F496149
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1960 | 551 | 3918 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300038741|Ga0400488_24090|Ga0400488_24090_16900_17232 |
| Length | 110 |
| Sequence | MGGRWCLALWRRVFSSKGGVAMSPDTVMTIGQQTLELIGLLSGIVLLPALVVGLIIAMFQAATQINEMTLTFIPKLVVAGLVLMLAGHWMLRVLMTFSIDLIESIPELIY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 17 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 109 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 110 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 144 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 145 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 146 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 152 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 233 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 244 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 246 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 249 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 251 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 253 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 254 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 255 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 256 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 257 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 258 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 259 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 260 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 261 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 262 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 263 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 264 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 265 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 266 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 267 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 269 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 270 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 271 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 272 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 273 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 274 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 275 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 276 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 277 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 278 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 279 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 280 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 281 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 282 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 283 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 284 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 285 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 286 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 288 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 290 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 291 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 292 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 293 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 294 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 295 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 297 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 298 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 300 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 301 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 302 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 303 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 304 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 305 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 306 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 307 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 308 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 309 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 310 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 311 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 312 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 313 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 314 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 315 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 316 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 317 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 322 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 323 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 324 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 325 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 326 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 327 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 328 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 329 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 330 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 331 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 332 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 333 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 334 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 335 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 336 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 337 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 338 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 339 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 340 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 341 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 342 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 343 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 344 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 345 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 346 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 347 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 348 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 349 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 350 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 351 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 352 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 353 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 354 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 438 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 440 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 441 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 442 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 443 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 444 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 445 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 446 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 447 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 448 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 449 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 450 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 451 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 452 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 453 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 454 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 455 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 456 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 457 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 458 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 459 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 460 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 461 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 462 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 488 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 489 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 497 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 498 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 507 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 508 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 509 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 510 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 511 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 512 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 513 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 515 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 516 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 517 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 518 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 519 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 520 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 521 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 523 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 526 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 527 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 528 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 529 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 530 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 531 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 532 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 533 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 534 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 535 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 536 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 537 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 538 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 539 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 540 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 541 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 542 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 543 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 544 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 545 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 546 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 547 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 548 | 2941479691 | |||
| 549 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 550 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 551 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.16 |
| Metatranscriptomes | 0.51 |
| Isolates | 1.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.37 |
| Nodule | 1.33 |
| Rhizoplane | 2.45 |
| Rhizosphere | 81.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400488_24090 | 3300038741 | Bacteria | 17246 |
| 2 | SwRhRL2b_contig_1195302 | 2162886007 | Bacteria | 1452 |
| 3 | SwRhRL2b_contig_1384764 | 2162886007 | Bacteria | 2078 |
| 4 | SwRhRL2b_contig_180466 | 2162886007 | Bacteria | 1236 |
| 5 | SwRhRL2b_contig_1913402 | 2162886007 | Bacteria | 3132 |
| 6 | SwRhRL2b_contig_1987842 | 2162886007 | Bacteria | 1838 |
| 7 | SwRhRL2b_contig_2510247 | 2162886007 | Bacteria | 1234 |
| 8 | SwRhRL2b_contig_3340866 | 2162886007 | Bacteria | 2699 |
| 9 | JGI24741J21665_1001662 | 3300001915 | Bacteria | 6178 |
| 10 | JGI24741J21665_1002120 | 3300001915 | Bacteria | 5289 |
| 11 | JGI24740J21852_10014411 | 3300001979 | Bacteria | 2917 |
| 12 | JGI25152J39213_1000183 | 3300002773 | Bacteria | 42030 |
| 13 | JGI25159J45721_1025895 | 3300002987 | Bacteria | 1020 |
| 14 | JGI25151J46595_10000469 | 3300003187 | Bacteria | 38425 |
| 15 | JGI25151J46595_10005242 | 3300003187 | Bacteria | 6721 |
| 16 | JGI25151J46595_10006006 | 3300003187 | Bacteria | 6181 |
| 17 | JGI25406J46586_10011151 | 3300003203 | Bacteria | 3951 |
| 18 | rootH2_10000637 | 3300003320 | Bacteria | 45323 |
| 19 | rootH2_10024085 | 3300003320 | Bacteria | 3188 |
| 20 | Ga0055529_1002914 | 3300003763 | Bacteria | 3048 |
| 21 | Ga0055526_1017409 | 3300003771 | Bacteria | 2746 |
| 22 | Ga0055537_1000734 | 3300003773 | Bacteria | 16810 |
| 23 | Ga0055524_1001300 | 3300003775 | Bacteria | 14625 |
| 24 | Ga0055534_1000029 | 3300003784 | Bacteria | 123436 |
| 25 | Ga0055530_10033751 | 3300003791 | Bacteria | 1316 |
| 26 | Ga0055530_10104491 | 3300003791 | Bacteria | 565 |
| 27 | Ga0058692_1012139 | 3300003856 | Bacteria | 2053 |
| 28 | Ga0058692_1015210 | 3300003856 | Bacteria | 1741 |
| 29 | JGI25405J52794_10069281 | 3300003911 | Bacteria | 769 |
| 30 | Ga0065704_10000334 | 3300005289 | Bacteria | 44552 |
| 31 | Ga0065704_10000845 | 3300005289 | Bacteria | 11713 |
| 32 | Ga0065704_10004094 | 3300005289 | Bacteria | 4709 |
| 33 | Ga0065704_10005135 | 3300005289 | Bacteria | 3020 |
| 34 | Ga0065704_10076738 | 3300005289 | Bacteria | 4996 |
| 35 | Ga0065704_10121891 | 3300005289 | Bacteria | 1758 |
| 36 | Ga0065715_10026164 | 3300005293 | Bacteria | 1922 |
| 37 | Ga0065707_10082547 | 3300005295 | Bacteria | 13911 |
| 38 | Ga0065707_10553254 | 3300005295 | Bacteria | 719 |
| 39 | Ga0070658_10017515 | 3300005327 | Bacteria | 5732 |
| 40 | Ga0070658_10876700 | 3300005327 | Bacteria | 780 |
| 41 | Ga0070658_11141461 | 3300005327 | Bacteria | 678 |
| 42 | Ga0070676_10714572 | 3300005328 | Bacteria | 733 |
| 43 | Ga0070676_11203027 | 3300005328 | Bacteria | 576 |
| 44 | Ga0070683_100056377 | 3300005329 | Bacteria | 3649 |
| 45 | Ga0070683_100465684 | 3300005329 | Bacteria | 1206 |
| 46 | Ga0070683_100606762 | 3300005329 | Bacteria | 1047 |
| 47 | Ga0070683_100816785 | 3300005329 | Bacteria | 894 |
| 48 | Ga0070683_101280349 | 3300005329 | Bacteria | 705 |
| 49 | Ga0070683_102204733 | 3300005329 | Bacteria | 529 |
| 50 | Ga0070690_100000862 | 3300005330 | Bacteria | 15409 |
| 51 | Ga0070670_100188453 | 3300005331 | Bacteria | 1791 |
| 52 | Ga0070670_100418425 | 3300005331 | Bacteria | 1184 |
| 53 | Ga0070670_101832599 | 3300005331 | Bacteria | 559 |
| 54 | Ga0070677_10010017 | 3300005333 | Bacteria | 3228 |
| 55 | Ga0070677_10013378 | 3300005333 | Bacteria | 2868 |
| 56 | Ga0070677_10191415 | 3300005333 | Bacteria | 981 |
| 57 | Ga0068869_100033019 | 3300005334 | Bacteria | 3651 |
| 58 | Ga0068869_100148954 | 3300005334 | Bacteria | 1813 |
| 59 | Ga0068869_100236544 | 3300005334 | Bacteria | 1453 |
| 60 | Ga0068869_100409585 | 3300005334 | Bacteria | 1117 |
| 61 | Ga0068869_100769472 | 3300005334 | Bacteria | 826 |
| 62 | Ga0068869_100837613 | 3300005334 | Bacteria | 793 |
| 63 | Ga0068869_100929649 | 3300005334 | Bacteria | 754 |
| 64 | Ga0068869_101487645 | 3300005334 | Bacteria | 601 |
| 65 | Ga0068869_101552347 | 3300005334 | Bacteria | 589 |
| 66 | Ga0070666_10006752 | 3300005335 | Bacteria | 7067 |
| 67 | Ga0070666_10192379 | 3300005335 | Bacteria | 1434 |
| 68 | Ga0070666_10244335 | 3300005335 | Bacteria | 1270 |
| 69 | Ga0070666_11407793 | 3300005335 | Bacteria | 521 |
| 70 | Ga0070680_100001797 | 3300005336 | Bacteria | 15738 |
| 71 | Ga0070680_100131471 | 3300005336 | Bacteria | 2094 |
| 72 | Ga0070680_100190525 | 3300005336 | Bacteria | 1728 |
| 73 | Ga0070680_100363801 | 3300005336 | Bacteria | 1230 |
| 74 | Ga0070680_100528885 | 3300005336 | Bacteria | 1010 |
| 75 | Ga0070680_101174465 | 3300005336 | Bacteria | 664 |
| 76 | Ga0070682_100006822 | 3300005337 | Bacteria | 6410 |
| 77 | Ga0070682_100009264 | 3300005337 | Bacteria | 5571 |
| 78 | Ga0070682_100070231 | 3300005337 | Bacteria | 2238 |
| 79 | Ga0070682_100306385 | 3300005337 | Bacteria | 1168 |
| 80 | Ga0070682_100824623 | 3300005337 | Bacteria | 756 |
| 81 | Ga0070682_100908163 | 3300005337 | Bacteria | 724 |
| 82 | Ga0070682_101948340 | 3300005337 | Bacteria | 516 |
| 83 | Ga0068868_100042630 | 3300005338 | Bacteria | 3543 |
| 84 | Ga0068868_100425020 | 3300005338 | Bacteria | 1151 |
| 85 | Ga0068868_100460035 | 3300005338 | Bacteria | 1108 |
| 86 | Ga0068868_100900709 | 3300005338 | Bacteria | 804 |
| 87 | Ga0070660_100027579 | 3300005339 | Bacteria | 4240 |
| 88 | Ga0070660_100569371 | 3300005339 | Bacteria | 946 |
| 89 | Ga0070660_101785167 | 3300005339 | Bacteria | 524 |
| 90 | Ga0070660_101937961 | 3300005339 | Bacteria | 502 |
| 91 | Ga0070689_100005091 | 3300005340 | Bacteria | 8947 |
| 92 | Ga0070689_100015154 | 3300005340 | Bacteria | 5617 |
| 93 | Ga0070689_100508385 | 3300005340 | Bacteria | 1033 |
| 94 | Ga0070689_101796665 | 3300005340 | Bacteria | 559 |
| 95 | Ga0070691_10037376 | 3300005341 | Bacteria | 2291 |
| 96 | Ga0070691_10275584 | 3300005341 | Bacteria | 911 |
| 97 | Ga0070691_10351518 | 3300005341 | Bacteria | 818 |
| 98 | Ga0070687_100185306 | 3300005343 | Bacteria | 1250 |
| 99 | Ga0070687_100581430 | 3300005343 | Bacteria | 767 |
| 100 | Ga0070687_100744305 | 3300005343 | Bacteria | 689 |
| 101 | Ga0070687_100849261 | 3300005343 | Bacteria | 651 |
| 102 | Ga0070687_101015148 | 3300005343 | Bacteria | 602 |
| 103 | Ga0070661_100002419 | 3300005344 | Bacteria | 12809 |
| 104 | Ga0070661_100024156 | 3300005344 | Bacteria | 4360 |
| 105 | Ga0070661_100076717 | 3300005344 | Bacteria | 2463 |
| 106 | Ga0070661_100195458 | 3300005344 | Bacteria | 1544 |
| 107 | Ga0070661_100246102 | 3300005344 | Bacteria | 1378 |
| 108 | Ga0070661_100276496 | 3300005344 | Bacteria | 1301 |
| 109 | Ga0070661_100655288 | 3300005344 | Bacteria | 852 |
| 110 | Ga0070661_101888874 | 3300005344 | Bacteria | 507 |
| 111 | Ga0070692_10048810 | 3300005345 | Bacteria | 2194 |
| 112 | Ga0070692_10100773 | 3300005345 | Bacteria | 1583 |
| 113 | Ga0070692_10606787 | 3300005345 | Bacteria | 725 |
| 114 | Ga0070692_10840907 | 3300005345 | Bacteria | 630 |
| 115 | Ga0070692_11032793 | 3300005345 | Bacteria | 577 |
| 116 | Ga0070668_100108452 | 3300005347 | Bacteria | 2208 |
| 117 | Ga0070668_100336399 | 3300005347 | Bacteria | 1274 |
| 118 | Ga0070668_100343419 | 3300005347 | Bacteria | 1262 |
| 119 | Ga0070668_101057428 | 3300005347 | Bacteria | 731 |
| 120 | Ga0070669_100017956 | 3300005353 | Bacteria | 5053 |
| 121 | Ga0070669_100223021 | 3300005353 | Bacteria | 1491 |
| 122 | Ga0070675_100049094 | 3300005354 | Bacteria | 3462 |
| 123 | Ga0070675_100099720 | 3300005354 | Bacteria | 2445 |
| 124 | Ga0070675_100318390 | 3300005354 | Bacteria | 1374 |
| 125 | Ga0070675_100504193 | 3300005354 | Bacteria | 1091 |
| 126 | Ga0070675_101103593 | 3300005354 | Bacteria | 729 |
| 127 | Ga0070675_101515357 | 3300005354 | Bacteria | 618 |
| 128 | Ga0070671_100095184 | 3300005355 | Bacteria | 2496 |
| 129 | Ga0070671_100178640 | 3300005355 | Bacteria | 1796 |
| 130 | Ga0070671_100494509 | 3300005355 | Bacteria | 1052 |
| 131 | Ga0070671_100569207 | 3300005355 | Bacteria | 978 |
| 132 | Ga0070674_100134345 | 3300005356 | Bacteria | 1849 |
| 133 | Ga0070674_100300367 | 3300005356 | Bacteria | 1280 |
| 134 | Ga0070674_100518338 | 3300005356 | Bacteria | 995 |
| 135 | Ga0070674_100803240 | 3300005356 | Bacteria | 812 |
| 136 | Ga0070673_100009252 | 3300005364 | Bacteria | 6609 |
| 137 | Ga0070673_100589429 | 3300005364 | Bacteria | 1013 |
| 138 | Ga0070673_100628226 | 3300005364 | Bacteria | 982 |
| 139 | Ga0070673_100861702 | 3300005364 | Bacteria | 839 |
| 140 | Ga0070673_101157933 | 3300005364 | Bacteria | 724 |
| 141 | Ga0070673_101200681 | 3300005364 | Bacteria | 711 |
| 142 | Ga0070673_101293338 | 3300005364 | Bacteria | 685 |
| 143 | Ga0070688_100001927 | 3300005365 | Bacteria | 10424 |
| 144 | Ga0070688_100139158 | 3300005365 | Bacteria | 1647 |
| 145 | Ga0070688_100189518 | 3300005365 | Bacteria | 1432 |
| 146 | Ga0070688_101031371 | 3300005365 | Bacteria | 655 |
| 147 | Ga0070659_100199605 | 3300005366 | Bacteria | 1646 |
| 148 | Ga0070659_100220321 | 3300005366 | Bacteria | 1566 |
| 149 | Ga0070659_100855567 | 3300005366 | Bacteria | 793 |
| 150 | Ga0070659_100989628 | 3300005366 | Bacteria | 738 |
| 151 | Ga0070659_101384213 | 3300005366 | Bacteria | 625 |
| 152 | Ga0070659_101565486 | 3300005366 | Bacteria | 588 |
| 153 | Ga0070659_101679955 | 3300005366 | Bacteria | 568 |
| 154 | Ga0070659_101925985 | 3300005366 | Bacteria | 530 |
| 155 | Ga0070667_100000057 | 3300005367 | Bacteria | 150501 |
| 156 | Ga0070667_100008603 | 3300005367 | Bacteria | 8460 |
| 157 | Ga0070667_100223778 | 3300005367 | Bacteria | 1675 |
| 158 | Ga0070667_100353048 | 3300005367 | Bacteria | 1331 |
| 159 | Ga0070667_100364219 | 3300005367 | Bacteria | 1311 |
| 160 | Ga0070667_100401567 | 3300005367 | Bacteria | 1248 |
| 161 | Ga0070667_100520375 | 3300005367 | Bacteria | 1092 |
| 162 | Ga0070667_102272731 | 3300005367 | Bacteria | 511 |
| 163 | Ga0070714_100270949 | 3300005435 | Bacteria | 1574 |
| 164 | Ga0070714_100842448 | 3300005435 | Bacteria | 889 |
| 165 | Ga0070713_100634402 | 3300005436 | Bacteria | 1017 |
| 166 | Ga0070713_101885972 | 3300005436 | Bacteria | 580 |
| 167 | Ga0070701_10146939 | 3300005438 | Bacteria | 1354 |
| 168 | Ga0070701_10554201 | 3300005438 | Bacteria | 755 |
| 169 | Ga0070701_10721507 | 3300005438 | Bacteria | 673 |
| 170 | Ga0070701_11218919 | 3300005438 | Bacteria | 535 |
| 171 | Ga0070711_100284830 | 3300005439 | Bacteria | 1309 |
| 172 | Ga0070711_101537983 | 3300005439 | Bacteria | 581 |
| 173 | Ga0070705_100007848 | 3300005440 | Bacteria | 5271 |
| 174 | Ga0070705_100479253 | 3300005440 | Bacteria | 940 |
| 175 | Ga0070700_100038603 | 3300005441 | Bacteria | 2912 |
| 176 | Ga0070700_100055207 | 3300005441 | Bacteria | 2486 |
| 177 | Ga0070700_100169763 | 3300005441 | Bacteria | 1510 |
| 178 | Ga0070700_100178038 | 3300005441 | Bacteria | 1477 |
| 179 | Ga0070700_100550842 | 3300005441 | Bacteria | 896 |
| 180 | Ga0070700_100757578 | 3300005441 | Bacteria | 778 |
| 181 | Ga0070700_101225194 | 3300005441 | Bacteria | 628 |
| 182 | Ga0070700_101320978 | 3300005441 | Bacteria | 607 |
| 183 | Ga0070694_100387309 | 3300005444 | Bacteria | 1091 |
| 184 | Ga0070694_100448578 | 3300005444 | Bacteria | 1018 |
| 185 | Ga0070694_101205091 | 3300005444 | Bacteria | 634 |
| 186 | Ga0070694_101870751 | 3300005444 | Bacteria | 512 |
| 187 | Ga0070663_100093360 | 3300005455 | Bacteria | 2233 |
| 188 | Ga0070663_100872707 | 3300005455 | Bacteria | 776 |
| 189 | Ga0070663_101141949 | 3300005455 | Bacteria | 683 |
| 190 | Ga0070663_101665695 | 3300005455 | Bacteria | 570 |
| 191 | Ga0070663_102022754 | 3300005455 | Bacteria | 519 |
| 192 | Ga0070678_100011774 | 3300005456 | Bacteria | 5410 |
| 193 | Ga0070678_100188741 | 3300005456 | Bacteria | 1693 |
| 194 | Ga0070678_101315703 | 3300005456 | Bacteria | 673 |
| 195 | Ga0070678_101633282 | 3300005456 | Bacteria | 606 |
| 196 | Ga0070662_100033049 | 3300005457 | Bacteria | 3640 |
| 197 | Ga0070662_100104219 | 3300005457 | Bacteria | 2152 |
| 198 | Ga0070662_100174385 | 3300005457 | Bacteria | 1691 |
| 199 | Ga0070662_100452526 | 3300005457 | Bacteria | 1066 |
| 200 | Ga0070662_100570615 | 3300005457 | Bacteria | 950 |
| 201 | Ga0070662_100833556 | 3300005457 | Bacteria | 785 |
| 202 | Ga0070662_101320590 | 3300005457 | Bacteria | 621 |
| 203 | Ga0070681_10000088 | 3300005458 | Bacteria | 69295 |
| 204 | Ga0070681_10001383 | 3300005458 | Bacteria | 21258 |
| 205 | Ga0070681_10007177 | 3300005458 | Bacteria | 10855 |
| 206 | Ga0070681_10018737 | 3300005458 | Bacteria | 6927 |
| 207 | Ga0070681_10199372 | 3300005458 | Bacteria | 1920 |
| 208 | Ga0070681_10244832 | 3300005458 | Bacteria | 1706 |
| 209 | Ga0070681_10276094 | 3300005458 | Bacteria | 1592 |
| 210 | Ga0070681_10551543 | 3300005458 | Bacteria | 1066 |
| 211 | Ga0070681_10807384 | 3300005458 | Bacteria | 855 |
| 212 | Ga0070681_11286494 | 3300005458 | Bacteria | 654 |
| 213 | Ga0068867_100095490 | 3300005459 | Bacteria | 2262 |
| 214 | Ga0068867_100216829 | 3300005459 | Bacteria | 1540 |
| 215 | Ga0068867_100435634 | 3300005459 | Bacteria | 1114 |
| 216 | Ga0068867_100516248 | 3300005459 | Bacteria | 1029 |
| 217 | Ga0068867_102368889 | 3300005459 | Bacteria | 505 |
| 218 | Ga0070685_10009778 | 3300005466 | Bacteria | 4972 |
| 219 | Ga0070685_10085944 | 3300005466 | Bacteria | 1895 |
| 220 | Ga0070685_10095684 | 3300005466 | Bacteria | 1806 |
| 221 | Ga0070685_10176932 | 3300005466 | Bacteria | 1371 |
| 222 | Ga0070685_10573268 | 3300005466 | Bacteria | 809 |
| 223 | Ga0070685_10968668 | 3300005466 | Bacteria | 637 |
| 224 | Ga0070706_100254895 | 3300005467 | Bacteria | 1638 |
| 225 | Ga0070706_100384352 | 3300005467 | Bacteria | 1307 |
| 226 | Ga0070698_100260323 | 3300005471 | Bacteria | 1667 |
| 227 | Ga0070699_102013677 | 3300005518 | Bacteria | 528 |
| 228 | Ga0070679_100000061 | 3300005530 | Bacteria | 80570 |
| 229 | Ga0070679_100006720 | 3300005530 | Bacteria | 10728 |
| 230 | Ga0070679_100062929 | 3300005530 | Bacteria | 3698 |
| 231 | Ga0070679_100867149 | 3300005530 | Bacteria | 846 |
