F496110

General Info

Members Datasets Scaffolds Average Seq Length
1940 716 1870 266

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10000482|Ga0213872_1000048213
Length 298
Sequence MCRPQQVWHWNFPSLHRKDIAMSTPQTSAVTNTNGRLQGKVAIVTGAGCVGPGWGNGRAVAVLFAQAGATIFAVDKNAEAMEETIRRVREVGGTISAHTCDVTDSTSVAEMVAACEAQYGRVDILVNNVGGSAAGGPVALAEEKWDAQVDFNLKSVYLTCKHVLPVMEKQGKGAIVNTASTSGIRWTGSAQVAYAACKAGVIQLSRVVAVEYAKKGIRVNTVVPGQLHTPMVEVRLAGQRSGGDVDKLLESRVARIPLGFMGDGRDTANAALFLASDEAQFVTGTEIIVDGGMTARCD

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
4 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
5 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
11 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
12 2643221556 Massilia sp. Root1485 Isolate Unclassified
13 2643221684 Massilia sp. Root133 Isolate Unclassified
14 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
15 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
16 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
17 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
18 2773857670 Pseudomonas sp. 478 Isolate Unclassified
19 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
20 2784132072 Pseudomonas sp. 460 Isolate Unclassified
21 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
22 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
23 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
24 2818991446 Variovorax sp. 1180 Isolate Unclassified
25 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
26 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
27 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
28 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
29 2855730933 Achromobacter sp. HZ28 Isolate Nodule
30 2855767633 Achromobacter sp. HZ34 Isolate Nodule
31 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
32 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
33 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
34 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
35 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
36 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
37 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
38 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
39 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
40 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
41 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
42 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
43 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
44 2904456579 Variovorax sp. 2002 Isolate Unclassified
45 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
46 2928037797 Variovorax sp. 1126 Isolate Unclassified
47 2928044640 Variovorax sp. 1128 Isolate Unclassified
48 2928058823 Ralstonia sp. 1138 Isolate Unclassified
49 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
50 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
51 2929520902 Variovorax beijingensis 502 Isolate Unclassified
52 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
53 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
54 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
55 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
56 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
57 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
58 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
59 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
60 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
61 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
62 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
63 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
64 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
65 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
66 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
67 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
68 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
69 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
70 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
71 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
72 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
73 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
74 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
75 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
76 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
77 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
78 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
79 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
80 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
81 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
82 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
84 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
85 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
86 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
87 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
89 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
90 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
91 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
92 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
93 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
94 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
95 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
96 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
97 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
98 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
99 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
100 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
101 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
102 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
103 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
104 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
105 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
106 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
107 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
108 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
109 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
110 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
111 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
112 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
113 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
114 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
115 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
116 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
117 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
118 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
119 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
120 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
121 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
122 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
123 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
124 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
125 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
126 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
127 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
128 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
129 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
130 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
131 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
132 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
133 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
134 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
135 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
136 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
137 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
138 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
139 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
140 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
141 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
142 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
143 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
144 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
145 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
146 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
147 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
148 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
149 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
150 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
151 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
152 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
153 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
154 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
155 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
156 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
157 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
