga0495605_0000015_157680_159059 440
1797 3300046474 Ga0495605_0006706 Ga0495605_0006706_3603_5003 440
1798 3300046491 Ga0495584_0000022 Ga0495584_0000022_9317_10717 440
1799 3300046491 Ga0495584_0003124 Ga0495584_0003124_7387_8793 440
1800 3300046492 Ga0495585_0005510 Ga0495585_0005510_3490_4890 440
1801 3300046492 Ga0495585_0014494 Ga0495585_0014494_1473_2879 440
1802 3300046499 Ga0495594_0058875 Ga0495594_0058875_666_2066 440
1803 3300046500 Ga0495596_0002563 Ga0495596_0002563_1100_2515 440
1804 3300046500 Ga0495596_0010316 Ga0495596_0010316_512_1912 440
1805 3300046501 Ga0495607_0006325 Ga0495607_0006325_6516_7931 440
1806 3300046501 Ga0495607_0006614 Ga0495607_0006614_479_1885 440
1807 3300046506 Ga0495583_0000257 Ga0495583_0000257_9735_11138 440
1808 3300046506 Ga0495583_0000892 Ga0495583_0000892_27106_28506 440
1809 3300046507 Ga0495606_0000673 Ga0495606_0000673_11538_12926 440
1810 3300046507 Ga0495606_0000739 Ga0495606_0000739_11044_12423 440
1811 3300046507 Ga0495606_0001991 Ga0495606_0001991_2760_4148 440
1812 3300046507 Ga0495606_0008434 Ga0495606_0008434_6773_8173 440
1813 3300046512 Ga0495610_0000765 Ga0495610_0000765_3983_5362 440
1814 3300046512 Ga0495610_0003702 Ga0495610_0003702_7577_8977 440
1815 3300046512 Ga0495610_0009906 Ga0495610_0009906_758_2143 440
1816 3300046513 Ga0495616_0056065 Ga0495616_0056065_459_1874 440
1817 3300046517 Ga0495630_0009746 Ga0495630_0009746_2484_3884 440
1818 3300046518 Ga0495631_0057372 Ga0495631_0057372_69_1481 440
1819 3300046519 Ga0495632_0000148 Ga0495632_0000148_61446_62861 440
1820 3300046520 Ga0495637_0000006 Ga0495637_0000006_251041_252441 440
1821 3300046522 Ga0495643_0000310 Ga0495643_0000310_36254_37639 440
1822 3300046523 Ga0495644_0007340 Ga0495644_0007340_445_1860 440
1823 3300046524 Ga0495648_0000035 Ga0495648_0000035_34661_36046 440
1824 3300046524 Ga0495648_0005704 Ga0495648_0005704_1645_3030 440
1825 3300046526 Ga0495666_0000744 Ga0495666_0000744_1111_2511 440
1826 3300046528 Ga0495642_0000569 Ga0495642_0000569_9545_10960 440
1827 3300046529 Ga0495652_0036945 Ga0495652_0036945_546_1949 440
1828 3300046530 Ga0495654_0000005 Ga0495654_0000005_460172_461551 440
1829 3300046536 Ga0495587_0037483 Ga0495587_0037483_71_1474 440
1830 3300046536 Ga0495587_0053892 Ga0495587_0053892_136_1536 440
1831 3300046538 Ga0495609_0016904 Ga0495609_0016904_955_2367 440
1832 3300046542 Ga0495597_0000993 Ga0495597_0000993_10179_11564 440
1833 3300046542 Ga0495597_0002415 Ga0495597_0002415_2659_4059 440
1834 3300046542 Ga0495597_0025190 Ga0495597_0025190_122_1522 440
1835 3300046557 Ga0495622_0011709 Ga0495622_0011709_1654_3066 440
1836 3300046558 Ga0495633_0000832 Ga0495633_0000832_24913_26298 440
1837 3300046558 Ga0495633_0001682 Ga0495633_0001682_4566_5981 440
1838 3300046558 Ga0495633_0034734 Ga0495633_0034734_780_2189 440
1839 3300046616 Ga0495668_0000870 Ga0495668_0000870_29780_31159 440