| 232 | Ga0070679_101034294 | 3300005530 | Bacteria | 765 |
| 233 | Ga0070684_100051167 | 3300005535 | Bacteria | 3588 |
| 234 | Ga0070684_100222626 | 3300005535 | Bacteria | 1721 |
| 235 | Ga0070684_100293402 | 3300005535 | Bacteria | 1491 |
| 236 | Ga0070684_100449820 | 3300005535 | Bacteria | 1190 |
| 237 | Ga0070684_101209166 | 3300005535 | Bacteria | 711 |
| 238 | Ga0070684_101496171 | 3300005535 | Bacteria | 636 |
| 239 | Ga0070697_100262222 | 3300005536 | Bacteria | 1480 |
| 240 | Ga0068853_100007822 | 3300005539 | Bacteria | 8573 |
| 241 | Ga0068853_100023739 | 3300005539 | Bacteria | 5137 |
| 242 | Ga0068853_100352113 | 3300005539 | Bacteria | 1370 |
| 243 | Ga0068853_100482049 | 3300005539 | Bacteria | 1169 |
| 244 | Ga0068853_100487230 | 3300005539 | Bacteria | 1163 |
| 245 | Ga0068853_100758447 | 3300005539 | Bacteria | 928 |
| 246 | Ga0068853_101193205 | 3300005539 | Bacteria | 735 |
| 247 | Ga0068853_102282410 | 3300005539 | Bacteria | 524 |
| 248 | Ga0070672_100031587 | 3300005543 | Bacteria | 3987 |
| 249 | Ga0070672_100064860 | 3300005543 | Bacteria | 2887 |
| 250 | Ga0070672_100090697 | 3300005543 | Bacteria | 2465 |
| 251 | Ga0070672_100301730 | 3300005543 | Bacteria | 1358 |
| 252 | Ga0070672_100435559 | 3300005543 | Bacteria | 1128 |
| 253 | Ga0070686_100009824 | 3300005544 | Bacteria | 5375 |
| 254 | Ga0070686_100017671 | 3300005544 | Bacteria | 4171 |
| 255 | Ga0070686_100727785 | 3300005544 | Bacteria | 794 |
| 256 | Ga0070695_100588314 | 3300005545 | Bacteria | 872 |
| 257 | Ga0070695_100878344 | 3300005545 | Bacteria | 723 |
| 258 | Ga0070695_101234062 | 3300005545 | Bacteria | 616 |
| 259 | Ga0070695_101630478 | 3300005545 | Bacteria | 539 |
| 260 | Ga0070696_100004707 | 3300005546 | Bacteria | 9121 |
| 261 | Ga0070696_101113572 | 3300005546 | Bacteria | 664 |
| 262 | Ga0070693_100031912 | 3300005547 | Bacteria | 2892 |
| 263 | Ga0070693_100210667 | 3300005547 | Bacteria | 1268 |
| 264 | Ga0070693_100310719 | 3300005547 | Bacteria | 1066 |
| 265 | Ga0070693_100509531 | 3300005547 | Bacteria | 855 |
| 266 | Ga0070693_100853343 | 3300005547 | Bacteria | 679 |
| 267 | Ga0070693_101318269 | 3300005547 | Bacteria | 558 |
| 268 | Ga0070665_100000191 | 3300005548 | Bacteria | 108807 |
| 269 | Ga0070665_100000210 | 3300005548 | Bacteria | 101899 |
| 270 | Ga0070665_100001746 | 3300005548 | Bacteria | 24877 |
| 271 | Ga0070665_100003610 | 3300005548 | Bacteria | 16386 |
| 272 | Ga0070665_100068569 | 3300005548 | Bacteria | 3556 |
| 273 | Ga0070665_100078558 | 3300005548 | Bacteria | 3306 |
| 274 | Ga0070665_100243042 | 3300005548 | Bacteria | 1800 |
| 275 | Ga0070665_101667534 | 3300005548 | Bacteria | 645 |
| 276 | Ga0070665_102426107 | 3300005548 | Bacteria | 527 |
| 277 | Ga0070704_100441104 | 3300005549 | Bacteria | 1119 |
| 278 | Ga0070704_100470567 | 3300005549 | Bacteria | 1086 |
| 279 | Ga0068855_100033321 | 3300005563 | Bacteria | 6149 |
| 280 | Ga0068855_100065852 | 3300005563 | Bacteria | 4224 |
| 281 | Ga0068855_100093588 | 3300005563 | Bacteria | 3465 |
| 282 | Ga0068855_100140638 | 3300005563 | Bacteria | 2752 |
| 283 | Ga0068855_100273589 | 3300005563 | Bacteria | 1877 |
| 284 | Ga0068855_100288891 | 3300005563 | Bacteria | 1818 |
| 285 | Ga0068855_102508009 | 3300005563 | Bacteria | 513 |
| 286 | Ga0068855_102621400 | 3300005563 | Bacteria | 500 |
| 287 | Ga0070664_100036310 | 3300005564 | Bacteria | 4139 |
| 288 | Ga0070664_100038133 | 3300005564 | Bacteria | 4044 |
| 289 | Ga0070664_100113395 | 3300005564 | Bacteria | 2368 |
| 290 | Ga0070664_100149776 | 3300005564 | Bacteria | 2059 |
| 291 | Ga0070664_100516076 | 3300005564 | Bacteria | 1103 |
| 292 | Ga0070664_100673152 | 3300005564 | Bacteria | 963 |
| 293 | Ga0070664_101558032 | 3300005564 | Bacteria | 626 |
| 294 | Ga0068857_100000406 | 3300005577 | Bacteria | 30347 |
| 295 | Ga0068857_100021709 | 3300005577 | Bacteria | 5648 |
| 296 | Ga0068857_100060196 | 3300005577 | Bacteria | 3374 |
| 297 | Ga0068857_100098120 | 3300005577 | Bacteria | 2627 |
| 298 | Ga0068857_100221521 | 3300005577 | Bacteria | 1728 |
| 299 | Ga0068857_102128892 | 3300005577 | Bacteria | 550 |
| 300 | Ga0068854_100001777 | 3300005578 | Bacteria | 13120 |
| 301 | Ga0068854_100076840 | 3300005578 | Bacteria | 2455 |
| 302 | Ga0068854_100519385 | 3300005578 | Bacteria | 1005 |
| 303 | Ga0068854_100645719 | 3300005578 | Bacteria | 908 |
| 304 | Ga0068854_101236318 | 3300005578 | Bacteria | 670 |
| 305 | Ga0068854_101383465 | 3300005578 | Bacteria | 636 |
| 306 | Ga0068854_102279767 | 3300005578 | Bacteria | 501 |
| 307 | Ga0068856_100289239 | 3300005614 | Bacteria | 1656 |
| 308 | Ga0068856_100307217 | 3300005614 | Bacteria | 1604 |
| 309 | Ga0068856_100648553 | 3300005614 | Bacteria | 1076 |
| 310 | Ga0068856_100959710 | 3300005614 | Bacteria | 873 |
| 311 | Ga0068856_101902250 | 3300005614 | Bacteria | 606 |
| 312 | Ga0068856_102280909 | 3300005614 | Bacteria | 550 |
| 313 | Ga0068856_102640703 | 3300005614 | Bacteria | 508 |
| 314 | Ga0070702_100007333 | 3300005615 | Bacteria | 5274 |
| 315 | Ga0070702_100010312 | 3300005615 | Bacteria | 4596 |
| 316 | Ga0070702_100158004 | 3300005615 | Bacteria | 1462 |
| 317 | Ga0068852_100192245 | 3300005616 | Bacteria | 1926 |
| 318 | Ga0068852_100483566 | 3300005616 | Bacteria | 1231 |
| 319 | Ga0068852_100740766 | 3300005616 | Bacteria | 994 |
| 320 | Ga0068859_100000781 | 3300005617 | Bacteria | 32135 |
| 321 | Ga0068859_100042804 | 3300005617 | Bacteria | 4549 |
| 322 | Ga0068859_100062693 | 3300005617 | Bacteria | 3748 |
| 323 | Ga0068859_100106398 | 3300005617 | Bacteria | 2865 |
| 324 | Ga0068859_100303271 | 3300005617 | Bacteria | 1691 |
| 325 | Ga0068859_100340880 | 3300005617 | Bacteria | 1593 |
| 326 | Ga0068859_100451494 | 3300005617 | Bacteria | 1382 |
| 327 | Ga0068859_100873726 | 3300005617 | Bacteria | 985 |
| 328 | Ga0068859_102331268 | 3300005617 | Bacteria | 590 |
| 329 | Ga0068859_102968171 | 3300005617 | Bacteria | 519 |
| 330 | Ga0068864_100014352 | 3300005618 | Bacteria | 6579 |
| 331 | Ga0068864_100059707 | 3300005618 | Bacteria | 3300 |
| 332 | Ga0068864_100227652 | 3300005618 | Bacteria | 1723 |
| 333 | Ga0068864_100242617 | 3300005618 | Bacteria | 1670 |
| 334 | Ga0068864_100411525 | 3300005618 | Bacteria | 1287 |
| 335 | Ga0068864_100459896 | 3300005618 | Bacteria | 1218 |
| 336 | Ga0068864_100839587 | 3300005618 | Bacteria | 905 |
| 337 | Ga0068866_10020296 | 3300005718 | Bacteria | 3043 |
| 338 | Ga0068866_10081053 | 3300005718 | Bacteria | 1742 |
| 339 | Ga0068866_10307387 | 3300005718 | Bacteria | 993 |
| 340 | Ga0068861_100071332 | 3300005719 | Bacteria | 2692 |
| 341 | Ga0068861_100093190 | 3300005719 | Bacteria | 2381 |
| 342 | Ga0068861_100201507 | 3300005719 | Bacteria | 1671 |
| 343 | Ga0068861_100376936 | 3300005719 | Bacteria | 1252 |
| 344 | Ga0068861_100521597 | 3300005719 | Bacteria | 1078 |
| 345 | Ga0068861_100917451 | 3300005719 | Bacteria | 831 |
| 346 | Ga0068861_101484603 | 3300005719 | Bacteria | 665 |
| 347 | Ga0068861_102063066 | 3300005719 | Bacteria | 570 |
| 348 | Ga0068851_10140807 | 3300005834 | Bacteria | 1312 |
| 349 | Ga0068851_10155295 | 3300005834 | Bacteria | 1253 |
| 350 | Ga0068851_10167453 | 3300005834 | Bacteria | 1211 |
| 351 | Ga0068870_10016867 | 3300005840 | Bacteria | 3501 |
| 352 | Ga0068870_10035185 | 3300005840 | Bacteria | 2568 |
| 353 | Ga0068870_10050571 | 3300005840 | Bacteria | 2197 |
| 354 | Ga0068870_10196466 | 3300005840 | Bacteria | 1220 |
| 355 | Ga0068863_100029235 | 3300005841 | Bacteria | 5261 |
| 356 | Ga0068863_100139041 | 3300005841 | Bacteria | 2321 |
| 357 | Ga0068863_100174209 | 3300005841 | Bacteria | 2064 |
| 358 | Ga0068863_100290171 | 3300005841 | Bacteria | 1586 |
| 359 | Ga0068863_100525071 | 3300005841 | Bacteria | 1167 |
| 360 | Ga0068863_100605108 | 3300005841 | Bacteria | 1085 |
| 361 | Ga0068863_100693910 | 3300005841 | Bacteria | 1012 |
| 362 | Ga0068863_101618841 | 3300005841 | Bacteria | 657 |
| 363 | Ga0068863_102360557 | 3300005841 | Bacteria | 541 |
| 364 | Ga0068858_100009868 | 3300005842 | Bacteria | 9073 |
| 365 | Ga0068858_100063745 | 3300005842 | Bacteria | 3410 |
| 366 | Ga0068858_100171595 | 3300005842 | Bacteria | 2045 |
| 367 | Ga0068858_100200138 | 3300005842 | Bacteria | 1889 |
| 368 | Ga0068858_101601974 | 3300005842 | Bacteria | 643 |
| 369 | Ga0068860_100062183 | 3300005843 | Bacteria | 3547 |
| 370 | Ga0068860_100228662 | 3300005843 | Bacteria | 1807 |
| 371 | Ga0068860_100455204 | 3300005843 | Bacteria | 1273 |
| 372 | Ga0068860_100927219 | 3300005843 | Bacteria | 887 |
| 373 | Ga0068860_102389318 | 3300005843 | Bacteria | 549 |
| 374 | Ga0068862_100000803 | 3300005844 | Bacteria | 31159 |
| 375 | Ga0068862_100003696 | 3300005844 | Bacteria | 13077 |
| 376 | Ga0068862_100016037 | 3300005844 | Bacteria | 6231 |
| 377 | Ga0068862_100020500 | 3300005844 | Bacteria | 5523 |
| 378 | Ga0068862_100121363 | 3300005844 | Bacteria | 2304 |
| 379 | Ga0068862_100284770 | 3300005844 | Bacteria | 1516 |
| 380 | Ga0068862_100349967 | 3300005844 | Bacteria | 1371 |
| 381 | Ga0068862_100355377 | 3300005844 | Bacteria | 1360 |
| 382 | Ga0068862_101058623 | 3300005844 | Bacteria | 805 |
| 383 | Ga0068862_101510320 | 3300005844 | Bacteria | 677 |
| 384 | Ga0081455_10000010 | 3300005937 | Bacteria | 248212 |
| 385 | Ga0081455_10001002 | 3300005937 | Bacteria | 35808 |
| 386 | Ga0081455_10386693 | 3300005937 | Bacteria | 975 |
| 387 | Ga0081539_10000058 | 3300005985 | Bacteria | 256212 |
| 388 | Ga0075364_10004846 | 3300006051 | Bacteria | 7794 |
| 389 | Ga0075364_10005493 | 3300006051 | Bacteria | 7374 |
| 390 | Ga0075364_10009906 | 3300006051 | Bacteria | 5732 |
| 391 | Ga0075364_10011687 | 3300006051 | Bacteria | 5340 |
| 392 | Ga0075364_10012628 | 3300006051 | Bacteria | 5173 |
| 393 | Ga0075364_10122263 | 3300006051 | Bacteria | 1743 |
| 394 | Ga0075364_11183869 | 3300006051 | Bacteria | 518 |
| 395 | Ga0070715_10339352 | 3300006163 | Bacteria | 817 |
| 396 | Ga0070716_100487600 | 3300006173 | Bacteria | 906 |
| 397 | Ga0070716_101398071 | 3300006173 | Bacteria | 569 |
| 398 | Ga0075366_10013000 | 3300006195 | Bacteria | 4733 |
| 399 | Ga0097621_100029912 | 3300006237 | Bacteria | 4306 |
| 400 | Ga0097621_100114052 | 3300006237 | Bacteria | 2286 |
| 401 | Ga0097621_100217273 | 3300006237 | Bacteria | 1664 |
| 402 | Ga0097621_100387765 | 3300006237 | Bacteria | 1249 |
| 403 | Ga0097621_100548997 | 3300006237 | Bacteria | 1051 |
| 404 | Ga0097621_100770162 | 3300006237 | Bacteria | 890 |
| 405 | Ga0068871_100029967 | 3300006358 | Bacteria | 4280 |
| 406 | Ga0068871_100144367 | 3300006358 | Bacteria | 2025 |
| 407 | Ga0068871_100247948 | 3300006358 | Bacteria | 1550 |
| 408 | Ga0068871_100276222 | 3300006358 | Bacteria | 1469 |
| 409 | Ga0068871_100559445 | 3300006358 | Bacteria | 1037 |
| 410 | Ga0068871_100592094 | 3300006358 | Bacteria | 1008 |
| 411 | Ga0068871_101555809 | 3300006358 | Bacteria | 625 |
| 412 | Ga0075428_100131210 | 3300006844 | Bacteria | 2725 |
| 413 | Ga0075428_100342077 | 3300006844 | Bacteria | 1606 |
| 414 | Ga0075428_100682209 | 3300006844 | Bacteria | 1095 |
| 415 | Ga0075430_100032834 | 3300006846 | Bacteria | 4405 |
| 416 | Ga0075430_100094065 | 3300006846 | Bacteria | 2505 |
| 417 | Ga0075430_100327045 | 3300006846 | Bacteria | 1267 |
| 418 | Ga0075430_100337890 | 3300006846 | Bacteria | 1244 |
| 419 | Ga0075430_101023094 | 3300006846 | Bacteria | 680 |
| 420 | Ga0075430_101150600 | 3300006846 | Bacteria | 639 |
| 421 | Ga0075430_101693435 | 3300006846 | Bacteria | 519 |
| 422 | Ga0075431_100003695 | 3300006847 | Bacteria | 14869 |
| 423 | Ga0075431_100168996 | 3300006847 | Bacteria | 2248 |
| 424 | Ga0075431_100190531 | 3300006847 | Bacteria | 2101 |
| 425 | Ga0075431_100391527 | 3300006847 | Bacteria | 1392 |
| 426 | Ga0075431_101171974 | 3300006847 | Bacteria | 732 |
| 427 | Ga0075431_101199043 | 3300006847 | Bacteria | 722 |
| 428 | Ga0075431_102013692 | 3300006847 | Bacteria | 533 |
| 429 | Ga0075433_10150683 | 3300006852 | Bacteria | 2069 |
| 430 | Ga0075433_10493759 | 3300006852 | Bacteria | 1078 |
| 431 | Ga0075434_100207202 | 3300006871 | Bacteria | 1981 |
| 432 | Ga0075434_101224685 | 3300006871 | Bacteria | 762 |
| 433 | Ga0075429_100007951 | 3300006880 | Bacteria | 9215 |
| 434 | Ga0075429_100012668 | 3300006880 | Bacteria | 7314 |
| 435 | Ga0075429_100259841 | 3300006880 | Bacteria | 1520 |
| 436 | Ga0075429_100589947 | 3300006880 | Bacteria | 974 |
| 437 | Ga0068865_100149122 | 3300006881 | Bacteria | 1772 |
| 438 | Ga0068865_100170635 | 3300006881 | Bacteria | 1667 |
| 439 | Ga0068865_100351876 | 3300006881 | Bacteria | 1194 |
| 440 | Ga0068865_100410971 | 3300006881 | Bacteria | 1110 |
| 441 | Ga0068865_100779132 | 3300006881 | Bacteria | 823 |
| 442 | Ga0068865_101040122 | 3300006881 | Bacteria | 719 |
| 443 | Ga0068865_101262745 | 3300006881 | Bacteria | 655 |
| 444 | Ga0068865_101980464 | 3300006881 | Bacteria | 528 |
| 445 | Ga0075436_100679603 | 3300006914 | Bacteria | 762 |
| 446 | Ga0097620_100000781 | 3300006931 | Bacteria | 32135 |
| 447 | Ga0097620_100042804 | 3300006931 | Bacteria | 4549 |
| 448 | Ga0097620_100062697 | 3300006931 | Bacteria | 3748 |
| 449 | Ga0097620_100106397 | 3300006931 | Bacteria | 2865 |
| 450 | Ga0097620_100303274 | 3300006931 | Bacteria | 1691 |
| 451 | Ga0097620_100340869 | 3300006931 | Bacteria | 1593 |
| 452 | Ga0097620_100451490 | 3300006931 | Bacteria | 1382 |
| 453 | Ga0097620_100873770 | 3300006931 | Bacteria | 985 |
| 454 | Ga0097620_102332103 | 3300006931 | Bacteria | 590 |
| 455 | Ga0097620_102968127 | 3300006931 | Bacteria | 519 |
| 456 | Ga0079104_1000171 | 3300006946 | Bacteria | 92164 |
| 457 | Ga0079104_1001588 | 3300006946 | Bacteria | 14837 |
| 458 | Ga0079104_1002382 | 3300006946 | Bacteria | 10253 |
| 459 | Ga0079104_1006552 | 3300006946 | Bacteria | 4378 |
| 460 | Ga0079104_1009529 | 3300006946 | Bacteria | 3279 |
| 461 | Ga0079104_1010786 | 3300006946 | Bacteria | 2980 |
| 462 | Ga0079104_1010787 | 3300006946 | Bacteria | 2979 |
| 463 | Ga0079104_1119690 | 3300006946 | Bacteria | 517 |
| 464 | Ga0099826_10000013 | 3300006948 | Bacteria | 265459 |
| 465 | Ga0105251_10003671 | 3300009011 | Bacteria | 11015 |
| 466 | Ga0105251_10015401 | 3300009011 | Bacteria | 4182 |
| 467 | Ga0105251_10027498 | 3300009011 | Bacteria | 2883 |
| 468 | Ga0105251_10046730 | 3300009011 | Bacteria | 2083 |
| 469 | Ga0105251_10080733 | 3300009011 | Bacteria | 1504 |
| 470 | Ga0105251_10123692 | 3300009011 | Bacteria | 1174 |
| 471 | Ga0105251_10389284 | 3300009011 | Bacteria | 640 |
| 472 | Ga0105244_10000020 | 3300009036 | Bacteria | 241021 |
| 473 | Ga0105244_10000197 | 3300009036 | Bacteria | 61327 |
| 474 | Ga0105244_10000674 | 3300009036 | Bacteria | 29941 |
| 475 | Ga0105244_10002440 | 3300009036 | Bacteria | 14025 |
| 476 | Ga0105244_10015340 | 3300009036 | Bacteria | 4395 |
| 477 | Ga0105244_10015634 | 3300009036 | Bacteria | 4346 |
| 478 | Ga0105244_10029291 | 3300009036 | Bacteria | 2944 |
| 479 | Ga0105244_10041222 | 3300009036 | Bacteria | 2393 |
| 480 | Ga0105250_10000037 | 3300009092 | Bacteria | 143923 |
| 481 | Ga0105250_10000839 | 3300009092 | Bacteria | 18237 |
| 482 | Ga0105250_10002125 | 3300009092 | Bacteria | 10166 |
| 483 | Ga0105250_10002406 | 3300009092 | Bacteria | 9419 |
| 484 | Ga0105250_10048505 | 3300009092 | Bacteria | 1703 |
| 485 | Ga0105250_10054331 | 3300009092 | Bacteria | 1606 |
| 486 | Ga0105250_10212043 | 3300009092 | Bacteria | 819 |
| 487 | Ga0105250_10416495 | 3300009092 | Bacteria | 598 |
| 488 | Ga0105240_10240593 | 3300009093 | Bacteria | 2098 |
| 489 | Ga0105240_10423383 | 3300009093 | Bacteria | 1495 |
| 490 | Ga0105240_10524916 | 3300009093 | Bacteria | 1313 |
| 491 | Ga0105240_11260788 | 3300009093 | Bacteria | 781 |
| 492 | Ga0105240_11713007 | 3300009093 | Bacteria | 656 |
| 493 | Ga0105240_12221274 | 3300009093 | Bacteria | 569 |
| 494 | Ga0105240_12324523 | 3300009093 | Bacteria | 555 |
| 495 | Ga0111539_10038732 | 3300009094 | Bacteria | 5752 |
| 496 | Ga0111539_10082605 | 3300009094 | Bacteria | 3778 |
| 497 | Ga0111539_10166893 | 3300009094 | Bacteria | 2573 |
| 498 | Ga0111539_10236459 | 3300009094 | Bacteria | 2127 |
| 499 | Ga0111539_10468019 | 3300009094 | Bacteria | 1468 |
| 500 | Ga0111539_10736871 | 3300009094 | Bacteria | 1147 |
| 501 | Ga0111539_11099412 | 3300009094 | Bacteria | 924 |
| 502 | Ga0111539_11340849 | 3300009094 | Bacteria | 830 |
| 503 | Ga0111539_13112315 | 3300009094 | Bacteria | 535 |
| 504 | Ga0111539_13247013 | 3300009094 | Bacteria | 524 |
| 505 | Ga0105245_10113009 | 3300009098 | Bacteria | 2528 |
| 506 | Ga0105245_10869076 | 3300009098 | Bacteria | 942 |
| 507 | Ga0105245_10903875 | 3300009098 | Bacteria | 925 |
| 508 | Ga0105245_11244051 | 3300009098 | Bacteria | 793 |
| 509 | Ga0105245_11263229 | 3300009098 | Bacteria | 787 |
| 510 | Ga0105245_11639846 | 3300009098 | Bacteria | 695 |
| 511 | Ga0105245_11795603 | 3300009098 | Bacteria | 666 |
| 512 | Ga0105247_10000086 | 3300009101 | Bacteria | 99603 |
| 513 | Ga0105247_10039354 | 3300009101 | Bacteria | 2888 |
| 514 | Ga0105247_10090057 | 3300009101 | Bacteria | 1946 |
| 515 | Ga0105247_10434469 | 3300009101 | Unclassified | 943 |
| 516 | Ga0105247_11022105 | 3300009101 | Bacteria | 647 |
| 517 | Ga0105247_11321714 | 3300009101 | Bacteria | 580 |
| 518 | Ga0114129_10012903 | 3300009147 | Bacteria | 11890 |
| 519 | Ga0114129_13501557 | 3300009147 | Bacteria | 502 |
| 520 | Ga0105243_10104836 | 3300009148 | Bacteria | 2354 |
| 521 | Ga0105243_10125167 | 3300009148 | Bacteria | 2173 |
| 522 | Ga0105243_11182920 | 3300009148 | Bacteria | 777 |
| 523 | Ga0105243_11433155 | 3300009148 | Bacteria | 712 |
| 524 | Ga0105243_11542865 | 3300009148 | Bacteria | 689 |
| 525 | Ga0105243_11750703 | 3300009148 | Bacteria | 651 |
| 526 | Ga0105243_12048061 | 3300009148 | Bacteria | 607 |
| 527 | Ga0105243_12068976 | 3300009148 | Bacteria | 605 |
| 528 | Ga0105243_12338381 | 3300009148 | Bacteria | 572 |
| 529 | Ga0105243_12545835 | 3300009148 | Bacteria | 551 |
| 530 | Ga0105243_12813468 | 3300009148 | Bacteria | 527 |
| 531 | Ga0105241_10107889 | 3300009174 | Bacteria | 2225 |
| 532 | Ga0105241_10576300 | 3300009174 | Bacteria | 1014 |
| 533 | Ga0105241_10626347 | 3300009174 | Bacteria | 974 |
| 534 | Ga0105241_11248782 | 3300009174 | Bacteria | 705 |
| 535 | Ga0105242_10168577 | 3300009176 | Bacteria | 1922 |
| 536 | Ga0105242_10288162 | 3300009176 | Bacteria | 1494 |
| 537 | Ga0105242_10459950 | 3300009176 | Bacteria | 1201 |
| 538 | Ga0105242_10875371 | 3300009176 | Bacteria | 896 |
| 539 | Ga0105242_11159900 | 3300009176 | Bacteria | 790 |
| 540 | Ga0105242_11524614 | 3300009176 | Bacteria | 700 |
| 541 | Ga0105242_12646847 | 3300009176 | Bacteria | 551 |
| 542 | Ga0105242_12681220 | 3300009176 | Bacteria | 548 |
| 543 | Ga0105248_10026309 | 3300009177 | Bacteria | 6473 |
| 544 | Ga0105248_10090143 | 3300009177 | Bacteria | 3452 |
| 545 | Ga0105248_10416837 | 3300009177 | Bacteria | 1512 |
| 546 | Ga0105248_10470407 | 3300009177 | Bacteria | 1417 |
| 547 | Ga0105248_10620854 | 3300009177 | Bacteria | 1220 |
| 548 | Ga0105248_11233058 | 3300009177 | Bacteria | 846 |
| 549 | Ga0105248_12422508 | 3300009177 | Bacteria | 598 |
| 550 | Ga0105237_10121366 | 3300009545 | Bacteria | 2608 |
| 551 | Ga0105237_10122634 | 3300009545 | Bacteria | 2593 |
| 552 | Ga0105237_10262368 | 3300009545 | Bacteria | 1730 |
| 553 | Ga0105237_10780964 | 3300009545 | Bacteria | 962 |
| 554 | Ga0105237_10832952 | 3300009545 | Bacteria | 929 |
| 555 | Ga0105237_11030774 | 3300009545 | Bacteria | 830 |
| 556 | Ga0105237_11370267 | 3300009545 | Bacteria | 714 |
| 557 | Ga0105237_11735498 | 3300009545 | Bacteria | 632 |
| 558 | Ga0105238_10049581 | 3300009551 | Bacteria | 4227 |
| 559 | Ga0105238_10089896 | 3300009551 | Bacteria | 3058 |
| 560 | Ga0105238_10393190 | 3300009551 | Bacteria | 1379 |
| 561 | Ga0105238_10668372 | 3300009551 | Bacteria | 1050 |
| 562 | Ga0105238_12491644 | 3300009551 | Bacteria | 553 |
| 563 | Ga0105249_10002589 | 3300009553 | Bacteria | 15657 |
| 564 | Ga0105249_10260095 | 3300009553 | Bacteria | 1724 |
| 565 | Ga0105249_10581818 | 3300009553 | Bacteria | 1173 |
| 566 | Ga0099796_10342410 | 3300010159 | Bacteria | 643 |
| 567 | Ga0105239_10082120 | 3300010375 | Bacteria | 3548 |
| 568 | Ga0105239_10090438 | 3300010375 | Bacteria | 3377 |
| 569 | Ga0105239_10837743 | 3300010375 | Bacteria | 1054 |
| 570 | Ga0105239_11183363 | 3300010375 | Bacteria | 881 |
| 571 | Ga0105246_10002690 | 3300011119 | Bacteria | 10761 |
| 572 | Ga0105246_10033797 | 3300011119 | Bacteria | 3401 |
| 573 | Ga0105246_10648303 | 3300011119 | Bacteria | 919 |
| 574 | Ga0105246_10714533 | 3300011119 | Bacteria | 880 |
| 575 | Ga0105246_10745296 | 3300011119 | Bacteria | 863 |
| 576 | Ga0157373_10005568 | 3300013100 | Bacteria | 9441 |
| 577 | Ga0157373_10008472 | 3300013100 | Bacteria | 7635 |
| 578 | Ga0157373_10296754 | 3300013100 | Bacteria | 1146 |
| 579 | Ga0157373_10301905 | 3300013100 | Bacteria | 1137 |
| 580 | Ga0157373_10442172 | 3300013100 | Bacteria | 935 |
| 581 | Ga0157371_10043618 | 3300013102 | Bacteria | 3194 |
| 582 | Ga0157371_10090023 | 3300013102 | Bacteria | 2174 |
| 583 | Ga0157371_10125940 | 3300013102 | Bacteria | 1822 |
| 584 | Ga0157371_10232342 | 3300013102 | Bacteria | 1326 |
| 585 | Ga0157371_10416417 | 3300013102 | Bacteria | 985 |
| 586 | Ga0157371_11033610 | 3300013102 | Bacteria | 628 |
| 587 | Ga0157370_10005611 | 3300013104 | Bacteria | 14044 |
| 588 | Ga0157370_10006677 | 3300013104 | Bacteria | 12667 |
| 589 | Ga0157370_10011572 | 3300013104 | Bacteria | 9211 |
| 590 | Ga0157370_10029414 | 3300013104 | Bacteria | 5391 |
| 591 | Ga0157370_10093122 | 3300013104 | Bacteria | 2828 |
| 592 | Ga0157370_10466069 | 3300013104 | Bacteria | 1161 |
| 593 | Ga0157370_10513126 | 3300013104 | Bacteria | 1100 |
| 594 | Ga0157370_10676114 | 3300013104 | Bacteria | 943 |
| 595 | Ga0157369_10029226 | 3300013105 | Bacteria | 6092 |
| 596 | Ga0157369_10044187 | 3300013105 | Bacteria | 4850 |
| 597 | Ga0157369_10087770 | 3300013105 | Bacteria | 3321 |
| 598 | Ga0157369_10171226 | 3300013105 | Bacteria | 2288 |
| 599 | Ga0157369_10213745 | 3300013105 | Bacteria | 2021 |
| 600 | Ga0157369_10455035 | 3300013105 | Bacteria | 1325 |
| 601 | Ga0157369_11383524 | 3300013105 | Bacteria | 716 |
| 602 | Ga0157369_11528089 | 3300013105 | Bacteria | 679 |
| 603 | Ga0157369_11974102 | 3300013105 | Bacteria | 592 |
| 604 | Ga0157369_12567981 | 3300013105 | Bacteria | 515 |
| 605 | Ga0157374_10000170 | 3300013296 | Bacteria | 60286 |
| 606 | Ga0157374_10149706 | 3300013296 | Bacteria | 2268 |
| 607 | Ga0157374_10449655 | 3300013296 | Bacteria | 1290 |
| 608 | Ga0157374_10589718 | 3300013296 | Bacteria | 1121 |
| 609 | Ga0157374_11326843 | 3300013296 | Bacteria | 742 |
| 610 | Ga0157374_12956478 | 3300013296 | Bacteria | 502 |
| 611 | Ga0157378_10202588 | 3300013297 | Bacteria | 1877 |
| 612 | Ga0157378_12404070 | 3300013297 | Bacteria | 579 |
| 613 | Ga0157378_12615341 | 3300013297 | Bacteria | 557 |
| 614 | Ga0163162_10009881 | 3300013306 | Bacteria | 9281 |
| 615 | Ga0163162_10243246 | 3300013306 | Bacteria | 1930 |
| 616 | Ga0163162_11118143 | 3300013306 | Bacteria | 893 |
| 617 | Ga0157372_10001723 | 3300013307 | Bacteria | 23725 |
| 618 | Ga0157372_10005345 | 3300013307 | Bacteria | 13644 |
| 619 | Ga0157372_10134866 | 3300013307 | Bacteria | 2842 |
| 620 | Ga0157372_10143033 | 3300013307 | Bacteria | 2758 |
| 621 | Ga0157372_10235943 | 3300013307 | Bacteria | 2121 |
| 622 | Ga0157372_10578807 | 3300013307 | Bacteria | 1309 |
| 623 | Ga0157372_10776946 | 3300013307 | Bacteria | 1113 |
| 624 | Ga0157372_11045039 | 3300013307 | Bacteria | 945 |
| 625 | Ga0157372_13422479 | 3300013307 | Bacteria | 505 |
| 626 | Ga0157375_10088445 | 3300013308 | Bacteria | 3153 |
| 627 | Ga0157375_10250831 | 3300013308 | Bacteria | 1930 |
| 628 | Ga0157375_10307443 | 3300013308 | Bacteria | 1749 |
| 629 | Ga0157375_10529248 | 3300013308 | Bacteria | 1341 |
| 630 | Ga0157375_10725201 | 3300013308 | Bacteria | 1147 |
| 631 | Ga0157375_10870107 | 3300013308 | Bacteria | 1047 |
| 632 | Ga0157375_13315750 | 3300013308 | Bacteria | 537 |
| 633 | Ga0163163_10008768 | 3300014325 | Bacteria | 9000 |
| 634 | Ga0163163_10029560 | 3300014325 | Bacteria | 5273 |
| 635 | Ga0163163_10047761 | 3300014325 | Bacteria | 4208 |
| 636 | Ga0163163_10266337 | 3300014325 | Bacteria | 1765 |
| 637 | Ga0163163_10405585 | 3300014325 | Bacteria | 1421 |
| 638 | Ga0163163_10835071 | 3300014325 | Bacteria | 985 |