158 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
159 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
160 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
161 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
162 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
163 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
164 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
165 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
166 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
167 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
168 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
169 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
170 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
171 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
172 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
173 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
174 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
175 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
176 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
177 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
178 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
179 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
180 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
181 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
182 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
183 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
184 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
185 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
186 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
187 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
188 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
189 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
190 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
191 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
192 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
193 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
194 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
195 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
196 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
197 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
198 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
199 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
200 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
201 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
202 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
203 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
204 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
205 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
206 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
207 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
208 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
209 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
210 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
211 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
212 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
213 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
214 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
215 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
216 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
217 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
218 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
219 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
220 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
221 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
222 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
223 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
224 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
225 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
226 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
227 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
228 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
229 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
230 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
231 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
232 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
233 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
234 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
235 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
236 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
237 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
238 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
239 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
240 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
241 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
242 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
243 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
244 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
245 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
246 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
247 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
248 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
249 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
250 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
251 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
252 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
254 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
255 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
256 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
257 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
265 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
266 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
269 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
270 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
273 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
274 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
275 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
276 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
278 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
280 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
282 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
283 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
356 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
357 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
358 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
359 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
361 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
362 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
363 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
365 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
366 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
368 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
369 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
370 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
374 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
375 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
376 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
377 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
378 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
379 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
380 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
381 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
382 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
383 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
384 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
386 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
387 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
388 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
389 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
390 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
391 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
392 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
393 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
394 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
395 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
396 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
397 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
398 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
399 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
400 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
401 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
402 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
403 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
404 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
405 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
406 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