1840 3300046616 Ga0495668_0020897 Ga0495668_0020897_2059_3465 440
1841 3300046642 Ga0495634_0051931 Ga0495634_0051931_595_1998 440
1842 3300046648 Ga0495611_0001771 Ga0495611_0001771_4305_5711 440
1843 3300046648 Ga0495611_0010876 Ga0495611_0010876_1937_3337 440
1844 3300046660 Ga0495625_0055158 Ga0495625_0055158_1301_2701 440
1845 3300046665 Ga0495661_0008775 Ga0495661_0008775_776_2176 440
1846 3300046665 Ga0495661_0032557 Ga0495661_0032557_479_1885 440
1847 3300046679 Ga0495623_0017230 Ga0495623_0017230_2866_4233 440
1848 3300046679 Ga0495623_0049866 Ga0495623_0049866_305_1708 440
1849 3300046684 Ga0495669_0000400 Ga0495669_0000400_8623_10035 440
1850 3300046691 Ga0495670_0015421 Ga0495670_0015421_689_2101 440
1851 3300046691 Ga0495670_0032960 Ga0495670_0032960_505_1905 440
1852 3300046692 Ga0495671_0039861 Ga0495671_0039861_528_1928 440
1853 3300046694 Ga0495649_0014413 Ga0495649_0014413_420_1829 440
1854 3300046794 Ga0495589_0002800 Ga0495589_0002800_3960_5360 440
1855 3300046809 Ga0495600_0004228 Ga0495600_0004228_343_1746 440
1856 3300046810 Ga0495660_0003819 Ga0495660_0003819_7375_8781 440
1857 3300047317 Ga0495604_0030292 Ga0495604_0030292_1559_2962 440
1858 3300047318 Ga0495636_0003685 Ga0495636_0003685_3184_4584 440
1859 3300047318 Ga0495636_0006799 Ga0495636_0006799_3068_4468 440
1860 3300047320 Ga0495672_0000118 Ga0495672_0000118_4946_6346 440
1861 3300047323 Ga0495683_0005405 Ga0495683_0005405_4125_5531 440
1862 3300047443 Ga0495687_000032 Ga0495687_000032_206347_207714 440
1863 3300047443 Ga0495687_000166 Ga0495687_000166_14060_15475 440
1864 3300047443 Ga0495687_000210 Ga0495687_000210_10199_11599 440
1865 3300047443 Ga0495687_001343 Ga0495687_001343_1289_2674 440
1866 3300047443 Ga0495687_001347 Ga0495687_001347_20187_21572 440
1867 3300047444 Ga0495675_0028520 Ga0495675_0028520_496_1899 440
1868 3300047469 Ga0495673_0020230 Ga0495673_0020230_534_1934 440
1869 3300047470 Ga0495681_0011149 Ga0495681_0011149_3949_5349 440
1870 3300047470 Ga0495681_0059223 Ga0495681_0059223_83_1483 440
1871 3300047472 Ga0495686_0006400 Ga0495686_0006400_4906_6306 440
1872 3300047673 Ga0495593_0005042 Ga0495593_0005042_4327_5742 440
1873 3300047673 Ga0495593_0008112 Ga0495593_0008112_1393_2796 440
1874 3300048088 Ga0495602_0023478 Ga0495602_0023478_1072_2475 440
1875 3300048091 Ga0495626_0000034 Ga0495626_0000034_11507_12916 440
1876 3300048091 Ga0495626_0013978 Ga0495626_0013978_2199_3608 440
1877 3300048904 Ga0496101_0067158 Ga0496101_0067158_693_2060 440
1878 3300048905 Ga0496102_0007112 Ga0496102_0007112_5539_6906 440
1879 3300048910 Ga0496107_0012714 Ga0496107_0012714_2646_4055 440
1880 3300048910 Ga0496107_0051882 Ga0496107_0051882_558_1925 440
1881 3300048913 Ga0496110_0015135 Ga0496110_0015135_647_2047 440
1882 3300048920 Ga0496117_0000010 Ga0496117_0000010_82395_83810 440
1883 3300048921 Ga0496118_0000009 Ga0496118_0000009_528145_529560 440
1884 3300048924 Ga0496121_0008669 Ga0496121_0008669_3852_5216 440