| 639 | Ga0163163_12215038 | 3300014325 | Bacteria | 609 |
| 640 | Ga0163163_13052529 | 3300014325 | Bacteria | 522 |
| 641 | Ga0157380_10022588 | 3300014326 | Bacteria | 4740 |
| 642 | Ga0157380_10198467 | 3300014326 | Bacteria | 1778 |
| 643 | Ga0157380_10275189 | 3300014326 | Bacteria | 1537 |
| 644 | Ga0157380_10299523 | 3300014326 | Bacteria | 1480 |
| 645 | Ga0157380_10506118 | 3300014326 | Bacteria | 1174 |
| 646 | Ga0157380_10726586 | 3300014326 | Bacteria | 1001 |
| 647 | Ga0157380_11105896 | 3300014326 | Bacteria | 832 |
| 648 | Ga0157380_12145267 | 3300014326 | Bacteria | 622 |
| 649 | Ga0157380_13430589 | 3300014326 | Unclassified | 507 |
| 650 | Ga0182008_10037326 | 3300014497 | Bacteria | 2430 |
| 651 | Ga0157377_10011088 | 3300014745 | Bacteria | 4486 |
| 652 | Ga0157377_11217797 | 3300014745 | Bacteria | 584 |
| 653 | Ga0157377_11569265 | 3300014745 | Bacteria | 526 |
| 654 | Ga0157379_10158199 | 3300014968 | Bacteria | 2044 |
| 655 | Ga0157379_10170501 | 3300014968 | Bacteria | 1965 |
| 656 | Ga0157379_10357977 | 3300014968 | Bacteria | 1337 |
| 657 | Ga0157379_10683279 | 3300014968 | Bacteria | 963 |
| 658 | Ga0157376_10009262 | 3300014969 | Bacteria | 7147 |
| 659 | Ga0157376_10051525 | 3300014969 | Bacteria | 3419 |
| 660 | Ga0157376_10216261 | 3300014969 | Bacteria | 1772 |
| 661 | Ga0157376_10358465 | 3300014969 | Bacteria | 1398 |
| 662 | Ga0157376_10573155 | 3300014969 | Bacteria | 1120 |
| 663 | Ga0157376_10735779 | 3300014969 | Bacteria | 994 |
| 664 | Ga0157376_11091024 | 3300014969 | Bacteria | 824 |
| 665 | Ga0157376_12837019 | 3300014969 | Bacteria | 524 |
| 666 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 667 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 668 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 669 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 670 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 671 | Ga0163161_10185833 | 3300017792 | Bacteria | 1595 |
| 672 | Ga0163161_10281807 | 3300017792 | Bacteria | 1304 |
| 673 | Ga0163161_10293827 | 3300017792 | Bacteria | 1278 |
| 674 | Ga0163161_10423781 | 3300017792 | Bacteria | 1071 |
| 675 | Ga0163161_10469896 | 3300017792 | Bacteria | 1020 |
| 676 | Ga0163161_10659548 | 3300017792 | Bacteria | 868 |
| 677 | Ga0163161_10945310 | 3300017792 | Bacteria | 733 |
| 678 | Ga0163161_12088364 | 3300017792 | Bacteria | 504 |
| 679 | Ga0206356_11801913 | 3300020070 | Bacteria | 1112 |
| 680 | Ga0206354_10249962 | 3300020081 | Bacteria | 3164 |
| 681 | Ga0154015_1031133 | 3300020610 | Bacteria | 756 |
| 682 | Ga0154015_1078359 | 3300020610 | Bacteria | 2361 |
| 683 | Ga0213876_10000034 | 3300021384 | Bacteria | 202967 |
| 684 | Ga0209672_112342 | 3300025228 | Bacteria | 1064 |
| 685 | Ga0209258_104361 | 3300025242 | Bacteria | 2709 |
| 686 | Ga0209129_1000077 | 3300025258 | Bacteria | 193474 |
| 687 | Ga0209565_1000095 | 3300025263 | Bacteria | 134566 |
| 688 | Ga0209455_1001008 | 3300025272 | Bacteria | 14196 |
| 689 | Ga0209673_1024142 | 3300025273 | Bacteria | 2050 |
| 690 | Ga0209675_1000067 | 3300025291 | Bacteria | 171840 |
| 691 | Ga0209676_1020931 | 3300025292 | Bacteria | 2207 |
| 692 | Ga0209025_1000018 | 3300025294 | Bacteria | 686898 |
| 693 | Ga0209025_1000034 | 3300025294 | Bacteria | 413205 |
| 694 | Ga0209025_1000059 | 3300025294 | Bacteria | 305480 |
| 695 | Ga0209564_1004589 | 3300025295 | Bacteria | 8352 |
| 696 | Ga0209758_1017252 | 3300025297 | Bacteria | 3609 |
| 697 | Ga0209050_1002453 | 3300025298 | Bacteria | 15846 |
| 698 | Ga0209256_1000985 | 3300025299 | Bacteria | 34104 |
| 699 | Ga0209051_1018943 | 3300025303 | Bacteria | 3024 |
| 700 | Ga0209051_1043725 | 3300025303 | Bacteria | 1569 |
| 701 | Ga0207697_10225871 | 3300025315 | Bacteria | 826 |
| 702 | Ga0207656_10265465 | 3300025321 | Bacteria | 844 |
| 703 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 704 | Ga0207696_1000099 | 3300025711 | Bacteria | 173329 |
| 705 | Ga0207696_1000497 | 3300025711 | Bacteria | 32924 |
| 706 | Ga0207696_1002263 | 3300025711 | Bacteria | 9572 |
| 707 | Ga0207696_1002685 | 3300025711 | Bacteria | 8533 |
| 708 | Ga0207696_1045627 | 3300025711 | Bacteria | 1267 |
| 709 | Ga0207696_1051192 | 3300025711 | Bacteria | 1180 |
| 710 | Ga0207696_1053155 | 3300025711 | Bacteria | 1154 |
| 711 | Ga0207655_1000002 | 3300025728 | Bacteria | 1148694 |
| 712 | Ga0207655_1000004 | 3300025728 | Bacteria | 1021221 |
| 713 | Ga0207655_1000036 | 3300025728 | Bacteria | 356747 |
| 714 | Ga0207655_1000071 | 3300025728 | Bacteria | 237394 |
| 715 | Ga0207655_1000305 | 3300025728 | Bacteria | 73826 |
| 716 | Ga0207655_1000316 | 3300025728 | Bacteria | 71819 |
| 717 | Ga0207655_1000666 | 3300025728 | Bacteria | 40517 |
| 718 | Ga0207655_1038031 | 3300025728 | Bacteria | 2109 |
| 719 | Ga0207655_1057156 | 3300025728 | Bacteria | 1533 |
| 720 | Ga0207655_1107820 | 3300025728 | Bacteria | 946 |
| 721 | Ga0207713_1000004 | 3300025735 | Bacteria | 702781 |
| 722 | Ga0207713_1000120 | 3300025735 | Bacteria | 123766 |
| 723 | Ga0207713_1001730 | 3300025735 | Bacteria | 16799 |
| 724 | Ga0207713_1002855 | 3300025735 | Bacteria | 12144 |
| 725 | Ga0207713_1012995 | 3300025735 | Bacteria | 4418 |
| 726 | Ga0207713_1040996 | 3300025735 | Bacteria | 1936 |
| 727 | Ga0207713_1087413 | 3300025735 | Bacteria | 1104 |
| 728 | Ga0207682_10023400 | 3300025893 | Bacteria | 2440 |
| 729 | Ga0207682_10029992 | 3300025893 | Bacteria | 2177 |
| 730 | Ga0207682_10160651 | 3300025893 | Bacteria | 1018 |
| 731 | Ga0207682_10261330 | 3300025893 | Bacteria | 807 |
| 732 | Ga0207642_10010780 | 3300025899 | Bacteria | 3237 |
| 733 | Ga0207642_10032098 | 3300025899 | Bacteria | 2207 |
| 734 | Ga0207710_10000233 | 3300025900 | Bacteria | 48055 |
| 735 | Ga0207688_10012356 | 3300025901 | Bacteria | 4646 |
| 736 | Ga0207680_10056803 | 3300025903 | Bacteria | 2366 |
| 737 | Ga0207680_10082345 | 3300025903 | Bacteria | 2025 |
| 738 | Ga0207680_10175776 | 3300025903 | Bacteria | 1445 |
| 739 | Ga0207680_10980969 | 3300025903 | Bacteria | 605 |
| 740 | Ga0207647_10003226 | 3300025904 | Bacteria | 12238 |
| 741 | Ga0207685_10389233 | 3300025905 | Bacteria | 712 |
| 742 | Ga0207645_10024964 | 3300025907 | Bacteria | 3871 |
| 743 | Ga0207645_10085698 | 3300025907 | Bacteria | 2023 |
| 744 | Ga0207645_10331408 | 3300025907 | Bacteria | 1016 |
| 745 | Ga0207643_10040761 | 3300025908 | Bacteria | 2615 |
| 746 | Ga0207643_10067057 | 3300025908 | Bacteria | 2059 |
| 747 | Ga0207643_10113423 | 3300025908 | Bacteria | 1599 |
| 748 | Ga0207643_10566272 | 3300025908 | Unclassified | 730 |
| 749 | Ga0207705_10000029 | 3300025909 | Bacteria | 239897 |
| 750 | Ga0207705_10000755 | 3300025909 | Bacteria | 26682 |
| 751 | Ga0207684_11493695 | 3300025910 | Bacteria | 550 |
| 752 | Ga0207654_10117072 | 3300025911 | Bacteria | 1667 |
| 753 | Ga0207654_10184858 | 3300025911 | Bacteria | 1362 |
| 754 | Ga0207654_10680126 | 3300025911 | Bacteria | 738 |
| 755 | Ga0207707_10000042 | 3300025912 | Bacteria | 126050 |
| 756 | Ga0207707_10000301 | 3300025912 | Bacteria | 51922 |
| 757 | Ga0207707_10000302 | 3300025912 | Bacteria | 51850 |
| 758 | Ga0207707_10000392 | 3300025912 | Bacteria | 45789 |
| 759 | Ga0207707_10000932 | 3300025912 | Bacteria | 28294 |
| 760 | Ga0207707_10001056 | 3300025912 | Bacteria | 26434 |
| 761 | Ga0207707_10001397 | 3300025912 | Bacteria | 22381 |
| 762 | Ga0207707_10009958 | 3300025912 | Bacteria | 8243 |
| 763 | Ga0207707_10050854 | 3300025912 | Bacteria | 3609 |
| 764 | Ga0207707_10102453 | 3300025912 | Bacteria | 2502 |
| 765 | Ga0207707_10141527 | 3300025912 | Bacteria | 2103 |
| 766 | Ga0207707_10195879 | 3300025912 | Bacteria | 1762 |
| 767 | Ga0207695_10002071 | 3300025913 | Bacteria | 30574 |
| 768 | Ga0207695_10020791 | 3300025913 | Bacteria | 7508 |
| 769 | Ga0207695_11466429 | 3300025913 | Bacteria | 563 |
| 770 | Ga0207695_11635772 | 3300025913 | Bacteria | 525 |
| 771 | Ga0207695_11726965 | 3300025913 | Bacteria | 507 |
| 772 | Ga0207671_10650063 | 3300025914 | Bacteria | 840 |
| 773 | Ga0207693_10246759 | 3300025915 | Bacteria | 1401 |
| 774 | Ga0207663_11284780 | 3300025916 | Bacteria | 589 |
| 775 | Ga0207660_10000413 | 3300025917 | Bacteria | 28242 |
| 776 | Ga0207660_10000722 | 3300025917 | Bacteria | 21994 |
| 777 | Ga0207660_10205966 | 3300025917 | Bacteria | 1538 |
| 778 | Ga0207660_10324822 | 3300025917 | Bacteria | 1229 |
| 779 | Ga0207660_10626220 | 3300025917 | Bacteria | 877 |
| 780 | Ga0207660_10770080 | 3300025917 | Bacteria | 785 |
| 781 | Ga0207660_11322184 | 3300025917 | Bacteria | 585 |
| 782 | Ga0207660_11364877 | 3300025917 | Bacteria | 575 |
| 783 | Ga0207662_10010415 | 3300025918 | Bacteria | 5134 |
| 784 | Ga0207662_10752816 | 3300025918 | Bacteria | 685 |
| 785 | Ga0207657_10029708 | 3300025919 | Bacteria | 4971 |
| 786 | Ga0207657_10030356 | 3300025919 | Bacteria | 4906 |
| 787 | Ga0207657_10441732 | 3300025919 | Bacteria | 1021 |
| 788 | Ga0207657_10576145 | 3300025919 | Bacteria | 879 |
| 789 | Ga0207657_11063100 | 3300025919 | Bacteria | 619 |
| 790 | Ga0207649_10015666 | 3300025920 | Bacteria | 4259 |
| 791 | Ga0207649_10016136 | 3300025920 | Bacteria | 4207 |
| 792 | Ga0207649_10081166 | 3300025920 | Bacteria | 2099 |
| 793 | Ga0207649_10126409 | 3300025920 | Bacteria | 1731 |
| 794 | Ga0207649_10231728 | 3300025920 | Bacteria | 1321 |
| 795 | Ga0207649_10842270 | 3300025920 | Bacteria | 717 |
| 796 | Ga0207649_10861467 | 3300025920 | Bacteria | 709 |
| 797 | Ga0207652_10000082 | 3300025921 | Bacteria | 103057 |
| 798 | Ga0207652_10000808 | 3300025921 | Bacteria | 29892 |
| 799 | Ga0207652_10001430 | 3300025921 | Bacteria | 21150 |
| 800 | Ga0207652_10001471 | 3300025921 | Bacteria | 20845 |
| 801 | Ga0207652_10020194 | 3300025921 | Bacteria | 5485 |
| 802 | Ga0207652_10350538 | 3300025921 | Bacteria | 1332 |
| 803 | Ga0207652_10974934 | 3300025921 | Bacteria | 746 |
| 804 | Ga0207646_11861106 | 3300025922 | Bacteria | 514 |
| 805 | Ga0207681_10013599 | 3300025923 | Bacteria | 5039 |
| 806 | Ga0207681_10353125 | 3300025923 | Bacteria | 1177 |
| 807 | Ga0207694_10063480 | 3300025924 | Bacteria | 2877 |
| 808 | Ga0207694_10448184 | 3300025924 | Bacteria | 1077 |
| 809 | Ga0207694_10654636 | 3300025924 | Bacteria | 885 |
| 810 | Ga0207650_10049871 | 3300025925 | Bacteria | 3093 |
| 811 | Ga0207650_10094024 | 3300025925 | Bacteria | 2296 |
| 812 | Ga0207650_10483831 | 3300025925 | Bacteria | 1033 |
| 813 | Ga0207650_10788102 | 3300025925 | Bacteria | 805 |
| 814 | Ga0207650_11094481 | 3300025925 | Bacteria | 678 |
| 815 | Ga0207659_10047840 | 3300025926 | Bacteria | 3026 |
| 816 | Ga0207659_10074244 | 3300025926 | Bacteria | 2492 |
| 817 | Ga0207659_10297394 | 3300025926 | Bacteria | 1325 |
| 818 | Ga0207659_10353613 | 3300025926 | Bacteria | 1220 |
| 819 | Ga0207659_11249594 | 3300025926 | Bacteria | 638 |
| 820 | Ga0207659_11263967 | 3300025926 | Bacteria | 634 |
| 821 | Ga0207659_11384859 | 3300025926 | Bacteria | 603 |
| 822 | Ga0207659_11735304 | 3300025926 | Bacteria | 531 |
| 823 | Ga0207700_10032522 | 3300025928 | Bacteria | 3721 |
| 824 | Ga0207664_10028573 | 3300025929 | Bacteria | 4240 |
| 825 | Ga0207664_10590883 | 3300025929 | Bacteria | 997 |
| 826 | Ga0207644_10206730 | 3300025931 | Bacteria | 1551 |
| 827 | Ga0207644_10514627 | 3300025931 | Bacteria | 988 |
| 828 | Ga0207644_10590366 | 3300025931 | Bacteria | 922 |
| 829 | Ga0207690_10002484 | 3300025932 | Bacteria | 11136 |
| 830 | Ga0207690_10005386 | 3300025932 | Bacteria | 7539 |
| 831 | Ga0207690_10184103 | 3300025932 | Bacteria | 1575 |
| 832 | Ga0207690_10210960 | 3300025932 | Bacteria | 1481 |
| 833 | Ga0207690_10852445 | 3300025932 | Bacteria | 754 |
| 834 | Ga0207690_11116635 | 3300025932 | Bacteria | 657 |
| 835 | Ga0207690_11160757 | 3300025932 | Bacteria | 644 |
| 836 | Ga0207690_11197472 | 3300025932 | Bacteria | 634 |
| 837 | Ga0207706_10008490 | 3300025933 | Bacteria | 9476 |
| 838 | Ga0207706_10123391 | 3300025933 | Bacteria | 2278 |
| 839 | Ga0207706_10185134 | 3300025933 | Bacteria | 1829 |
| 840 | Ga0207706_10312878 | 3300025933 | Bacteria | 1367 |
| 841 | Ga0207706_10433400 | 3300025933 | Bacteria | 1138 |
| 842 | Ga0207706_11058631 | 3300025933 | Bacteria | 679 |
| 843 | Ga0207686_10039354 | 3300025934 | Bacteria | 2869 |
| 844 | Ga0207686_11380727 | 3300025934 | Bacteria | 579 |
| 845 | Ga0207709_10044621 | 3300025935 | Bacteria | 2680 |
| 846 | Ga0207709_10834354 | 3300025935 | Bacteria | 746 |
| 847 | Ga0207709_11227006 | 3300025935 | Bacteria | 618 |
| 848 | Ga0207709_11735101 | 3300025935 | Bacteria | 519 |
| 849 | Ga0207670_10004036 | 3300025936 | Bacteria | 7850 |
| 850 | Ga0207670_10014859 | 3300025936 | Bacteria | 4635 |
| 851 | Ga0207670_10450618 | 3300025936 | Bacteria | 1037 |
| 852 | Ga0207670_10701882 | 3300025936 | Bacteria | 838 |
| 853 | Ga0207670_10841639 | 3300025936 | Bacteria | 766 |
| 854 | Ga0207669_10087051 | 3300025937 | Bacteria | 2022 |
| 855 | Ga0207669_10124301 | 3300025937 | Bacteria | 1759 |
| 856 | Ga0207669_10210671 | 3300025937 | Bacteria | 1418 |
| 857 | Ga0207669_11779010 | 3300025937 | Bacteria | 526 |
| 858 | Ga0207704_10070872 | 3300025938 | Bacteria | 2209 |
| 859 | Ga0207704_10127387 | 3300025938 | Bacteria | 1756 |
| 860 | Ga0207704_10401878 | 3300025938 | Bacteria | 1081 |
| 861 | Ga0207704_10645037 | 3300025938 | Bacteria | 871 |
| 862 | Ga0207704_10902105 | 3300025938 | Bacteria | 743 |
| 863 | Ga0207704_10913136 | 3300025938 | Bacteria | 739 |
| 864 | Ga0207704_11556815 | 3300025938 | Unclassified | 568 |
| 865 | Ga0207704_11803067 | 3300025938 | Bacteria | 526 |
| 866 | Ga0207691_10013845 | 3300025940 | Bacteria | 7701 |
| 867 | Ga0207691_10013979 | 3300025940 | Bacteria | 7658 |
| 868 | Ga0207691_10020673 | 3300025940 | Bacteria | 6224 |
| 869 | Ga0207691_10068468 | 3300025940 | Bacteria | 3207 |
| 870 | Ga0207691_10092590 | 3300025940 | Bacteria | 2707 |
| 871 | Ga0207691_10194096 | 3300025940 | Bacteria | 1770 |
| 872 | Ga0207691_11714348 | 3300025940 | Bacteria | 508 |
| 873 | Ga0207711_10010645 | 3300025941 | Bacteria | 7650 |
| 874 | Ga0207711_10090838 | 3300025941 | Bacteria | 2685 |
| 875 | Ga0207711_10416792 | 3300025941 | Bacteria | 1249 |
| 876 | Ga0207711_10434188 | 3300025941 | Bacteria | 1222 |
| 877 | Ga0207711_10553495 | 3300025941 | Bacteria | 1073 |
| 878 | Ga0207689_10000371 | 3300025942 | Bacteria | 42309 |
| 879 | Ga0207689_10001446 | 3300025942 | Bacteria | 22702 |
| 880 | Ga0207689_10021355 | 3300025942 | Bacteria | 5444 |
| 881 | Ga0207689_10096610 | 3300025942 | Bacteria | 2426 |
| 882 | Ga0207689_10100688 | 3300025942 | Bacteria | 2374 |
| 883 | Ga0207689_10162303 | 3300025942 | Bacteria | 1841 |
| 884 | Ga0207689_10197665 | 3300025942 | Bacteria | 1660 |
| 885 | Ga0207689_10940478 | 3300025942 | Bacteria | 729 |
| 886 | Ga0207689_11718622 | 3300025942 | Bacteria | 520 |
| 887 | Ga0207661_10203729 | 3300025944 | Bacteria | 1741 |
| 888 | Ga0207661_10554982 | 3300025944 | Bacteria | 1052 |
| 889 | Ga0207661_11230428 | 3300025944 | Bacteria | 689 |
| 890 | Ga0207661_11558253 | 3300025944 | Bacteria | 605 |
| 891 | Ga0207679_10005183 | 3300025945 | Bacteria | 8167 |
| 892 | Ga0207679_10088079 | 3300025945 | Bacteria | 2392 |
| 893 | Ga0207679_10110291 | 3300025945 | Bacteria | 2170 |
| 894 | Ga0207679_10133435 | 3300025945 | Bacteria | 1995 |
| 895 | Ga0207679_10284283 | 3300025945 | Bacteria | 1420 |
| 896 | Ga0207679_10447722 | 3300025945 | Bacteria | 1145 |
| 897 | Ga0207679_11185340 | 3300025945 | Bacteria | 701 |
| 898 | Ga0207679_11796659 | 3300025945 | Bacteria | 560 |
| 899 | Ga0207667_10000075 | 3300025949 | Bacteria | 169836 |
| 900 | Ga0207667_10003270 | 3300025949 | Bacteria | 20002 |
| 901 | Ga0207667_10005022 | 3300025949 | Bacteria | 16175 |
| 902 | Ga0207667_10009976 | 3300025949 | Bacteria | 11141 |
| 903 | Ga0207667_10268458 | 3300025949 | Bacteria | 1744 |
| 904 | Ga0207667_10373442 | 3300025949 | Bacteria | 1453 |
| 905 | Ga0207667_10543334 | 3300025949 | Bacteria | 1176 |
| 906 | Ga0207667_10608528 | 3300025949 | Bacteria | 1101 |
| 907 | Ga0207667_12082021 | 3300025949 | Bacteria | 526 |
| 908 | Ga0207651_10028390 | 3300025960 | Bacteria | 3529 |
| 909 | Ga0207651_10035410 | 3300025960 | Bacteria | 3245 |
| 910 | Ga0207651_10195254 | 3300025960 | Bacteria | 1618 |
| 911 | Ga0207651_10481521 | 3300025960 | Bacteria | 1070 |
| 912 | Ga0207651_10679836 | 3300025960 | Bacteria | 905 |
| 913 | Ga0207651_10800570 | 3300025960 | Bacteria | 835 |
| 914 | Ga0207651_10803220 | 3300025960 | Bacteria | 834 |
| 915 | Ga0207651_10812892 | 3300025960 | Bacteria | 829 |
| 916 | Ga0207712_10040229 | 3300025961 | Bacteria | 3207 |
| 917 | Ga0207712_10165243 | 3300025961 | Bacteria | 1724 |
| 918 | Ga0207712_10477124 | 3300025961 | Bacteria | 1062 |
| 919 | Ga0207712_11151185 | 3300025961 | Bacteria | 691 |
| 920 | Ga0207712_11186724 | 3300025961 | Bacteria | 681 |
| 921 | Ga0207668_10049615 | 3300025972 | Bacteria | 2887 |
| 922 | Ga0207668_10088928 | 3300025972 | Bacteria | 2263 |
| 923 | Ga0207668_10482064 | 3300025972 | Bacteria | 1064 |
| 924 | Ga0207668_10722817 | 3300025972 | Bacteria | 877 |
| 925 | Ga0207668_10971443 | 3300025972 | Bacteria | 758 |
| 926 | Ga0207668_11032748 | 3300025972 | Bacteria | 735 |
| 927 | Ga0207640_10003603 | 3300025981 | Bacteria | 8355 |
| 928 | Ga0207640_10014722 | 3300025981 | Bacteria | 4508 |
| 929 | Ga0207640_10042886 | 3300025981 | Bacteria | 2887 |
| 930 | Ga0207640_10280087 | 3300025981 | Bacteria | 1309 |
| 931 | Ga0207640_10287246 | 3300025981 | Bacteria | 1295 |
| 932 | Ga0207640_10547495 | 3300025981 | Bacteria | 972 |
| 933 | Ga0207640_10875889 | 3300025981 | Bacteria | 783 |
| 934 | Ga0207658_10000200 | 3300025986 | Bacteria | 62618 |
| 935 | Ga0207658_10004744 | 3300025986 | Bacteria | 9416 |
| 936 | Ga0207658_10146291 | 3300025986 | Bacteria | 1920 |
| 937 | Ga0207658_10304410 | 3300025986 | Bacteria | 1374 |
| 938 | Ga0207658_10957412 | 3300025986 | Bacteria | 780 |
| 939 | Ga0207658_11232482 | 3300025986 | Bacteria | 684 |
| 940 | Ga0207658_11557713 | 3300025986 | Bacteria | 604 |
| 941 | Ga0207677_10027709 | 3300026023 | Bacteria | 3573 |
| 942 | Ga0207677_10032981 | 3300026023 | Bacteria | 3335 |
| 943 | Ga0207677_10098703 | 3300026023 | Bacteria | 2143 |
| 944 | Ga0207677_10376450 | 3300026023 | Bacteria | 1197 |
| 945 | Ga0207677_10511288 | 3300026023 | Bacteria | 1040 |
| 946 | Ga0207677_10548506 | 3300026023 | Bacteria | 1007 |
| 947 | Ga0207677_11431777 | 3300026023 | Bacteria | 637 |
| 948 | Ga0207703_10023685 | 3300026035 | Bacteria | 4828 |
| 949 | Ga0207703_10039366 | 3300026035 | Bacteria | 3778 |
| 950 | Ga0207703_10423955 | 3300026035 | Bacteria | 1238 |
| 951 | Ga0207703_10743649 | 3300026035 | Bacteria | 934 |
| 952 | Ga0207639_10002359 | 3300026041 | Bacteria | 12688 |
| 953 | Ga0207639_10010177 | 3300026041 | Bacteria | 6507 |
| 954 | Ga0207639_10038101 | 3300026041 | Bacteria | 3574 |
| 955 | Ga0207639_10071797 | 3300026041 | Bacteria | 2709 |
| 956 | Ga0207639_10111605 | 3300026041 | Bacteria | 2229 |
| 957 | Ga0207639_10260488 | 3300026041 | Bacteria | 1517 |
| 958 | Ga0207639_10419113 | 3300026041 | Bacteria | 1210 |
| 959 | Ga0207639_10632475 | 3300026041 | Bacteria | 989 |
| 960 | Ga0207639_10701649 | 3300026041 | Bacteria | 939 |
| 961 | Ga0207639_10708096 | 3300026041 | Bacteria | 934 |
| 962 | Ga0207678_10044515 | 3300026067 | Bacteria | 3839 |
| 963 | Ga0207678_10121049 | 3300026067 | Bacteria | 2233 |
| 964 | Ga0207678_10232765 | 3300026067 | Bacteria | 1577 |
| 965 | Ga0207678_10256173 | 3300026067 | Bacteria | 1499 |
| 966 | Ga0207678_10271595 | 3300026067 | Bacteria | 1454 |
| 967 | Ga0207678_10518863 | 3300026067 | Bacteria | 1040 |
| 968 | Ga0207678_10550205 | 3300026067 | Bacteria | 1009 |
| 969 | Ga0207678_10558989 | 3300026067 | Bacteria | 1001 |
| 970 | Ga0207708_10041543 | 3300026075 | Bacteria | 3506 |
| 971 | Ga0207708_10047816 | 3300026075 | Bacteria | 3256 |
| 972 | Ga0207708_10339229 | 3300026075 | Bacteria | 1230 |
| 973 | Ga0207702_10035000 | 3300026078 | Bacteria | 4200 |
| 974 | Ga0207702_10037347 | 3300026078 | Bacteria | 4065 |
| 975 | Ga0207702_10256973 | 3300026078 | Bacteria | 1643 |
| 976 | Ga0207702_11582016 | 3300026078 | Bacteria | 649 |
| 977 | Ga0207702_11690316 | 3300026078 | Bacteria | 626 |
| 978 | Ga0207702_11862376 | 3300026078 | Bacteria | 593 |
| 979 | Ga0207641_10022918 | 3300026088 | Bacteria | 5143 |
| 980 | Ga0207641_10039525 | 3300026088 | Bacteria | 3946 |
| 981 | Ga0207641_10504381 | 3300026088 | Bacteria | 1175 |
| 982 | Ga0207641_10511676 | 3300026088 | Bacteria | 1167 |
| 983 | Ga0207641_10539783 | 3300026088 | Bacteria | 1136 |
| 984 | Ga0207641_10800175 | 3300026088 | Bacteria | 932 |
| 985 | Ga0207641_11364143 | 3300026088 | Bacteria | 710 |
| 986 | Ga0207641_11641391 | 3300026088 | Bacteria | 645 |
| 987 | Ga0207648_10063545 | 3300026089 | Bacteria | 3217 |
| 988 | Ga0207648_10130673 | 3300026089 | Bacteria | 2210 |
| 989 | Ga0207648_10153721 | 3300026089 | Bacteria | 2031 |
| 990 | Ga0207648_10188089 | 3300026089 | Bacteria | 1829 |
| 991 | Ga0207648_10199117 | 3300026089 | Bacteria | 1776 |
| 992 | Ga0207676_10011531 | 3300026095 | Bacteria | 6322 |
| 993 | Ga0207676_10056478 | 3300026095 | Bacteria | 3087 |
| 994 | Ga0207676_10137214 | 3300026095 | Bacteria | 2089 |
| 995 | Ga0207676_10529709 | 3300026095 | Bacteria | 1123 |
| 996 | Ga0207676_10635738 | 3300026095 | Bacteria | 1028 |
| 997 | Ga0207676_10905621 | 3300026095 | Bacteria | 865 |
| 998 | Ga0207674_10000572 | 3300026116 | Bacteria | 48336 |
| 999 | Ga0207674_10007862 | 3300026116 | Bacteria | 12394 |
| 1000 | Ga0207674_10011838 | 3300026116 | Bacteria | 9781 |
| 1001 | Ga0207674_10039765 | 3300026116 | Bacteria | 4874 |
| 1002 | Ga0207674_10052688 | 3300026116 | Bacteria | 4149 |
| 1003 | Ga0207674_10063554 | 3300026116 | Bacteria | 3726 |
| 1004 | Ga0207674_10872555 | 3300026116 | Bacteria | 867 |
| 1005 | Ga0207674_12131192 | 3300026116 | Bacteria | 524 |
| 1006 | Ga0207675_100004755 | 3300026118 | Bacteria | 13078 |
| 1007 | Ga0207675_100024866 | 3300026118 | Bacteria | 5573 |
| 1008 | Ga0207675_100026368 | 3300026118 | Bacteria | 5409 |
| 1009 | Ga0207675_100037411 | 3300026118 | Bacteria | 4526 |
| 1010 | Ga0207675_100038140 | 3300026118 | Bacteria | 4484 |
| 1011 | Ga0207675_100051706 | 3300026118 | Bacteria | 3834 |
| 1012 | Ga0207675_100107890 | 3300026118 | Bacteria | 2626 |
| 1013 | Ga0207675_100178828 | 3300026118 | Bacteria | 2031 |
| 1014 | Ga0207675_100296515 | 3300026118 | Bacteria | 1574 |
| 1015 | Ga0207675_100415235 | 3300026118 | Bacteria | 1328 |
| 1016 | Ga0207675_101029420 | 3300026118 | Bacteria | 842 |
| 1017 | Ga0207675_102509138 | 3300026118 | Bacteria | 526 |
| 1018 | Ga0207683_10023239 | 3300026121 | Bacteria | 5329 |
| 1019 | Ga0207683_10037952 | 3300026121 | Bacteria | 4196 |
| 1020 | Ga0207683_10104195 | 3300026121 | Bacteria | 2535 |
| 1021 | Ga0207683_10273162 | 3300026121 | Bacteria | 1544 |
| 1022 | Ga0207683_10513617 | 3300026121 | Bacteria | 1107 |
| 1023 | Ga0207683_11189928 | 3300026121 | Bacteria | 706 |
| 1024 | Ga0207698_10000358 | 3300026142 | Bacteria | 26861 |
| 1025 | Ga0207698_10004642 | 3300026142 | Bacteria | 8391 |
| 1026 | Ga0207698_10464285 | 3300026142 | Bacteria | 1225 |
| 1027 | Ga0207698_10651507 | 3300026142 | Bacteria | 1043 |
| 1028 | Ga0207698_11520689 | 3300026142 | Bacteria | 685 |
| 1029 | Ga0207698_11695704 | 3300026142 | Bacteria | 647 |
| 1030 | Ga0209281_1000001 | 3300027111 | Bacteria | 1933496 |
| 1031 | Ga0209281_1000004 | 3300027111 | Bacteria | 1253949 |
| 1032 | Ga0209281_1000006 | 3300027111 | Bacteria | 1170244 |
| 1033 | Ga0209281_1000012 | 3300027111 | Bacteria | 684886 |
| 1034 | Ga0209281_1000064 | 3300027111 | Bacteria | 287876 |
| 1035 | Ga0209281_1000071 | 3300027111 | Bacteria | 274050 |
| 1036 | Ga0209281_1000109 | 3300027111 | Bacteria | 216504 |
| 1037 | Ga0209281_1000509 | 3300027111 | Bacteria | 51378 |
| 1038 | Ga0209281_1000530 | 3300027111 | Bacteria | 48514 |
| 1039 | Ga0209281_1001268 | 3300027111 | Bacteria | 16346 |
| 1040 | Ga0209281_1039581 | 3300027111 | Bacteria | 799 |
| 1041 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 1042 | Ga0209371_1000002 | 3300027312 | Bacteria | 1551985 |
| 1043 | Ga0209371_1000015 | 3300027312 | Bacteria | 659640 |
| 1044 | Ga0209371_1001413 | 3300027312 | Bacteria | 16441 |
| 1045 | Ga0209371_1004930 | 3300027312 | Bacteria | 5550 |
| 1046 | Ga0209371_1005273 | 3300027312 | Bacteria | 5208 |
| 1047 | Ga0209371_1007026 | 3300027312 | Bacteria | 4018 |
| 1048 | Ga0209371_1009297 | 3300027312 | Bacteria | 3138 |