407 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
408 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
409 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
410 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
411 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
412 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
413 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
414 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
415 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
416 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
417 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
418 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
419 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
420 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
421 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
422 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
423 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
424 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
425 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
426 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
427 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
428 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
429 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
430 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
431 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
432 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
433 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
434 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
435 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
436 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
437 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
438 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
439 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
440 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
441 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
442 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
443 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
444 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
445 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
446 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
447 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
448 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
449 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
450 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
451 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
452 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
453 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
454 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
455 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
456 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
457 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
458 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
459 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
460 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
461 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
462 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
463 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
464 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
465 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
466 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
467 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
468 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
469 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
470 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
471 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
472 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
473 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
474 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
475 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
476 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
477 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
478 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
479 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
480 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
481 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
482 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
483 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
484 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
485 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
486 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
487 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
488 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
489 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
490 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
491 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
492 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
493 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
494 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
495 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
496 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
497 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
498 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
499 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
500 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
501 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
502 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
503 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
504 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
505 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
506 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
507 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
508 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
509 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
510 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
511 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
512 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
513 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
514 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
515 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
516 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
517 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
518 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
519 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
520 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
521 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
522 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
523 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
524 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
525 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
526 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
527 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
528 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
529 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
530 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
531 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
532 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
533 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
534 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
535 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
536 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
537 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
538 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
539 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
540 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
541 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
542 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
543 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
544 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
545 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
546 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
547 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
548 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
549 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
550 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
551 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
552 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
553 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
554 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
555 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
556 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
557 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
558 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
559 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
560 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
561 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