1885 3300048924 Ga0496121_0020196 Ga0496121_0020196_3891_5306 440
1886 3300048925 Ga0496122_0043812 Ga0496122_0043812_1711_3078 440
1887 3300048926 Ga0496123_0024459 Ga0496123_0024459_706_2073 440
1888 3300048927 Ga0496124_0047432 Ga0496124_0047432_1548_2915 440
1889 3300048928 Ga0496125_0007861 Ga0496125_0007861_1062_2453 440
1890 3300048929 Ga0496126_0156876 Ga0496126_0156876_198_1562 440
1891 3300049459 Ga0495678_000001 Ga0495678_000001_727321_728706 440
1892 3300049459 Ga0495678_006525 Ga0495678_006525_547_1932 440
1893 3300049460 Ga0495682_0032943 Ga0495682_0032943_176_1576 440
1894 3300053125 Ga0500618_001245 Ga0500618_001245_7048_8427 440
1895 3300001979 JGI24740J21852_10000902 JGI24740J21852_1000090211 441
1896 3300001979 JGI24740J21852_10026257 JGI24740J21852_100262572 441
1897 3300001989 JGI24739J22299_10001586 JGI24739J22299_100015864 441
1898 3300001989 JGI24739J22299_10012346 JGI24739J22299_100123463 441
1899 3300001989 JGI24739J22299_10013738 JGI24739J22299_100137383 441
1900 3300001990 JGI24737J22298_10028174 JGI24737J22298_100281742 441
1901 3300002067 JGI24735J21928_10001906 JGI24735J21928_100019062 441
1902 3300002067 JGI24735J21928_10008427 JGI24735J21928_100084272 441
1903 3300002067 JGI24735J21928_10035280 JGI24735J21928_100352801 441
1904 3300002075 JGI24738J21930_10004100 JGI24738J21930_100041003 441
1905 3300002705 JGI25156J39149_1002143 JGI25156J39149_10021434 441
1906 3300002705 JGI25156J39149_1003079 JGI25156J39149_10030793 441
1907 3300002705 JGI25156J39149_1003106 JGI25156J39149_10031063 441
1908 3300003214 JGI25165J46597_1001096 JGI25165J46597_10010963 441
1909 3300003354 JGI25160J50197_1000267 JGI25160J50197_10002676 441
1910 3300003756 Ga0055533_1001062 Ga0055533_10010623 441
1911 3300003758 Ga0055532_1000147 Ga0055532_100014717 441
1912 3300003760 Ga0055527_1000093 Ga0055527_100009317 441
1913 3300003761 Ga0055535_1000094 Ga0055535_100009444 441
1914 3300003762 Ga0055542_1000131 Ga0055542_100013144 441
1915 3300003763 Ga0055529_1000238 Ga0055529_100023844 441
1916 3300003790 Ga0055528_1002575 Ga0055528_10025754 441
1917 3300003856 Ga0058692_1002107 Ga0058692_10021072 441
1918 3300005262 Ga0065165_1001067 Ga0065165_10010676 441
1919 3300005327 Ga0070658_10073950 Ga0070658_100739501 441
1920 3300005335 Ga0070666_10019208 Ga0070666_100192084 441
1921 3300005339 Ga0070660_100000030 Ga0070660_10000003061 441
1922 3300005366 Ga0070659_100000124 Ga0070659_10000012431 441
1923 3300005366 Ga0070659_100010328 Ga0070659_1000103283 441
1924 3300005455 Ga0070663_100000037 Ga0070663_10000003729 441
1925 3300005455 Ga0070663_100018966 Ga0070663_1000189664 441
1926 3300005455 Ga0070663_100033511 Ga0070663_1000335111 441
1927 3300005563 Ga0068855_100001358 Ga0068855_10000135816 441
1928 3300009011 Ga0105251_10001356 Ga0105251_1000135619 441
1929 3300009011 Ga0105251_10022391 Ga0105251_100223914 441
1930 3300009093 Ga0105240_10022347 Ga0105240_100223478 441