| 1049 | Ga0209371_1014162 | 3300027312 | Bacteria | 2199 |
| 1050 | Ga0209371_1021952 | 3300027312 | Bacteria | 1537 |
| 1051 | Ga0210002_1020764 | 3300027617 | Bacteria | 1059 |
| 1052 | Ga0209983_1016929 | 3300027665 | Bacteria | 1507 |
| 1053 | Ga0209282_1000043 | 3300027666 | Bacteria | 119260 |
| 1054 | Ga0209971_1041869 | 3300027682 | Bacteria | 1103 |
| 1055 | Ga0207428_10042435 | 3300027907 | Bacteria | 3679 |
| 1056 | Ga0207428_10309282 | 3300027907 | Bacteria | 1168 |
| 1057 | Ga0207428_10339863 | 3300027907 | Bacteria | 1106 |
| 1058 | Ga0207428_10385769 | 3300027907 | Bacteria | 1027 |
| 1059 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 1060 | Ga0268266_10000976 | 3300028379 | Bacteria | 36289 |
| 1061 | Ga0268266_10059695 | 3300028379 | Bacteria | 3285 |
| 1062 | Ga0268266_10077118 | 3300028379 | Bacteria | 2897 |
| 1063 | Ga0268266_10105100 | 3300028379 | Bacteria | 2494 |
| 1064 | Ga0268266_10106705 | 3300028379 | Bacteria | 2476 |
| 1065 | Ga0268266_10200330 | 3300028379 | Bacteria | 1827 |
| 1066 | Ga0268266_10395066 | 3300028379 | Bacteria | 1306 |
| 1067 | Ga0268266_10562066 | 3300028379 | Bacteria | 1094 |
| 1068 | Ga0268266_12262433 | 3300028379 | Bacteria | 515 |
| 1069 | Ga0268265_10006518 | 3300028380 | Bacteria | 7910 |
| 1070 | Ga0268265_10006672 | 3300028380 | Bacteria | 7812 |
| 1071 | Ga0268265_10010943 | 3300028380 | Bacteria | 6126 |
| 1072 | Ga0268265_10028107 | 3300028380 | Bacteria | 4024 |
| 1073 | Ga0268265_10044156 | 3300028380 | Bacteria | 3317 |
| 1074 | Ga0268265_10053990 | 3300028380 | Bacteria | 3046 |
| 1075 | Ga0268265_10132373 | 3300028380 | Bacteria | 2075 |
| 1076 | Ga0268265_10485117 | 3300028380 | Bacteria | 1162 |
| 1077 | Ga0268265_10720070 | 3300028380 | Bacteria | 966 |
| 1078 | Ga0268265_10869030 | 3300028380 | Bacteria | 883 |
| 1079 | Ga0268265_11382345 | 3300028380 | Bacteria | 706 |
| 1080 | Ga0268265_12096677 | 3300028380 | Bacteria | 572 |
| 1081 | Ga0268264_10022304 | 3300028381 | Bacteria | 5171 |
| 1082 | Ga0268264_10210617 | 3300028381 | Bacteria | 1784 |
| 1083 | Ga0268264_10309266 | 3300028381 | Bacteria | 1490 |
| 1084 | Ga0268264_10613391 | 3300028381 | Bacteria | 1073 |
| 1085 | Ga0268264_10753938 | 3300028381 | Bacteria | 970 |
| 1086 | Ga0268264_11906773 | 3300028381 | Bacteria | 604 |
| 1087 | Ga0265334_10101048 | 3300028573 | Bacteria | 1044 |
| 1088 | Ga0265318_10233049 | 3300028577 | Bacteria | 672 |
| 1089 | Ga0265336_10233406 | 3300028666 | Bacteria | 546 |
| 1090 | Ga0307517_10196957 | 3300028786 | Bacteria | 1267 |
| 1091 | Ga0265338_10006983 | 3300028800 | Bacteria | 14189 |
| 1092 | Ga0265338_10014249 | 3300028800 | Bacteria | 8867 |
| 1093 | Ga0265338_10727045 | 3300028800 | Bacteria | 684 |
| 1094 | Ga0265324_10000023 | 3300029957 | Bacteria | 164128 |
| 1095 | Ga0265324_10318366 | 3300029957 | Bacteria | 530 |
| 1096 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 1097 | Ga0268256_1000002 | 3300030500 | Bacteria | 1535763 |
| 1098 | Ga0268256_1001210 | 3300030500 | Bacteria | 16441 |
| 1099 | Ga0268256_1001873 | 3300030500 | Bacteria | 11646 |
| 1100 | Ga0268256_1005140 | 3300030500 | Bacteria | 5208 |
| 1101 | Ga0268256_1009603 | 3300030500 | Bacteria | 3192 |
| 1102 | Ga0268256_1010954 | 3300030500 | Bacteria | 2906 |
| 1103 | Ga0268256_1012887 | 3300030500 | Bacteria | 2563 |
| 1104 | Ga0268256_1015703 | 3300030500 | Bacteria | 2199 |
| 1105 | Ga0268256_1024544 | 3300030500 | Bacteria | 1545 |
| 1106 | Ga0268256_1025030 | 3300030500 | Bacteria | 1522 |
| 1107 | Ga0265770_1056347 | 3300030878 | Bacteria | 722 |
| 1108 | Ga0265330_10021565 | 3300031235 | Bacteria | 2938 |
| 1109 | Ga0265332_10009214 | 3300031238 | Bacteria | 4414 |
| 1110 | Ga0265332_10430125 | 3300031238 | Bacteria | 545 |
| 1111 | Ga0265328_10001981 | 3300031239 | Bacteria | 9294 |
| 1112 | Ga0265328_10011375 | 3300031239 | Bacteria | 3557 |
| 1113 | Ga0265328_10068864 | 3300031239 | Bacteria | 1300 |
| 1114 | Ga0265320_10012710 | 3300031240 | Bacteria | 4883 |
| 1115 | Ga0265320_10015761 | 3300031240 | Bacteria | 4260 |
| 1116 | Ga0265325_10000099 | 3300031241 | Bacteria | 61211 |
| 1117 | Ga0265325_10125404 | 3300031241 | Bacteria | 1234 |
| 1118 | Ga0265329_10056532 | 3300031242 | Bacteria | 1244 |
| 1119 | Ga0265340_10043331 | 3300031247 | Bacteria | 2206 |
| 1120 | Ga0265340_10188792 | 3300031247 | Bacteria | 930 |
| 1121 | Ga0265340_10352153 | 3300031247 | Bacteria | 650 |
| 1122 | Ga0265331_10003774 | 3300031250 | Bacteria | 9612 |
| 1123 | Ga0265331_10018195 | 3300031250 | Bacteria | 3649 |
| 1124 | Ga0265331_10019217 | 3300031250 | Bacteria | 3530 |
| 1125 | Ga0265327_10010769 | 3300031251 | Bacteria | 6379 |
| 1126 | Ga0265327_10158278 | 3300031251 | Bacteria | 1048 |
| 1127 | Ga0265316_10578363 | 3300031344 | Bacteria | 798 |
| 1128 | Ga0307513_10013944 | 3300031456 | Bacteria | 9850 |
| 1129 | Ga0307513_10014238 | 3300031456 | Bacteria | 9726 |
| 1130 | Ga0307513_10045145 | 3300031456 | Bacteria | 4818 |
| 1131 | Ga0307513_10073776 | 3300031456 | Bacteria | 3551 |
| 1132 | Ga0307513_10190036 | 3300031456 | Bacteria | 1906 |
| 1133 | Ga0307513_10293284 | 3300031456 | Bacteria | 1397 |
| 1134 | Ga0307509_10122863 | 3300031507 | Bacteria | 2570 |
| 1135 | Ga0307509_10240477 | 3300031507 | Bacteria | 1603 |
| 1136 | Ga0307408_100000233 | 3300031548 | Bacteria | 58127 |
| 1137 | Ga0307408_100119662 | 3300031548 | Bacteria | 2038 |
| 1138 | Ga0307408_100123916 | 3300031548 | Bacteria | 2006 |
| 1139 | Ga0307408_100157384 | 3300031548 | Bacteria | 1801 |
| 1140 | Ga0307408_100245499 | 3300031548 | Bacteria | 1474 |
| 1141 | Ga0307408_100324954 | 3300031548 | Bacteria | 1297 |
| 1142 | Ga0307408_101349188 | 3300031548 | Bacteria | 670 |
| 1143 | Ga0307408_101531664 | 3300031548 | Bacteria | 631 |
| 1144 | Ga0307408_101755879 | 3300031548 | Bacteria | 592 |
| 1145 | Ga0307508_10159712 | 3300031616 | Bacteria | 1858 |
| 1146 | Ga0307514_10115739 | 3300031649 | Bacteria | 1885 |
| 1147 | Ga0316575_10076193 | 3300031665 | Bacteria | 1350 |
| 1148 | Ga0316575_10124046 | 3300031665 | Bacteria | 1057 |
| 1149 | Ga0316579_10025457 | 3300031691 | Bacteria | 2671 |
| 1150 | Ga0316579_10380023 | 3300031691 | Bacteria | 683 |
| 1151 | Ga0265314_10001396 | 3300031711 | Bacteria | 27081 |
| 1152 | Ga0265314_10016392 | 3300031711 | Bacteria | 5854 |
| 1153 | Ga0265342_10018541 | 3300031712 | Bacteria | 4505 |
| 1154 | Ga0316576_10005681 | 3300031727 | Bacteria | 7667 |
| 1155 | Ga0316576_10067143 | 3300031727 | Bacteria | 2640 |
| 1156 | Ga0316578_10054629 | 3300031728 | Bacteria | 2343 |
| 1157 | Ga0316578_10195730 | 3300031728 | Bacteria | 1217 |
| 1158 | Ga0316578_10762131 | 3300031728 | Bacteria | 562 |
| 1159 | Ga0307405_10096800 | 3300031731 | Bacteria | 1969 |
| 1160 | Ga0307405_10157211 | 3300031731 | Bacteria | 1606 |
| 1161 | Ga0307405_10799621 | 3300031731 | Bacteria | 790 |
| 1162 | Ga0307405_11954929 | 3300031731 | Bacteria | 524 |
| 1163 | Ga0316577_10115592 | 3300031733 | Bacteria | 1506 |
| 1164 | Ga0307413_10029858 | 3300031824 | Bacteria | 3056 |
| 1165 | Ga0307413_10131836 | 3300031824 | Bacteria | 1712 |
| 1166 | Ga0307413_10156383 | 3300031824 | Bacteria | 1595 |
| 1167 | Ga0307410_10093591 | 3300031852 | Bacteria | 2139 |
| 1168 | Ga0307410_10539757 | 3300031852 | Bacteria | 965 |
| 1169 | Ga0326468_10044942 | 3300031889 | Bacteria | 647 |
| 1170 | Ga0307406_10009598 | 3300031901 | Bacteria | 5437 |
| 1171 | Ga0307406_10028506 | 3300031901 | Bacteria | 3374 |
| 1172 | Ga0307406_10136622 | 3300031901 | Bacteria | 1729 |
| 1173 | Ga0307406_10286953 | 3300031901 | Bacteria | 1258 |
| 1174 | Ga0307406_10691235 | 3300031901 | Bacteria | 851 |
| 1175 | Ga0307406_11645538 | 3300031901 | Bacteria | 568 |
| 1176 | Ga0307406_11683595 | 3300031901 | Bacteria | 562 |
| 1177 | Ga0307407_10135111 | 3300031903 | Bacteria | 1583 |
| 1178 | Ga0307407_10215276 | 3300031903 | Bacteria | 1296 |
| 1179 | Ga0307407_10477084 | 3300031903 | Bacteria | 910 |
| 1180 | Ga0307412_10020275 | 3300031911 | Bacteria | 4043 |
| 1181 | Ga0307412_10276823 | 3300031911 | Bacteria | 1316 |
| 1182 | Ga0307412_10358879 | 3300031911 | Bacteria | 1173 |
| 1183 | Ga0307412_10998402 | 3300031911 | Bacteria | 739 |
| 1184 | Ga0307409_100000848 | 3300031995 | Bacteria | 14077 |
| 1185 | Ga0307409_100026291 | 3300031995 | Bacteria | 4101 |
| 1186 | Ga0307409_100054968 | 3300031995 | Bacteria | 3070 |
| 1187 | Ga0307409_100169363 | 3300031995 | Bacteria | 1921 |
| 1188 | Ga0307409_101279673 | 3300031995 | Bacteria | 758 |
| 1189 | Ga0307409_101433852 | 3300031995 | Bacteria | 717 |
| 1190 | Ga0307409_102936608 | 3300031995 | Bacteria | 503 |
| 1191 | Ga0307416_100028510 | 3300032002 | Bacteria | 4153 |
| 1192 | Ga0307416_100114813 | 3300032002 | Bacteria | 2383 |
| 1193 | Ga0307416_100151409 | 3300032002 | Bacteria | 2128 |
| 1194 | Ga0307416_100600851 | 3300032002 | Bacteria | 1180 |
| 1195 | Ga0307416_100715894 | 3300032002 | Bacteria | 1091 |
| 1196 | Ga0307416_101207104 | 3300032002 | Bacteria | 862 |
| 1197 | Ga0307416_101998303 | 3300032002 | Bacteria | 682 |
| 1198 | Ga0307416_102080034 | 3300032002 | Bacteria | 670 |
| 1199 | Ga0307416_102737302 | 3300032002 | Bacteria | 589 |
| 1200 | Ga0307414_10399099 | 3300032004 | Bacteria | 1194 |
| 1201 | Ga0307414_10456699 | 3300032004 | Bacteria | 1122 |
| 1202 | Ga0307414_10604225 | 3300032004 | Bacteria | 984 |
| 1203 | Ga0307414_10884528 | 3300032004 | Bacteria | 818 |
| 1204 | Ga0307411_10006042 | 3300032005 | Bacteria | 6020 |
| 1205 | Ga0307411_10035933 | 3300032005 | Bacteria | 3099 |
| 1206 | Ga0307411_10070087 | 3300032005 | Bacteria | 2371 |
| 1207 | Ga0307411_10108470 | 3300032005 | Bacteria | 1981 |
| 1208 | Ga0307411_10124138 | 3300032005 | Bacteria | 1874 |
| 1209 | Ga0307411_10891462 | 3300032005 | Bacteria | 790 |
| 1210 | Ga0307411_12358168 | 3300032005 | Bacteria | 500 |
| 1211 | Ga0307415_100104265 | 3300032126 | Bacteria | 2089 |
| 1212 | Ga0307415_100142226 | 3300032126 | Bacteria | 1834 |
| 1213 | Ga0307415_100213386 | 3300032126 | Bacteria | 1542 |
| 1214 | Ga0307415_100549756 | 3300032126 | Bacteria | 1019 |
| 1215 | Ga0307415_100957725 | 3300032126 | Bacteria | 793 |
| 1216 | Ga0307415_101652789 | 3300032126 | Bacteria | 617 |
| 1217 | Ga0307415_101882067 | 3300032126 | Bacteria | 580 |
| 1218 | Ga0307415_101896915 | 3300032126 | Bacteria | 578 |
| 1219 | Ga0307415_102337004 | 3300032126 | Bacteria | 525 |
| 1220 | Ga0316583_10006991 | 3300032133 | Bacteria | 4060 |
| 1221 | Ga0316583_10162233 | 3300032133 | Bacteria | 778 |
| 1222 | Ga0316585_10022280 | 3300032137 | Bacteria | 1948 |
| 1223 | Ga0316593_10002945 | 3300032168 | Bacteria | 4139 |
| 1224 | Ga0316593_10004191 | 3300032168 | Bacteria | 3674 |
| 1225 | Ga0316593_10133054 | 3300032168 | Bacteria | 898 |
| 1226 | Ga0307507_10249937 | 3300033179 | Bacteria | 1147 |
| 1227 | Ga0316596_1024048 | 3300033541 | Bacteria | 1563 |
| 1228 | Ga0316596_1096720 | 3300033541 | Bacteria | 797 |
| 1229 | Ga0373959_0188007 | 3300034820 | Bacteria | 540 |
| 1230 | Ga0373959_0206559 | 3300034820 | Bacteria | 521 |
| 1231 | Ga0373944_0112038 | 3300035089 | Bacteria | 933 |
| 1232 | Ga0373954_0686199 | 3300035118 | Bacteria | 508 |
| 1233 | Ga0373946_0280383 | 3300035171 | Bacteria | 820 |
| 1234 | Ga0373962_0191054 | 3300035242 | Bacteria | 689 |
| 1235 | Ga0316574_0007271 | 3300035398 | Bacteria | 6058 |
| 1236 | Ga0316574_0008371 | 3300035398 | Bacteria | 5743 |
| 1237 | Ga0373937_0429906 | 3300036401 | Bacteria | 1253 |
| 1238 | Ga0373937_0471016 | 3300036401 | Bacteria | 1193 |
| 1239 | Ga0316582_0007780 | 3300036647 | Bacteria | 5727 |
| 1240 | Ga0316582_0011144 | 3300036647 | Bacteria | 4961 |
| 1241 | Ga0316582_0095316 | 3300036647 | Bacteria | 1964 |
| 1242 | Ga0316582_0101983 | 3300036647 | Bacteria | 1902 |
| 1243 | Ga0316584_0068479 | 3300036712 | Bacteria | 2660 |
| 1244 | Ga0316584_0078325 | 3300036712 | Bacteria | 2475 |
| 1245 | Ga0316584_0427174 | 3300036712 | Bacteria | 940 |
| 1246 | Ga0316584_0718848 | 3300036712 | Bacteria | 683 |
| 1247 | Ga0373925_0578941 | 3300037068 | Bacteria | 924 |
| 1248 | Ga0395899_0015304 | 3300037312 | Bacteria | 5845 |
| 1249 | Ga0395899_0073306 | 3300037312 | Bacteria | 2504 |
| 1250 | Ga0395899_0682958 | 3300037312 | Bacteria | 646 |
| 1251 | Ga0395900_0004973 | 3300037418 | Bacteria | 13983 |
| 1252 | Ga0395900_0017837 | 3300037418 | Bacteria | 7244 |
| 1253 | Ga0395900_0062746 | 3300037418 | Bacteria | 3819 |
| 1254 | Ga0395900_0087814 | 3300037418 | Bacteria | 3196 |
| 1255 | Ga0395900_0314044 | 3300037418 | Bacteria | 1550 |
| 1256 | Ga0395900_0406109 | 3300037418 | Bacteria | 1325 |
| 1257 | Ga0395900_0493215 | 3300037418 | Bacteria | 1176 |
| 1258 | Ga0395900_0608656 | 3300037418 | Bacteria | 1032 |
| 1259 | Ga0395900_1178691 | 3300037418 | Bacteria | 682 |
| 1260 | Ga0395898_0040030 | 3300037466 | Bacteria | 4637 |
| 1261 | Ga0395898_0202453 | 3300037466 | Bacteria | 1895 |
| 1262 | Ga0395898_1669599 | 3300037466 | Bacteria | 560 |
| 1263 | Ga0395905_0033547 | 3300037471 | Bacteria | 4822 |
| 1264 | Ga0395905_0407314 | 3300037471 | Bacteria | 1255 |
| 1265 | Ga0316581_0005837 | 3300037588 | Bacteria | 3234 |
| 1266 | Ga0316581_0067070 | 3300037588 | Bacteria | 1102 |
| 1267 | Ga0395901_0032242 | 3300038443 | Bacteria | 5407 |
| 1268 | Ga0395901_0104830 | 3300038443 | Bacteria | 2967 |
| 1269 | Ga0395901_0154352 | 3300038443 | Bacteria | 2411 |
| 1270 | Ga0400484_05024 | 3300038725 | Bacteria | 33998 |
| 1271 | Ga0400484_10160 | 3300038725 | Bacteria | 1137 |
| 1272 | Ga0400484_43085 | 3300038725 | Bacteria | 3132 |
| 1273 | Ga0400490_00409 | 3300038726 | Bacteria | 12140 |
| 1274 | Ga0400490_34188 | 3300038726 | Bacteria | 18647 |
| 1275 | Ga0400490_42931 | 3300038726 | Bacteria | 25734 |
| 1276 | Ga0400490_43036 | 3300038726 | Bacteria | 1088 |
| 1277 | Ga0400491_18134 | 3300038727 | Bacteria | 4680 |
| 1278 | Ga0400491_26290 | 3300038727 | Bacteria | 3634 |
| 1279 | Ga0400485_07089 | 3300038735 | Bacteria | 55387 |
| 1280 | Ga0400485_18810 | 3300038735 | Bacteria | 2463 |
| 1281 | Ga0400488_03145 | 3300038741 | Bacteria | 1021 |
| 1282 | Ga0400488_14284 | 3300038741 | Bacteria | 8862 |
| 1283 | Ga0400488_35681 | 3300038741 | Bacteria | 3759 |
| 1284 | Ga0400488_38081 | 3300038741 | Bacteria | 3210 |
| 1285 | Ga0400488_42106 | 3300038741 | Bacteria | 1579 |
| 1286 | Ga0400488_45799 | 3300038741 | Bacteria | 4365 |
| 1287 | Ga0400488_50773 | 3300038741 | Bacteria | 1117 |
| 1288 | Ga0400488_59901 | 3300038741 | Bacteria | 2885 |
| 1289 | Ga0400486_00736 | 3300038742 | Bacteria | 47794 |
| 1290 | Ga0400486_05533 | 3300038742 | Bacteria | 2142 |
| 1291 | Ga0400486_17198 | 3300038742 | Bacteria | 1072 |
| 1292 | Ga0400486_19297 | 3300038742 | Bacteria | 2660 |
| 1293 | Ga0400483_001519 | 3300039062 | Bacteria | 9720 |
| 1294 | Ga0400483_031408 | 3300039062 | Bacteria | 1914 |
| 1295 | Ga0400483_072960 | 3300039062 | Bacteria | 14885 |
| 1296 | Ga0400483_078562 | 3300039062 | Bacteria | 1349 |
| 1297 | Ga0400483_087044 | 3300039062 | Bacteria | 1040 |
| 1298 | Ga0400483_088943 | 3300039062 | Bacteria | 9451 |
| 1299 | Ga0400483_096157 | 3300039062 | Bacteria | 3475 |
| 1300 | Ga0400483_117917 | 3300039062 | Bacteria | 2224 |
| 1301 | Ga0400483_170536 | 3300039062 | Bacteria | 20327 |
| 1302 | Ga0400483_176269 | 3300039062 | Bacteria | 4804 |
| 1303 | Ga0400483_180135 | 3300039062 | Bacteria | 8660 |
| 1304 | Ga0400483_210780 | 3300039062 | Bacteria | 10470 |
| 1305 | Ga0400483_228091 | 3300039062 | Bacteria | 14906 |
| 1306 | Ga0400483_252383 | 3300039062 | Bacteria | 3710 |
| 1307 | Ga0400483_256324 | 3300039062 | Bacteria | 3100 |
| 1308 | Ga0400489_00591 | 3300039093 | Bacteria | 1958 |
| 1309 | Ga0400489_40355 | 3300039093 | Bacteria | 9964 |
| 1310 | Ga0400489_65224 | 3300039093 | Bacteria | 3524 |
| 1311 | Ga0400487_02857 | 3300039110 | Bacteria | 12480 |
| 1312 | Ga0400487_07641 | 3300039110 | Bacteria | 1262 |
| 1313 | Ga0400487_22307 | 3300039110 | Bacteria | 3115 |
| 1314 | Ga0400487_24442 | 3300039110 | Bacteria | 38481 |
| 1315 | Ga0400487_26069 | 3300039110 | Bacteria | 54334 |
| 1316 | Ga0400487_31982 | 3300039110 | Bacteria | 24104 |
| 1317 | Ga0400487_59236 | 3300039110 | Bacteria | 1020 |
| 1318 | Ga0400487_65155 | 3300039110 | Bacteria | 2349 |
| 1319 | Ga0436365_0965775 | 3300039437 | Bacteria | 470291 |
| 1320 | Ga0436360_1029640 | 3300039438 | Bacteria | 1548 |
| 1321 | Ga0436361_0560107 | 3300039447 | Bacteria | 808 |
| 1322 | Ga0436361_0739768 | 3300039447 | Bacteria | 83506 |
| 1323 | Ga0439438_000380 | 3300041405 | Bacteria | 19959 |
| 1324 | Ga0439438_061571 | 3300041405 | Bacteria | 939 |
| 1325 | Ga0451787_846636 | 3300041441 | Bacteria | 532 |
| 1326 | Ga0451789_0637691 | 3300041443 | Bacteria | 525 |
| 1327 | Ga0451793_0676117 | 3300041452 | Bacteria | 1065 |
| 1328 | Ga0451797_0959931 | 3300041453 | Bacteria | 550 |
| 1329 | Ga0451800_1265253 | 3300041459 | Bacteria | 572 |
| 1330 | Ga0451802_0524849 | 3300041460 | Bacteria | 1298 |
| 1331 | Ga0451802_1547169 | 3300041460 | Bacteria | 536 |
| 1332 | Ga0451804_0586432 | 3300041463 | Bacteria | 1016 |
| 1333 | Ga0451807_0147918 | 3300041486 | Bacteria | 1210 |
| 1334 | Ga0451807_1389212 | 3300041486 | Bacteria | 989 |
| 1335 | Ga0451807_1505127 | 3300041486 | Bacteria | 735 |
| 1336 | Ga0451837_0130692 | 3300041494 | Bacteria | 1680 |
| 1337 | Ga0451843_1240565 | 3300041509 | Bacteria | 1078 |
| 1338 | Ga0451853_0325509 | 3300041512 | Bacteria | 5877 |
| 1339 | Ga0451853_0462214 | 3300041512 | Bacteria | 1033 |
| 1340 | Ga0451853_1180675 | 3300041512 | Bacteria | 1354 |
| 1341 | Ga0451853_3327388 | 3300041512 | Bacteria | 506 |
| 1342 | Ga0439442_100762 | 3300042002 | Bacteria | 625 |
| 1343 | Ga0439432_000045 | 3300042006 | Bacteria | 37506 |
| 1344 | Ga0439432_006137 | 3300042006 | Bacteria | 4303 |
| 1345 | Ga0439432_010116 | 3300042006 | Bacteria | 3279 |
| 1346 | Ga0439432_061984 | 3300042006 | Bacteria | 1152 |
| 1347 | Ga0439450_084743 | 3300042008 | Bacteria | 791 |
| 1348 | Ga0439452_000022 | 3300042010 | Bacteria | 267565 |
| 1349 | Ga0439452_000031 | 3300042010 | Bacteria | 196691 |
| 1350 | Ga0439452_000052 | 3300042010 | Bacteria | 116502 |
| 1351 | Ga0439452_000185 | 3300042010 | Bacteria | 46686 |
| 1352 | Ga0439452_001436 | 3300042010 | Bacteria | 9740 |
| 1353 | Ga0439452_101540 | 3300042010 | Bacteria | 618 |
| 1354 | Ga0450923_027568 | 3300042125 | Bacteria | 1143 |
| 1355 | Ga0450890_057670 | 3300042127 | Bacteria | 603 |
| 1356 | Ga0450899_036526 | 3300042135 | Bacteria | 608 |
| 1357 | Ga0450900_018344 | 3300042136 | Bacteria | 959 |
| 1358 | Ga0450902_026772 | 3300042137 | Bacteria | 965 |
| 1359 | Ga0450905_023878 | 3300042142 | Bacteria | 914 |
| 1360 | Ga0439464_0096641 | 3300042439 | Bacteria | 895 |
| 1361 | Ga0439464_0144060 | 3300042439 | Bacteria | 743 |
| 1362 | Ga0451577_0011606 | 3300042876 | Bacteria | 8323 |
| 1363 | Ga0451577_0094281 | 3300042876 | Bacteria | 2673 |
| 1364 | Ga0451577_0462057 | 3300042876 | Bacteria | 1153 |
| 1365 | Ga0451577_0541409 | 3300042876 | Bacteria | 1057 |
| 1366 | Ga0451577_1424458 | 3300042876 | Unclassified | 614 |
| 1367 | Ga0451577_2032600 | 3300042876 | Bacteria | 502 |
| 1368 | Ga0439440_0093582 | 3300042993 | Bacteria | 809 |
| 1369 | Ga0439440_0149460 | 3300042993 | Bacteria | 668 |
| 1370 | Ga0466969_0134121 | 3300044656 | Bacteria | 1147 |
| 1371 | Ga0466972_0026077 | 3300044658 | Bacteria | 2895 |
| 1372 | Ga0466977_0000151 | 3300044666 | Bacteria | 16992 |
| 1373 | Ga0466981_0000003 | 3300044669 | Bacteria | 248458 |
| 1374 | Ga0466981_0000008 | 3300044669 | Bacteria | 147179 |
| 1375 | Ga0453683_0010800 | 3300044673 | Bacteria | 6044 |
| 1376 | Ga0466961_0012469 | 3300044693 | Bacteria | 5439 |
| 1377 | Ga0466961_0787082 | 3300044693 | Bacteria | 568 |
| 1378 | Ga0453684_0000029 | 3300044712 | Bacteria | 757969 |
| 1379 | Ga0453684_0745521 | 3300044712 | Bacteria | 1061 |
| 1380 | Ga0453684_1008640 | 3300044712 | Bacteria | 885 |
| 1381 | Ga0453684_1333549 | 3300044712 | Bacteria | 747 |
| 1382 | Ga0466970_0780516 | 3300044765 | Bacteria | 559 |
| 1383 | Ga0466957_1368104 | 3300044842 | Bacteria | 515 |
| 1384 | Ga0466959_0038794 | 3300045049 | Bacteria | 3519 |
| 1385 | Ga0466959_0057703 | 3300045049 | Bacteria | 2830 |
| 1386 | Ga0451576_0000060 | 3300045051 | Bacteria | 290345 |
| 1387 | Ga0451576_0023459 | 3300045051 | Bacteria | 6679 |
| 1388 | Ga0451576_0025846 | 3300045051 | Bacteria | 6324 |
| 1389 | Ga0451576_0263152 | 3300045051 | Bacteria | 1803 |
| 1390 | Ga0451576_1270707 | 3300045051 | Bacteria | 768 |
| 1391 | Ga0466958_0446809 | 3300045836 | Bacteria | 837 |
| 1392 | Ga0466967_2496654 | 3300045976 | Bacteria | 512 |
| 1393 | Ga0495627_000027 | 3300046453 | Bacteria | 236960 |
| 1394 | Ga0495627_023825 | 3300046453 | Bacteria | 2001 |
| 1395 | Ga0495592_0141065 | 3300046454 | Bacteria | 1676 |
| 1396 | Ga0495592_0143502 | 3300046454 | Bacteria | 1658 |
| 1397 | Ga0495603_0087342 | 3300046455 | Bacteria | 1825 |
| 1398 | Ga0495590_0006902 | 3300046457 | Bacteria | 4406 |
| 1399 | Ga0495591_000083 | 3300046458 | Bacteria | 106558 |
| 1400 | Ga0495591_000998 | 3300046458 | Bacteria | 19239 |
| 1401 | Ga0495591_016860 | 3300046458 | Bacteria | 2527 |
| 1402 | Ga0495629_0020593 | 3300046459 | Bacteria | 4710 |
| 1403 | Ga0495638_0001268 | 3300046460 | Bacteria | 23573 |
| 1404 | Ga0495638_0001518 | 3300046460 | Bacteria | 20885 |
| 1405 | Ga0495638_0018668 | 3300046460 | Bacteria | 4601 |
| 1406 | Ga0495638_0045381 | 3300046460 | Bacteria | 2765 |
| 1407 | Ga0495638_0228681 | 3300046460 | Bacteria | 1036 |
| 1408 | Ga0495641_0093236 | 3300046461 | Bacteria | 1345 |
| 1409 | Ga0495641_0436813 | 3300046461 | Bacteria | 595 |
| 1410 | Ga0495641_0540684 | 3300046461 | Bacteria | 532 |
| 1411 | Ga0495653_0002537 | 3300046463 | Bacteria | 14547 |
| 1412 | Ga0495653_0031052 | 3300046463 | Bacteria | 4249 |
| 1413 | Ga0495650_0000300 | 3300046471 | Bacteria | 89857 |
| 1414 | Ga0495580_0003545 | 3300046472 | Bacteria | 13258 |
| 1415 | Ga0495582_0002615 | 3300046473 | Bacteria | 10024 |
| 1416 | Ga0495605_0000901 | 3300046474 | Bacteria | 20462 |
| 1417 | Ga0495605_0051001 | 3300046474 | Bacteria | 2016 |
| 1418 | Ga0495664_0005042 | 3300046477 | Bacteria | 7232 |
| 1419 | Ga0495584_0021863 | 3300046491 | Bacteria | 3248 |
| 1420 | Ga0495584_0303296 | 3300046491 | Bacteria | 811 |
| 1421 | Ga0495584_0396782 | 3300046491 | Bacteria | 701 |
| 1422 | Ga0495585_0008886 | 3300046492 | Bacteria | 6062 |
| 1423 | Ga0495585_0129285 | 3300046492 | Bacteria | 1330 |
| 1424 | Ga0495585_0572959 | 3300046492 | Bacteria | 532 |
| 1425 | Ga0495594_0165067 | 3300046499 | Bacteria | 1259 |
| 1426 | Ga0495596_0000058 | 3300046500 | Bacteria | 80763 |
| 1427 | Ga0495607_0003653 | 3300046501 | Bacteria | 11680 |
| 1428 | Ga0495607_0014151 | 3300046501 | Bacteria | 5206 |
| 1429 | Ga0495583_0031710 | 3300046506 | Bacteria | 2559 |
| 1430 | Ga0495606_0005069 | 3300046507 | Bacteria | 12815 |
| 1431 | Ga0495606_0629282 | 3300046507 | Bacteria | 522 |
| 1432 | Ga0495608_0003661 | 3300046511 | Bacteria | 11051 |
| 1433 | Ga0495610_0000563 | 3300046512 | Bacteria | 37173 |
| 1434 | Ga0495616_0001404 | 3300046513 | Bacteria | 16762 |
| 1435 | Ga0495616_0013893 | 3300046513 | Bacteria | 4525 |
| 1436 | Ga0495616_0026195 | 3300046513 | Bacteria | 3107 |
| 1437 | Ga0495616_0168625 | 3300046513 | Bacteria | 980 |
| 1438 | Ga0495618_0001116 | 3300046514 | Bacteria | 18155 |
| 1439 | Ga0495620_0001269 | 3300046515 | Bacteria | 15394 |
| 1440 | Ga0495630_0004287 | 3300046517 | Bacteria | 10004 |
| 1441 | Ga0495631_0498045 | 3300046518 | Bacteria | 519 |
| 1442 | Ga0495632_0259751 | 3300046519 | Bacteria | 777 |
| 1443 | Ga0495637_0086401 | 3300046520 | Bacteria | 1243 |
| 1444 | Ga0495643_0281962 | 3300046522 | Bacteria | 764 |
| 1445 | Ga0495648_0036468 | 3300046524 | Bacteria | 3172 |
| 1446 | Ga0495648_0082650 | 3300046524 | Bacteria | 1822 |
| 1447 | Ga0495648_0317285 | 3300046524 | Bacteria | 724 |
| 1448 | Ga0495666_0000165 | 3300046526 | Bacteria | 27949 |
| 1449 | Ga0495652_0053359 | 3300046529 | Bacteria | 3445 |
| 1450 | Ga0495652_0203738 | 3300046529 | Bacteria | 1500 |
| 1451 | Ga0495654_0002080 | 3300046530 | Bacteria | 13121 |
| 1452 | Ga0495654_0007484 | 3300046530 | Bacteria | 6097 |
| 1453 | Ga0495654_0020885 | 3300046530 | Bacteria | 3409 |
| 1454 | Ga0495654_0146065 | 3300046530 | Bacteria | 1049 |
| 1455 | Ga0495665_0007277 | 3300046531 | Bacteria | 5974 |
| 1456 | Ga0495640_0001348 | 3300046533 | Bacteria | 19310 |