562 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
563 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
564 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
565 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
566 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
567 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
568 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
569 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
570 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
571 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
572 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
573 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
574 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
575 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
576 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
577 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
578 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
579 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
580 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
581 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
582 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
583 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
584 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
585 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
586 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
587 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
588 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
589 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
590 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
591 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
592 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
593 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
594 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
595 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
596 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
597 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
598 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
599 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
600 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
601 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
602 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
603 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
604 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
605 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
606 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
607 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
608 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
609 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
610 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
611 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
612 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
613 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
614 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
615 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
616 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
617 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
618 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
619 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
620 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
621 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
622 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
623 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
624 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
625 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
626 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
627 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
628 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
629 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
630 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
631 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
632 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
633 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
634 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
635 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
636 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
637 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
638 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
639 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
640 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
641 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
642 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
643 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
644 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
645 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
646 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
647 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
648 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
649 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
650 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
651 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
652 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
653 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
654 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
655 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
656 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
657 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
658 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
659 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
660 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
661 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
662 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
663 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
664 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
665 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
666 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
667 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
668 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
669 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
670 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
671 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
672 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
673 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
674 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
675 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
676 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
677 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
678 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
679 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
680 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
681 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
682 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
683 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
684 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
685 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
686 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
687 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
688 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
689 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
690 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
691 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
692 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
693 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
694 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
695 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
696 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
697 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
698 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
699 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
700 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
701 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
702 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
703 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
704 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
705 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
706 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
707 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
708 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
709 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
710 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
711 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
712 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
713 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
714 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
715 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