1931 3300009093 Ga0105240_10164018 Ga0105240_101640183 441
1932 3300009545 Ga0105237_10250797 Ga0105237_102507972 441
1933 3300009551 Ga0105238_10006909 Ga0105238_1000690911 441
1934 3300010375 Ga0105239_10009186 Ga0105239_100091863 441
1935 3300013104 Ga0157370_10003689 Ga0157370_100036892 441
1936 3300013105 Ga0157369_10000416 Ga0157369_1000041639 441
1937 3300013105 Ga0157369_10002445 Ga0157369_1000244521 441
1938 3300013105 Ga0157369_10009680 Ga0157369_100096806 441
1939 3300013105 Ga0157369_10047477 Ga0157369_100474775 441
1940 3300013306 Ga0163162_10011113 Ga0163162_100111132 441
1941 3300013308 Ga0157375_10004718 Ga0157375_100047188 441
1942 3300015262 Ga0182007_10002507 Ga0182007_100025078 441
1943 3300016635 Ga0183361_10012 Ga0183361_10012157 441
1944 3300022467 Ga0224712_10000681 Ga0224712_100006816 441
1945 3300025225 Ga0209566_102058 Ga0209566_1020583 441
1946 3300025226 Ga0209674_100013 Ga0209674_100013710 441
1947 3300025226 Ga0209674_100235 Ga0209674_10023530 441
1948 3300025228 Ga0209672_100010 Ga0209672_100010763 441
1949 3300025228 Ga0209672_100028 Ga0209672_10002822 441
1950 3300025228 Ga0209672_100159 Ga0209672_10015934 441
1951 3300025228 Ga0209672_101163 Ga0209672_1011637 441
1952 3300025229 Ga0209147_100006 Ga0209147_100006763 441
1953 3300025230 Ga0209563_101002 Ga0209563_1010023 441
1954 3300025231 Ga0207427_100675 Ga0207427_1006753 441
1955 3300025242 Ga0209258_100010 Ga0209258_100010763 441
1956 3300025254 Ga0209148_1000081 Ga0209148_1000081217 441
1957 3300025254 Ga0209148_1000189 Ga0209148_100018944 441
1958 3300025256 Ga0209759_1000192 Ga0209759_10001928 441
1959 3300025256 Ga0209759_1000406 Ga0209759_100040616 441
1960 3300025256 Ga0209759_1000580 Ga0209759_100058029 441
1961 3300025261 Ga0209233_1000244 Ga0209233_100024441 441
1962 3300025272 Ga0209455_1000050 Ga0209455_1000050299 441
1963 3300025272 Ga0209455_1000162 Ga0209455_100016265 441
1964 3300025273 Ga0209673_1000038 Ga0209673_1000038230 441
1965 3300025295 Ga0209564_1002960 Ga0209564_100296010 441
1966 3300025295 Ga0209564_1005340 Ga0209564_10053406 441
1967 3300025302 Ga0207426_1000037 Ga0207426_100003762 441
1968 3300025735 Ga0207713_1000247 Ga0207713_10002475 441
1969 3300025904 Ga0207647_10011104 Ga0207647_100111046 441
1970 3300025904 Ga0207647_10018831 Ga0207647_100188313 441
1971 3300025909 Ga0207705_10000221 Ga0207705_100002216 441
1972 3300025909 Ga0207705_10032643 Ga0207705_100326432 441
1973 3300025913 Ga0207695_10015091 Ga0207695_100150914 441
1974 3300025914 Ga0207671_10159085 Ga0207671_101590852 441
1975 3300025919 Ga0207657_10000064 Ga0207657_1000006434 441
1976 3300025924 Ga0207694_10006495 Ga0207694_100064957 441
1977 3300025932 Ga0207690_10000060 Ga0207690_1000006035 441
1978 3300025932 Ga0207690_10006220 Ga0207690_100062205 441
1979 3300025949 Ga0207667_10021484 Ga0207667_100214845 441
1980 3300025949 Ga0207667_10021577 Ga0207667_100215776 441