| 1457 | Ga0495586_0003809 | 3300046535 | Bacteria | 8079 |
| 1458 | Ga0495587_0002694 | 3300046536 | Bacteria | 11857 |
| 1459 | Ga0495587_0415575 | 3300046536 | Bacteria | 747 |
| 1460 | Ga0495609_0002064 | 3300046538 | Bacteria | 12641 |
| 1461 | Ga0495597_0001859 | 3300046542 | Bacteria | 14432 |
| 1462 | Ga0495645_0002675 | 3300046543 | Bacteria | 12098 |
| 1463 | Ga0495622_0000220 | 3300046557 | Bacteria | 45127 |
| 1464 | Ga0495622_0179303 | 3300046557 | Bacteria | 950 |
| 1465 | Ga0495656_0709901 | 3300046615 | Bacteria | 541 |
| 1466 | Ga0495668_0095818 | 3300046616 | Bacteria | 1624 |
| 1467 | Ga0495634_0000855 | 3300046642 | Bacteria | 29347 |
| 1468 | Ga0495611_0555521 | 3300046648 | Bacteria | 520 |
| 1469 | Ga0495625_0017002 | 3300046660 | Bacteria | 5704 |
| 1470 | Ga0495625_0026459 | 3300046660 | Bacteria | 4384 |
| 1471 | Ga0495625_0085518 | 3300046660 | Bacteria | 2189 |
| 1472 | Ga0495625_0279732 | 3300046660 | Bacteria | 1074 |
| 1473 | Ga0495625_0401630 | 3300046660 | Bacteria | 856 |
| 1474 | Ga0495635_0029481 | 3300046663 | Bacteria | 3816 |
| 1475 | Ga0495635_0647210 | 3300046663 | Bacteria | 688 |
| 1476 | Ga0495659_0432541 | 3300046664 | Bacteria | 571 |
| 1477 | Ga0495661_0000095 | 3300046665 | Bacteria | 109100 |
| 1478 | Ga0495661_0007158 | 3300046665 | Bacteria | 7786 |
| 1479 | Ga0495661_0053608 | 3300046665 | Bacteria | 2424 |
| 1480 | Ga0495661_0159907 | 3300046665 | Bacteria | 1210 |
| 1481 | Ga0495588_0077975 | 3300046674 | Bacteria | 1728 |
| 1482 | Ga0495599_0007872 | 3300046678 | Bacteria | 6463 |
| 1483 | Ga0495599_0086600 | 3300046678 | Bacteria | 1956 |
| 1484 | Ga0495599_0393464 | 3300046678 | Bacteria | 826 |
| 1485 | Ga0495599_0764400 | 3300046678 | Bacteria | 554 |
| 1486 | Ga0495623_0005692 | 3300046679 | Bacteria | 8138 |
| 1487 | Ga0495646_0007023 | 3300046680 | Bacteria | 7149 |
| 1488 | Ga0495646_0116857 | 3300046680 | Bacteria | 1513 |
| 1489 | Ga0495647_0478634 | 3300046681 | Bacteria | 578 |
| 1490 | Ga0495669_0554361 | 3300046684 | Bacteria | 559 |
| 1491 | Ga0495669_0574234 | 3300046684 | Bacteria | 549 |
| 1492 | Ga0495613_0001821 | 3300046689 | Bacteria | 16207 |
| 1493 | Ga0495613_0197723 | 3300046689 | Bacteria | 1419 |
| 1494 | Ga0495624_0007673 | 3300046690 | Bacteria | 7571 |
| 1495 | Ga0495624_0706071 | 3300046690 | Bacteria | 598 |
| 1496 | Ga0495670_0044916 | 3300046691 | Bacteria | 2206 |
| 1497 | Ga0495671_0000878 | 3300046692 | Bacteria | 21471 |
| 1498 | Ga0495671_0263368 | 3300046692 | Bacteria | 831 |
| 1499 | Ga0495671_0275790 | 3300046692 | Bacteria | 810 |
| 1500 | Ga0495649_0000947 | 3300046694 | Bacteria | 22926 |
| 1501 | Ga0495649_0002065 | 3300046694 | Bacteria | 14446 |
| 1502 | Ga0495649_0015533 | 3300046694 | Bacteria | 4332 |
| 1503 | Ga0495649_0022383 | 3300046694 | Bacteria | 3536 |
| 1504 | Ga0495649_0068923 | 3300046694 | Bacteria | 1897 |
| 1505 | Ga0495649_0143318 | 3300046694 | Bacteria | 1257 |
| 1506 | Ga0495649_0151881 | 3300046694 | Bacteria | 1216 |
| 1507 | Ga0495589_0000001 | 3300046794 | Bacteria | 888100 |
| 1508 | Ga0495660_0275851 | 3300046810 | Bacteria | 771 |
| 1509 | Ga0495581_0005536 | 3300047315 | Bacteria | 7315 |
| 1510 | Ga0495604_0004579 | 3300047317 | Bacteria | 10953 |
| 1511 | Ga0495636_0206493 | 3300047318 | Bacteria | 898 |
| 1512 | Ga0495674_0018957 | 3300047319 | Bacteria | 6397 |
| 1513 | Ga0495672_0000204 | 3300047320 | Bacteria | 84394 |
| 1514 | Ga0495672_0022544 | 3300047320 | Bacteria | 4091 |
| 1515 | Ga0495676_0001816 | 3300047321 | Bacteria | 18695 |
| 1516 | Ga0495676_0019609 | 3300047321 | Bacteria | 5947 |
| 1517 | Ga0495680_0003907 | 3300047322 | Bacteria | 14416 |
| 1518 | Ga0495680_0200219 | 3300047322 | Bacteria | 1433 |
| 1519 | Ga0495680_0291780 | 3300047322 | Bacteria | 1147 |
| 1520 | Ga0495680_0979118 | 3300047322 | Bacteria | 542 |
| 1521 | Ga0495683_0000089 | 3300047323 | Bacteria | 92081 |
| 1522 | Ga0495683_0392255 | 3300047323 | Bacteria | 579 |
| 1523 | Ga0495675_0017805 | 3300047444 | Bacteria | 4504 |
| 1524 | Ga0495679_000052 | 3300047446 | Bacteria | 120793 |
| 1525 | Ga0495679_001064 | 3300047446 | Bacteria | 16657 |
| 1526 | Ga0495679_007896 | 3300047446 | Bacteria | 4382 |
| 1527 | Ga0495679_080691 | 3300047446 | Bacteria | 924 |
| 1528 | Ga0495685_213749 | 3300047447 | Bacteria | 616 |
| 1529 | Ga0495673_0000007 | 3300047469 | Bacteria | 796722 |
| 1530 | Ga0495673_0295812 | 3300047469 | Bacteria | 581 |
| 1531 | Ga0495681_0059079 | 3300047470 | Bacteria | 1775 |
| 1532 | Ga0495684_0047087 | 3300047471 | Bacteria | 3299 |
| 1533 | Ga0495686_0458815 | 3300047472 | Bacteria | 676 |
| 1534 | Ga0495593_0012504 | 3300047673 | Bacteria | 4851 |
| 1535 | Ga0495602_0004785 | 3300048088 | Bacteria | 14151 |
| 1536 | Ga0495602_0034813 | 3300048088 | Bacteria | 4704 |
| 1537 | Ga0495614_0006132 | 3300048089 | Bacteria | 5403 |
| 1538 | Ga0495626_0068504 | 3300048091 | Bacteria | 1600 |
| 1539 | Ga0496100_0514283 | 3300048903 | Bacteria | 923 |
| 1540 | Ga0496100_1195924 | 3300048903 | Bacteria | 600 |
| 1541 | Ga0496101_0008211 | 3300048904 | Bacteria | 6818 |
| 1542 | Ga0496101_0336456 | 3300048904 | Bacteria | 1185 |
| 1543 | Ga0496102_0878019 | 3300048905 | Bacteria | 819 |
| 1544 | Ga0496102_1270923 | 3300048905 | Bacteria | 655 |
| 1545 | Ga0496104_0000187 | 3300048907 | Bacteria | 55714 |
| 1546 | Ga0496104_0151923 | 3300048907 | Bacteria | 2222 |
| 1547 | Ga0496104_0410133 | 3300048907 | Bacteria | 1267 |
| 1548 | Ga0496104_1064425 | 3300048907 | Bacteria | 712 |
| 1549 | Ga0496105_0015135 | 3300048908 | Bacteria | 6139 |
| 1550 | Ga0496105_0156388 | 3300048908 | Bacteria | 1872 |
| 1551 | Ga0496105_0164947 | 3300048908 | Bacteria | 1818 |
| 1552 | Ga0496105_1239443 | 3300048908 | Bacteria | 547 |
| 1553 | Ga0496106_0512695 | 3300048909 | Bacteria | 963 |
| 1554 | Ga0496107_0411574 | 3300048910 | Bacteria | 1006 |
| 1555 | Ga0496107_0548398 | 3300048910 | Bacteria | 856 |
| 1556 | Ga0496108_0131761 | 3300048911 | Bacteria | 2149 |
| 1557 | Ga0496108_0522518 | 3300048911 | Bacteria | 1036 |
| 1558 | Ga0496109_0240926 | 3300048912 | Bacteria | 1702 |
| 1559 | Ga0496109_1777394 | 3300048912 | Bacteria | 550 |
| 1560 | Ga0496110_0130442 | 3300048913 | Bacteria | 2269 |
| 1561 | Ga0496110_0692012 | 3300048913 | Bacteria | 921 |
| 1562 | Ga0496110_1228651 | 3300048913 | Bacteria | 658 |
| 1563 | Ga0496111_0368765 | 3300048914 | Bacteria | 1062 |
| 1564 | Ga0496112_0043105 | 3300048915 | Bacteria | 4417 |
| 1565 | Ga0496112_0112780 | 3300048915 | Bacteria | 2689 |
| 1566 | Ga0496114_0000303 | 3300048917 | Bacteria | 36267 |
| 1567 | Ga0496114_0014654 | 3300048917 | Bacteria | 6300 |
| 1568 | Ga0496114_0024350 | 3300048917 | Bacteria | 4940 |
| 1569 | Ga0496114_0440519 | 3300048917 | Bacteria | 1154 |
| 1570 | Ga0496114_1187481 | 3300048917 | Bacteria | 649 |
| 1571 | Ga0496115_0174592 | 3300048918 | Bacteria | 1777 |
| 1572 | Ga0496115_0378968 | 3300048918 | Bacteria | 1151 |
| 1573 | Ga0496115_0927972 | 3300048918 | Bacteria | 670 |
| 1574 | Ga0496116_0000001 | 3300048919 | Bacteria | 1501681 |
| 1575 | Ga0496116_0000259 | 3300048919 | Bacteria | 92753 |
| 1576 | Ga0496116_0000261 | 3300048919 | Bacteria | 92108 |
| 1577 | Ga0496116_0000431 | 3300048919 | Bacteria | 58709 |
| 1578 | Ga0496116_0001765 | 3300048919 | Bacteria | 23575 |
| 1579 | Ga0496116_0002090 | 3300048919 | Bacteria | 21348 |
| 1580 | Ga0496116_0014384 | 3300048919 | Bacteria | 6325 |
| 1581 | Ga0496116_0038209 | 3300048919 | Bacteria | 3336 |
| 1582 | Ga0496116_0049568 | 3300048919 | Bacteria | 2806 |
| 1583 | Ga0496116_0081517 | 3300048919 | Bacteria | 2005 |
| 1584 | Ga0496116_0095137 | 3300048919 | Bacteria | 1798 |
| 1585 | Ga0496116_0120430 | 3300048919 | Bacteria | 1520 |
| 1586 | Ga0496116_0132944 | 3300048919 | Bacteria | 1414 |
| 1587 | Ga0496116_0139340 | 3300048919 | Bacteria | 1367 |
| 1588 | Ga0496116_0150216 | 3300048919 | Bacteria | 1295 |
| 1589 | Ga0496117_0000088 | 3300048920 | Bacteria | 211093 |
| 1590 | Ga0496117_0000213 | 3300048920 | Bacteria | 111751 |
| 1591 | Ga0496117_0000692 | 3300048920 | Bacteria | 53710 |
| 1592 | Ga0496117_0000775 | 3300048920 | Bacteria | 50341 |
| 1593 | Ga0496117_0013550 | 3300048920 | Bacteria | 7106 |
| 1594 | Ga0496117_0014719 | 3300048920 | Bacteria | 6718 |
| 1595 | Ga0496117_0022682 | 3300048920 | Bacteria | 5027 |
| 1596 | Ga0496117_0036301 | 3300048920 | Bacteria | 3690 |
| 1597 | Ga0496117_0069195 | 3300048920 | Bacteria | 2378 |
| 1598 | Ga0496117_0070590 | 3300048920 | Bacteria | 2345 |
| 1599 | Ga0496118_0000137 | 3300048921 | Bacteria | 129477 |
| 1600 | Ga0496118_0003151 | 3300048921 | Bacteria | 21097 |
| 1601 | Ga0496118_0004717 | 3300048921 | Bacteria | 15960 |
| 1602 | Ga0496118_0025556 | 3300048921 | Bacteria | 5058 |
| 1603 | Ga0496118_0029767 | 3300048921 | Bacteria | 4571 |
| 1604 | Ga0496118_0031473 | 3300048921 | Bacteria | 4397 |
| 1605 | Ga0496118_0069757 | 3300048921 | Bacteria | 2543 |
| 1606 | Ga0496118_0073596 | 3300048921 | Bacteria | 2446 |
| 1607 | Ga0496118_0369956 | 3300048921 | Bacteria | 756 |
| 1608 | Ga0496119_0000001 | 3300048922 | Bacteria | 789520 |
| 1609 | Ga0496119_0000677 | 3300048922 | Bacteria | 45578 |
| 1610 | Ga0496119_0022421 | 3300048922 | Bacteria | 4521 |
| 1611 | Ga0496119_0029153 | 3300048922 | Bacteria | 3749 |
| 1612 | Ga0496119_0030587 | 3300048922 | Bacteria | 3625 |
| 1613 | Ga0496119_0055251 | 3300048922 | Bacteria | 2412 |
| 1614 | Ga0496119_0058376 | 3300048922 | Bacteria | 2325 |
| 1615 | Ga0496120_0000035 | 3300048923 | Bacteria | 213992 |
| 1616 | Ga0496120_0011345 | 3300048923 | Bacteria | 6132 |
| 1617 | Ga0496120_0014936 | 3300048923 | Bacteria | 5144 |
| 1618 | Ga0496120_0022355 | 3300048923 | Bacteria | 3979 |
| 1619 | Ga0496120_0024300 | 3300048923 | Bacteria | 3780 |
| 1620 | Ga0496120_0041853 | 3300048923 | Bacteria | 2679 |
| 1621 | Ga0496120_0102367 | 3300048923 | Bacteria | 1510 |
| 1622 | Ga0496120_0324295 | 3300048923 | Bacteria | 698 |
| 1623 | Ga0496121_0000124 | 3300048924 | Bacteria | 170427 |
| 1624 | Ga0496121_0000565 | 3300048924 | Bacteria | 69798 |
| 1625 | Ga0496121_0002427 | 3300048924 | Bacteria | 28487 |
| 1626 | Ga0496121_0002678 | 3300048924 | Bacteria | 26645 |
| 1627 | Ga0496121_0005298 | 3300048924 | Bacteria | 16601 |
| 1628 | Ga0496121_0009939 | 3300048924 | Bacteria | 10830 |
| 1629 | Ga0496121_0016780 | 3300048924 | Bacteria | 7532 |
| 1630 | Ga0496121_0030937 | 3300048924 | Bacteria | 4905 |
| 1631 | Ga0496121_0038197 | 3300048924 | Bacteria | 4257 |
| 1632 | Ga0496121_0054881 | 3300048924 | Bacteria | 3325 |
| 1633 | Ga0496121_0094555 | 3300048924 | Bacteria | 2325 |
| 1634 | Ga0496121_0175622 | 3300048924 | Bacteria | 1551 |
| 1635 | Ga0496121_0188624 | 3300048924 | Bacteria | 1480 |
| 1636 | Ga0496121_0449869 | 3300048924 | Bacteria | 830 |
| 1637 | Ga0496122_0000003 | 3300048925 | Bacteria | 645810 |
| 1638 | Ga0496122_0000033 | 3300048925 | Bacteria | 324104 |
| 1639 | Ga0496122_0000130 | 3300048925 | Bacteria | 173330 |
| 1640 | Ga0496122_0000556 | 3300048925 | Bacteria | 76521 |
| 1641 | Ga0496122_0000908 | 3300048925 | Bacteria | 54441 |
| 1642 | Ga0496122_0002291 | 3300048925 | Bacteria | 27653 |
| 1643 | Ga0496122_0004489 | 3300048925 | Bacteria | 17257 |
| 1644 | Ga0496122_0010973 | 3300048925 | Bacteria | 9261 |
| 1645 | Ga0496122_0017009 | 3300048925 | Bacteria | 6829 |
| 1646 | Ga0496122_0067397 | 3300048925 | Bacteria | 2578 |
| 1647 | Ga0496122_0091745 | 3300048925 | Bacteria | 2067 |
| 1648 | Ga0496122_0198803 | 3300048925 | Bacteria | 1174 |
| 1649 | Ga0496122_0332487 | 3300048925 | Bacteria | 802 |
| 1650 | Ga0496123_0000047 | 3300048926 | Bacteria | 244302 |
| 1651 | Ga0496123_0000064 | 3300048926 | Bacteria | 212668 |
| 1652 | Ga0496123_0000248 | 3300048926 | Bacteria | 109122 |
| 1653 | Ga0496123_0000412 | 3300048926 | Bacteria | 78170 |
| 1654 | Ga0496123_0000827 | 3300048926 | Bacteria | 49725 |
| 1655 | Ga0496123_0001688 | 3300048926 | Bacteria | 29564 |
| 1656 | Ga0496123_0003088 | 3300048926 | Bacteria | 19125 |
| 1657 | Ga0496123_0003448 | 3300048926 | Bacteria | 17728 |
| 1658 | Ga0496123_0010153 | 3300048926 | Bacteria | 8360 |
| 1659 | Ga0496123_0013548 | 3300048926 | Bacteria | 6829 |
| 1660 | Ga0496123_0078525 | 3300048926 | Bacteria | 2021 |
| 1661 | Ga0496123_0078527 | 3300048926 | Bacteria | 2021 |
| 1662 | Ga0496123_0144193 | 3300048926 | Bacteria | 1296 |
| 1663 | Ga0496123_0283379 | 3300048926 | Bacteria | 799 |
| 1664 | Ga0496123_0452602 | 3300048926 | Bacteria | 571 |
| 1665 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 1666 | Ga0496124_0000520 | 3300048927 | Bacteria | 65628 |
| 1667 | Ga0496124_0000787 | 3300048927 | Bacteria | 51800 |
| 1668 | Ga0496124_0003227 | 3300048927 | Bacteria | 20134 |
| 1669 | Ga0496124_0004158 | 3300048927 | Bacteria | 17083 |
| 1670 | Ga0496124_0019126 | 3300048927 | Bacteria | 6390 |
| 1671 | Ga0496124_0023793 | 3300048927 | Bacteria | 5583 |
| 1672 | Ga0496124_0027226 | 3300048927 | Bacteria | 5137 |
| 1673 | Ga0496124_0052665 | 3300048927 | Bacteria | 3456 |
| 1674 | Ga0496124_0059890 | 3300048927 | Bacteria | 3196 |
| 1675 | Ga0496124_0085047 | 3300048927 | Bacteria | 2592 |
| 1676 | Ga0496124_0106994 | 3300048927 | Bacteria | 2257 |
| 1677 | Ga0496124_0324812 | 3300048927 | Bacteria | 1100 |
| 1678 | Ga0496125_0000065 | 3300048928 | Bacteria | 249830 |
| 1679 | Ga0496125_0000527 | 3300048928 | Bacteria | 66086 |
| 1680 | Ga0496125_0003418 | 3300048928 | Bacteria | 19283 |
| 1681 | Ga0496125_0003564 | 3300048928 | Bacteria | 18747 |
| 1682 | Ga0496125_0003754 | 3300048928 | Bacteria | 18085 |
| 1683 | Ga0496125_0057096 | 3300048928 | Bacteria | 3164 |
| 1684 | Ga0496125_0084677 | 3300048928 | Bacteria | 2406 |
| 1685 | Ga0496125_0097344 | 3300048928 | Bacteria | 2180 |
| 1686 | Ga0496125_0138861 | 3300048928 | Bacteria | 1694 |
| 1687 | Ga0496125_0177891 | 3300048928 | Bacteria | 1421 |
| 1688 | Ga0496126_0000841 | 3300048929 | Bacteria | 54337 |
| 1689 | Ga0496126_0000960 | 3300048929 | Bacteria | 49411 |
| 1690 | Ga0496126_0002568 | 3300048929 | Bacteria | 24280 |
| 1691 | Ga0496126_0007255 | 3300048929 | Bacteria | 12189 |
| 1692 | Ga0496126_0011250 | 3300048929 | Bacteria | 9283 |
| 1693 | Ga0496126_0048382 | 3300048929 | Bacteria | 3886 |
| 1694 | Ga0496126_0080195 | 3300048929 | Bacteria | 2888 |
| 1695 | Ga0496126_0088145 | 3300048929 | Bacteria | 2734 |
| 1696 | Ga0496126_0088277 | 3300048929 | Bacteria | 2732 |
| 1697 | Ga0496126_0266211 | 3300048929 | Bacteria | 1424 |
| 1698 | Ga0496126_0342424 | 3300048929 | Bacteria | 1224 |
| 1699 | Ga0496126_0355785 | 3300048929 | Bacteria | 1197 |
| 1700 | Ga0496126_0642362 | 3300048929 | Bacteria | 831 |
| 1701 | Ga0496126_0682605 | 3300048929 | Bacteria | 800 |
| 1702 | Ga0495678_012399 | 3300049459 | Bacteria | 4045 |
| 1703 | Ga0495678_135436 | 3300049459 | Bacteria | 812 |
| 1704 | Ga0501031_0002035 | 3300049568 | Bacteria | 12732 |
| 1705 | Ga0501031_0006803 | 3300049568 | Bacteria | 7459 |
| 1706 | Ga0501031_0361835 | 3300049568 | Bacteria | 939 |
| 1707 | Ga0501031_0917656 | 3300049568 | Bacteria | 560 |
| 1708 | Ga0501032_0000544 | 3300049569 | Bacteria | 30544 |
| 1709 | Ga0501032_0015477 | 3300049569 | Bacteria | 5379 |
| 1710 | Ga0501032_0029516 | 3300049569 | Bacteria | 3762 |
| 1711 | Ga0501032_0086692 | 3300049569 | Bacteria | 2080 |
| 1712 | Ga0501033_0000453 | 3300049570 | Bacteria | 38996 |
| 1713 | Ga0501033_0002266 | 3300049570 | Bacteria | 16454 |
| 1714 | Ga0501033_0003651 | 3300049570 | Bacteria | 12550 |
| 1715 | Ga0501033_0010735 | 3300049570 | Bacteria | 7021 |
| 1716 | Ga0501033_0042922 | 3300049570 | Bacteria | 3370 |
| 1717 | Ga0501033_0187675 | 3300049570 | Bacteria | 1480 |
| 1718 | Ga0501034_0000106 | 3300049571 | Bacteria | 153523 |
| 1719 | Ga0501034_0006930 | 3300049571 | Bacteria | 12110 |
| 1720 | Ga0501034_0085778 | 3300049571 | Bacteria | 3150 |
| 1721 | Ga0501034_0147928 | 3300049571 | Bacteria | 2325 |
| 1722 | Ga0501034_0158103 | 3300049571 | Bacteria | 2239 |
| 1723 | Ga0501034_0195111 | 3300049571 | Bacteria | 1985 |
| 1724 | Ga0501034_0203589 | 3300049571 | Bacteria | 1936 |
| 1725 | Ga0501034_0241590 | 3300049571 | Bacteria | 1752 |
| 1726 | Ga0501034_0626057 | 3300049571 | Bacteria | 980 |
| 1727 | Ga0501034_1132247 | 3300049571 | Bacteria | 663 |
| 1728 | Ga0501036_0004516 | 3300049572 | Bacteria | 11235 |
| 1729 | Ga0501036_0027523 | 3300049572 | Bacteria | 4803 |
| 1730 | Ga0501036_0034801 | 3300049572 | Bacteria | 4261 |
| 1731 | Ga0501036_0070509 | 3300049572 | Bacteria | 2955 |
| 1732 | Ga0501036_0774701 | 3300049572 | Bacteria | 791 |
| 1733 | Ga0501036_1078024 | 3300049572 | Bacteria | 656 |
| 1734 | Ga0501036_1250004 | 3300049572 | Bacteria | 604 |
| 1735 | Ga0501036_1253513 | 3300049572 | Bacteria | 603 |
| 1736 | Ga0501037_0020086 | 3300049573 | Bacteria | 4931 |
| 1737 | Ga0501037_0023039 | 3300049573 | Bacteria | 4605 |
| 1738 | Ga0501037_0028095 | 3300049573 | Bacteria | 4155 |
| 1739 | Ga0501037_0123564 | 3300049573 | Bacteria | 1859 |
| 1740 | Ga0501037_0145203 | 3300049573 | Bacteria | 1697 |
| 1741 | Ga0501037_0211879 | 3300049573 | Bacteria | 1366 |
| 1742 | Ga0501037_0246353 | 3300049573 | Bacteria | 1251 |
| 1743 | Ga0501037_0856613 | 3300049573 | Bacteria | 597 |
| 1744 | Ga0501038_0003152 | 3300049574 | Bacteria | 15392 |
| 1745 | Ga0501038_0004970 | 3300049574 | Bacteria | 12355 |
| 1746 | Ga0501038_0023378 | 3300049574 | Bacteria | 5526 |
| 1747 | Ga0501038_0048140 | 3300049574 | Bacteria | 3690 |
| 1748 | Ga0501038_0071477 | 3300049574 | Bacteria | 2943 |
| 1749 | Ga0501038_0231891 | 3300049574 | Bacteria | 1469 |
| 1750 | Ga0501038_0306666 | 3300049574 | Bacteria | 1245 |
| 1751 | Ga0501038_0929458 | 3300049574 | Bacteria | 641 |
| 1752 | Ga0501039_0066148 | 3300049575 | Bacteria | 2805 |
| 1753 | Ga0501039_0309346 | 3300049575 | Bacteria | 1242 |
| 1754 | Ga0501039_0349478 | 3300049575 | Bacteria | 1162 |
| 1755 | Ga0501039_0523731 | 3300049575 | Bacteria | 931 |
| 1756 | Ga0501039_0942338 | 3300049575 | Bacteria | 671 |
| 1757 | Ga0501039_0981543 | 3300049575 | Bacteria | 656 |
| 1758 | Ga0501040_0000770 | 3300049576 | Bacteria | 19940 |
| 1759 | Ga0501042_0069563 | 3300049578 | Bacteria | 2517 |
| 1760 | Ga0501042_0079136 | 3300049578 | Bacteria | 2354 |
| 1761 | Ga0501042_0181334 | 3300049578 | Bacteria | 1519 |
| 1762 | Ga0501042_0584424 | 3300049578 | Bacteria | 812 |
| 1763 | Ga0501043_0040439 | 3300049579 | Bacteria | 3664 |
| 1764 | Ga0501043_0056051 | 3300049579 | Bacteria | 3095 |
| 1765 | Ga0501043_0072241 | 3300049579 | Bacteria | 2710 |
| 1766 | Ga0501043_0126725 | 3300049579 | Bacteria | 2002 |
| 1767 | Ga0501043_0160048 | 3300049579 | Bacteria | 1759 |
| 1768 | Ga0501043_0295561 | 3300049579 | Bacteria | 1239 |
| 1769 | Ga0501043_0335092 | 3300049579 | Bacteria | 1151 |
| 1770 | Ga0501043_0377646 | 3300049579 | Bacteria | 1073 |
| 1771 | Ga0501043_1006878 | 3300049579 | Bacteria | 593 |
| 1772 | Ga0501043_1036889 | 3300049579 | Bacteria | 582 |
| 1773 | Ga0501043_1185237 | 3300049579 | Bacteria | 537 |
| 1774 | Ga0501046_0001235 | 3300049580 | Bacteria | 24729 |
| 1775 | Ga0501046_0032971 | 3300049580 | Bacteria | 4190 |
| 1776 | Ga0501046_0134734 | 3300049580 | Bacteria | 1871 |
| 1777 | Ga0501046_0459726 | 3300049580 | Bacteria | 915 |
| 1778 | Ga0501046_0611976 | 3300049580 | Bacteria | 772 |
| 1779 | Ga0501047_0002002 | 3300049581 | Bacteria | 19529 |
| 1780 | Ga0501047_0005122 | 3300049581 | Bacteria | 12297 |
| 1781 | Ga0501047_0021281 | 3300049581 | Bacteria | 6226 |
| 1782 | Ga0501047_0028905 | 3300049581 | Bacteria | 5347 |
| 1783 | Ga0501047_0102634 | 3300049581 | Bacteria | 2739 |
| 1784 | Ga0501047_0104936 | 3300049581 | Bacteria | 2706 |
| 1785 | Ga0501047_0233220 | 3300049581 | Bacteria | 1693 |
| 1786 | Ga0501047_0356841 | 3300049581 | Bacteria | 1298 |
| 1787 | Ga0501047_0833483 | 3300049581 | Bacteria | 736 |
| 1788 | Ga0501047_1262359 | 3300049581 | Bacteria | 552 |
| 1789 | Ga0501048_0172024 | 3300049582 | Bacteria | 1534 |
| 1790 | Ga0501048_0184065 | 3300049582 | Bacteria | 1481 |
| 1791 | Ga0501048_0599752 | 3300049582 | Bacteria | 791 |
| 1792 | Ga0501048_1053711 | 3300049582 | Bacteria | 585 |
| 1793 | Ga0501067_0018564 | 3300049583 | Bacteria | 3851 |
| 1794 | Ga0501067_0048459 | 3300049583 | Bacteria | 2356 |
| 1795 | Ga0501067_0252026 | 3300049583 | Bacteria | 983 |
| 1796 | Ga0501068_0003440 | 3300049584 | Bacteria | 8517 |
| 1797 | Ga0501068_0094066 | 3300049584 | Bacteria | 1852 |
| 1798 | Ga0501068_0120578 | 3300049584 | Bacteria | 1635 |
| 1799 | Ga0501068_0226524 | 3300049584 | Bacteria | 1188 |
| 1800 | Ga0501069_0052553 | 3300049585 | Bacteria | 2269 |
| 1801 | Ga0501069_0724070 | 3300049585 | Bacteria | 601 |
| 1802 | Ga0501070_0023465 | 3300049586 | Bacteria | 5167 |
| 1803 | Ga0501070_0025728 | 3300049586 | Bacteria | 4937 |
| 1804 | Ga0501070_0053387 | 3300049586 | Bacteria | 3353 |
| 1805 | Ga0501070_0081412 | 3300049586 | Bacteria | 2679 |
| 1806 | Ga0501070_0330839 | 3300049586 | Bacteria | 1238 |
| 1807 | Ga0501071_0022501 | 3300049587 | Bacteria | 4394 |
| 1808 | Ga0501071_0365020 | 3300049587 | Bacteria | 1100 |
| 1809 | Ga0501072_0138011 | 3300049588 | Bacteria | 1944 |
| 1810 | Ga0501073_0012284 | 3300049589 | Bacteria | 6250 |
| 1811 | Ga0501073_0043433 | 3300049589 | Bacteria | 3169 |
| 1812 | Ga0501073_0142579 | 3300049589 | Bacteria | 1660 |
| 1813 | Ga0501073_0324499 | 3300049589 | Bacteria | 1063 |
| 1814 | Ga0501073_0647350 | 3300049589 | Bacteria | 729 |
| 1815 | Ga0501074_0001837 | 3300049590 | Bacteria | 14546 |
| 1816 | Ga0501074_0088925 | 3300049590 | Bacteria | 2212 |
| 1817 | Ga0501074_0376595 | 3300049590 | Bacteria | 1007 |
| 1818 | Ga0501074_0514980 | 3300049590 | Bacteria | 847 |
| 1819 | Ga0501074_0610795 | 3300049590 | Bacteria | 771 |
| 1820 | Ga0501076_0244771 | 3300049592 | Bacteria | 1467 |
| 1821 | Ga0501076_1177967 | 3300049592 | Bacteria | 631 |
| 1822 | Ga0501077_0028566 | 3300049593 | Bacteria | 3545 |
| 1823 | Ga0501077_0066789 | 3300049593 | Bacteria | 2281 |
| 1824 | Ga0501202_124753 | 3300049652 | Bacteria | 651 |
| 1825 | Ga0501257_017094 | 3300049686 | Bacteria | 1686 |
| 1826 | Ga0501079_0021645 | 3300049741 | Bacteria | 4919 |
| 1827 | Ga0501079_0291778 | 3300049741 | Bacteria | 1276 |
| 1828 | Ga0501079_0667098 | 3300049741 | Bacteria | 819 |
| 1829 | Ga0501079_0669475 | 3300049741 | Bacteria | 817 |
| 1830 | Ga0501080_0005664 | 3300049742 | Bacteria | 11163 |
| 1831 | Ga0501080_0013573 | 3300049742 | Bacteria | 7500 |
| 1832 | Ga0501080_0033071 | 3300049742 | Bacteria | 4826 |
| 1833 | Ga0501080_0054773 | 3300049742 | Bacteria | 3714 |
| 1834 | Ga0501080_0058218 | 3300049742 | Bacteria | 3597 |
| 1835 | Ga0501080_0142694 | 3300049742 | Bacteria | 2214 |
| 1836 | Ga0501080_0272099 | 3300049742 | Bacteria | 1541 |
| 1837 | Ga0501080_0548819 | 3300049742 | Bacteria | 1029 |
| 1838 | Ga0501080_0703232 | 3300049742 | Bacteria | 891 |
| 1839 | Ga0501080_1484700 | 3300049742 | Bacteria | 576 |
| 1840 | Ga0501081_0351274 | 3300049743 | Bacteria | 1087 |
| 1841 | Ga0501083_0175015 | 3300049744 | Bacteria | 1402 |
| 1842 | Ga0501083_0308872 | 3300049744 | Bacteria | 1028 |
| 1843 | Ga0501083_0722756 | 3300049744 | Bacteria | 648 |
| 1844 | Ga0501035_0004983 | 3300049822 | Bacteria | 12582 |
| 1845 | Ga0501035_0007405 | 3300049822 | Bacteria | 10254 |
| 1846 | Ga0501035_0017658 | 3300049822 | Bacteria | 6581 |
| 1847 | Ga0501035_0025130 | 3300049822 | Bacteria | 5461 |
| 1848 | Ga0501035_0039689 | 3300049822 | Bacteria | 4259 |
| 1849 | Ga0501035_0121293 | 3300049822 | Bacteria | 2285 |
| 1850 | Ga0501035_0125955 | 3300049822 | Bacteria | 2236 |
| 1851 | Ga0501035_0187171 | 3300049822 | Bacteria | 1781 |
| 1852 | Ga0501035_0350768 | 3300049822 | Bacteria | 1235 |
| 1853 | Ga0501035_0424393 | 3300049822 | Bacteria | 1103 |
| 1854 | Ga0501035_0519323 | 3300049822 | Bacteria | 978 |
| 1855 | Ga0501035_1080734 | 3300049822 | Bacteria | 627 |
| 1856 | Ga0501035_1119168 | 3300049822 | Bacteria | 614 |
| 1857 | Ga0501044_0000126 | 3300049823 | Bacteria | 92879 |
| 1858 | Ga0501044_0001523 | 3300049823 | Bacteria | 27175 |
| 1859 | Ga0501044_0004461 | 3300049823 | Bacteria | 15650 |
| 1860 | Ga0501044_0041467 | 3300049823 | Bacteria | 4792 |
| 1861 | Ga0501044_0051948 | 3300049823 | Bacteria | 4226 |
| 1862 | Ga0501044_0081780 | 3300049823 | Bacteria | 3269 |
| 1863 | Ga0501044_0092712 | 3300049823 | Bacteria | 3046 |
| 1864 | Ga0501044_0158308 | 3300049823 | Bacteria | 2243 |