716 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.13
Metatranscriptomes 0.26
Isolates 3.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.34
Nodule 0.67
Rhizoplane 5.67
Rhizosphere 76.8
Stem 0
Stem Tuber 0.05
Unclassified 5.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilYngRDRAFT_c00576 3300000042 Bacteria 3981
2 ARcpr5yngRDRAFT_c001137 3300000043 Bacteria 2997
3 ARSoilOldRDRAFT_c000653 3300000044 Bacteria 3670
4 ARCol0oldRDRAFT_c00755 3300000045 Bacteria 2730
5 ARCol0yngRDRAFT_1001991 3300000652 Bacteria 1581
6 JGI24032J14994_100465 3300001430 Bacteria 2116
7 JGI24740J21852_10002833 3300001979 Bacteria 7750
8 JGI24740J21852_10044403 3300001979 Bacteria 1319
9 JGI24739J22299_10002387 3300001989 Bacteria 7244
10 JGI24739J22299_10007118 3300001989 Bacteria 4210
11 JGI24743J22301_10006200 3300001991 Bacteria 2028
12 JGI24738J21930_10000453 3300002075 Bacteria 11626
13 JGI24749J21850_1001528 3300002076 Bacteria 3275
14 JGI24744J21845_10003861 3300002077 Bacteria 3097
15 JGI24035J26624_1000356 3300002126 Bacteria 4312
16 JGI24742J22300_10000709 3300002244 Bacteria 5049
17 JGI25156J39149_1001517 3300002705 Bacteria 9640
18 JGI25154J39366_1000333 3300002738 Bacteria 27260
19 JGI25151J46595_10018445 3300003187 Bacteria 2995
20 JGI25406J46586_10005393 3300003203 Bacteria 5933
21 JGI25153J46596_10000151 3300003215 Bacteria 70139
22 JGI25153J46596_10002286 3300003215 Bacteria 11161
23 JGI25153J46596_10055377 3300003215 Bacteria 1110
24 rootH2_10182889 3300003320 Bacteria 2136
25 rootH1_10000649 3300003323 Bacteria 26896
26 JGI25160J50197_1000163 3300003354 Bacteria 57578
27 JGI25404J52841_10000106 3300003659 Bacteria 8317
28 Ga0055538_1001362 3300003751 Bacteria 4807
29 Ga0055538_1001370 3300003751 Bacteria 4796
30 Ga0055539_1000145 3300003752 Bacteria 71820
31 Ga0055533_1000866 3300003756 Bacteria 9241
32 Ga0055533_1005873 3300003756 Bacteria 1904
33 Ga0055533_1005885 3300003756 Bacteria 1902
34 Ga0055532_1000469 3300003758 Bacteria 18242
35 Ga0055525_1000001 3300003759 Bacteria 1016948
36 Ga0055525_1001053 3300003759 Bacteria 7112
37 Ga0055535_1000999 3300003761 Bacteria 18242
38 Ga0055542_1000385 3300003762 Bacteria 44928
39 Ga0055529_1000831 3300003763 Bacteria 18242
40 Ga0055526_1000314 3300003771 Bacteria 40385
41 Ga0055526_1026726 3300003771 Bacteria 1809
42 Ga0055537_1000688 3300003773 Bacteria 17628
43 Ga0055524_1000031 3300003775 Bacteria 187744
44 Ga0055524_1016351 3300003775 Bacteria 2665
45 Ga0055524_1025859 3300003775 Bacteria 1829
46 Ga0055536_1000638 3300003781 Bacteria 23865
47 Ga0055536_1002200 3300003781 Bacteria 11106
48 Ga0055536_1040464 3300003781 Bacteria 1109
49 Ga0055534_1000488 3300003784 Bacteria 21993
50 Ga0055530_10001927 3300003791 Bacteria 14155
51 Ga0055540_1000149 3300003792 Bacteria 68747
52 Ga0055540_1000275 3300003792 Bacteria 46202
53 Ga0055540_1003439 3300003792 Bacteria 7649
54 Ga0055531_10000062 3300003794 Bacteria 120504
55 Ga0055541_1004944 3300003841 Bacteria 2374
56 Ga0055541_1006873 3300003841 Bacteria 1904
57 Ga0055541_1006878 3300003841 Bacteria 1902
58 Ga0065165_1001672 3300005262 Bacteria 22433
59 Ga0065714_10002324 3300005288 Bacteria 25506
60 Ga0065714_10152351 3300005288 Bacteria 1098
61 Ga0065704_10124798 3300005289 Bacteria 1712
62 Ga0065715_10112482 3300005293 Bacteria 2528
63 Ga0065707_10092907 3300005295 Bacteria 3690
64 Ga0065707_10102207 3300005295 Bacteria 2820
65 Ga0070658_10015415 3300005327 Bacteria 6115
66 Ga0070658_10021036 3300005327 Bacteria 5226
67 Ga0070658_10035934 3300005327 Bacteria 3992
68 Ga0070658_10155946 3300005327 Bacteria 1914
69 Ga0070658_10197897 3300005327 Bacteria 1695
70 Ga0070676_10002407 3300005328 Bacteria 9583
71 Ga0070683_100004780 3300005329 Bacteria 11211
72 Ga0070683_100139715 3300005329 Bacteria 2295
73 Ga0070690_100000577 3300005330 Bacteria 18482
74 Ga0070690_100059684 3300005330 Bacteria 2453
75 Ga0070670_100026119 3300005331 Bacteria 5027
76 Ga0070670_100691356 3300005331 Bacteria 917
77 Ga0070677_10000943 3300005333 Bacteria 9437
78 Ga0070677_10039250 3300005333 Bacteria 1857
79 Ga0068869_100040653 3300005334 Bacteria 3326
80 Ga0070666_10030069 3300005335 Bacteria 3576
81 Ga0070666_10038679 3300005335 Bacteria 3176
82 Ga0070680_100008066 3300005336 Bacteria 8042
83 Ga0070680_100028142 3300005336 Bacteria 4507
84 Ga0070680_100032815 3300005336 Bacteria 4180
85 Ga0070680_100097670 3300005336 Bacteria 2436
86 Ga0070680_100407707 3300005336 Bacteria 1159
87 Ga0070682_100002906 3300005337 Bacteria 9504
88 Ga0070682_100026631 3300005337 Bacteria 3462
89 Ga0070682_100333548 3300005337 Bacteria 1125
90 Ga0068868_100000892 3300005338 Bacteria 20293
91 Ga0070660_100003390 3300005339 Bacteria 10962
92 Ga0070660_100052583 3300005339 Bacteria 3140
93 Ga0070660_100192548 3300005339 Bacteria 1652
94 Ga0070689_100002855 3300005340 Bacteria 11357
95 Ga0070691_10001992 3300005341 Bacteria 9004
96 Ga0070691_10214045 3300005341 Bacteria 1018
97 Ga0070687_100000895 3300005343 Bacteria 10044
98 Ga0070661_100000172 3300005344 Bacteria 53064
99 Ga0070661_100000804 3300005344 Bacteria 22558
100 Ga0070661_100143009 3300005344 Bacteria 1804
101 Ga0070661_100220425 3300005344 Bacteria 1455
102 Ga0070692_10000830 3300005345 Bacteria 10335
103 Ga0070692_10072062 3300005345 Bacteria 1842
104 Ga0070668_100005596 3300005347 Bacteria 9317
105 Ga0070668_100015026 3300005347 Bacteria 5782
106 Ga0070669_100010788 3300005353 Bacteria 6485
107 Ga0070669_100044673 3300005353 Bacteria 3228
108 Ga0070675_100007817 3300005354 Bacteria 8286
109 Ga0070675_100040003 3300005354 Bacteria 3827
110 Ga0070675_100199836 3300005354 Bacteria 1735
111 Ga0070671_100000144 3300005355 Bacteria 46097
112 Ga0070671_100046072 3300005355 Bacteria 3626
113 Ga0070671_100047928 3300005355 Bacteria 3553
114 Ga0070671_100050429 3300005355 Bacteria 3462
115 Ga0070671_100512005 3300005355 Bacteria 1033
116 Ga0070674_100003771 3300005356 Bacteria 8557
117 Ga0070674_100267397 3300005356 Bacteria 1350
118 Ga0070673_100003994 3300005364 Bacteria 9279
119 Ga0070673_100007016 3300005364 Bacteria 7385
120 Ga0070673_100251216 3300005364 Bacteria 1541
121 Ga0070673_100339346 3300005364 Bacteria 1331
122 Ga0070673_100394145 3300005364 Bacteria 1237
123 Ga0070688_100009077 3300005365 Bacteria 5423
124 Ga0070688_100011259 3300005365 Bacteria 4966
125 Ga0070688_100019796 3300005365 Bacteria 3904
126 Ga0070688_100045165 3300005365 Bacteria 2720
127 Ga0070659_100005098 3300005366 Bacteria 9424
128 Ga0070659_100234867 3300005366 Bacteria 1516
129 Ga0070667_100003448 3300005367 Bacteria 13475
130 Ga0070667_100022884 3300005367 Bacteria 5181
131 Ga0070667_100029930 3300005367 Bacteria 4540
132 Ga0070667_100089458 3300005367 Bacteria 2645
133 Ga0070667_100385199 3300005367 Bacteria 1274
134 Ga0070703_10005909 3300005406 Bacteria 3428
135 Ga0070714_100015402 3300005435 Bacteria 6153
136 Ga0070714_100272549 3300005435 Bacteria 1570
137 Ga0070713_100005437 3300005436 Bacteria 8707
138 Ga0070713_100040256 3300005436 Bacteria 3798
139 Ga0070713_100042493 3300005436 Bacteria 3710
140 Ga0070713_100314160 3300005436 Bacteria 1446
141 Ga0070710_10002210 3300005437 Bacteria 9185
142 Ga0070710_10172690 3300005437 Bacteria 1348
143 Ga0070701_10000951 3300005438 Bacteria 10493
144 Ga0070711_100026734 3300005439 Bacteria 3784
145 Ga0070711_100300686 3300005439 Bacteria 1276
146 Ga0070711_100391823 3300005439 Bacteria 1125
147 Ga0070705_100003034 3300005440 Bacteria 8286
148 Ga0070705_100019384 3300005440 Bacteria 3580
149 Ga0070705_100020776 3300005440 Bacteria 3482
150 Ga0070705_100344093 3300005440 Bacteria 1085
151 Ga0070700_100001925 3300005441 Bacteria 10503
152 Ga0070700_100148601 3300005441 Bacteria 1600
153 Ga0070694_100013679 3300005444 Bacteria 5071
154 Ga0070694_100017580 3300005444 Bacteria 4522
155 Ga0070694_100195845 3300005444 Bacteria 1503
156 Ga0070708_100011316 3300005445 Bacteria 7254
157 Ga0070708_100076491 3300005445 Bacteria 3023
158 Ga0070708_100155288 3300005445 Bacteria 2130
159 Ga0070708_100228982 3300005445 Bacteria 1744
160 Ga0070663_100000048 3300005455 Bacteria 53064
161 Ga0070663_100008331 3300005455 Bacteria 6370
162 Ga0070663_100066970 3300005455 Bacteria 2603
163 Ga0070663_100408049 3300005455 Bacteria 1112
164 Ga0070678_100019470 3300005456 Bacteria 4426
165 Ga0070678_100031617 3300005456 Bacteria 3654
166 Ga0070678_100032939 3300005456 Bacteria 3592
167 Ga0070678_100168451 3300005456 Bacteria 1782
168 Ga0070662_100009476 3300005457 Bacteria 6370
169 Ga0070662_100125525 3300005457 Bacteria 1972
170 Ga0070662_100399074 3300005457 Bacteria 1134
171 Ga0070681_10079817 3300005458 Bacteria 3228
172 Ga0070681_10113424 3300005458 Bacteria 2650
173 Ga0070681_10168760 3300005458 Bacteria 2111
174 Ga0070681_10237499 3300005458 Bacteria 1736
175 Ga0070681_10343051 3300005458 Bacteria 1404
176 Ga0070681_10423468 3300005458 Bacteria 1243
177 Ga0068867_100011042 3300005459 Bacteria 6370
178 Ga0068867_100062306 3300005459 Bacteria 2771
179 Ga0068867_100093862 3300005459 Bacteria 2281