1981 3300025986 Ga0207658_10033878 Ga0207658_100338782 441
1982 3300026067 Ga0207678_10000233 Ga0207678_1000023315 441
1983 3300026067 Ga0207678_10027958 Ga0207678_100279586 441
1984 3300026067 Ga0207678_10028754 Ga0207678_100287544 441
1985 3300026067 Ga0207678_10048915 Ga0207678_100489152 441
1986 3300026142 Ga0207698_10004724 Ga0207698_100047248 441
1987 3300027312 Ga0209371_1000114 Ga0209371_100011456 441
1988 3300027312 Ga0209371_1001990 Ga0209371_10019903 441
1989 3300028800 Ga0265338_10000409 Ga0265338_1000040914 441
1990 3300030500 Ga0268256_1000177 Ga0268256_100017719 441
1991 3300030500 Ga0268256_1001738 Ga0268256_10017383 441
1992 3300031548 Ga0307408_100001734 Ga0307408_1000017349 441
1993 3300031911 Ga0307412_10000044 Ga0307412_10000044125 441
1994 3300031911 Ga0307412_10127583 Ga0307412_101275831 441
1995 3300037312 Ga0395899_0000008 Ga0395899_0000008_504244_505611 441
1996 3300037418 Ga0395900_0000055 Ga0395900_0000055_156547_157914 441
1997 3300037418 Ga0395900_0006242 Ga0395900_0006242_4903_6270 441
1998 3300037418 Ga0395900_0027441 Ga0395900_0027441_4110_5477 441
1999 3300037466 Ga0395898_0000119 Ga0395898_0000119_187026_188393 441
2000 3300037466 Ga0395898_0001022 Ga0395898_0001022_24877_26244 441
2001 3300037466 Ga0395898_0020307 Ga0395898_0020307_3538_4905 441
2002 3300037471 Ga0395905_0000201 Ga0395905_0000201_51534_52901 441
2003 3300038443 Ga0395901_0000003 Ga0395901_0000003_635755_637122 441
2004 3300038443 Ga0395901_0000186 Ga0395901_0000186_60886_62253 441
2005 3300038443 Ga0395901_0010386 Ga0395901_0010386_6767_8134 441
2006 3300038443 Ga0395901_0086646 Ga0395901_0086646_236_1603 441
2007 3300039447 Ga0436361_1073079 Ga0436361_1073079_1288_2655 441
2008 3300044656 Ga0466969_0001609 Ga0466969_0001609_4905_6272 441
2009 3300044656 Ga0466969_0013258 Ga0466969_0013258_221_1588 441
2010 3300044683 Ga0466965_0016238 Ga0466965_0016238_216_1583 441
2011 3300044684 Ga0466966_0000016 Ga0466966_0000016_125169_126536 441
2012 3300044684 Ga0466966_0016156 Ga0466966_0016156_2757_4124 441
2013 3300044684 Ga0466966_0020533 Ga0466966_0020533_270_1637 441
2014 3300044693 Ga0466961_0001896 Ga0466961_0001896_10971_12338 441
2015 3300044693 Ga0466961_0006565 Ga0466961_0006565_676_2043 441
2016 3300044693 Ga0466961_0010462 Ga0466961_0010462_3781_5148 441
2017 3300044719 Ga0466971_0000504 Ga0466971_0000504_12206_13573 441
2018 3300044765 Ga0466970_0031191 Ga0466970_0031191_221_1588 441
2019 3300044842 Ga0466957_0000539 Ga0466957_0000539_11820_13187 441
2020 3300045049 Ga0466959_0002979 Ga0466959_0002979_6153_7520 441
2021 3300045049 Ga0466959_0014913 Ga0466959_0014913_2445_3812 441
2022 3300045836 Ga0466958_0001102 Ga0466958_0001102_9316_10683 441
2023 3300045836 Ga0466958_0002984 Ga0466958_0002984_4699_6066 441
2024 3300045836 Ga0466958_0008799 Ga0466958_0008799_3941_5308 441
2025 3300046455 Ga0495603_0003557 Ga0495603_0003557_6126_7493 441