| 1865 | Ga0501044_0186457 | 3300049823 | Bacteria | 2039 |
| 1866 | Ga0501044_0392449 | 3300049823 | Bacteria | 1301 |
| 1867 | Ga0501044_1105235 | 3300049823 | Bacteria | 662 |
| 1868 | Ga0501044_1118934 | 3300049823 | Bacteria | 656 |
| 1869 | Ga0501044_1142234 | 3300049823 | Bacteria | 647 |
| 1870 | Ga0501044_1585876 | 3300049823 | Bacteria | 519 |
| 1871 | Ga0501045_1212343 | 3300049824 | Bacteria | 550 |
| 1872 | nmdc:mga00v17_11240_c1 | 3300050491 | Bacteria | 4917 |
| 1873 | nmdc:mga00v17_131965_c1 | 3300050491 | Bacteria | 1597 |
| 1874 | nmdc:mga00v17_16716_c1 | 3300050491 | Bacteria | 4138 |
| 1875 | nmdc:mga00v17_379124_c1 | 3300050491 | Bacteria | 919 |
| 1876 | nmdc:mga00v17_611264_c1 | 3300050491 | Bacteria | 702 |
| 1877 | nmdc:mga00v17_7469_c1 | 3300050491 | Bacteria | 5835 |
| 1878 | nmdc:mga00v17_9919_c2 | 3300050491 | Bacteria | 4812 |
| 1879 | nmdc:mga0k408_8016_c1 | 3300050493 | Bacteria | 5661 |
| 1880 | nmdc:mga05p37_32471_c1 | 3300050507 | Bacteria | 6384 |
| 1881 | nmdc:mga09592_1131099_c1 | 3300050508 | Bacteria | 650 |
| 1882 | nmdc:mga09592_35368_c1 | 3300050508 | Bacteria | 4182 |
| 1883 | nmdc:mga0qj67_114559_c1 | 3300050509 | Bacteria | 2178 |
| 1884 | nmdc:mga0qj67_163349_c1 | 3300050509 | Bacteria | 1808 |
| 1885 | nmdc:mga0qj67_315911_c1 | 3300050509 | Bacteria | 1265 |
| 1886 | nmdc:mga0qj67_487999_c1 | 3300050509 | Bacteria | 991 |
| 1887 | nmdc:mga0qj67_899196_c1 | 3300050509 | Bacteria | 698 |
| 1888 | nmdc:mga06r32_1469572_c1 | 3300050510 | Bacteria | 622 |
| 1889 | nmdc:mga06r32_556726_c1 | 3300050510 | Bacteria | 1120 |
| 1890 | nmdc:mga06r32_570650_c1 | 3300050510 | Bacteria | 1104 |
| 1891 | nmdc:mga06r32_5777_c1 | 3300050510 | Bacteria | 11149 |
| 1892 | nmdc:mga06r32_89541_c1 | 3300050510 | Bacteria | 3005 |
| 1893 | nmdc:mga08y16_1194404_c1 | 3300050511 | Bacteria | 732 |
| 1894 | nmdc:mga08y16_165761_c1 | 3300050511 | Bacteria | 2295 |
| 1895 | nmdc:mga08y16_20769_c1 | 3300050511 | Bacteria | 6933 |
| 1896 | nmdc:mga08y16_381664_c1 | 3300050511 | Bacteria | 1444 |
| 1897 | nmdc:mga08y16_44730_c1 | 3300050511 | Bacteria | 4640 |
| 1898 | nmdc:mga08y16_54486_c1 | 3300050511 | Bacteria | 4179 |
| 1899 | nmdc:mga08y16_545911_c1 | 3300050511 | Bacteria | 1173 |
| 1900 | nmdc:mga08y16_95174_c1 | 3300050511 | Bacteria | 3102 |
| 1901 | nmdc:mga0n895_1069229_c1 | 3300050512 | Bacteria | 785 |
| 1902 | nmdc:mga0n895_289109_c1 | 3300050512 | Bacteria | 1662 |
| 1903 | nmdc:mga08x19_615834_c1 | 3300050514 | Bacteria | 769 |
| 1904 | nmdc:mga0a205_1103145_c1 | 3300050515 | Bacteria | 641 |
| 1905 | nmdc:mga0a205_452118_c1 | 3300050515 | Bacteria | 1144 |
| 1906 | Ga0500635_0031243 | 3300053080 | Bacteria | 1723 |
| 1907 | Ga0500644_0006369 | 3300053088 | Bacteria | 3021 |
| 1908 | Ga0500583_0268626 | 3300053092 | Bacteria | 839 |
| 1909 | Ga0500651_0433400 | 3300053093 | Bacteria | 734 |
| 1910 | Ga0500651_0592226 | 3300053093 | Bacteria | 602 |
| 1911 | Ga0500641_0128889 | 3300053096 | Bacteria | 1091 |
| 1912 | Ga0500556_0010020 | 3300053104 | Bacteria | 2771 |
| 1913 | Ga0500617_033737 | 3300053124 | Bacteria | 2293 |
| 1914 | Ga0500618_003225 | 3300053125 | Bacteria | 5682 |
| 1915 | Ga0500628_177948 | 3300053129 | Bacteria | 606 |
| 1916 | Ga0500642_0179487 | 3300053130 | Bacteria | 990 |
| 1917 | Ga0500642_0271213 | 3300053130 | Bacteria | 774 |
| 1918 | Ga0500658_0013889 | 3300053134 | Bacteria | 2978 |
| 1919 | Ga0500568_0001745 | 3300053139 | Bacteria | 13454 |
| 1920 | Ga0500568_0163233 | 3300053139 | Bacteria | 822 |
| 1921 | Ga0500586_153810 | 3300053145 | Bacteria | 784 |
| 1922 | Ga0500588_0002927 | 3300053146 | Bacteria | 3547 |
| 1923 | Ga0500588_0102195 | 3300053146 | Bacteria | 989 |
| 1924 | Ga0500589_350390 | 3300053147 | Bacteria | 507 |
| 1925 | Ga0500616_0055558 | 3300053153 | Bacteria | 2070 |
| 1926 | Ga0500611_184095 | 3300053727 | Bacteria | 586 |
| 1927 | Ga0501084_0003303 | 3300054114 | Bacteria | 13048 |
| 1928 | Ga0501084_0037327 | 3300054114 | Bacteria | 4059 |
| 1929 | Ga0501084_1234202 | 3300054114 | Bacteria | 627 |
| 1930 | Ga0501082_0001202 | 3300060353 | Bacteria | 22774 |
| 1931 | Ga0501082_0647886 | 3300060353 | Bacteria | 924 |
| 1932 | Ga0530510_0514245 | 3300061734 | Bacteria | 908 |
| 1933 | Ga0530510_1360959 | 3300061734 | Bacteria | 545 |
| 1934 | 2513953587 | 2513237150 | Bacteria | 6553639 |
| 1935 | 2514044283 | 2513237165 | Bacteria | 6771773 |
| 1936 | 2526213797 | 2526164512 | Bacteria | 4025691 |
| 1937 | 2599906998 | 2599185292 | Bacteria | 6290804 |
| 1938 | 2643863202 | 2643221569 | Bacteria | 6064337 |
| 1939 | 2643978608 | 2643221594 | Bacteria | 5811388 |
| 1940 | 2644121730 | 2643221621 | Bacteria | 6212786 |
| 1941 | 2671101388 | 2667528172 | Bacteria | 5170840 |
| 1942 | 2739613417 | 2739367655 | Bacteria | 4051151 |
| 1943 | 2808927135 | 2808606376 | Bacteria | 6248667 |
| 1944 | 2808949254 | 2808606380 | Bacteria | 6248705 |
| 1945 | 2809036635 | 2808606395 | Bacteria | 6020352 |
| 1946 | 2842750943 | 2842747753 | Bacteria | 5578255 |
| 1947 | 2852107463 | 2852103415 | Bacteria | 5193810 |
| 1948 | 2855731429 | 2855730933 | Bacteria | 7047938 |
| 1949 | 2855768135 | 2855767633 | Bacteria | 7049357 |
| 1950 | 2857542729 | 2857537821 | Bacteria | 5248181 |
| 1951 | 2857545876 | 2857542790 | Bacteria | 5326616 |
| 1952 | 2858691198 | 2858688981 | Bacteria | 8184122 |
| 1953 | 2858954789 | 2858950400 | Bacteria | 6783797 |
| 1954 | 2881413696 | 2881412998 | Bacteria | 6492157 |
| 1955 | 2901305592 | 2901300506 | Bacteria | 8463898 |
| 1956 | 2941481051 | |||
| 1957 | 644750416 | 644736347 | Bacteria | 6476522 |
| 1958 | 8002393569 | 8002392321 | Bacteria | 4159911 |
| 1959 | 8048748088 | 8048746797 | Bacteria | 3557226 |
| 1960 | Ga0400488_24090 | |||
| 1961 | SwRhRL2b_contig_1195302 | |||
| 1962 | SwRhRL2b_contig_1384764 | |||
| 1963 | SwRhRL2b_contig_180466 | |||
| 1964 | SwRhRL2b_contig_1913402 | |||
| 1965 | SwRhRL2b_contig_1987842 | |||
| 1966 | SwRhRL2b_contig_2510247 | |||
| 1967 | SwRhRL2b_contig_3340866 | |||
| 1968 | JGI24741J21665_1001662 | |||
| 1969 | JGI24741J21665_1002120 | |||
| 1970 | JGI24740J21852_10014411 | |||
| 1971 | JGI25152J39213_1000183 | |||
| 1972 | JGI25159J45721_1025895 | |||
| 1973 | JGI25151J46595_10000469 | |||
| 1974 | JGI25151J46595_10005242 | |||
| 1975 | JGI25151J46595_10006006 | |||
| 1976 | JGI25406J46586_10011151 | |||
| 1977 | rootH2_10000637 | |||
| 1978 | rootH2_10024085 | |||
| 1979 | Ga0055529_1002914 | |||
| 1980 | Ga0055526_1017409 | |||
| 1981 | Ga0055537_1000734 | |||
| 1982 | Ga0055524_1001300 | |||
| 1983 | Ga0055534_1000029 | |||
| 1984 | Ga0055530_10033751 | |||
| 1985 | Ga0055530_10104491 | |||
| 1986 | Ga0058692_1012139 | |||
| 1987 | Ga0058692_1015210 | |||
| 1988 | JGI25405J52794_10069281 | |||
| 1989 | Ga0065704_10000334 | |||
| 1990 | Ga0065704_10000845 | |||
| 1991 | Ga0065704_10004094 | |||
| 1992 | Ga0065704_10005135 | |||
| 1993 | Ga0065704_10076738 | |||
| 1994 | Ga0065704_10121891 | |||
| 1995 | Ga0065715_10026164 | |||
| 1996 | Ga0065707_10082547 | |||
| 1997 | Ga0065707_10553254 | |||
| 1998 | Ga0070658_10017515 | |||
| 1999 | Ga0070658_10876700 | |||
| 2000 | Ga0070658_11141461 | |||
| 2001 | Ga0070676_10714572 | |||
| 2002 | Ga0070676_11203027 | |||
| 2003 | Ga0070683_100056377 | |||
| 2004 | Ga0070683_100465684 | |||
| 2005 | Ga0070683_100606762 | |||
| 2006 | Ga0070683_100816785 | |||
| 2007 | Ga0070683_101280349 | |||
| 2008 | Ga0070683_102204733 | |||
| 2009 | Ga0070690_100000862 | |||
| 2010 | Ga0070670_100188453 | |||
| 2011 | Ga0070670_100418425 | |||
| 2012 | Ga0070670_101832599 | |||
| 2013 | Ga0070677_10010017 | |||
| 2014 | Ga0070677_10013378 | |||
| 2015 | Ga0070677_10191415 | |||
| 2016 | Ga0068869_100033019 | |||
| 2017 | Ga0068869_100148954 | |||
| 2018 | Ga0068869_100236544 | |||
| 2019 | Ga0068869_100409585 | |||
| 2020 | Ga0068869_100769472 | |||
| 2021 | Ga0068869_100837613 | |||
| 2022 | Ga0068869_100929649 | |||
| 2023 | Ga0068869_101487645 | |||
| 2024 | Ga0068869_101552347 | |||
| 2025 | Ga0070666_10006752 | |||
| 2026 | Ga0070666_10192379 | |||
| 2027 | Ga0070666_10244335 | |||
| 2028 | Ga0070666_11407793 | |||
| 2029 | Ga0070680_100001797 | |||
| 2030 | Ga0070680_100131471 | |||
| 2031 | Ga0070680_100190525 | |||
| 2032 | Ga0070680_100363801 | |||
| 2033 | Ga0070680_100528885 | |||
| 2034 | Ga0070680_101174465 | |||
| 2035 | Ga0070682_100006822 | |||
| 2036 | Ga0070682_100009264 | |||
| 2037 | Ga0070682_100070231 | |||
| 2038 | Ga0070682_100306385 | |||
| 2039 | Ga0070682_100824623 | |||
| 2040 | Ga0070682_100908163 | |||
| 2041 | Ga0070682_101948340 | |||
| 2042 | Ga0068868_100042630 | |||
| 2043 | Ga0068868_100425020 | |||
| 2044 | Ga0068868_100460035 | |||
| 2045 | Ga0068868_100900709 | |||
| 2046 | Ga0070660_100027579 | |||
| 2047 | Ga0070660_100569371 | |||
| 2048 | Ga0070660_101785167 | |||
| 2049 | Ga0070660_101937961 | |||
| 2050 | Ga0070689_100005091 | |||
| 2051 | Ga0070689_100015154 | |||
| 2052 | Ga0070689_100508385 | |||
| 2053 | Ga0070689_101796665 | |||
| 2054 | Ga0070691_10037376 | |||
| 2055 | Ga0070691_10275584 | |||
| 2056 | Ga0070691_10351518 | |||
| 2057 | Ga0070687_100185306 | |||
| 2058 | Ga0070687_100581430 | |||
| 2059 | Ga0070687_100744305 | |||
| 2060 | Ga0070687_100849261 | |||
| 2061 | Ga0070687_101015148 | |||
| 2062 | Ga0070661_100002419 | |||
| 2063 | Ga0070661_100024156 | |||
| 2064 | Ga0070661_100076717 | |||
| 2065 | Ga0070661_100195458 | |||
| 2066 | Ga0070661_100246102 | |||
| 2067 | Ga0070661_100276496 | |||
| 2068 | Ga0070661_100655288 | |||
| 2069 | Ga0070661_101888874 | |||
| 2070 | Ga0070692_10048810 | |||
| 2071 | Ga0070692_10100773 | |||
| 2072 | Ga0070692_10606787 | |||
| 2073 | Ga0070692_10840907 | |||
| 2074 | Ga0070692_11032793 | |||
| 2075 | Ga0070668_100108452 | |||
| 2076 | Ga0070668_100336399 | |||
| 2077 | Ga0070668_100343419 | |||
| 2078 | Ga0070668_101057428 | |||
| 2079 | Ga0070669_100017956 | |||
| 2080 | Ga0070669_100223021 | |||
| 2081 | Ga0070675_100049094 | |||
| 2082 | Ga0070675_100099720 | |||
| 2083 | Ga0070675_100318390 | |||
| 2084 | Ga0070675_100504193 | |||
| 2085 | Ga0070675_101103593 | |||
| 2086 | Ga0070675_101515357 | |||
| 2087 | Ga0070671_100095184 | |||
| 2088 | Ga0070671_100178640 | |||
| 2089 | Ga0070671_100494509 | |||
| 2090 | Ga0070671_100569207 | |||
| 2091 | Ga0070674_100134345 | |||
| 2092 | Ga0070674_100300367 | |||
| 2093 | Ga0070674_100518338 | |||
| 2094 | Ga0070674_100803240 | |||
| 2095 | Ga0070673_100009252 | |||
| 2096 | Ga0070673_100589429 | |||
| 2097 | Ga0070673_100628226 | |||
| 2098 | Ga0070673_100861702 | |||
| 2099 | Ga0070673_101157933 | |||
| 2100 | Ga0070673_101200681 | |||
| 2101 | Ga0070673_101293338 | |||
| 2102 | Ga0070688_100001927 | |||
| 2103 | Ga0070688_100139158 | |||
| 2104 | Ga0070688_100189518 | |||
| 2105 | Ga0070688_101031371 | |||
| 2106 | Ga0070659_100199605 | |||
| 2107 | Ga0070659_100220321 | |||
| 2108 | Ga0070659_100855567 | |||
| 2109 | Ga0070659_100989628 | |||
| 2110 | Ga0070659_101384213 | |||
| 2111 | Ga0070659_101565486 | |||
| 2112 | Ga0070659_101679955 | |||
| 2113 | Ga0070659_101925985 | |||
| 2114 | Ga0070667_100000057 | |||
| 2115 | Ga0070667_100008603 | |||
| 2116 | Ga0070667_100223778 | |||
| 2117 | Ga0070667_100353048 | |||
| 2118 | Ga0070667_100364219 | |||
| 2119 | Ga0070667_100401567 | |||
| 2120 | Ga0070667_100520375 | |||
| 2121 | Ga0070667_102272731 | |||
| 2122 | Ga0070714_100270949 | |||
| 2123 | Ga0070714_100842448 | |||
| 2124 | Ga0070713_100634402 | |||
| 2125 | Ga0070713_101885972 | |||
| 2126 | Ga0070701_10146939 | |||
| 2127 | Ga0070701_10554201 | |||
| 2128 | Ga0070701_10721507 | |||
| 2129 | Ga0070701_11218919 | |||
| 2130 | Ga0070711_100284830 | |||
| 2131 | Ga0070711_101537983 | |||
| 2132 | Ga0070705_100007848 | |||
| 2133 | Ga0070705_100479253 | |||
| 2134 | Ga0070700_100038603 | |||
| 2135 | Ga0070700_100055207 | |||
| 2136 | Ga0070700_100169763 | |||
| 2137 | Ga0070700_100178038 | |||
| 2138 | Ga0070700_100550842 | |||
| 2139 | Ga0070700_100757578 | |||
| 2140 | Ga0070700_101225194 | |||
| 2141 | Ga0070700_101320978 | |||
| 2142 | Ga0070694_100387309 | |||
| 2143 | Ga0070694_100448578 | |||
| 2144 | Ga0070694_101205091 | |||
| 2145 | Ga0070694_101870751 | |||
| 2146 | Ga0070663_100093360 | |||
| 2147 | Ga0070663_100872707 | |||
| 2148 | Ga0070663_101141949 | |||
| 2149 | Ga0070663_101665695 | |||
| 2150 | Ga0070663_102022754 | |||
| 2151 | Ga0070678_100011774 | |||
| 2152 | Ga0070678_100188741 | |||
| 2153 | Ga0070678_101315703 | |||
| 2154 | Ga0070678_101633282 | |||
| 2155 | Ga0070662_100033049 | |||
| 2156 | Ga0070662_100104219 | |||
| 2157 | Ga0070662_100174385 | |||
| 2158 | Ga0070662_100452526 | |||
| 2159 | Ga0070662_100570615 | |||
| 2160 | Ga0070662_100833556 | |||
| 2161 | Ga0070662_101320590 | |||
| 2162 | Ga0070681_10000088 | |||
| 2163 | Ga0070681_10001383 | |||
| 2164 | Ga0070681_10007177 | |||
| 2165 | Ga0070681_10018737 | |||
| 2166 | Ga0070681_10199372 | |||
| 2167 | Ga0070681_10244832 | |||
| 2168 | Ga0070681_10276094 | |||
| 2169 | Ga0070681_10551543 | |||
| 2170 | Ga0070681_10807384 | |||
| 2171 | Ga0070681_11286494 | |||
| 2172 | Ga0068867_100095490 | |||
| 2173 | Ga0068867_100216829 | |||
| 2174 | Ga0068867_100435634 | |||
| 2175 | Ga0068867_100516248 | |||
| 2176 | Ga0068867_102368889 | |||
| 2177 | Ga0070685_10009778 | |||
| 2178 | Ga0070685_10085944 | |||
| 2179 | Ga0070685_10095684 | |||
| 2180 | Ga0070685_10176932 | |||
| 2181 | Ga0070685_10573268 | |||
| 2182 | Ga0070685_10968668 | |||
| 2183 | Ga0070706_100254895 | |||
| 2184 | Ga0070706_100384352 | |||
| 2185 | Ga0070698_100260323 | |||
| 2186 | Ga0070699_102013677 | |||
| 2187 | Ga0070679_100000061 | |||
| 2188 | Ga0070679_100006720 | |||
| 2189 | Ga0070679_100062929 | |||
| 2190 | Ga0070679_100867149 | |||
| 2191 | Ga0070679_101034294 | |||
| 2192 | Ga0070684_100051167 | |||
| 2193 | Ga0070684_100222626 | |||
| 2194 | Ga0070684_100293402 | |||
| 2195 | Ga0070684_100449820 | |||
| 2196 | Ga0070684_101209166 | |||
| 2197 | Ga0070684_101496171 | |||
| 2198 | Ga0070697_100262222 | |||
| 2199 | Ga0068853_100007822 | |||
| 2200 | Ga0068853_100023739 | |||
| 2201 | Ga0068853_100352113 | |||
| 2202 | Ga0068853_100482049 | |||
| 2203 | Ga0068853_100487230 | |||
| 2204 | Ga0068853_100758447 | |||
| 2205 | Ga0068853_101193205 | |||
| 2206 | Ga0068853_102282410 | |||
| 2207 | Ga0070672_100031587 | |||
| 2208 | Ga0070672_100064860 | |||
| 2209 | Ga0070672_100090697 | |||
| 2210 | Ga0070672_100301730 | |||
| 2211 | Ga0070672_100435559 | |||
| 2212 | Ga0070686_100009824 | |||
| 2213 | Ga0070686_100017671 | |||
| 2214 | Ga0070686_100727785 | |||
| 2215 | Ga0070695_100588314 | |||
| 2216 | Ga0070695_100878344 | |||
| 2217 | Ga0070695_101234062 | |||
| 2218 | Ga0070695_101630478 | |||
| 2219 | Ga0070696_100004707 | |||
| 2220 | Ga0070696_101113572 | |||
| 2221 | Ga0070693_100031912 | |||
| 2222 | Ga0070693_100210667 | |||
| 2223 | Ga0070693_100310719 | |||
| 2224 | Ga0070693_100509531 | |||
| 2225 | Ga0070693_100853343 | |||
| 2226 | Ga0070693_101318269 | |||
| 2227 | Ga0070665_100000191 | |||
| 2228 | Ga0070665_100000210 | |||
| 2229 | Ga0070665_100001746 | |||
| 2230 | Ga0070665_100003610 | |||
| 2231 | Ga0070665_100068569 | |||
| 2232 | Ga0070665_100078558 | |||
| 2233 | Ga0070665_100243042 | |||
| 2234 | Ga0070665_101667534 | |||
| 2235 | Ga0070665_102426107 | |||
| 2236 | Ga0070704_100441104 | |||
| 2237 | Ga0070704_100470567 | |||
| 2238 | Ga0068855_100033321 | |||
| 2239 | Ga0068855_100065852 | |||
| 2240 | Ga0068855_100093588 | |||
| 2241 | Ga0068855_100140638 | |||
| 2242 | Ga0068855_100273589 | |||
| 2243 | Ga0068855_100288891 | |||
| 2244 | Ga0068855_102508009 | |||
| 2245 | Ga0068855_102621400 | |||
| 2246 | Ga0070664_100036310 | |||
| 2247 | Ga0070664_100038133 | |||
| 2248 | Ga0070664_100113395 | |||
| 2249 | Ga0070664_100149776 | |||
| 2250 | Ga0070664_100516076 | |||
| 2251 | Ga0070664_100673152 | |||
| 2252 | Ga0070664_101558032 | |||
| 2253 | Ga0068857_100000406 | |||
| 2254 | Ga0068857_100021709 | |||
| 2255 | Ga0068857_100060196 | |||
| 2256 | Ga0068857_100098120 | |||
| 2257 | Ga0068857_100221521 | |||
| 2258 | Ga0068857_102128892 | |||
| 2259 | Ga0068854_100001777 | |||
| 2260 | Ga0068854_100076840 | |||
| 2261 | Ga0068854_100519385 | |||
| 2262 | Ga0068854_100645719 | |||
| 2263 | Ga0068854_101236318 | |||
| 2264 | Ga0068854_101383465 | |||
| 2265 | Ga0068854_102279767 | |||
| 2266 | Ga0068856_100289239 | |||
| 2267 | Ga0068856_100307217 | |||
| 2268 | Ga0068856_100648553 | |||
| 2269 | Ga0068856_100959710 | |||
| 2270 | Ga0068856_101902250 | |||
| 2271 | Ga0068856_102280909 | |||
| 2272 | Ga0068856_102640703 | |||
| 2273 | Ga0070702_100007333 | |||
| 2274 | Ga0070702_100010312 | |||
| 2275 | Ga0070702_100158004 | |||
| 2276 | Ga0068852_100192245 | |||
| 2277 | Ga0068852_100483566 | |||
| 2278 | Ga0068852_100740766 | |||
| 2279 | Ga0068859_100000781 | |||
| 2280 | Ga0068859_100042804 | |||
| 2281 | Ga0068859_100062693 | |||
| 2282 | Ga0068859_100106398 | |||
| 2283 | Ga0068859_100303271 | |||
| 2284 | Ga0068859_100340880 | |||
| 2285 | Ga0068859_100451494 | |||
| 2286 | Ga0068859_100873726 | |||
| 2287 | Ga0068859_102331268 | |||
| 2288 | Ga0068859_102968171 | |||
| 2289 | Ga0068864_100014352 | |||
| 2290 | Ga0068864_100059707 | |||
| 2291 | Ga0068864_100227652 | |||
| 2292 | Ga0068864_100242617 | |||
| 2293 | Ga0068864_100411525 | |||
| 2294 | Ga0068864_100459896 | |||
| 2295 | Ga0068864_100839587 | |||
| 2296 | Ga0068866_10020296 | |||
| 2297 | Ga0068866_10081053 | |||
| 2298 | Ga0068866_10307387 | |||
| 2299 | Ga0068861_100071332 | |||
| 2300 | Ga0068861_100093190 | |||
| 2301 | Ga0068861_100201507 | |||
| 2302 | Ga0068861_100376936 | |||
| 2303 | Ga0068861_100521597 | |||
| 2304 | Ga0068861_100917451 | |||
| 2305 | Ga0068861_101484603 | |||
| 2306 | Ga0068861_102063066 | |||
| 2307 | Ga0068851_10140807 | |||
| 2308 | Ga0068851_10155295 | |||
| 2309 | Ga0068851_10167453 | |||
| 2310 | Ga0068870_10016867 | |||
| 2311 | Ga0068870_10035185 | |||
| 2312 | Ga0068870_10050571 | |||
| 2313 | Ga0068870_10196466 | |||
| 2314 | Ga0068863_100029235 | |||
| 2315 | Ga0068863_100139041 | |||
| 2316 | Ga0068863_100174209 | |||
| 2317 | Ga0068863_100290171 | |||
| 2318 | Ga0068863_100525071 | |||
| 2319 | Ga0068863_100605108 | |||
| 2320 | Ga0068863_100693910 | |||
| 2321 | Ga0068863_101618841 | |||
| 2322 | Ga0068863_102360557 | |||
| 2323 | Ga0068858_100009868 | |||
| 2324 | Ga0068858_100063745 | |||
| 2325 | Ga0068858_100171595 | |||
| 2326 | Ga0068858_100200138 | |||
| 2327 | Ga0068858_101601974 | |||
| 2328 | Ga0068860_100062183 | |||
| 2329 | Ga0068860_100228662 | |||
| 2330 | Ga0068860_100455204 | |||
| 2331 | Ga0068860_100927219 | |||
| 2332 | Ga0068860_102389318 | |||
| 2333 | Ga0068862_100000803 | |||
| 2334 | Ga0068862_100003696 | |||
| 2335 | Ga0068862_100016037 | |||
| 2336 | Ga0068862_100020500 | |||
| 2337 | Ga0068862_100121363 | |||
| 2338 | Ga0068862_100284770 | |||
| 2339 | Ga0068862_100349967 | |||
| 2340 | Ga0068862_100355377 | |||
| 2341 | Ga0068862_101058623 | |||
| 2342 | Ga0068862_101510320 | |||
| 2343 | Ga0081455_10000010 | |||
| 2344 | Ga0081455_10001002 | |||
| 2345 | Ga0081455_10386693 | |||
| 2346 | Ga0081539_10000058 | |||
| 2347 | Ga0075364_10004846 | |||
| 2348 | Ga0075364_10005493 | |||
| 2349 | Ga0075364_10009906 | |||
| 2350 | Ga0075364_10011687 | |||
| 2351 | Ga0075364_10012628 | |||
| 2352 | Ga0075364_10122263 | |||
| 2353 | Ga0075364_11183869 | |||
| 2354 | Ga0070715_10339352 | |||
| 2355 | Ga0070716_100487600 | |||
| 2356 | Ga0070716_101398071 | |||
| 2357 | Ga0075366_10013000 | |||
| 2358 | Ga0097621_100029912 | |||
| 2359 | Ga0097621_100114052 | |||
| 2360 | Ga0097621_100217273 | |||
| 2361 | Ga0097621_100387765 | |||
| 2362 | Ga0097621_100548997 | |||
| 2363 | Ga0097621_100770162 | |||
| 2364 | Ga0068871_100029967 | |||
| 2365 | Ga0068871_100144367 | |||
| 2366 | Ga0068871_100247948 | |||
| 2367 | Ga0068871_100276222 | |||
| 2368 | Ga0068871_100559445 | |||
| 2369 | Ga0068871_100592094 | |||
| 2370 | Ga0068871_101555809 | |||
| 2371 | Ga0075428_100131210 | |||
| 2372 | Ga0075428_100342077 | |||
| 2373 | Ga0075428_100682209 | |||
| 2374 | Ga0075430_100032834 | |||
| 2375 | Ga0075430_100094065 | |||
| 2376 | Ga0075430_100327045 | |||
| 2377 | Ga0075430_100337890 | |||
| 2378 | Ga0075430_101023094 | |||
| 2379 | Ga0075430_101150600 | |||
| 2380 | Ga0075430_101693435 | |||
| 2381 | Ga0075431_100003695 | |||
| 2382 | Ga0075431_100168996 | |||
| 2383 | Ga0075431_100190531 | |||
| 2384 | Ga0075431_100391527 | |||
| 2385 | Ga0075431_101171974 | |||
| 2386 | Ga0075431_101199043 | |||
| 2387 | Ga0075431_102013692 | |||
| 2388 | Ga0075433_10150683 | |||
| 2389 | Ga0075433_10493759 | |||
| 2390 | Ga0075434_100207202 | |||
| 2391 | Ga0075434_101224685 | |||
| 2392 | Ga0075429_100007951 | |||
| 2393 | Ga0075429_100012668 | |||
| 2394 | Ga0075429_100259841 | |||
| 2395 | Ga0075429_100589947 | |||
| 2396 | Ga0068865_100149122 | |||
| 2397 | Ga0068865_100170635 | |||
| 2398 | Ga0068865_100351876 | |||
| 2399 | Ga0068865_100410971 | |||
| 2400 | Ga0068865_100779132 | |||
| 2401 | Ga0068865_101040122 | |||
| 2402 | Ga0068865_101262745 | |||
| 2403 | Ga0068865_101980464 | |||
| 2404 | Ga0075436_100679603 | |||
| 2405 | Ga0097620_100000781 | |||
| 2406 | Ga0097620_100042804 | |||
| 2407 | Ga0097620_100062697 | |||
| 2408 | Ga0097620_100106397 | |||
| 2409 | Ga0097620_100303274 | |||
| 2410 | Ga0097620_100340869 | |||
| 2411 | Ga0097620_100451490 | |||
| 2412 | Ga0097620_100873770 | |||
| 2413 | Ga0097620_102332103 | |||
| 2414 | Ga0097620_102968127 | |||
| 2415 | Ga0079104_1000171 | |||
| 2416 | Ga0079104_1001588 | |||
| 2417 | Ga0079104_1002382 | |||
| 2418 | Ga0079104_1006552 | |||
| 2419 | Ga0079104_1009529 | |||
| 2420 | Ga0079104_1010786 | |||
| 2421 | Ga0079104_1010787 | |||
| 2422 | Ga0079104_1119690 | |||
| 2423 | Ga0099826_10000013 | |||
| 2424 | Ga0105251_10003671 | |||
| 2425 | Ga0105251_10015401 | |||
| 2426 | Ga0105251_10027498 | |||
| 2427 | Ga0105251_10046730 | |||
| 2428 | Ga0105251_10080733 | |||
| 2429 | Ga0105251_10123692 | |||
| 2430 | Ga0105251_10389284 | |||
| 2431 | Ga0105244_10000020 | |||
| 2432 | Ga0105244_10000197 | |||
| 2433 | Ga0105244_10000674 | |||
| 2434 | Ga0105244_10002440 | |||
| 2435 | Ga0105244_10015340 | |||
| 2436 | Ga0105244_10015634 | |||
| 2437 | Ga0105244_10029291 | |||
| 2438 | Ga0105244_10041222 | |||
| 2439 | Ga0105250_10000037 | |||
| 2440 | Ga0105250_10000839 | |||
| 2441 | Ga0105250_10002125 | |||
| 2442 | Ga0105250_10002406 | |||
| 2443 | Ga0105250_10048505 | |||
| 2444 | Ga0105250_10054331 | |||
| 2445 | Ga0105250_10212043 | |||
| 2446 | Ga0105250_10416495 | |||
| 2447 | Ga0105240_10240593 | |||
| 2448 | Ga0105240_10423383 | |||
| 2449 | Ga0105240_10524916 | |||
| 2450 | Ga0105240_11260788 | |||
| 2451 | Ga0105240_11713007 | |||
| 2452 | Ga0105240_12221274 | |||
| 2453 | Ga0105240_12324523 | |||
| 2454 | Ga0111539_10038732 | |||
| 2455 | Ga0111539_10082605 | |||
| 2456 | Ga0111539_10166893 | |||
| 2457 | Ga0111539_10236459 | |||
| 2458 | Ga0111539_10468019 | |||
| 2459 | Ga0111539_10736871 | |||
| 2460 | Ga0111539_11099412 | |||
| 2461 | Ga0111539_11340849 | |||
| 2462 | Ga0111539_13112315 | |||
| 2463 | Ga0111539_13247013 | |||
| 2464 | Ga0105245_10113009 | |||
| 2465 | Ga0105245_10869076 | |||
| 2466 | Ga0105245_10903875 | |||
| 2467 | Ga0105245_11244051 | |||
| 2468 | Ga0105245_11263229 | |||
| 2469 | Ga0105245_11639846 | |||
| 2470 | Ga0105245_11795603 | |||
| 2471 | Ga0105247_10000086 | |||
| 2472 | Ga0105247_10039354 | |||
| 2473 | Ga0105247_10090057 | |||
| 2474 | Ga0105247_10434469 | |||
| 2475 | Ga0105247_11022105 | |||
| 2476 | Ga0105247_11321714 | |||
| 2477 | Ga0114129_10012903 | |||
| 2478 | Ga0114129_13501557 | |||
| 2479 | Ga0105243_10104836 | |||
| 2480 | Ga0105243_10125167 | |||
| 2481 | Ga0105243_11182920 | |||
| 2482 | Ga0105243_11433155 | |||
| 2483 | Ga0105243_11542865 | |||
| 2484 | Ga0105243_11750703 | |||
| 2485 | Ga0105243_12048061 | |||
| 2486 | Ga0105243_12068976 | |||
| 2487 | Ga0105243_12338381 | |||
| 2488 | Ga0105243_12545835 | |||
| 2489 | Ga0105243_12813468 | |||
| 2490 | Ga0105241_10107889 | |||
| 2491 | Ga0105241_10576300 | |||
| 2492 | Ga0105241_10626347 | |||
| 2493 | Ga0105241_11248782 | |||
| 2494 | Ga0105242_10168577 | |||
| 2495 | Ga0105242_10288162 | |||
| 2496 | Ga0105242_10459950 | |||
| 2497 | Ga0105242_10875371 | |||
| 2498 | Ga0105242_11159900 | |||
| 2499 | Ga0105242_11524614 | |||
| 2500 | Ga0105242_12646847 | |||
| 2501 | Ga0105242_12681220 | |||