180 Ga0070685_10040340 3300005466 Bacteria 2656
181 Ga0070706_100167319 3300005467 Bacteria 2053
182 Ga0070706_100448950 3300005467 Bacteria 1200
183 Ga0070707_100005638 3300005468 Bacteria 11699
184 Ga0070698_100096540 3300005471 Bacteria 2932
185 Ga0070698_100436242 3300005471 Bacteria 1245
186 Ga0070699_100034500 3300005518 Bacteria 4373
187 Ga0070679_100019238 3300005530 Bacteria 6636
188 Ga0070679_100088242 3300005530 Bacteria 3089
189 Ga0070679_100095190 3300005530 Bacteria 2966
190 Ga0070679_100260969 3300005530 Bacteria 1688
191 Ga0070679_100309016 3300005530 Bacteria 1531
192 Ga0070679_100468364 3300005530 Bacteria 1204
193 Ga0070679_100589015 3300005530 Bacteria 1056
194 Ga0070684_100001753 3300005535 Bacteria 15811
195 Ga0070684_100016515 3300005535 Bacteria 6033
196 Ga0070684_100104379 3300005535 Bacteria 2535
197 Ga0070697_100014513 3300005536 Bacteria 6188
198 Ga0068853_100005853 3300005539 Bacteria 9685
199 Ga0070672_100025104 3300005543 Bacteria 4416
200 Ga0070672_100030562 3300005543 Bacteria 4048
201 Ga0070686_100000086 3300005544 Bacteria 65438
202 Ga0070686_100008070 3300005544 Bacteria 5881
203 Ga0070695_100002465 3300005545 Bacteria 10658
204 Ga0070695_100007717 3300005545 Bacteria 6370
205 Ga0070695_100057276 3300005545 Bacteria 2517
206 Ga0070695_100226069 3300005545 Bacteria 1351
207 Ga0070696_100004489 3300005546 Bacteria 9315
208 Ga0070696_100054505 3300005546 Bacteria 2786
209 Ga0070696_100149595 3300005546 Bacteria 1713
210 Ga0070696_100397112 3300005546 Bacteria 1078
211 Ga0070693_100053012 3300005547 Bacteria 2327
212 Ga0070693_100096016 3300005547 Bacteria 1796
213 Ga0070665_100008890 3300005548 Bacteria 10173
214 Ga0070665_100053124 3300005548 Bacteria 4064
215 Ga0070704_100000280 3300005549 Bacteria 22434
216 Ga0070704_100053958 3300005549 Bacteria 2843
217 Ga0070704_100140072 3300005549 Bacteria 1887
218 Ga0070704_100487516 3300005549 Bacteria 1067
219 Ga0068855_100001526 3300005563 Bacteria 29026
220 Ga0068855_100027435 3300005563 Bacteria 6811
221 Ga0068855_100037526 3300005563 Bacteria 5761
222 Ga0068855_100097674 3300005563 Bacteria 3383
223 Ga0068855_100171536 3300005563 Bacteria 2457
224 Ga0070664_100000119 3300005564 Bacteria 52383
225 Ga0070664_100008530 3300005564 Bacteria 8286
226 Ga0070664_100044515 3300005564 Bacteria 3748
227 Ga0068857_100005404 3300005577 Bacteria 10892
228 Ga0068857_100031359 3300005577 Bacteria 4696
229 Ga0068857_100067804 3300005577 Bacteria 3176
230 Ga0068857_100636776 3300005577 Bacteria 1010
231 Ga0068854_100003207 3300005578 Bacteria 10203
232 Ga0068854_100010312 3300005578 Bacteria 6056
233 Ga0068856_100000308 3300005614 Bacteria 53511
234 Ga0068856_100010687 3300005614 Bacteria 8918
235 Ga0068856_100258975 3300005614 Bacteria 1755
236 Ga0070702_100014862 3300005615 Bacteria 3961
237 Ga0070702_100116622 3300005615 Bacteria 1665
238 Ga0070702_100204860 3300005615 Bacteria 1309
239 Ga0068852_100002326 3300005616 Bacteria 13065
240 Ga0068852_100031324 3300005616 Bacteria 4387
241 Ga0068852_100574103 3300005616 Bacteria 1130
242 Ga0068859_100009076 3300005617 Bacteria 10044
243 Ga0068859_100039394 3300005617 Bacteria 4741
244 Ga0068859_100053408 3300005617 Bacteria 4064
245 Ga0068864_100001754 3300005618 Bacteria 17838
246 Ga0068864_100013586 3300005618 Bacteria 6750
247 Ga0068864_100050852 3300005618 Bacteria 3568
248 Ga0068864_100579545 3300005618 Bacteria 1087
249 Ga0068866_10001865 3300005718 Bacteria 8828
250 Ga0068861_100033242 3300005719 Bacteria 3803
251 Ga0068861_100062553 3300005719 Bacteria 2860
252 Ga0068861_100247729 3300005719 Bacteria 1519
253 Ga0068870_10000419 3300005840 Bacteria 15983
254 Ga0068863_100000340 3300005841 Bacteria 47641
255 Ga0068863_100026204 3300005841 Bacteria 5563
256 Ga0068863_100071220 3300005841 Bacteria 3289
257 Ga0068858_100009413 3300005842 Bacteria 9322
258 Ga0068858_100029243 3300005842 Bacteria 5116
259 Ga0068858_100099646 3300005842 Bacteria 2709
260 Ga0068858_100532949 3300005842 Bacteria 1136
261 Ga0068860_100052206 3300005843 Bacteria 3889
262 Ga0068860_100071592 3300005843 Bacteria 3294
263 Ga0068860_100073526 3300005843 Bacteria 3249
264 Ga0068860_100781709 3300005843 Bacteria 967
265 Ga0068862_100006116 3300005844 Bacteria 10017
266 Ga0068862_100041473 3300005844 Bacteria 3916
267 Ga0068862_100767656 3300005844 Bacteria 939
268 Ga0081455_10000007 3300005937 Bacteria 269394
269 Ga0081540_1000002 3300005983 Bacteria 251149
270 Ga0081539_10000394 3300005985 Bacteria 93943
271 Ga0081539_10000668 3300005985 Bacteria 68754
272 Ga0070717_10003040 3300006028 Bacteria 11964
273 Ga0070717_10121840 3300006028 Bacteria 2235
274 Ga0070717_10139779 3300006028 Bacteria 2088
275 Ga0070717_10323784 3300006028 Bacteria 1374
276 Ga0075365_10003142 3300006038 Bacteria 8419
277 Ga0075365_10100662 3300006038 Bacteria 1978
278 Ga0075365_10178335 3300006038 Bacteria 1485
279 Ga0075365_10252205 3300006038 Bacteria 1240
280 Ga0075365_10467938 3300006038 Bacteria 890
281 Ga0075368_10003305 3300006042 Bacteria 5370
282 Ga0075368_10030278 3300006042 Bacteria 2095
283 Ga0075363_100000734 3300006048 Bacteria 11140
284 Ga0075363_100017534 3300006048 Bacteria 3552
285 Ga0075363_100041451 3300006048 Bacteria 2428
286 Ga0075363_100043053 3300006048 Bacteria 2387
287 Ga0075364_10027040 3300006051 Bacteria 3662
288 Ga0075364_10102231 3300006051 Bacteria 1908
289 Ga0075432_10028982 3300006058 Bacteria 1910
290 Ga0075432_10032292 3300006058 Bacteria 1814
291 Ga0070715_10005346 3300006163 Bacteria 4276
292 Ga0070715_10016579 3300006163 Bacteria 2771
293 Ga0070716_100001217 3300006173 Bacteria 11316
294 Ga0070712_100005950 3300006175 Bacteria 7542
295 Ga0070712_100012114 3300006175 Bacteria 5480
296 Ga0070712_100175548 3300006175 Bacteria 1666
297 Ga0075362_10000286 3300006177 Bacteria 14260
298 Ga0075362_10080265 3300006177 Bacteria 1503
299 Ga0075362_10109557 3300006177 Bacteria 1298
300 Ga0075362_10168438 3300006177 Bacteria 1057
301 Ga0075367_10000730 3300006178 Bacteria 12773
302 Ga0075367_10002322 3300006178 Bacteria 8645
303 Ga0075367_10003087 3300006178 Bacteria 7820
304 Ga0075367_10038840 3300006178 Bacteria 2773
305 Ga0075367_10137112 3300006178 Bacteria 1514
306 Ga0075367_10352577 3300006178 Bacteria 929
307 Ga0075369_10079221 3300006186 Bacteria 1455
308 Ga0075369_10110757 3300006186 Bacteria 1237
309 Ga0075369_10153483 3300006186 Bacteria 1053
310 Ga0075366_10001531 3300006195 Bacteria 11562
311 Ga0075366_10005069 3300006195 Bacteria 7122
312 Ga0075366_10015235 3300006195 Bacteria 4402
313 Ga0075366_10027421 3300006195 Bacteria 3342
314 Ga0075366_10034195 3300006195 Bacteria 2994
315 Ga0097621_100000880 3300006237 Bacteria 21059
316 Ga0097621_100010589 3300006237 Bacteria 6755
317 Ga0097621_100066478 3300006237 Bacteria 2969
318 Ga0075370_10001459 3300006353 Bacteria 10271
319 Ga0075370_10007230 3300006353 Bacteria 5646
320 Ga0075370_10065979 3300006353 Bacteria 2064
321 Ga0075370_10079544 3300006353 Bacteria 1883
322 Ga0075370_10149080 3300006353 Bacteria 1370
323 Ga0068871_100006040 3300006358 Bacteria 8523
324 Ga0068871_100008998 3300006358 Bacteria 7211
325 Ga0068871_100036409 3300006358 Bacteria 3918
326 Ga0075428_100001723 3300006844 Bacteria 23380
327 Ga0075428_100006547 3300006844 Bacteria 12951
328 Ga0075430_100000201 3300006846 Bacteria 40551
329 Ga0075431_100000260 3300006847 Bacteria 40551
330 Ga0075431_100001007 3300006847 Bacteria 25062
331 Ga0075431_100052381 3300006847 Bacteria 4208
332 Ga0075433_10000007 3300006852 Bacteria 75995
333 Ga0075433_10019271 3300006852 Bacteria 5682
334 Ga0075433_10297785 3300006852 Bacteria 1428
335 Ga0075434_100000091 3300006871 Bacteria 49489
336 Ga0075434_100005079 3300006871 Bacteria 11948
337 Ga0075434_100054318 3300006871 Bacteria 3980
338 Ga0075434_100243466 3300006871 Bacteria 1818
339 Ga0075434_100459202 3300006871 Bacteria 1295
340 Ga0075429_100001265 3300006880 Bacteria 20558
341 Ga0075429_100070114 3300006880 Bacteria 3051
342 Ga0068865_100000615 3300006881 Bacteria 20013
343 Ga0068865_100080765 3300006881 Bacteria 2333
344 Ga0068865_100121213 3300006881 Bacteria 1945
345 Ga0075436_100015888 3300006914 Bacteria 5152
346 Ga0075436_100017933 3300006914 Bacteria 4847
347 Ga0075436_100028258 3300006914 Bacteria 3858
348 Ga0075436_100068532 3300006914 Bacteria 2451
349 Ga0075436_100104260 3300006914 Bacteria 1977
350 Ga0097620_100009075 3300006931 Bacteria 10044
351 Ga0097620_100039391 3300006931 Bacteria 4741
352 Ga0097620_100053406 3300006931 Bacteria 4064
353 Ga0075435_100001029 3300007076 Bacteria 17685
354 Ga0075435_100001714 3300007076 Bacteria 14245
355 Ga0075435_100011790 3300007076 Bacteria 6450
356 Ga0075435_100066884 3300007076 Bacteria 2925
357 Ga0099794_10003104 3300007265 Bacteria 6284
358 Ga0099794_10056087 3300007265 Bacteria 1905
359 Ga0099795_10017367 3300007788 Bacteria 2293
360 Ga0105251_10003023 3300009011 Bacteria 12543
361 Ga0105251_10018333 3300009011 Bacteria 3724
362 Ga0105251_10147661 3300009011 Bacteria 1062