2026 3300046455 Ga0495603_0008435 Ga0495603_0008435_67_1437 441
2027 3300046457 Ga0495590_0002529 Ga0495590_0002529_5425_6792 441
2028 3300046457 Ga0495590_0006501 Ga0495590_0006501_520_1887 441
2029 3300046459 Ga0495629_0000435 Ga0495629_0000435_11582_12952 441
2030 3300046459 Ga0495629_0010284 Ga0495629_0010284_36_1403 441
2031 3300046459 Ga0495629_0010993 Ga0495629_0010993_96_1463 441
2032 3300046463 Ga0495653_0076714 Ga0495653_0076714_1042_2409 441
2033 3300046471 Ga0495650_0005799 Ga0495650_0005799_3219_4586 441
2034 3300046472 Ga0495580_0002727 Ga0495580_0002727_10911_12278 441
2035 3300046472 Ga0495580_0070938 Ga0495580_0070938_80_1447 441
2036 3300046472 Ga0495580_0105644 Ga0495580_0105644_344_1711 441
2037 3300046474 Ga0495605_0003727 Ga0495605_0003727_3074_4441 441
2038 3300046474 Ga0495605_0013928 Ga0495605_0013928_174_1544 441
2039 3300046477 Ga0495664_0009421 Ga0495664_0009421_1069_2436 441
2040 3300046477 Ga0495664_0030686 Ga0495664_0030686_898_2268 441
2041 3300046500 Ga0495596_0010252 Ga0495596_0010252_1160_2527 441
2042 3300046506 Ga0495583_0001786 Ga0495583_0001786_1102_2469 441
2043 3300046507 Ga0495606_0029341 Ga0495606_0029341_2475_3842 441
2044 3300046507 Ga0495606_0095149 Ga0495606_0095149_122_1489 441
2045 3300046512 Ga0495610_0009750 Ga0495610_0009750_3689_5056 441
2046 3300046514 Ga0495618_0004598 Ga0495618_0004598_4274_5641 441
2047 3300046515 Ga0495620_0020240 Ga0495620_0020240_603_1970 441
2048 3300046516 Ga0495628_0014240 Ga0495628_0014240_5270_6637 441
2049 3300046517 Ga0495630_0000781 Ga0495630_0000781_2392_3759 441
2050 3300046517 Ga0495630_0134264 Ga0495630_0134264_261_1628 441
2051 3300046524 Ga0495648_0051435 Ga0495648_0051435_931_2298 441
2052 3300046526 Ga0495666_0000312 Ga0495666_0000312_5771_7138 441
2053 3300046529 Ga0495652_0016164 Ga0495652_0016164_5270_6637 441
2054 3300046529 Ga0495652_0016400 Ga0495652_0016400_4345_5712 441
2055 3300046531 Ga0495665_0001728 Ga0495665_0001728_5000_6367 441
2056 3300046531 Ga0495665_0051332 Ga0495665_0051332_47_1414 441
2057 3300046533 Ga0495640_0052144 Ga0495640_0052144_120_1487 441
2058 3300046533 Ga0495640_0057162 Ga0495640_0057162_1156_2523 441
2059 3300046543 Ga0495645_0004117 Ga0495645_0004117_3181_4548 441
2060 3300046557 Ga0495622_0001742 Ga0495622_0001742_3315_4682 441
2061 3300046642 Ga0495634_0007024 Ga0495634_0007024_5371_6738 441
2062 3300046642 Ga0495634_0066769 Ga0495634_0066769_573_1940 441
2063 3300046663 Ga0495635_0030959 Ga0495635_0030959_546_1913 441
2064 3300046678 Ga0495599_0013388 Ga0495599_0013388_819_2186 441
2065 3300046679 Ga0495623_0012254 Ga0495623_0012254_75_1442 441
2066 3300046680 Ga0495646_0038453 Ga0495646_0038453_544_1911 441
2067 3300046690 Ga0495624_0005072 Ga0495624_0005072_1144_2511 441
2068 3300046690 Ga0495624_0041168 Ga0495624_0041168_1357_2724 441
2069 3300046692 Ga0495671_0018346 Ga0495671_0018346_2200_3570 441
2070 3300046692 Ga0495671_0023112 Ga0495671_0023112_1507_2874 441