| 2502 | Ga0105248_10026309 | |||
| 2503 | Ga0105248_10090143 | |||
| 2504 | Ga0105248_10416837 | |||
| 2505 | Ga0105248_10470407 | |||
| 2506 | Ga0105248_10620854 | |||
| 2507 | Ga0105248_11233058 | |||
| 2508 | Ga0105248_12422508 | |||
| 2509 | Ga0105237_10121366 | |||
| 2510 | Ga0105237_10122634 | |||
| 2511 | Ga0105237_10262368 | |||
| 2512 | Ga0105237_10780964 | |||
| 2513 | Ga0105237_10832952 | |||
| 2514 | Ga0105237_11030774 | |||
| 2515 | Ga0105237_11370267 | |||
| 2516 | Ga0105237_11735498 | |||
| 2517 | Ga0105238_10049581 | |||
| 2518 | Ga0105238_10089896 | |||
| 2519 | Ga0105238_10393190 | |||
| 2520 | Ga0105238_10668372 | |||
| 2521 | Ga0105238_12491644 | |||
| 2522 | Ga0105249_10002589 | |||
| 2523 | Ga0105249_10260095 | |||
| 2524 | Ga0105249_10581818 | |||
| 2525 | Ga0099796_10342410 | |||
| 2526 | Ga0105239_10082120 | |||
| 2527 | Ga0105239_10090438 | |||
| 2528 | Ga0105239_10837743 | |||
| 2529 | Ga0105239_11183363 | |||
| 2530 | Ga0105246_10002690 | |||
| 2531 | Ga0105246_10033797 | |||
| 2532 | Ga0105246_10648303 | |||
| 2533 | Ga0105246_10714533 | |||
| 2534 | Ga0105246_10745296 | |||
| 2535 | Ga0157373_10005568 | |||
| 2536 | Ga0157373_10008472 | |||
| 2537 | Ga0157373_10296754 | |||
| 2538 | Ga0157373_10301905 | |||
| 2539 | Ga0157373_10442172 | |||
| 2540 | Ga0157371_10043618 | |||
| 2541 | Ga0157371_10090023 | |||
| 2542 | Ga0157371_10125940 | |||
| 2543 | Ga0157371_10232342 | |||
| 2544 | Ga0157371_10416417 | |||
| 2545 | Ga0157371_11033610 | |||
| 2546 | Ga0157370_10005611 | |||
| 2547 | Ga0157370_10006677 | |||
| 2548 | Ga0157370_10011572 | |||
| 2549 | Ga0157370_10029414 | |||
| 2550 | Ga0157370_10093122 | |||
| 2551 | Ga0157370_10466069 | |||
| 2552 | Ga0157370_10513126 | |||
| 2553 | Ga0157370_10676114 | |||
| 2554 | Ga0157369_10029226 | |||
| 2555 | Ga0157369_10044187 | |||
| 2556 | Ga0157369_10087770 | |||
| 2557 | Ga0157369_10171226 | |||
| 2558 | Ga0157369_10213745 | |||
| 2559 | Ga0157369_10455035 | |||
| 2560 | Ga0157369_11383524 | |||
| 2561 | Ga0157369_11528089 | |||
| 2562 | Ga0157369_11974102 | |||
| 2563 | Ga0157369_12567981 | |||
| 2564 | Ga0157374_10000170 | |||
| 2565 | Ga0157374_10149706 | |||
| 2566 | Ga0157374_10449655 | |||
| 2567 | Ga0157374_10589718 | |||
| 2568 | Ga0157374_11326843 | |||
| 2569 | Ga0157374_12956478 | |||
| 2570 | Ga0157378_10202588 | |||
| 2571 | Ga0157378_12404070 | |||
| 2572 | Ga0157378_12615341 | |||
| 2573 | Ga0163162_10009881 | |||
| 2574 | Ga0163162_10243246 | |||
| 2575 | Ga0163162_11118143 | |||
| 2576 | Ga0157372_10001723 | |||
| 2577 | Ga0157372_10005345 | |||
| 2578 | Ga0157372_10134866 | |||
| 2579 | Ga0157372_10143033 | |||
| 2580 | Ga0157372_10235943 | |||
| 2581 | Ga0157372_10578807 | |||
| 2582 | Ga0157372_10776946 | |||
| 2583 | Ga0157372_11045039 | |||
| 2584 | Ga0157372_13422479 | |||
| 2585 | Ga0157375_10088445 | |||
| 2586 | Ga0157375_10250831 | |||
| 2587 | Ga0157375_10307443 | |||
| 2588 | Ga0157375_10529248 | |||
| 2589 | Ga0157375_10725201 | |||
| 2590 | Ga0157375_10870107 | |||
| 2591 | Ga0157375_13315750 | |||
| 2592 | Ga0163163_10008768 | |||
| 2593 | Ga0163163_10029560 | |||
| 2594 | Ga0163163_10047761 | |||
| 2595 | Ga0163163_10266337 | |||
| 2596 | Ga0163163_10405585 | |||
| 2597 | Ga0163163_10835071 | |||
| 2598 | Ga0163163_12215038 | |||
| 2599 | Ga0163163_13052529 | |||
| 2600 | Ga0157380_10022588 | |||
| 2601 | Ga0157380_10198467 | |||
| 2602 | Ga0157380_10275189 | |||
| 2603 | Ga0157380_10299523 | |||
| 2604 | Ga0157380_10506118 | |||
| 2605 | Ga0157380_10726586 | |||
| 2606 | Ga0157380_11105896 | |||
| 2607 | Ga0157380_12145267 | |||
| 2608 | Ga0157380_13430589 | |||
| 2609 | Ga0182008_10037326 | |||
| 2610 | Ga0157377_10011088 | |||
| 2611 | Ga0157377_11217797 | |||
| 2612 | Ga0157377_11569265 | |||
| 2613 | Ga0157379_10158199 | |||
| 2614 | Ga0157379_10170501 | |||
| 2615 | Ga0157379_10357977 | |||
| 2616 | Ga0157379_10683279 | |||
| 2617 | Ga0157376_10009262 | |||
| 2618 | Ga0157376_10051525 | |||
| 2619 | Ga0157376_10216261 | |||
| 2620 | Ga0157376_10358465 | |||
| 2621 | Ga0157376_10573155 | |||
| 2622 | Ga0157376_10735779 | |||
| 2623 | Ga0157376_11091024 | |||
| 2624 | Ga0157376_12837019 | |||
| 2625 | Ga0183366_1001 | |||
| 2626 | Ga0183370_1001 | |||
| 2627 | Ga0183369_1001 | |||
| 2628 | Ga0183368_1001 | |||
| 2629 | Ga0163161_10000001 | |||
| 2630 | Ga0163161_10185833 | |||
| 2631 | Ga0163161_10281807 | |||
| 2632 | Ga0163161_10293827 | |||
| 2633 | Ga0163161_10423781 | |||
| 2634 | Ga0163161_10469896 | |||
| 2635 | Ga0163161_10659548 | |||
| 2636 | Ga0163161_10945310 | |||
| 2637 | Ga0163161_12088364 | |||
| 2638 | Ga0206356_11801913 | |||
| 2639 | Ga0206354_10249962 | |||
| 2640 | Ga0154015_1031133 | |||
| 2641 | Ga0154015_1078359 | |||
| 2642 | Ga0213876_10000034 | |||
| 2643 | Ga0209672_112342 | |||
| 2644 | Ga0209258_104361 | |||
| 2645 | Ga0209129_1000077 | |||
| 2646 | Ga0209565_1000095 | |||
| 2647 | Ga0209455_1001008 | |||
| 2648 | Ga0209673_1024142 | |||
| 2649 | Ga0209675_1000067 | |||
| 2650 | Ga0209676_1020931 | |||
| 2651 | Ga0209025_1000018 | |||
| 2652 | Ga0209025_1000034 | |||
| 2653 | Ga0209025_1000059 | |||
| 2654 | Ga0209564_1004589 | |||
| 2655 | Ga0209758_1017252 | |||
| 2656 | Ga0209050_1002453 | |||
| 2657 | Ga0209256_1000985 | |||
| 2658 | Ga0209051_1018943 | |||
| 2659 | Ga0209051_1043725 | |||
| 2660 | Ga0207697_10225871 | |||
| 2661 | Ga0207656_10265465 | |||
| 2662 | Ga0207696_1000001 | |||
| 2663 | Ga0207696_1000099 | |||
| 2664 | Ga0207696_1000497 | |||
| 2665 | Ga0207696_1002263 | |||
| 2666 | Ga0207696_1002685 | |||
| 2667 | Ga0207696_1045627 | |||
| 2668 | Ga0207696_1051192 | |||
| 2669 | Ga0207696_1053155 | |||
| 2670 | Ga0207655_1000002 | |||
| 2671 | Ga0207655_1000004 | |||
| 2672 | Ga0207655_1000036 | |||
| 2673 | Ga0207655_1000071 | |||
| 2674 | Ga0207655_1000305 | |||
| 2675 | Ga0207655_1000316 | |||
| 2676 | Ga0207655_1000666 | |||
| 2677 | Ga0207655_1038031 | |||
| 2678 | Ga0207655_1057156 | |||
| 2679 | Ga0207655_1107820 | |||
| 2680 | Ga0207713_1000004 | |||
| 2681 | Ga0207713_1000120 | |||
| 2682 | Ga0207713_1001730 | |||
| 2683 | Ga0207713_1002855 | |||
| 2684 | Ga0207713_1012995 | |||
| 2685 | Ga0207713_1040996 | |||
| 2686 | Ga0207713_1087413 | |||
| 2687 | Ga0207682_10023400 | |||
| 2688 | Ga0207682_10029992 | |||
| 2689 | Ga0207682_10160651 | |||
| 2690 | Ga0207682_10261330 | |||
| 2691 | Ga0207642_10010780 | |||
| 2692 | Ga0207642_10032098 | |||
| 2693 | Ga0207710_10000233 | |||
| 2694 | Ga0207688_10012356 | |||
| 2695 | Ga0207680_10056803 | |||
| 2696 | Ga0207680_10082345 | |||
| 2697 | Ga0207680_10175776 | |||
| 2698 | Ga0207680_10980969 | |||
| 2699 | Ga0207647_10003226 | |||
| 2700 | Ga0207685_10389233 | |||
| 2701 | Ga0207645_10024964 | |||
| 2702 | Ga0207645_10085698 | |||
| 2703 | Ga0207645_10331408 | |||
| 2704 | Ga0207643_10040761 | |||
| 2705 | Ga0207643_10067057 | |||
| 2706 | Ga0207643_10113423 | |||
| 2707 | Ga0207643_10566272 | |||
| 2708 | Ga0207705_10000029 | |||
| 2709 | Ga0207705_10000755 | |||
| 2710 | Ga0207684_11493695 | |||
| 2711 | Ga0207654_10117072 | |||
| 2712 | Ga0207654_10184858 | |||
| 2713 | Ga0207654_10680126 | |||
| 2714 | Ga0207707_10000042 | |||
| 2715 | Ga0207707_10000301 | |||
| 2716 | Ga0207707_10000302 | |||
| 2717 | Ga0207707_10000392 | |||
| 2718 | Ga0207707_10000932 | |||
| 2719 | Ga0207707_10001056 | |||
| 2720 | Ga0207707_10001397 | |||
| 2721 | Ga0207707_10009958 | |||
| 2722 | Ga0207707_10050854 | |||
| 2723 | Ga0207707_10102453 | |||
| 2724 | Ga0207707_10141527 | |||
| 2725 | Ga0207707_10195879 | |||
| 2726 | Ga0207695_10002071 | |||
| 2727 | Ga0207695_10020791 | |||
| 2728 | Ga0207695_11466429 | |||
| 2729 | Ga0207695_11635772 | |||
| 2730 | Ga0207695_11726965 | |||
| 2731 | Ga0207671_10650063 | |||
| 2732 | Ga0207693_10246759 | |||
| 2733 | Ga0207663_11284780 | |||
| 2734 | Ga0207660_10000413 | |||
| 2735 | Ga0207660_10000722 | |||
| 2736 | Ga0207660_10205966 | |||
| 2737 | Ga0207660_10324822 | |||
| 2738 | Ga0207660_10626220 | |||
| 2739 | Ga0207660_10770080 | |||
| 2740 | Ga0207660_11322184 | |||
| 2741 | Ga0207660_11364877 | |||
| 2742 | Ga0207662_10010415 | |||
| 2743 | Ga0207662_10752816 | |||
| 2744 | Ga0207657_10029708 | |||
| 2745 | Ga0207657_10030356 | |||
| 2746 | Ga0207657_10441732 | |||
| 2747 | Ga0207657_10576145 | |||
| 2748 | Ga0207657_11063100 | |||
| 2749 | Ga0207649_10015666 | |||
| 2750 | Ga0207649_10016136 | |||
| 2751 | Ga0207649_10081166 | |||
| 2752 | Ga0207649_10126409 | |||
| 2753 | Ga0207649_10231728 | |||
| 2754 | Ga0207649_10842270 | |||
| 2755 | Ga0207649_10861467 | |||
| 2756 | Ga0207652_10000082 | |||
| 2757 | Ga0207652_10000808 | |||
| 2758 | Ga0207652_10001430 | |||
| 2759 | Ga0207652_10001471 | |||
| 2760 | Ga0207652_10020194 | |||
| 2761 | Ga0207652_10350538 | |||
| 2762 | Ga0207652_10974934 | |||
| 2763 | Ga0207646_11861106 | |||
| 2764 | Ga0207681_10013599 | |||
| 2765 | Ga0207681_10353125 | |||
| 2766 | Ga0207694_10063480 | |||
| 2767 | Ga0207694_10448184 | |||
| 2768 | Ga0207694_10654636 | |||
| 2769 | Ga0207650_10049871 | |||
| 2770 | Ga0207650_10094024 | |||
| 2771 | Ga0207650_10483831 | |||
| 2772 | Ga0207650_10788102 | |||
| 2773 | Ga0207650_11094481 | |||
| 2774 | Ga0207659_10047840 | |||
| 2775 | Ga0207659_10074244 | |||
| 2776 | Ga0207659_10297394 | |||
| 2777 | Ga0207659_10353613 | |||
| 2778 | Ga0207659_11249594 | |||
| 2779 | Ga0207659_11263967 | |||
| 2780 | Ga0207659_11384859 | |||
| 2781 | Ga0207659_11735304 | |||
| 2782 | Ga0207700_10032522 | |||
| 2783 | Ga0207664_10028573 | |||
| 2784 | Ga0207664_10590883 | |||
| 2785 | Ga0207644_10206730 | |||
| 2786 | Ga0207644_10514627 | |||
| 2787 | Ga0207644_10590366 | |||
| 2788 | Ga0207690_10002484 | |||
| 2789 | Ga0207690_10005386 | |||
| 2790 | Ga0207690_10184103 | |||
| 2791 | Ga0207690_10210960 | |||
| 2792 | Ga0207690_10852445 | |||
| 2793 | Ga0207690_11116635 | |||
| 2794 | Ga0207690_11160757 | |||
| 2795 | Ga0207690_11197472 | |||
| 2796 | Ga0207706_10008490 | |||
| 2797 | Ga0207706_10123391 | |||
| 2798 | Ga0207706_10185134 | |||
| 2799 | Ga0207706_10312878 | |||
| 2800 | Ga0207706_10433400 | |||
| 2801 | Ga0207706_11058631 | |||
| 2802 | Ga0207686_10039354 | |||
| 2803 | Ga0207686_11380727 | |||
| 2804 | Ga0207709_10044621 | |||
| 2805 | Ga0207709_10834354 | |||
| 2806 | Ga0207709_11227006 | |||
| 2807 | Ga0207709_11735101 | |||
| 2808 | Ga0207670_10004036 | |||
| 2809 | Ga0207670_10014859 | |||
| 2810 | Ga0207670_10450618 | |||
| 2811 | Ga0207670_10701882 | |||
| 2812 | Ga0207670_10841639 | |||
| 2813 | Ga0207669_10087051 | |||
| 2814 | Ga0207669_10124301 | |||
| 2815 | Ga0207669_10210671 | |||
| 2816 | Ga0207669_11779010 | |||
| 2817 | Ga0207704_10070872 | |||
| 2818 | Ga0207704_10127387 | |||
| 2819 | Ga0207704_10401878 | |||
| 2820 | Ga0207704_10645037 | |||
| 2821 | Ga0207704_10902105 | |||
| 2822 | Ga0207704_10913136 | |||
| 2823 | Ga0207704_11556815 | |||
| 2824 | Ga0207704_11803067 | |||
| 2825 | Ga0207691_10013845 | |||
| 2826 | Ga0207691_10013979 | |||
| 2827 | Ga0207691_10020673 | |||
| 2828 | Ga0207691_10068468 | |||
| 2829 | Ga0207691_10092590 | |||
| 2830 | Ga0207691_10194096 | |||
| 2831 | Ga0207691_11714348 | |||
| 2832 | Ga0207711_10010645 | |||
| 2833 | Ga0207711_10090838 | |||
| 2834 | Ga0207711_10416792 | |||
| 2835 | Ga0207711_10434188 | |||
| 2836 | Ga0207711_10553495 | |||
| 2837 | Ga0207689_10000371 | |||
| 2838 | Ga0207689_10001446 | |||
| 2839 | Ga0207689_10021355 | |||
| 2840 | Ga0207689_10096610 | |||
| 2841 | Ga0207689_10100688 | |||
| 2842 | Ga0207689_10162303 | |||
| 2843 | Ga0207689_10197665 | |||
| 2844 | Ga0207689_10940478 | |||
| 2845 | Ga0207689_11718622 | |||
| 2846 | Ga0207661_10203729 | |||
| 2847 | Ga0207661_10554982 | |||
| 2848 | Ga0207661_11230428 | |||
| 2849 | Ga0207661_11558253 | |||
| 2850 | Ga0207679_10005183 | |||
| 2851 | Ga0207679_10088079 | |||
| 2852 | Ga0207679_10110291 | |||
| 2853 | Ga0207679_10133435 | |||
| 2854 | Ga0207679_10284283 | |||
| 2855 | Ga0207679_10447722 | |||
| 2856 | Ga0207679_11185340 | |||
| 2857 | Ga0207679_11796659 | |||
| 2858 | Ga0207667_10000075 | |||
| 2859 | Ga0207667_10003270 | |||
| 2860 | Ga0207667_10005022 | |||
| 2861 | Ga0207667_10009976 | |||
| 2862 | Ga0207667_10268458 | |||
| 2863 | Ga0207667_10373442 | |||
| 2864 | Ga0207667_10543334 | |||
| 2865 | Ga0207667_10608528 | |||
| 2866 | Ga0207667_12082021 | |||
| 2867 | Ga0207651_10028390 | |||
| 2868 | Ga0207651_10035410 | |||
| 2869 | Ga0207651_10195254 | |||
| 2870 | Ga0207651_10481521 | |||
| 2871 | Ga0207651_10679836 | |||
| 2872 | Ga0207651_10800570 | |||
| 2873 | Ga0207651_10803220 | |||
| 2874 | Ga0207651_10812892 | |||
| 2875 | Ga0207712_10040229 | |||
| 2876 | Ga0207712_10165243 | |||
| 2877 | Ga0207712_10477124 | |||
| 2878 | Ga0207712_11151185 | |||
| 2879 | Ga0207712_11186724 | |||
| 2880 | Ga0207668_10049615 | |||
| 2881 | Ga0207668_10088928 | |||
| 2882 | Ga0207668_10482064 | |||
| 2883 | Ga0207668_10722817 | |||
| 2884 | Ga0207668_10971443 | |||
| 2885 | Ga0207668_11032748 | |||
| 2886 | Ga0207640_10003603 | |||
| 2887 | Ga0207640_10014722 | |||
| 2888 | Ga0207640_10042886 | |||
| 2889 | Ga0207640_10280087 | |||
| 2890 | Ga0207640_10287246 | |||
| 2891 | Ga0207640_10547495 | |||
| 2892 | Ga0207640_10875889 | |||
| 2893 | Ga0207658_10000200 | |||
| 2894 | Ga0207658_10004744 | |||
| 2895 | Ga0207658_10146291 | |||
| 2896 | Ga0207658_10304410 | |||
| 2897 | Ga0207658_10957412 | |||
| 2898 | Ga0207658_11232482 | |||
| 2899 | Ga0207658_11557713 | |||
| 2900 | Ga0207677_10027709 | |||
| 2901 | Ga0207677_10032981 | |||
| 2902 | Ga0207677_10098703 | |||
| 2903 | Ga0207677_10376450 | |||
| 2904 | Ga0207677_10511288 | |||
| 2905 | Ga0207677_10548506 | |||
| 2906 | Ga0207677_11431777 | |||
| 2907 | Ga0207703_10023685 | |||
| 2908 | Ga0207703_10039366 | |||
| 2909 | Ga0207703_10423955 | |||
| 2910 | Ga0207703_10743649 | |||
| 2911 | Ga0207639_10002359 | |||
| 2912 | Ga0207639_10010177 | |||
| 2913 | Ga0207639_10038101 | |||
| 2914 | Ga0207639_10071797 | |||
| 2915 | Ga0207639_10111605 | |||
| 2916 | Ga0207639_10260488 | |||
| 2917 | Ga0207639_10419113 | |||
| 2918 | Ga0207639_10632475 | |||
| 2919 | Ga0207639_10701649 | |||
| 2920 | Ga0207639_10708096 | |||
| 2921 | Ga0207678_10044515 | |||
| 2922 | Ga0207678_10121049 | |||
| 2923 | Ga0207678_10232765 | |||
| 2924 | Ga0207678_10256173 | |||
| 2925 | Ga0207678_10271595 | |||
| 2926 | Ga0207678_10518863 | |||
| 2927 | Ga0207678_10550205 | |||
| 2928 | Ga0207678_10558989 | |||
| 2929 | Ga0207708_10041543 | |||
| 2930 | Ga0207708_10047816 | |||
| 2931 | Ga0207708_10339229 | |||
| 2932 | Ga0207702_10035000 | |||
| 2933 | Ga0207702_10037347 | |||
| 2934 | Ga0207702_10256973 | |||
| 2935 | Ga0207702_11582016 | |||
| 2936 | Ga0207702_11690316 | |||
| 2937 | Ga0207702_11862376 | |||
| 2938 | Ga0207641_10022918 | |||
| 2939 | Ga0207641_10039525 | |||
| 2940 | Ga0207641_10504381 | |||
| 2941 | Ga0207641_10511676 | |||
| 2942 | Ga0207641_10539783 | |||
| 2943 | Ga0207641_10800175 | |||
| 2944 | Ga0207641_11364143 | |||
| 2945 | Ga0207641_11641391 | |||
| 2946 | Ga0207648_10063545 | |||
| 2947 | Ga0207648_10130673 | |||
| 2948 | Ga0207648_10153721 | |||
| 2949 | Ga0207648_10188089 | |||
| 2950 | Ga0207648_10199117 | |||
| 2951 | Ga0207676_10011531 | |||
| 2952 | Ga0207676_10056478 | |||
| 2953 | Ga0207676_10137214 | |||
| 2954 | Ga0207676_10529709 | |||
| 2955 | Ga0207676_10635738 | |||
| 2956 | Ga0207676_10905621 | |||
| 2957 | Ga0207674_10000572 | |||
| 2958 | Ga0207674_10007862 | |||
| 2959 | Ga0207674_10011838 | |||
| 2960 | Ga0207674_10039765 | |||
| 2961 | Ga0207674_10052688 | |||
| 2962 | Ga0207674_10063554 | |||
| 2963 | Ga0207674_10872555 | |||
| 2964 | Ga0207674_12131192 | |||
| 2965 | Ga0207675_100004755 | |||
| 2966 | Ga0207675_100024866 | |||
| 2967 | Ga0207675_100026368 | |||
| 2968 | Ga0207675_100037411 | |||
| 2969 | Ga0207675_100038140 | |||
| 2970 | Ga0207675_100051706 | |||
| 2971 | Ga0207675_100107890 | |||
| 2972 | Ga0207675_100178828 | |||
| 2973 | Ga0207675_100296515 | |||
| 2974 | Ga0207675_100415235 | |||
| 2975 | Ga0207675_101029420 | |||
| 2976 | Ga0207675_102509138 | |||
| 2977 | Ga0207683_10023239 | |||
| 2978 | Ga0207683_10037952 | |||
| 2979 | Ga0207683_10104195 | |||
| 2980 | Ga0207683_10273162 | |||
| 2981 | Ga0207683_10513617 | |||
| 2982 | Ga0207683_11189928 | |||
| 2983 | Ga0207698_10000358 | |||
| 2984 | Ga0207698_10004642 | |||
| 2985 | Ga0207698_10464285 | |||
| 2986 | Ga0207698_10651507 | |||
| 2987 | Ga0207698_11520689 | |||
| 2988 | Ga0207698_11695704 | |||
| 2989 | Ga0209281_1000001 | |||
| 2990 | Ga0209281_1000004 | |||
| 2991 | Ga0209281_1000006 | |||
| 2992 | Ga0209281_1000012 | |||
| 2993 | Ga0209281_1000064 | |||
| 2994 | Ga0209281_1000071 | |||
| 2995 | Ga0209281_1000109 | |||
| 2996 | Ga0209281_1000509 | |||
| 2997 | Ga0209281_1000530 | |||
| 2998 | Ga0209281_1001268 | |||
| 2999 | Ga0209281_1039581 | |||
| 3000 | Ga0209371_1000001 | |||
| 3001 | Ga0209371_1000002 | |||
| 3002 | Ga0209371_1000015 | |||
| 3003 | Ga0209371_1001413 | |||
| 3004 | Ga0209371_1004930 | |||
| 3005 | Ga0209371_1005273 | |||
| 3006 | Ga0209371_1007026 | |||
| 3007 | Ga0209371_1009297 | |||
| 3008 | Ga0209371_1014162 | |||
| 3009 | Ga0209371_1021952 | |||
| 3010 | Ga0210002_1020764 | |||
| 3011 | Ga0209983_1016929 | |||
| 3012 | Ga0209282_1000043 | |||
| 3013 | Ga0209971_1041869 | |||
| 3014 | Ga0207428_10042435 | |||
| 3015 | Ga0207428_10309282 | |||
| 3016 | Ga0207428_10339863 | |||
| 3017 | Ga0207428_10385769 | |||
| 3018 | Ga0268266_10000001 | |||
| 3019 | Ga0268266_10000976 | |||
| 3020 | Ga0268266_10059695 | |||
| 3021 | Ga0268266_10077118 | |||
| 3022 | Ga0268266_10105100 | |||
| 3023 | Ga0268266_10106705 | |||
| 3024 | Ga0268266_10200330 | |||
| 3025 | Ga0268266_10395066 | |||
| 3026 | Ga0268266_10562066 | |||
| 3027 | Ga0268266_12262433 | |||
| 3028 | Ga0268265_10006518 | |||
| 3029 | Ga0268265_10006672 | |||
| 3030 | Ga0268265_10010943 | |||
| 3031 | Ga0268265_10028107 | |||
| 3032 | Ga0268265_10044156 | |||
| 3033 | Ga0268265_10053990 | |||
| 3034 | Ga0268265_10132373 | |||
| 3035 | Ga0268265_10485117 | |||
| 3036 | Ga0268265_10720070 | |||
| 3037 | Ga0268265_10869030 | |||
| 3038 | Ga0268265_11382345 | |||
| 3039 | Ga0268265_12096677 | |||
| 3040 | Ga0268264_10022304 | |||
| 3041 | Ga0268264_10210617 | |||
| 3042 | Ga0268264_10309266 | |||
| 3043 | Ga0268264_10613391 | |||
| 3044 | Ga0268264_10753938 | |||
| 3045 | Ga0268264_11906773 | |||
| 3046 | Ga0265334_10101048 | |||
| 3047 | Ga0265318_10233049 | |||
| 3048 | Ga0265336_10233406 | |||
| 3049 | Ga0307517_10196957 | |||
| 3050 | Ga0265338_10006983 | |||
| 3051 | Ga0265338_10014249 | |||
| 3052 | Ga0265338_10727045 | |||
| 3053 | Ga0265324_10000023 | |||
| 3054 | Ga0265324_10318366 | |||
| 3055 | Ga0268256_1000001 | |||
| 3056 | Ga0268256_1000002 | |||
| 3057 | Ga0268256_1001210 | |||
| 3058 | Ga0268256_1001873 | |||
| 3059 | Ga0268256_1005140 | |||
| 3060 | Ga0268256_1009603 | |||
| 3061 | Ga0268256_1010954 | |||
| 3062 | Ga0268256_1012887 | |||
| 3063 | Ga0268256_1015703 | |||
| 3064 | Ga0268256_1024544 | |||
| 3065 | Ga0268256_1025030 | |||
| 3066 | Ga0265770_1056347 | |||
| 3067 | Ga0265330_10021565 | |||
| 3068 | Ga0265332_10009214 | |||
| 3069 | Ga0265332_10430125 | |||
| 3070 | Ga0265328_10001981 | |||
| 3071 | Ga0265328_10011375 | |||
| 3072 | Ga0265328_10068864 | |||
| 3073 | Ga0265320_10012710 | |||
| 3074 | Ga0265320_10015761 | |||
| 3075 | Ga0265325_10000099 | |||
| 3076 | Ga0265325_10125404 | |||
| 3077 | Ga0265329_10056532 | |||
| 3078 | Ga0265340_10043331 | |||
| 3079 | Ga0265340_10188792 | |||
| 3080 | Ga0265340_10352153 | |||
| 3081 | Ga0265331_10003774 | |||
| 3082 | Ga0265331_10018195 | |||
| 3083 | Ga0265331_10019217 | |||
| 3084 | Ga0265327_10010769 | |||
| 3085 | Ga0265327_10158278 | |||
| 3086 | Ga0265316_10578363 | |||
| 3087 | Ga0307513_10013944 | |||
| 3088 | Ga0307513_10014238 | |||
| 3089 | Ga0307513_10045145 | |||
| 3090 | Ga0307513_10073776 | |||
| 3091 | Ga0307513_10190036 | |||
| 3092 | Ga0307513_10293284 | |||
| 3093 | Ga0307509_10122863 | |||
| 3094 | Ga0307509_10240477 | |||
| 3095 | Ga0307408_100000233 | |||
| 3096 | Ga0307408_100119662 | |||
| 3097 | Ga0307408_100123916 | |||
| 3098 | Ga0307408_100157384 | |||
| 3099 | Ga0307408_100245499 | |||
| 3100 | Ga0307408_100324954 | |||
| 3101 | Ga0307408_101349188 | |||
| 3102 | Ga0307408_101531664 | |||
| 3103 | Ga0307408_101755879 | |||
| 3104 | Ga0307508_10159712 | |||
| 3105 | Ga0307514_10115739 | |||
| 3106 | Ga0316575_10076193 | |||
| 3107 | Ga0316575_10124046 | |||
| 3108 | Ga0316579_10025457 | |||
| 3109 | Ga0316579_10380023 | |||
| 3110 | Ga0265314_10001396 | |||
| 3111 | Ga0265314_10016392 | |||
| 3112 | Ga0265342_10018541 | |||
| 3113 | Ga0316576_10005681 | |||
| 3114 | Ga0316576_10067143 | |||
| 3115 | Ga0316578_10054629 | |||
| 3116 | Ga0316578_10195730 | |||
| 3117 | Ga0316578_10762131 | |||
| 3118 | Ga0307405_10096800 | |||
| 3119 | Ga0307405_10157211 | |||
| 3120 | Ga0307405_10799621 | |||
| 3121 | Ga0307405_11954929 | |||
| 3122 | Ga0316577_10115592 | |||
| 3123 | Ga0307413_10029858 | |||
| 3124 | Ga0307413_10131836 | |||
| 3125 | Ga0307413_10156383 | |||
| 3126 | Ga0307410_10093591 | |||
| 3127 | Ga0307410_10539757 | |||
| 3128 | Ga0326468_10044942 | |||
| 3129 | Ga0307406_10009598 | |||
| 3130 | Ga0307406_10028506 | |||
| 3131 | Ga0307406_10136622 | |||
| 3132 | Ga0307406_10286953 | |||
| 3133 | Ga0307406_10691235 | |||
| 3134 | Ga0307406_11645538 | |||
| 3135 | Ga0307406_11683595 | |||
| 3136 | Ga0307407_10135111 | |||
| 3137 | Ga0307407_10215276 | |||
| 3138 | Ga0307407_10477084 | |||
| 3139 | Ga0307412_10020275 | |||
| 3140 | Ga0307412_10276823 | |||
| 3141 | Ga0307412_10358879 | |||
| 3142 | Ga0307412_10998402 | |||
| 3143 | Ga0307409_100000848 | |||
| 3144 | Ga0307409_100026291 | |||
| 3145 | Ga0307409_100054968 | |||
| 3146 | Ga0307409_100169363 | |||
| 3147 | Ga0307409_101279673 | |||
| 3148 | Ga0307409_101433852 | |||
| 3149 | Ga0307409_102936608 | |||
| 3150 | Ga0307416_100028510 | |||
| 3151 | Ga0307416_100114813 | |||
| 3152 | Ga0307416_100151409 | |||
| 3153 | Ga0307416_100600851 | |||
| 3154 | Ga0307416_100715894 | |||
| 3155 | Ga0307416_101207104 | |||
| 3156 | Ga0307416_101998303 | |||
| 3157 | Ga0307416_102080034 | |||
| 3158 | Ga0307416_102737302 | |||
| 3159 | Ga0307414_10399099 | |||
| 3160 | Ga0307414_10456699 | |||
| 3161 | Ga0307414_10604225 | |||
| 3162 | Ga0307414_10884528 | |||
| 3163 | Ga0307411_10006042 | |||
| 3164 | Ga0307411_10035933 | |||
| 3165 | Ga0307411_10070087 | |||
| 3166 | Ga0307411_10108470 | |||
| 3167 | Ga0307411_10124138 | |||
| 3168 | Ga0307411_10891462 | |||
| 3169 | Ga0307411_12358168 | |||
| 3170 | Ga0307415_100104265 | |||
| 3171 | Ga0307415_100142226 | |||
| 3172 | Ga0307415_100213386 | |||
| 3173 | Ga0307415_100549756 | |||
| 3174 | Ga0307415_100957725 | |||
| 3175 | Ga0307415_101652789 | |||
| 3176 | Ga0307415_101882067 | |||
| 3177 | Ga0307415_101896915 | |||
| 3178 | Ga0307415_102337004 | |||
| 3179 | Ga0316583_10006991 | |||
| 3180 | Ga0316583_10162233 | |||
| 3181 | Ga0316585_10022280 | |||
| 3182 | Ga0316593_10002945 | |||
| 3183 | Ga0316593_10004191 | |||
| 3184 | Ga0316593_10133054 | |||
| 3185 | Ga0307507_10249937 | |||
| 3186 | Ga0316596_1024048 | |||
| 3187 | Ga0316596_1096720 | |||
| 3188 | Ga0373959_0188007 | |||
| 3189 | Ga0373959_0206559 | |||
| 3190 | Ga0373944_0112038 | |||
| 3191 | Ga0373954_0686199 | |||
| 3192 | Ga0373946_0280383 | |||
| 3193 | Ga0373962_0191054 | |||
| 3194 | Ga0316574_0007271 | |||
| 3195 | Ga0316574_0008371 | |||
| 3196 | Ga0373937_0429906 | |||
| 3197 | Ga0373937_0471016 | |||
| 3198 | Ga0316582_0007780 | |||
| 3199 | Ga0316582_0011144 | |||
| 3200 | Ga0316582_0095316 | |||
| 3201 | Ga0316582_0101983 | |||
| 3202 | Ga0316584_0068479 | |||
| 3203 | Ga0316584_0078325 | |||
| 3204 | Ga0316584_0427174 | |||
| 3205 | Ga0316584_0718848 | |||
| 3206 | Ga0373925_0578941 | |||
| 3207 | Ga0395899_0015304 | |||
| 3208 | Ga0395899_0073306 | |||
| 3209 | Ga0395899_0682958 | |||
| 3210 | Ga0395900_0004973 | |||
| 3211 | Ga0395900_0017837 | |||
| 3212 | Ga0395900_0062746 | |||
| 3213 | Ga0395900_0087814 | |||
| 3214 | Ga0395900_0314044 | |||
| 3215 | Ga0395900_0406109 | |||
| 3216 | Ga0395900_0493215 | |||
| 3217 | Ga0395900_0608656 | |||
| 3218 | Ga0395900_1178691 | |||
| 3219 | Ga0395898_0040030 | |||
| 3220 | Ga0395898_0202453 | |||
| 3221 | Ga0395898_1669599 | |||
| 3222 | Ga0395905_0033547 | |||
| 3223 | Ga0395905_0407314 | |||
| 3224 | Ga0316581_0005837 | |||
| 3225 | Ga0316581_0067070 | |||
| 3226 | Ga0395901_0032242 | |||