363 Ga0105244_10004322 3300009036 Bacteria 9823
364 Ga0105244_10013636 3300009036 Bacteria 4737
365 Ga0105244_10146237 3300009036 Bacteria 1134
366 Ga0105250_10001271 3300009092 Bacteria 13873
367 Ga0105240_10014700 3300009093 Bacteria 10677
368 Ga0105240_10025813 3300009093 Bacteria 7715
369 Ga0105240_10083154 3300009093 Bacteria 3929
370 Ga0105240_10090355 3300009093 Bacteria 3743
371 Ga0105240_10146942 3300009093 Bacteria 2812
372 Ga0105240_10347407 3300009093 Bacteria 1684
373 Ga0111539_10001412 3300009094 Bacteria 31985
374 Ga0111539_10026413 3300009094 Bacteria 7099
375 Ga0111539_10103262 3300009094 Bacteria 3346
376 Ga0111539_10195935 3300009094 Bacteria 2356
377 Ga0111539_10537663 3300009094 Bacteria 1361
378 Ga0111539_10672746 3300009094 Bacteria 1205
379 Ga0105245_10027580 3300009098 Bacteria 5004
380 Ga0105245_10041176 3300009098 Bacteria 4118
381 Ga0105245_10097858 3300009098 Bacteria 2710
382 Ga0105245_10201283 3300009098 Bacteria 1912
383 Ga0105245_10350161 3300009098 Bacteria 1463
384 Ga0105247_10026019 3300009101 Bacteria 3532
385 Ga0105247_10113547 3300009101 Bacteria 1746
386 Ga0105247_10150151 3300009101 Bacteria 1535
387 Ga0105247_10330992 3300009101 Bacteria 1065
388 Ga0114129_10002772 3300009147 Bacteria 24406
389 Ga0114129_10017987 3300009147 Bacteria 10065
390 Ga0114129_10078906 3300009147 Bacteria 4578
391 Ga0114129_10686652 3300009147 Bacteria 1317
392 Ga0105243_10007677 3300009148 Bacteria 8286
393 Ga0105243_10024994 3300009148 Bacteria 4561
394 Ga0105243_10030527 3300009148 Bacteria 4150
395 Ga0105243_10045128 3300009148 Bacteria 3462
396 Ga0105243_10429047 3300009148 Bacteria 1235
397 Ga0105241_10021798 3300009174 Bacteria 4740
398 Ga0105241_10023847 3300009174 Bacteria 4540
399 Ga0105241_10168092 3300009174 Bacteria 1809
400 Ga0105242_10004266 3300009176 Bacteria 11145
401 Ga0105242_10007702 3300009176 Bacteria 8286
402 Ga0105242_10211388 3300009176 Bacteria 1729
403 Ga0105248_10004655 3300009177 Bacteria 15184
404 Ga0105248_10043196 3300009177 Bacteria 5054
405 Ga0105248_10047663 3300009177 Bacteria 4806
406 Ga0105248_10057813 3300009177 Bacteria 4354
407 Ga0105248_10338938 3300009177 Bacteria 1693
408 Ga0105237_10042077 3300009545 Bacteria 4607
409 Ga0105237_10208558 3300009545 Bacteria 1954
410 Ga0105238_10110783 3300009551 Bacteria 2725
411 Ga0105238_10111936 3300009551 Bacteria 2710
412 Ga0105249_10010100 3300009553 Bacteria 8286
413 Ga0105249_10283720 3300009553 Bacteria 1655
414 Ga0105249_11020688 3300009553 Bacteria 896
415 Ga0105239_10086648 3300010375 Bacteria 3452
416 Ga0105239_10118061 3300010375 Bacteria 2944
417 Ga0105239_10219286 3300010375 Bacteria 2133
418 Ga0105239_10253389 3300010375 Bacteria 1977
419 Ga0105246_10001908 3300011119 Bacteria 12559
420 Ga0105246_10183283 3300011119 Bacteria 1614
421 Ga0105246_10239225 3300011119 Bacteria 1434
422 Ga0157373_10001235 3300013100 Bacteria 19546
423 Ga0157373_10004667 3300013100 Bacteria 10306
424 Ga0157371_10000419 3300013102 Bacteria 52509
425 Ga0157371_10004765 3300013102 Bacteria 11693
426 Ga0157371_10105612 3300013102 Bacteria 1998
427 Ga0157371_10174573 3300013102 Bacteria 1536
428 Ga0157370_10000002 3300013104 Bacteria 431400
429 Ga0157370_10061748 3300013104 Bacteria 3556
430 Ga0157370_10553966 3300013104 Bacteria 1054
431 Ga0157369_10001303 3300013105 Bacteria 31024
432 Ga0157369_10022078 3300013105 Bacteria 7112
433 Ga0157369_10042262 3300013105 Bacteria 4973
434 Ga0157369_10119185 3300013105 Bacteria 2801
435 Ga0157369_10522966 3300013105 Bacteria 1227
436 Ga0157374_10010364 3300013296 Bacteria 8018
437 Ga0157374_10029962 3300013296 Bacteria 4937
438 Ga0157378_10009964 3300013297 Bacteria 8286
439 Ga0157378_10035863 3300013297 Bacteria 4389
440 Ga0157378_10077532 3300013297 Bacteria 2996
441 Ga0163162_10011627 3300013306 Bacteria 8584
442 Ga0163162_10017148 3300013306 Bacteria 7086
443 Ga0163162_10054423 3300013306 Bacteria 4025
444 Ga0163162_10061637 3300013306 Bacteria 3788
445 Ga0163162_10067500 3300013306 Bacteria 3626
446 Ga0163162_10167493 3300013306 Bacteria 2321
447 Ga0157372_10002873 3300013307 Bacteria 18620
448 Ga0157372_10028009 3300013307 Bacteria 6144
449 Ga0157372_10088265 3300013307 Bacteria 3521
450 Ga0157372_10279203 3300013307 Bacteria 1942
451 Ga0157372_10801131 3300013307 Bacteria 1095
452 Ga0157375_10007981 3300013308 Bacteria 9268
453 Ga0157375_10059865 3300013308 Bacteria 3774
454 Ga0157375_10062691 3300013308 Bacteria 3695
455 Ga0157375_10219908 3300013308 Bacteria 2058
456 Ga0157375_10474743 3300013308 Bacteria 1416
457 Ga0163163_10006941 3300014325 Bacteria 9948
458 Ga0163163_10026981 3300014325 Bacteria 5496
459 Ga0163163_10071319 3300014325 Bacteria 3461
460 Ga0157380_10004902 3300014326 Bacteria 9325
461 Ga0157380_10287406 3300014326 Bacteria 1508
462 Ga0182008_10017556 3300014497 Bacteria 3711
463 Ga0182008_10039281 3300014497 Bacteria 2365
464 Ga0182008_10050232 3300014497 Bacteria 2070
465 Ga0182008_10105766 3300014497 Bacteria 1392
466 Ga0182008_10107420 3300014497 Bacteria 1381
467 Ga0157377_10002529 3300014745 Bacteria 8107
468 Ga0157379_10000036 3300014968 Bacteria 81888
469 Ga0157379_10024663 3300014968 Bacteria 5338
470 Ga0157379_10044610 3300014968 Bacteria 3957
471 Ga0157376_10027787 3300014969 Bacteria 4489
472 Ga0157376_10234851 3300014969 Bacteria 1705
473 Ga0182006_1002183 3300015261 Bacteria 10853
474 Ga0182006_1003839 3300015261 Bacteria 7545
475 Ga0182006_1006307 3300015261 Bacteria 5526
476 Ga0182006_1012230 3300015261 Bacteria 3756
477 Ga0182007_10007789 3300015262 Bacteria 4453
478 Ga0182007_10011471 3300015262 Bacteria 3449
479 Ga0182005_1001297 3300015265 Bacteria 10282
480 Ga0182005_1006013 3300015265 Bacteria 3748
481 Ga0163161_10006198 3300017792 Bacteria 8286
482 Ga0206356_11256461 3300020070 Bacteria 3409
483 Ga0206356_11423983 3300020070 Bacteria 933
484 Ga0206353_11376502 3300020082 Bacteria 1855
485 Ga0154015_1416319 3300020610 Bacteria 12687
486 Ga0213873_10026857 3300021358 Bacteria 1401
487 Ga0213872_10000482 3300021361 Bacteria 32036
488 Ga0213875_10011286 3300021388 Bacteria 4449
489 Ga0228598_1011274 3300024227 Bacteria 1779
490 Ga0209784_100003 3300025224 Bacteria 1379451
491 Ga0209784_100243 3300025224 Bacteria 35204
492 Ga0209784_100808 3300025224 Bacteria 7230
493 Ga0209566_100002 3300025225 Bacteria 2614868
494 Ga0209566_100742 3300025225 Bacteria 18112
495 Ga0209566_100934 3300025225 Bacteria 13351
496 Ga0209674_100010 3300025226 Bacteria 1038638
497 Ga0209674_100081 3300025226 Bacteria 201146
498 Ga0209674_101205 3300025226 Bacteria 7374
499 Ga0209672_100624 3300025228 Bacteria 18296
500 Ga0209147_100414 3300025229 Bacteria 28331
501 Ga0209563_100004 3300025230 Bacteria 1814108
502 Ga0209563_100007 3300025230 Bacteria 1579402
503 Ga0209563_100026 3300025230 Bacteria 559453
504 Ga0209258_100618 3300025242 Bacteria 28331
505 Ga0209646_1000065 3300025246 Bacteria 245452
506 Ga0209026_1010214 3300025250 Bacteria 1768
507 Ga0209677_100013 3300025253 Bacteria 548200
508 Ga0209677_101179 3300025253 Bacteria 11992
509 Ga0209148_1000113 3300025254 Bacteria 195646
510 Ga0209148_1006097 3300025254 Bacteria 2653
511 Ga0209759_1001010 3300025256 Bacteria 19015
512 Ga0209759_1001214 3300025256 Bacteria 15844
513 Ga0209759_1001322 3300025256 Bacteria 14570
514 Ga0209759_1003788 3300025256 Bacteria 5892
515 Ga0209565_1000176 3300025263 Bacteria 81062
516 Ga0207666_1000147 3300025271 Bacteria 11003
517 Ga0207666_1001482 3300025271 Bacteria 2775
518 Ga0209455_1000501 3300025272 Bacteria 28331
519 Ga0209673_1014335 3300025273 Bacteria 3070
520 Ga0209130_1001660 3300025284 Bacteria 13597
521 Ga0207673_1000767 3300025290 Bacteria 3463
522 Ga0209675_1000218 3300025291 Bacteria 60057
523 Ga0209675_1003302 3300025291 Bacteria 7746
524 Ga0209676_1000627 3300025292 Bacteria 51086
525 Ga0209676_1000855 3300025292 Bacteria 39250
526 Ga0209676_1001271 3300025292 Bacteria 26199
527 Ga0209676_1001369 3300025292 Bacteria 23919
528 Ga0209676_1008057 3300025292 Bacteria 4788
529 Ga0209025_1000028 3300025294 Bacteria 490678
530 Ga0209025_1002169 3300025294 Bacteria 21834
531 Ga0209025_1004673 3300025294 Bacteria 11705
532 Ga0209025_1029115 3300025294 Bacteria 2684
533 Ga0209025_1059610 3300025294 Bacteria 1439
534 Ga0209564_1000135 3300025295 Bacteria 188117
535 Ga0209564_1000421 3300025295 Bacteria 74558
536 Ga0209758_1000063 3300025297 Bacteria 315999
537 Ga0209758_1000120 3300025297 Bacteria 192212
538 Ga0209758_1005062 3300025297 Bacteria 10452
539 Ga0209050_1000100 3300025298 Bacteria 231385
540 Ga0209050_1000537 3300025298 Bacteria 62966
541 Ga0209256_1000107 3300025299 Bacteria 186233
542 Ga0209256_1000263 3300025299 Bacteria 92812
543 Ga0209256_1002000 3300025299 Bacteria 18244
544 Ga0209256_1010514 3300025299 Bacteria 3858
545 Ga0207426_1000018 3300025302 Bacteria 566740
546 Ga0209051_1000067 3300025303 Bacteria 227181
547 Ga0209051_1000302 3300025303 Bacteria 77692
548 Ga0209051_1000345 3300025303 Bacteria 69229
549 Ga0209257_1000095 3300025304 Bacteria 259437