2071 3300046694 Ga0495649_0067364 Ga0495649_0067364_177_1544 441
2072 3300046794 Ga0495589_0019365 Ga0495589_0019365_1716_3086 441
2073 3300047315 Ga0495581_0002940 Ga0495581_0002940_2914_4281 441
2074 3300047315 Ga0495581_0005503 Ga0495581_0005503_5321_6688 441
2075 3300047319 Ga0495674_0008675 Ga0495674_0008675_4173_5540 441
2076 3300047319 Ga0495674_0010569 Ga0495674_0010569_5391_6758 441
2077 3300047319 Ga0495674_0025226 Ga0495674_0025226_1466_2833 441
2078 3300047319 Ga0495674_0034001 Ga0495674_0034001_2993_4489 441
2079 3300047319 Ga0495674_0172587 Ga0495674_0172587_44_1411 441
2080 3300047320 Ga0495672_0004612 Ga0495672_0004612_827_2209 441
2081 3300047320 Ga0495672_0052009 Ga0495672_0052009_166_1533 441
2082 3300047322 Ga0495680_0011744 Ga0495680_0011744_4072_5439 441
2083 3300047323 Ga0495683_0066516 Ga0495683_0066516_91_1461 441
2084 3300047443 Ga0495687_051949 Ga0495687_051949_48_1415 441
2085 3300047444 Ga0495675_0006553 Ga0495675_0006553_940_2307 441
2086 3300047444 Ga0495675_0019367 Ga0495675_0019367_2328_3695 441
2087 3300047446 Ga0495679_000586 Ga0495679_000586_15296_16663 441
2088 3300047446 Ga0495679_000669 Ga0495679_000669_8931_10298 441
2089 3300047470 Ga0495681_0023626 Ga0495681_0023626_627_1994 441
2090 3300047472 Ga0495686_0000038 Ga0495686_0000038_82540_83922 441
2091 3300047472 Ga0495686_0028553 Ga0495686_0028553_1979_3370 441
2092 3300047673 Ga0495593_0008362 Ga0495593_0008362_364_1731 441
2093 3300048088 Ga0495602_0023850 Ga0495602_0023850_2249_3616 441
2094 3300048088 Ga0495602_0134158 Ga0495602_0134158_350_1717 441
2095 3300048089 Ga0495614_0000551 Ga0495614_0000551_8763_10130 441
2096 3300048089 Ga0495614_0005049 Ga0495614_0005049_2248_3615 441
2097 3300048905 Ga0496102_0003391 Ga0496102_0003391_5612_6979 441
2098 3300048905 Ga0496102_0026131 Ga0496102_0026131_1274_2644 441
2099 3300048906 Ga0496103_0003910 Ga0496103_0003910_1422_2810 441
2100 3300048906 Ga0496103_0005480 Ga0496103_0005480_2996_4363 441
2101 3300048909 Ga0496106_0000878 Ga0496106_0000878_3059_4426 441
2102 3300048920 Ga0496117_0007707 Ga0496117_0007707_2422_3789 441
2103 3300048920 Ga0496117_0016433 Ga0496117_0016433_4539_5906 441
2104 3300048921 Ga0496118_0003941 Ga0496118_0003941_9423_10790 441
2105 3300048921 Ga0496118_0005114 Ga0496118_0005114_7059_8426 441
2106 3300048921 Ga0496118_0027994 Ga0496118_0027994_722_2089 441
2107 3300048924 Ga0496121_0004860 Ga0496121_0004860_6001_7368 441
2108 3300048924 Ga0496121_0023301 Ga0496121_0023301_3642_5009 441
2109 3300048929 Ga0496126_0000603 Ga0496126_0000603_52404_53771 441
2110 3300048929 Ga0496126_0014923 Ga0496126_0014923_407_1774 441
2111 3300049460 Ga0495682_0042761 Ga0495682_0042761_261_1628 441
2112 3300061719 Ga0466962_0011852 Ga0466962_0011852_1148_2515 441
2113 3300061719 Ga0466962_0013444 Ga0466962_0013444_1262_2629 441
2114 3300061719 Ga0466962_0029531 Ga0466962_0029531_1041_2408 441