| 3227 | Ga0395901_0104830 | |||
| 3228 | Ga0395901_0154352 | |||
| 3229 | Ga0400484_05024 | |||
| 3230 | Ga0400484_10160 | |||
| 3231 | Ga0400484_43085 | |||
| 3232 | Ga0400490_00409 | |||
| 3233 | Ga0400490_34188 | |||
| 3234 | Ga0400490_42931 | |||
| 3235 | Ga0400490_43036 | |||
| 3236 | Ga0400491_18134 | |||
| 3237 | Ga0400491_26290 | |||
| 3238 | Ga0400485_07089 | |||
| 3239 | Ga0400485_18810 | |||
| 3240 | Ga0400488_03145 | |||
| 3241 | Ga0400488_14284 | |||
| 3242 | Ga0400488_35681 | |||
| 3243 | Ga0400488_38081 | |||
| 3244 | Ga0400488_42106 | |||
| 3245 | Ga0400488_45799 | |||
| 3246 | Ga0400488_50773 | |||
| 3247 | Ga0400488_59901 | |||
| 3248 | Ga0400486_00736 | |||
| 3249 | Ga0400486_05533 | |||
| 3250 | Ga0400486_17198 | |||
| 3251 | Ga0400486_19297 | |||
| 3252 | Ga0400483_001519 | |||
| 3253 | Ga0400483_031408 | |||
| 3254 | Ga0400483_072960 | |||
| 3255 | Ga0400483_078562 | |||
| 3256 | Ga0400483_087044 | |||
| 3257 | Ga0400483_088943 | |||
| 3258 | Ga0400483_096157 | |||
| 3259 | Ga0400483_117917 | |||
| 3260 | Ga0400483_170536 | |||
| 3261 | Ga0400483_176269 | |||
| 3262 | Ga0400483_180135 | |||
| 3263 | Ga0400483_210780 | |||
| 3264 | Ga0400483_228091 | |||
| 3265 | Ga0400483_252383 | |||
| 3266 | Ga0400483_256324 | |||
| 3267 | Ga0400489_00591 | |||
| 3268 | Ga0400489_40355 | |||
| 3269 | Ga0400489_65224 | |||
| 3270 | Ga0400487_02857 | |||
| 3271 | Ga0400487_07641 | |||
| 3272 | Ga0400487_22307 | |||
| 3273 | Ga0400487_24442 | |||
| 3274 | Ga0400487_26069 | |||
| 3275 | Ga0400487_31982 | |||
| 3276 | Ga0400487_59236 | |||
| 3277 | Ga0400487_65155 | |||
| 3278 | Ga0436365_0965775 | |||
| 3279 | Ga0436360_1029640 | |||
| 3280 | Ga0436361_0560107 | |||
| 3281 | Ga0436361_0739768 | |||
| 3282 | Ga0439438_000380 | |||
| 3283 | Ga0439438_061571 | |||
| 3284 | Ga0451787_846636 | |||
| 3285 | Ga0451789_0637691 | |||
| 3286 | Ga0451793_0676117 | |||
| 3287 | Ga0451797_0959931 | |||
| 3288 | Ga0451800_1265253 | |||
| 3289 | Ga0451802_0524849 | |||
| 3290 | Ga0451802_1547169 | |||
| 3291 | Ga0451804_0586432 | |||
| 3292 | Ga0451807_0147918 | |||
| 3293 | Ga0451807_1389212 | |||
| 3294 | Ga0451807_1505127 | |||
| 3295 | Ga0451837_0130692 | |||
| 3296 | Ga0451843_1240565 | |||
| 3297 | Ga0451853_0325509 | |||
| 3298 | Ga0451853_0462214 | |||
| 3299 | Ga0451853_1180675 | |||
| 3300 | Ga0451853_3327388 | |||
| 3301 | Ga0439442_100762 | |||
| 3302 | Ga0439432_000045 | |||
| 3303 | Ga0439432_006137 | |||
| 3304 | Ga0439432_010116 | |||
| 3305 | Ga0439432_061984 | |||
| 3306 | Ga0439450_084743 | |||
| 3307 | Ga0439452_000022 | |||
| 3308 | Ga0439452_000031 | |||
| 3309 | Ga0439452_000052 | |||
| 3310 | Ga0439452_000185 | |||
| 3311 | Ga0439452_001436 | |||
| 3312 | Ga0439452_101540 | |||
| 3313 | Ga0450923_027568 | |||
| 3314 | Ga0450890_057670 | |||
| 3315 | Ga0450899_036526 | |||
| 3316 | Ga0450900_018344 | |||
| 3317 | Ga0450902_026772 | |||
| 3318 | Ga0450905_023878 | |||
| 3319 | Ga0439464_0096641 | |||
| 3320 | Ga0439464_0144060 | |||
| 3321 | Ga0451577_0011606 | |||
| 3322 | Ga0451577_0094281 | |||
| 3323 | Ga0451577_0462057 | |||
| 3324 | Ga0451577_0541409 | |||
| 3325 | Ga0451577_1424458 | |||
| 3326 | Ga0451577_2032600 | |||
| 3327 | Ga0439440_0093582 | |||
| 3328 | Ga0439440_0149460 | |||
| 3329 | Ga0466969_0134121 | |||
| 3330 | Ga0466972_0026077 | |||
| 3331 | Ga0466977_0000151 | |||
| 3332 | Ga0466981_0000003 | |||
| 3333 | Ga0466981_0000008 | |||
| 3334 | Ga0453683_0010800 | |||
| 3335 | Ga0466961_0012469 | |||
| 3336 | Ga0466961_0787082 | |||
| 3337 | Ga0453684_0000029 | |||
| 3338 | Ga0453684_0745521 | |||
| 3339 | Ga0453684_1008640 | |||
| 3340 | Ga0453684_1333549 | |||
| 3341 | Ga0466970_0780516 | |||
| 3342 | Ga0466957_1368104 | |||
| 3343 | Ga0466959_0038794 | |||
| 3344 | Ga0466959_0057703 | |||
| 3345 | Ga0451576_0000060 | |||
| 3346 | Ga0451576_0023459 | |||
| 3347 | Ga0451576_0025846 | |||
| 3348 | Ga0451576_0263152 | |||
| 3349 | Ga0451576_1270707 | |||
| 3350 | Ga0466958_0446809 | |||
| 3351 | Ga0466967_2496654 | |||
| 3352 | Ga0495627_000027 | |||
| 3353 | Ga0495627_023825 | |||
| 3354 | Ga0495592_0141065 | |||
| 3355 | Ga0495592_0143502 | |||
| 3356 | Ga0495603_0087342 | |||
| 3357 | Ga0495590_0006902 | |||
| 3358 | Ga0495591_000083 | |||
| 3359 | Ga0495591_000998 | |||
| 3360 | Ga0495591_016860 | |||
| 3361 | Ga0495629_0020593 | |||
| 3362 | Ga0495638_0001268 | |||
| 3363 | Ga0495638_0001518 | |||
| 3364 | Ga0495638_0018668 | |||
| 3365 | Ga0495638_0045381 | |||
| 3366 | Ga0495638_0228681 | |||
| 3367 | Ga0495641_0093236 | |||
| 3368 | Ga0495641_0436813 | |||
| 3369 | Ga0495641_0540684 | |||
| 3370 | Ga0495653_0002537 | |||
| 3371 | Ga0495653_0031052 | |||
| 3372 | Ga0495650_0000300 | |||
| 3373 | Ga0495580_0003545 | |||
| 3374 | Ga0495582_0002615 | |||
| 3375 | Ga0495605_0000901 | |||
| 3376 | Ga0495605_0051001 | |||
| 3377 | Ga0495664_0005042 | |||
| 3378 | Ga0495584_0021863 | |||
| 3379 | Ga0495584_0303296 | |||
| 3380 | Ga0495584_0396782 | |||
| 3381 | Ga0495585_0008886 | |||
| 3382 | Ga0495585_0129285 | |||
| 3383 | Ga0495585_0572959 | |||
| 3384 | Ga0495594_0165067 | |||
| 3385 | Ga0495596_0000058 | |||
| 3386 | Ga0495607_0003653 | |||
| 3387 | Ga0495607_0014151 | |||
| 3388 | Ga0495583_0031710 | |||
| 3389 | Ga0495606_0005069 | |||
| 3390 | Ga0495606_0629282 | |||
| 3391 | Ga0495608_0003661 | |||
| 3392 | Ga0495610_0000563 | |||
| 3393 | Ga0495616_0001404 | |||
| 3394 | Ga0495616_0013893 | |||
| 3395 | Ga0495616_0026195 | |||
| 3396 | Ga0495616_0168625 | |||
| 3397 | Ga0495618_0001116 | |||
| 3398 | Ga0495620_0001269 | |||
| 3399 | Ga0495630_0004287 | |||
| 3400 | Ga0495631_0498045 | |||
| 3401 | Ga0495632_0259751 | |||
| 3402 | Ga0495637_0086401 | |||
| 3403 | Ga0495643_0281962 | |||
| 3404 | Ga0495648_0036468 | |||
| 3405 | Ga0495648_0082650 | |||
| 3406 | Ga0495648_0317285 | |||
| 3407 | Ga0495666_0000165 | |||
| 3408 | Ga0495652_0053359 | |||
| 3409 | Ga0495652_0203738 | |||
| 3410 | Ga0495654_0002080 | |||
| 3411 | Ga0495654_0007484 | |||
| 3412 | Ga0495654_0020885 | |||
| 3413 | Ga0495654_0146065 | |||
| 3414 | Ga0495665_0007277 | |||
| 3415 | Ga0495640_0001348 | |||
| 3416 | Ga0495586_0003809 | |||
| 3417 | Ga0495587_0002694 | |||
| 3418 | Ga0495587_0415575 | |||
| 3419 | Ga0495609_0002064 | |||
| 3420 | Ga0495597_0001859 | |||
| 3421 | Ga0495645_0002675 | |||
| 3422 | Ga0495622_0000220 | |||
| 3423 | Ga0495622_0179303 | |||
| 3424 | Ga0495656_0709901 | |||
| 3425 | Ga0495668_0095818 | |||
| 3426 | Ga0495634_0000855 | |||
| 3427 | Ga0495611_0555521 | |||
| 3428 | Ga0495625_0017002 | |||
| 3429 | Ga0495625_0026459 | |||
| 3430 | Ga0495625_0085518 | |||
| 3431 | Ga0495625_0279732 | |||
| 3432 | Ga0495625_0401630 | |||
| 3433 | Ga0495635_0029481 | |||
| 3434 | Ga0495635_0647210 | |||
| 3435 | Ga0495659_0432541 | |||
| 3436 | Ga0495661_0000095 | |||
| 3437 | Ga0495661_0007158 | |||
| 3438 | Ga0495661_0053608 | |||
| 3439 | Ga0495661_0159907 | |||
| 3440 | Ga0495588_0077975 | |||
| 3441 | Ga0495599_0007872 | |||
| 3442 | Ga0495599_0086600 | |||
| 3443 | Ga0495599_0393464 | |||
| 3444 | Ga0495599_0764400 | |||
| 3445 | Ga0495623_0005692 | |||
| 3446 | Ga0495646_0007023 | |||
| 3447 | Ga0495646_0116857 | |||
| 3448 | Ga0495647_0478634 | |||
| 3449 | Ga0495669_0554361 | |||
| 3450 | Ga0495669_0574234 | |||
| 3451 | Ga0495613_0001821 | |||
| 3452 | Ga0495613_0197723 | |||
| 3453 | Ga0495624_0007673 | |||
| 3454 | Ga0495624_0706071 | |||
| 3455 | Ga0495670_0044916 | |||
| 3456 | Ga0495671_0000878 | |||
| 3457 | Ga0495671_0263368 | |||
| 3458 | Ga0495671_0275790 | |||
| 3459 | Ga0495649_0000947 | |||
| 3460 | Ga0495649_0002065 | |||
| 3461 | Ga0495649_0015533 | |||
| 3462 | Ga0495649_0022383 | |||
| 3463 | Ga0495649_0068923 | |||
| 3464 | Ga0495649_0143318 | |||
| 3465 | Ga0495649_0151881 | |||
| 3466 | Ga0495589_0000001 | |||
| 3467 | Ga0495660_0275851 | |||
| 3468 | Ga0495581_0005536 | |||
| 3469 | Ga0495604_0004579 | |||
| 3470 | Ga0495636_0206493 | |||
| 3471 | Ga0495674_0018957 | |||
| 3472 | Ga0495672_0000204 | |||
| 3473 | Ga0495672_0022544 | |||
| 3474 | Ga0495676_0001816 | |||
| 3475 | Ga0495676_0019609 | |||
| 3476 | Ga0495680_0003907 | |||
| 3477 | Ga0495680_0200219 | |||
| 3478 | Ga0495680_0291780 | |||
| 3479 | Ga0495680_0979118 | |||
| 3480 | Ga0495683_0000089 | |||
| 3481 | Ga0495683_0392255 | |||
| 3482 | Ga0495675_0017805 | |||
| 3483 | Ga0495679_000052 | |||
| 3484 | Ga0495679_001064 | |||
| 3485 | Ga0495679_007896 | |||
| 3486 | Ga0495679_080691 | |||
| 3487 | Ga0495685_213749 | |||
| 3488 | Ga0495673_0000007 | |||
| 3489 | Ga0495673_0295812 | |||
| 3490 | Ga0495681_0059079 | |||
| 3491 | Ga0495684_0047087 | |||
| 3492 | Ga0495686_0458815 | |||
| 3493 | Ga0495593_0012504 | |||
| 3494 | Ga0495602_0004785 | |||
| 3495 | Ga0495602_0034813 | |||
| 3496 | Ga0495614_0006132 | |||
| 3497 | Ga0495626_0068504 | |||
| 3498 | Ga0496100_0514283 | |||
| 3499 | Ga0496100_1195924 | |||
| 3500 | Ga0496101_0008211 | |||
| 3501 | Ga0496101_0336456 | |||
| 3502 | Ga0496102_0878019 | |||
| 3503 | Ga0496102_1270923 | |||
| 3504 | Ga0496104_0000187 | |||
| 3505 | Ga0496104_0151923 | |||
| 3506 | Ga0496104_0410133 | |||
| 3507 | Ga0496104_1064425 | |||
| 3508 | Ga0496105_0015135 | |||
| 3509 | Ga0496105_0156388 | |||
| 3510 | Ga0496105_0164947 | |||
| 3511 | Ga0496105_1239443 | |||
| 3512 | Ga0496106_0512695 | |||
| 3513 | Ga0496107_0411574 | |||
| 3514 | Ga0496107_0548398 | |||
| 3515 | Ga0496108_0131761 | |||
| 3516 | Ga0496108_0522518 | |||
| 3517 | Ga0496109_0240926 | |||
| 3518 | Ga0496109_1777394 | |||
| 3519 | Ga0496110_0130442 | |||
| 3520 | Ga0496110_0692012 | |||
| 3521 | Ga0496110_1228651 | |||
| 3522 | Ga0496111_0368765 | |||
| 3523 | Ga0496112_0043105 | |||
| 3524 | Ga0496112_0112780 | |||
| 3525 | Ga0496114_0000303 | |||
| 3526 | Ga0496114_0014654 | |||
| 3527 | Ga0496114_0024350 | |||
| 3528 | Ga0496114_0440519 | |||
| 3529 | Ga0496114_1187481 | |||
| 3530 | Ga0496115_0174592 | |||
| 3531 | Ga0496115_0378968 | |||
| 3532 | Ga0496115_0927972 | |||
| 3533 | Ga0496116_0000001 | |||
| 3534 | Ga0496116_0000259 | |||
| 3535 | Ga0496116_0000261 | |||
| 3536 | Ga0496116_0000431 | |||
| 3537 | Ga0496116_0001765 | |||
| 3538 | Ga0496116_0002090 | |||
| 3539 | Ga0496116_0014384 | |||
| 3540 | Ga0496116_0038209 | |||
| 3541 | Ga0496116_0049568 | |||
| 3542 | Ga0496116_0081517 | |||
| 3543 | Ga0496116_0095137 | |||
| 3544 | Ga0496116_0120430 | |||
| 3545 | Ga0496116_0132944 | |||
| 3546 | Ga0496116_0139340 | |||
| 3547 | Ga0496116_0150216 | |||
| 3548 | Ga0496117_0000088 | |||
| 3549 | Ga0496117_0000213 | |||
| 3550 | Ga0496117_0000692 | |||
| 3551 | Ga0496117_0000775 | |||
| 3552 | Ga0496117_0013550 | |||
| 3553 | Ga0496117_0014719 | |||
| 3554 | Ga0496117_0022682 | |||
| 3555 | Ga0496117_0036301 | |||
| 3556 | Ga0496117_0069195 | |||
| 3557 | Ga0496117_0070590 | |||
| 3558 | Ga0496118_0000137 | |||
| 3559 | Ga0496118_0003151 | |||
| 3560 | Ga0496118_0004717 | |||
| 3561 | Ga0496118_0025556 | |||
| 3562 | Ga0496118_0029767 | |||
| 3563 | Ga0496118_0031473 | |||
| 3564 | Ga0496118_0069757 | |||
| 3565 | Ga0496118_0073596 | |||
| 3566 | Ga0496118_0369956 | |||
| 3567 | Ga0496119_0000001 | |||
| 3568 | Ga0496119_0000677 | |||
| 3569 | Ga0496119_0022421 | |||
| 3570 | Ga0496119_0029153 | |||
| 3571 | Ga0496119_0030587 | |||
| 3572 | Ga0496119_0055251 | |||
| 3573 | Ga0496119_0058376 | |||
| 3574 | Ga0496120_0000035 | |||
| 3575 | Ga0496120_0011345 | |||
| 3576 | Ga0496120_0014936 | |||
| 3577 | Ga0496120_0022355 | |||
| 3578 | Ga0496120_0024300 | |||
| 3579 | Ga0496120_0041853 | |||
| 3580 | Ga0496120_0102367 | |||
| 3581 | Ga0496120_0324295 | |||
| 3582 | Ga0496121_0000124 | |||
| 3583 | Ga0496121_0000565 | |||
| 3584 | Ga0496121_0002427 | |||
| 3585 | Ga0496121_0002678 | |||
| 3586 | Ga0496121_0005298 | |||
| 3587 | Ga0496121_0009939 | |||
| 3588 | Ga0496121_0016780 | |||
| 3589 | Ga0496121_0030937 | |||
| 3590 | Ga0496121_0038197 | |||
| 3591 | Ga0496121_0054881 | |||
| 3592 | Ga0496121_0094555 | |||
| 3593 | Ga0496121_0175622 | |||
| 3594 | Ga0496121_0188624 | |||
| 3595 | Ga0496121_0449869 | |||
| 3596 | Ga0496122_0000003 | |||
| 3597 | Ga0496122_0000033 | |||
| 3598 | Ga0496122_0000130 | |||
| 3599 | Ga0496122_0000556 | |||
| 3600 | Ga0496122_0000908 | |||
| 3601 | Ga0496122_0002291 | |||
| 3602 | Ga0496122_0004489 | |||
| 3603 | Ga0496122_0010973 | |||
| 3604 | Ga0496122_0017009 | |||
| 3605 | Ga0496122_0067397 | |||
| 3606 | Ga0496122_0091745 | |||
| 3607 | Ga0496122_0198803 | |||
| 3608 | Ga0496122_0332487 | |||
| 3609 | Ga0496123_0000047 | |||
| 3610 | Ga0496123_0000064 | |||
| 3611 | Ga0496123_0000248 | |||
| 3612 | Ga0496123_0000412 | |||
| 3613 | Ga0496123_0000827 | |||
| 3614 | Ga0496123_0001688 | |||
| 3615 | Ga0496123_0003088 | |||
| 3616 | Ga0496123_0003448 | |||
| 3617 | Ga0496123_0010153 | |||
| 3618 | Ga0496123_0013548 | |||
| 3619 | Ga0496123_0078525 | |||
| 3620 | Ga0496123_0078527 | |||
| 3621 | Ga0496123_0144193 | |||
| 3622 | Ga0496123_0283379 | |||
| 3623 | Ga0496123_0452602 | |||
| 3624 | Ga0496124_0000004 | |||
| 3625 | Ga0496124_0000520 | |||
| 3626 | Ga0496124_0000787 | |||
| 3627 | Ga0496124_0003227 | |||
| 3628 | Ga0496124_0004158 | |||
| 3629 | Ga0496124_0019126 | |||
| 3630 | Ga0496124_0023793 | |||
| 3631 | Ga0496124_0027226 | |||
| 3632 | Ga0496124_0052665 | |||
| 3633 | Ga0496124_0059890 | |||
| 3634 | Ga0496124_0085047 | |||
| 3635 | Ga0496124_0106994 | |||
| 3636 | Ga0496124_0324812 | |||
| 3637 | Ga0496125_0000065 | |||
| 3638 | Ga0496125_0000527 | |||
| 3639 | Ga0496125_0003418 | |||
| 3640 | Ga0496125_0003564 | |||
| 3641 | Ga0496125_0003754 | |||
| 3642 | Ga0496125_0057096 | |||
| 3643 | Ga0496125_0084677 | |||
| 3644 | Ga0496125_0097344 | |||
| 3645 | Ga0496125_0138861 | |||
| 3646 | Ga0496125_0177891 | |||
| 3647 | Ga0496126_0000841 | |||
| 3648 | Ga0496126_0000960 | |||
| 3649 | Ga0496126_0002568 | |||
| 3650 | Ga0496126_0007255 | |||
| 3651 | Ga0496126_0011250 | |||
| 3652 | Ga0496126_0048382 | |||
| 3653 | Ga0496126_0080195 | |||
| 3654 | Ga0496126_0088145 | |||
| 3655 | Ga0496126_0088277 | |||
| 3656 | Ga0496126_0266211 | |||
| 3657 | Ga0496126_0342424 | |||
| 3658 | Ga0496126_0355785 | |||
| 3659 | Ga0496126_0642362 | |||
| 3660 | Ga0496126_0682605 | |||
| 3661 | Ga0495678_012399 | |||
| 3662 | Ga0495678_135436 | |||
| 3663 | Ga0501031_0002035 | |||
| 3664 | Ga0501031_0006803 | |||
| 3665 | Ga0501031_0361835 | |||
| 3666 | Ga0501031_0917656 | |||
| 3667 | Ga0501032_0000544 | |||
| 3668 | Ga0501032_0015477 | |||
| 3669 | Ga0501032_0029516 | |||
| 3670 | Ga0501032_0086692 | |||
| 3671 | Ga0501033_0000453 | |||
| 3672 | Ga0501033_0002266 | |||
| 3673 | Ga0501033_0003651 | |||
| 3674 | Ga0501033_0010735 | |||
| 3675 | Ga0501033_0042922 | |||
| 3676 | Ga0501033_0187675 | |||
| 3677 | Ga0501034_0000106 | |||
| 3678 | Ga0501034_0006930 | |||
| 3679 | Ga0501034_0085778 | |||
| 3680 | Ga0501034_0147928 | |||
| 3681 | Ga0501034_0158103 | |||
| 3682 | Ga0501034_0195111 | |||
| 3683 | Ga0501034_0203589 | |||
| 3684 | Ga0501034_0241590 | |||
| 3685 | Ga0501034_0626057 | |||
| 3686 | Ga0501034_1132247 | |||
| 3687 | Ga0501036_0004516 | |||
| 3688 | Ga0501036_0027523 | |||
| 3689 | Ga0501036_0034801 | |||
| 3690 | Ga0501036_0070509 | |||
| 3691 | Ga0501036_0774701 | |||
| 3692 | Ga0501036_1078024 | |||
| 3693 | Ga0501036_1250004 | |||
| 3694 | Ga0501036_1253513 | |||
| 3695 | Ga0501037_0020086 | |||
| 3696 | Ga0501037_0023039 | |||
| 3697 | Ga0501037_0028095 | |||
| 3698 | Ga0501037_0123564 | |||
| 3699 | Ga0501037_0145203 | |||
| 3700 | Ga0501037_0211879 | |||
| 3701 | Ga0501037_0246353 | |||
| 3702 | Ga0501037_0856613 | |||
| 3703 | Ga0501038_0003152 | |||
| 3704 | Ga0501038_0004970 | |||
| 3705 | Ga0501038_0023378 | |||
| 3706 | Ga0501038_0048140 | |||
| 3707 | Ga0501038_0071477 | |||
| 3708 | Ga0501038_0231891 | |||
| 3709 | Ga0501038_0306666 | |||
| 3710 | Ga0501038_0929458 | |||
| 3711 | Ga0501039_0066148 | |||
| 3712 | Ga0501039_0309346 | |||
| 3713 | Ga0501039_0349478 | |||
| 3714 | Ga0501039_0523731 | |||
| 3715 | Ga0501039_0942338 | |||
| 3716 | Ga0501039_0981543 | |||
| 3717 | Ga0501040_0000770 | |||
| 3718 | Ga0501042_0069563 | |||
| 3719 | Ga0501042_0079136 | |||
| 3720 | Ga0501042_0181334 | |||
| 3721 | Ga0501042_0584424 | |||
| 3722 | Ga0501043_0040439 | |||
| 3723 | Ga0501043_0056051 | |||
| 3724 | Ga0501043_0072241 | |||
| 3725 | Ga0501043_0126725 | |||
| 3726 | Ga0501043_0160048 | |||
| 3727 | Ga0501043_0295561 | |||
| 3728 | Ga0501043_0335092 | |||
| 3729 | Ga0501043_0377646 | |||
| 3730 | Ga0501043_1006878 | |||
| 3731 | Ga0501043_1036889 | |||
| 3732 | Ga0501043_1185237 | |||
| 3733 | Ga0501046_0001235 | |||
| 3734 | Ga0501046_0032971 | |||
| 3735 | Ga0501046_0134734 | |||
| 3736 | Ga0501046_0459726 | |||
| 3737 | Ga0501046_0611976 | |||
| 3738 | Ga0501047_0002002 | |||
| 3739 | Ga0501047_0005122 | |||
| 3740 | Ga0501047_0021281 | |||
| 3741 | Ga0501047_0028905 | |||
| 3742 | Ga0501047_0102634 | |||
| 3743 | Ga0501047_0104936 | |||
| 3744 | Ga0501047_0233220 | |||
| 3745 | Ga0501047_0356841 | |||
| 3746 | Ga0501047_0833483 | |||
| 3747 | Ga0501047_1262359 | |||
| 3748 | Ga0501048_0172024 | |||
| 3749 | Ga0501048_0184065 | |||
| 3750 | Ga0501048_0599752 | |||
| 3751 | Ga0501048_1053711 | |||
| 3752 | Ga0501067_0018564 | |||
| 3753 | Ga0501067_0048459 | |||
| 3754 | Ga0501067_0252026 | |||
| 3755 | Ga0501068_0003440 | |||
| 3756 | Ga0501068_0094066 | |||
| 3757 | Ga0501068_0120578 | |||
| 3758 | Ga0501068_0226524 | |||
| 3759 | Ga0501069_0052553 | |||
| 3760 | Ga0501069_0724070 | |||
| 3761 | Ga0501070_0023465 | |||
| 3762 | Ga0501070_0025728 | |||
| 3763 | Ga0501070_0053387 | |||
| 3764 | Ga0501070_0081412 | |||
| 3765 | Ga0501070_0330839 | |||
| 3766 | Ga0501071_0022501 | |||
| 3767 | Ga0501071_0365020 | |||
| 3768 | Ga0501072_0138011 | |||
| 3769 | Ga0501073_0012284 | |||
| 3770 | Ga0501073_0043433 | |||
| 3771 | Ga0501073_0142579 | |||
| 3772 | Ga0501073_0324499 | |||
| 3773 | Ga0501073_0647350 | |||
| 3774 | Ga0501074_0001837 | |||
| 3775 | Ga0501074_0088925 | |||
| 3776 | Ga0501074_0376595 | |||
| 3777 | Ga0501074_0514980 | |||
| 3778 | Ga0501074_0610795 | |||
| 3779 | Ga0501076_0244771 | |||
| 3780 | Ga0501076_1177967 | |||
| 3781 | Ga0501077_0028566 | |||
| 3782 | Ga0501077_0066789 | |||
| 3783 | Ga0501202_124753 | |||
| 3784 | Ga0501257_017094 | |||
| 3785 | Ga0501079_0021645 | |||
| 3786 | Ga0501079_0291778 | |||
| 3787 | Ga0501079_0667098 | |||
| 3788 | Ga0501079_0669475 | |||
| 3789 | Ga0501080_0005664 | |||
| 3790 | Ga0501080_0013573 | |||
| 3791 | Ga0501080_0033071 | |||
| 3792 | Ga0501080_0054773 | |||
| 3793 | Ga0501080_0058218 | |||
| 3794 | Ga0501080_0142694 | |||
| 3795 | Ga0501080_0272099 | |||
| 3796 | Ga0501080_0548819 | |||
| 3797 | Ga0501080_0703232 | |||
| 3798 | Ga0501080_1484700 | |||
| 3799 | Ga0501081_0351274 | |||
| 3800 | Ga0501083_0175015 | |||
| 3801 | Ga0501083_0308872 | |||
| 3802 | Ga0501083_0722756 | |||
| 3803 | Ga0501035_0004983 | |||
| 3804 | Ga0501035_0007405 | |||
| 3805 | Ga0501035_0017658 | |||
| 3806 | Ga0501035_0025130 | |||
| 3807 | Ga0501035_0039689 | |||
| 3808 | Ga0501035_0121293 | |||
| 3809 | Ga0501035_0125955 | |||
| 3810 | Ga0501035_0187171 | |||
| 3811 | Ga0501035_0350768 | |||
| 3812 | Ga0501035_0424393 | |||
| 3813 | Ga0501035_0519323 | |||
| 3814 | Ga0501035_1080734 | |||
| 3815 | Ga0501035_1119168 | |||
| 3816 | Ga0501044_0000126 | |||
| 3817 | Ga0501044_0001523 | |||
| 3818 | Ga0501044_0004461 | |||
| 3819 | Ga0501044_0041467 | |||
| 3820 | Ga0501044_0051948 | |||
| 3821 | Ga0501044_0081780 | |||
| 3822 | Ga0501044_0092712 | |||
| 3823 | Ga0501044_0158308 | |||
| 3824 | Ga0501044_0186457 | |||
| 3825 | Ga0501044_0392449 | |||
| 3826 | Ga0501044_1105235 | |||
| 3827 | Ga0501044_1118934 | |||
| 3828 | Ga0501044_1142234 | |||
| 3829 | Ga0501044_1585876 | |||
| 3830 | Ga0501045_1212343 | |||
| 3831 | nmdc:mga00v17_11240_c1 | |||
| 3832 | nmdc:mga00v17_131965_c1 | |||
| 3833 | nmdc:mga00v17_16716_c1 | |||
| 3834 | nmdc:mga00v17_379124_c1 | |||
| 3835 | nmdc:mga00v17_611264_c1 | |||
| 3836 | nmdc:mga00v17_7469_c1 | |||
| 3837 | nmdc:mga00v17_9919_c2 | |||
| 3838 | nmdc:mga0k408_8016_c1 | |||
| 3839 | nmdc:mga05p37_32471_c1 | |||
| 3840 | nmdc:mga09592_1131099_c1 | |||
| 3841 | nmdc:mga09592_35368_c1 | |||
| 3842 | nmdc:mga0qj67_114559_c1 | |||
| 3843 | nmdc:mga0qj67_163349_c1 | |||
| 3844 | nmdc:mga0qj67_315911_c1 | |||
| 3845 | nmdc:mga0qj67_487999_c1 | |||
| 3846 | nmdc:mga0qj67_899196_c1 | |||
| 3847 | nmdc:mga06r32_1469572_c1 | |||
| 3848 | nmdc:mga06r32_556726_c1 | |||
| 3849 | nmdc:mga06r32_570650_c1 | |||
| 3850 | nmdc:mga06r32_5777_c1 | |||
| 3851 | nmdc:mga06r32_89541_c1 | |||
| 3852 | nmdc:mga08y16_1194404_c1 | |||
| 3853 | nmdc:mga08y16_165761_c1 | |||
| 3854 | nmdc:mga08y16_20769_c1 | |||
| 3855 | nmdc:mga08y16_381664_c1 | |||
| 3856 | nmdc:mga08y16_44730_c1 | |||
| 3857 | nmdc:mga08y16_54486_c1 | |||
| 3858 | nmdc:mga08y16_545911_c1 | |||
| 3859 | nmdc:mga08y16_95174_c1 | |||
| 3860 | nmdc:mga0n895_1069229_c1 | |||
| 3861 | nmdc:mga0n895_289109_c1 | |||
| 3862 | nmdc:mga08x19_615834_c1 | |||
| 3863 | nmdc:mga0a205_1103145_c1 | |||
| 3864 | nmdc:mga0a205_452118_c1 | |||
| 3865 | Ga0500635_0031243 | |||
| 3866 | Ga0500644_0006369 | |||
| 3867 | Ga0500583_0268626 | |||
| 3868 | Ga0500651_0433400 | |||
| 3869 | Ga0500651_0592226 | |||
| 3870 | Ga0500641_0128889 | |||
| 3871 | Ga0500556_0010020 | |||
| 3872 | Ga0500617_033737 | |||
| 3873 | Ga0500618_003225 | |||
| 3874 | Ga0500628_177948 | |||
| 3875 | Ga0500642_0179487 | |||
| 3876 | Ga0500642_0271213 | |||
| 3877 | Ga0500658_0013889 | |||
| 3878 | Ga0500568_0001745 | |||
| 3879 | Ga0500568_0163233 | |||
| 3880 | Ga0500586_153810 | |||
| 3881 | Ga0500588_0002927 | |||
| 3882 | Ga0500588_0102195 | |||
| 3883 | Ga0500589_350390 | |||
| 3884 | Ga0500616_0055558 | |||
| 3885 | Ga0500611_184095 | |||
| 3886 | Ga0501084_0003303 | |||
| 3887 | Ga0501084_0037327 | |||
| 3888 | Ga0501084_1234202 | |||
| 3889 | Ga0501082_0001202 | |||
| 3890 | Ga0501082_0647886 | |||
| 3891 | Ga0530510_0514245 | |||
| 3892 | Ga0530510_1360959 | |||
| 3893 | 2513953587 | |||
| 3894 | 2514044283 | |||
| 3895 | 2526213797 | |||
| 3896 | 2599906998 | |||
| 3897 | 2643863202 | |||
| 3898 | 2643978608 | |||
| 3899 | 2644121730 | |||
| 3900 | 2671101388 | |||
| 3901 | 2739613417 | |||
| 3902 | 2808927135 | |||
| 3903 | 2808949254 | |||
| 3904 | 2809036635 | |||
| 3905 | 2842750943 | |||
| 3906 | 2852107463 | |||
| 3907 | 2855731429 | |||
| 3908 | 2855768135 | |||
| 3909 | 2857542729 | |||
| 3910 | 2857545876 | |||
| 3911 | 2858691198 | |||
| 3912 | 2858954789 | |||
| 3913 | 2881413696 | |||
| 3914 | 2901305592 | |||
| 3915 | 2941481051 | |||
| 3916 | 644750416 | |||
| 3917 | 8002393569 | |||
| 3918 | 8048748088 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6s3r-assembly1.cif.gz_G | structure of the flipqr complex from the flagellar type 3 secretion system of pseudomonas savastanoi. | 0.9441 | 1 | 89 |
| 6s3s-assembly1.cif.gz_J | structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. | 0.9389 | 1 | 89 |
| 8axk-assembly1.cif.gz_G | type 3 secretion system export apparatus core, inner rod and needle of shigella flexneri | 0.9364 | 5 | 85 |
| 6s3s-assembly1.cif.gz_H | structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. | 0.934 | 1 | 89 |
| 7bin-assembly1.cif.gz_G | salmonella export gate and rod refined in focussed c1 map | 0.9325 | 1 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q96A46_204_362_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.6675 | 9 | 78 | 1.50.40.10 |
| af_Q7T292_208_372_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.631 | 9 | 83 | 1.50.40.10 |
| af_O94370_10_276_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.6228 | 16 | 63 | 1.50.40.10 |
| af_A0A0R0J393_2_271_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.6123 | 14 | 72 | 1.50.40.10 |
| af_Q9VJA5_252_399_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.5875 | 9 | 78 | 1.50.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538ENN5-F1-model_v4 | Flagellar biosynthetic protein FliQ | 0.9961 | 1 | 79 |
GO:0005886
GO:0009306 GO:0009425 GO:0044780 |
| AF-A0A2I1DN03-F1-model_v4 | Flagellar biosynthetic protein FliQ | 0.9957 | 1 | 88 |
GO:0005886
GO:0009306 GO:0009425 GO:0044780 |
| AF-A0A5J6SX28-F1-model_v4 | deleted | 0.9957 | 1 | 89 |
|
| AF-A0A7V6Q0U3-F1-model_v4 | Flagellar biosynthetic protein FliQ | 0.9956 | 1 | 89 |
GO:0005886
GO:0009306 GO:0009425 GO:0044780 |
| AF-D5XFF7-F1-model_v4 | Flagellar biosynthetic protein FliQ | 0.995 | 1 | 89 |
GO:0005886
GO:0009306 GO:0009425 GO:0044780 |