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02785

Biotin_carb_C

Biotin carboxylase C-terminal domain

307

413

0.99

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

100

295

0.97

PF00289

Biotin_carb_N

Biotin carboxylase, N-terminal domain

9

95

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rv4-assembly1.cif.gz_A-2 crystal structure of e.coli biotin carboxylase r16e mutant in complex with mg-adp and bicarbonate 0.9689 1 431
2vqd-assembly1.cif.gz_A crystal structure of biotin carboxylase from pseudomonas aeruginosa complexed with ampcp 0.9644 1 432
2vr1-assembly1.cif.gz_A crystal structure of biotin carboxylase from e. coli in complex with atp analog, adpcf2p. 0.961 1 431
3jzf-assembly1.cif.gz_A crystal structure of biotin carboxylase from e. coli in complex with benzimidazoles series 0.9594 1 431
3ouu-assembly1.cif.gz_A crystal structure of biotin carboxylase-beta-gamma-atp complex from campylobacter jejuni 0.9578 1 428
ID Description Score Start End Superfamily
2vqdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.991 1 84 3.40.50.20
af_A0A2R8PV58_38_157_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9858 14 131 3.40.50.20
5h80B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9747 4 129 3.40.50.20
3n6rA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9747 2 128 3.40.50.20
2vqdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9681 1 84 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A382MGM7-F1-model_v4 Biotin carboxylation domain-containing protein 1.004 1 75 GO:0004658
GO:0005524
GO:0005739
AF-A0A519SWJ0-F1-model_v4 Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.2) 1.002 1 72 GO:0003989
GO:0004658
GO:0005524
AF-A0A7C5TV65-F1-model_v4 Biotin carboxylation domain-containing protein 1 4 75 GO:0005524
GO:0016874
AF-A0A7J9W0A8-F1-model_v4 biotin carboxylase (EC 6.3.4.14) 1 1 71 GO:0005524
GO:0016874
AF-A0A3M1P1Z5-F1-model_v4 Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.2) 0.9985 3 73 GO:0003989
GO:0005524

Feature Viewer

pLDDT pTM Quality
92.68 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map