550 Ga0209257_1002834 3300025304 Bacteria 16262
551 Ga0207697_10002326 3300025315 Bacteria 9897
552 Ga0207697_10077030 3300025315 Bacteria 1402
553 Ga0207696_1002217 3300025711 Bacteria 9716
554 Ga0207655_1005104 3300025728 Bacteria 9061
555 Ga0207655_1008924 3300025728 Bacteria 6293
556 Ga0207655_1019123 3300025728 Bacteria 3598
557 Ga0207713_1002340 3300025735 Bacteria 13916
558 Ga0207653_10001409 3300025885 Bacteria 7795
559 Ga0207682_10001723 3300025893 Bacteria 10024
560 Ga0207692_10022169 3300025898 Bacteria 2919
561 Ga0207692_10120478 3300025898 Bacteria 1469
562 Ga0207692_10317278 3300025898 Bacteria 953
563 Ga0207710_10005311 3300025900 Bacteria 5559
564 Ga0207710_10005447 3300025900 Bacteria 5480
565 Ga0207710_10060865 3300025900 Bacteria 1712
566 Ga0207688_10000167 3300025901 Bacteria 28809
567 Ga0207688_10097804 3300025901 Bacteria 1692
568 Ga0207688_10171623 3300025901 Bacteria 1290
569 Ga0207680_10023271 3300025903 Bacteria 3380
570 Ga0207680_10044018 3300025903 Bacteria 2622
571 Ga0207647_10002561 3300025904 Bacteria 13747
572 Ga0207647_10057430 3300025904 Bacteria 2386
573 Ga0207685_10010229 3300025905 Bacteria 2760
574 Ga0207685_10020155 3300025905 Bacteria 2211
575 Ga0207685_10136186 3300025905 Bacteria 1096
576 Ga0207699_10001489 3300025906 Bacteria 11129
577 Ga0207699_10106411 3300025906 Bacteria 1790
578 Ga0207645_10005140 3300025907 Bacteria 9571
579 Ga0207645_10125221 3300025907 Bacteria 1670
580 Ga0207645_10172079 3300025907 Bacteria 1420
581 Ga0207643_10004063 3300025908 Bacteria 7870
582 Ga0207705_10017729 3300025909 Bacteria 5093
583 Ga0207705_10081845 3300025909 Bacteria 2353
584 Ga0207684_10126446 3300025910 Bacteria 2194
585 Ga0207684_10318850 3300025910 Bacteria 1340
586 Ga0207654_10026883 3300025911 Bacteria 3122
587 Ga0207707_10016807 3300025912 Bacteria 6375
588 Ga0207707_10040964 3300025912 Bacteria 4044
589 Ga0207707_10058268 3300025912 Bacteria 3361
590 Ga0207707_10159070 3300025912 Bacteria 1975
591 Ga0207707_10378882 3300025912 Bacteria 1216
592 Ga0207695_10005378 3300025913 Bacteria 17020
593 Ga0207695_10045076 3300025913 Bacteria 4685
594 Ga0207695_10188244 3300025913 Bacteria 1982
595 Ga0207695_10242936 3300025913 Bacteria 1701
596 Ga0207671_10035659 3300025914 Bacteria 3690
597 Ga0207671_10588322 3300025914 Bacteria 887
598 Ga0207693_10008449 3300025915 Bacteria 8426
599 Ga0207693_10032045 3300025915 Bacteria 4150
600 Ga0207693_10132042 3300025915 Bacteria 1963
601 Ga0207693_10181051 3300025915 Bacteria 1658
602 Ga0207693_10222535 3300025915 Bacteria 1482
603 Ga0207663_10070179 3300025916 Bacteria 2257
604 Ga0207663_10144020 3300025916 Bacteria 1664
605 Ga0207663_10556355 3300025916 Bacteria 897
606 Ga0207660_10020078 3300025917 Bacteria 4479
607 Ga0207660_10029553 3300025917 Bacteria 3761
608 Ga0207660_10041239 3300025917 Bacteria 3234
609 Ga0207660_10199301 3300025917 Bacteria 1563
610 Ga0207662_10000195 3300025918 Bacteria 28315
611 Ga0207662_10021822 3300025918 Bacteria 3664
612 Ga0207662_10198917 3300025918 Bacteria 1296
613 Ga0207657_10012031 3300025919 Bacteria 8558
614 Ga0207657_10141998 3300025919 Bacteria 1961
615 Ga0207657_10145041 3300025919 Bacteria 1937
616 Ga0207657_10251829 3300025919 Bacteria 1407
617 Ga0207657_10302416 3300025919 Bacteria 1267
618 Ga0207649_10000168 3300025920 Bacteria 53468
619 Ga0207649_10000944 3300025920 Bacteria 18174
620 Ga0207649_10026440 3300025920 Bacteria 3395
621 Ga0207649_10293310 3300025920 Bacteria 1187
622 Ga0207652_10027911 3300025921 Bacteria 4708
623 Ga0207652_10028891 3300025921 Bacteria 4629
624 Ga0207652_10074387 3300025921 Bacteria 2958
625 Ga0207652_10193030 3300025921 Bacteria 1832
626 Ga0207646_10014392 3300025922 Bacteria 7516
627 Ga0207681_10004024 3300025923 Bacteria 9118
628 Ga0207681_10033795 3300025923 Bacteria 3357
629 Ga0207694_10170107 3300025924 Bacteria 1764
630 Ga0207650_10011209 3300025925 Bacteria 6165
631 Ga0207650_10241511 3300025925 Bacteria 1460
632 Ga0207659_10001128 3300025926 Bacteria 15843
633 Ga0207659_10017661 3300025926 Bacteria 4662
634 Ga0207659_10105888 3300025926 Bacteria 2129
635 Ga0207687_10016099 3300025927 Bacteria 4908
636 Ga0207700_10005022 3300025928 Bacteria 7870
637 Ga0207700_10038774 3300025928 Bacteria 3461
638 Ga0207700_10038856 3300025928 Bacteria 3458
639 Ga0207700_10530417 3300025928 Bacteria 1044
640 Ga0207664_10037901 3300025929 Bacteria 3734
641 Ga0207664_10310225 3300025929 Bacteria 1390
642 Ga0207644_10016379 3300025931 Bacteria 4987
643 Ga0207644_10029859 3300025931 Bacteria 3784
644 Ga0207644_10048690 3300025931 Bacteria 3032
645 Ga0207644_10534818 3300025931 Bacteria 969
646 Ga0207690_10010455 3300025932 Bacteria 5516
647 Ga0207690_10307559 3300025932 Bacteria 1242
648 Ga0207706_10010273 3300025933 Bacteria 8558
649 Ga0207706_10019439 3300025933 Bacteria 6112
650 Ga0207706_10053277 3300025933 Bacteria 3572
651 Ga0207706_10160825 3300025933 Bacteria 1974
652 Ga0207706_10409685 3300025933 Bacteria 1175
653 Ga0207686_10002278 3300025934 Bacteria 10539
654 Ga0207686_10009205 3300025934 Bacteria 5356
655 Ga0207686_10196287 3300025934 Bacteria 1442
656 Ga0207709_10002480 3300025935 Bacteria 11563
657 Ga0207709_10103755 3300025935 Bacteria 1885
658 Ga0207670_10000792 3300025936 Bacteria 16529
659 Ga0207669_10001389 3300025937 Bacteria 10299
660 Ga0207669_10165189 3300025937 Bacteria 1569
661 Ga0207704_10478771 3300025938 Bacteria 999
662 Ga0207665_10034351 3300025939 Bacteria 3364
663 Ga0207691_10009001 3300025940 Bacteria 9573
664 Ga0207691_10034563 3300025940 Bacteria 4699
665 Ga0207711_10009422 3300025941 Bacteria 8151
666 Ga0207711_10011627 3300025941 Bacteria 7313
667 Ga0207711_10046935 3300025941 Bacteria 3691
668 Ga0207711_10539283 3300025941 Bacteria 1088
669 Ga0207689_10000008 3300025942 Bacteria 127942
670 Ga0207661_10002577 3300025944 Bacteria 12474
671 Ga0207661_10254323 3300025944 Bacteria 1563
672 Ga0207679_10000085 3300025945 Bacteria 82493
673 Ga0207679_10004919 3300025945 Bacteria 8331
674 Ga0207679_10149819 3300025945 Bacteria 1897
675 Ga0207679_10158555 3300025945 Bacteria 1850
676 Ga0207667_10008690 3300025949 Bacteria 12035
677 Ga0207667_10017077 3300025949 Bacteria 8183
678 Ga0207667_10029863 3300025949 Bacteria 5905
679 Ga0207667_10080722 3300025949 Bacteria 3370
680 Ga0207651_10000292 3300025960 Bacteria 21406
681 Ga0207651_10013806 3300025960 Bacteria 4638
682 Ga0207651_10035767 3300025960 Bacteria 3234
683 Ga0207651_10230681 3300025960 Bacteria 1503
684 Ga0207712_10253608 3300025961 Bacteria 1423
685 Ga0207712_10265581 3300025961 Bacteria 1394
686 Ga0207668_10001329 3300025972 Bacteria 14678
687 Ga0207668_10062991 3300025972 Bacteria 2614
688 Ga0207668_10068701 3300025972 Bacteria 2520
689 Ga0207668_10175610 3300025972 Bacteria 1685
690 Ga0207668_10288539 3300025972 Bacteria 1349
691 Ga0207640_10000946 3300025981 Bacteria 16207
692 Ga0207640_10001339 3300025981 Bacteria 13347
693 Ga0207658_10008697 3300025986 Bacteria 6898
694 Ga0207658_10014450 3300025986 Bacteria 5406
695 Ga0207658_10026305 3300025986 Bacteria 4079
696 Ga0207658_10028752 3300025986 Bacteria 3919
697 Ga0207658_10089957 3300025986 Bacteria 2378
698 Ga0207677_10023807 3300026023 Bacteria 3790
699 Ga0207677_10030325 3300026023 Bacteria 3450
700 Ga0207703_10006686 3300026035 Bacteria 9198
701 Ga0207703_10048343 3300026035 Bacteria 3434
702 Ga0207703_10672537 3300026035 Bacteria 983
703 Ga0207639_10061983 3300026041 Bacteria 2890
704 Ga0207639_10198554 3300026041 Bacteria 1718
705 Ga0207639_10310928 3300026041 Bacteria 1396
706 Ga0207678_10000202 3300026067 Bacteria 52357
707 Ga0207678_10009486 3300026067 Bacteria 8558
708 Ga0207678_10092108 3300026067 Bacteria 2591
709 Ga0207678_10564253 3300026067 Bacteria 996
710 Ga0207708_10006642 3300026075 Bacteria 8558
711 Ga0207708_10075557 3300026075 Bacteria 2584
712 Ga0207708_10289801 3300026075 Bacteria 1329
713 Ga0207708_10473437 3300026075 Bacteria 1046
714 Ga0207702_10000294 3300026078 Bacteria 57746
715 Ga0207702_10025513 3300026078 Bacteria 4906
716 Ga0207702_10073289 3300026078 Bacteria 2952
717 Ga0207641_10004156 3300026088 Bacteria 12612
718 Ga0207641_10029014 3300026088 Bacteria 4574
719 Ga0207641_10279426 3300026088 Bacteria 1570
720 Ga0207648_10009518 3300026089 Bacteria 9297
721 Ga0207648_10040099 3300026089 Bacteria 4115
722 Ga0207648_10060737 3300026089 Bacteria 3296
723 Ga0207676_10000182 3300026095 Bacteria 55544
724 Ga0207676_10008809 3300026095 Bacteria 7183
725 Ga0207676_10018336 3300026095 Bacteria 5086
726 Ga0207676_10075023 3300026095 Bacteria 2727
727 Ga0207674_10012281 3300026116 Bacteria 9578
728 Ga0207674_10034038 3300026116 Bacteria 5328
729 Ga0207674_10058447 3300026116 Bacteria 3906
730 Ga0207674_10148377 3300026116 Bacteria 2303
731 Ga0207674_10550578 3300026116 Bacteria 1114
732 Ga0207674_10605528 3300026116 Bacteria 1058
733 Ga0207675_100009202 3300026118 Bacteria 9264
734 Ga0207675_100033365 3300026118 Bacteria 4796
735 Ga0207675_100223631 3300026118 Bacteria 1814
736 Ga0207675_100611305 3300026118 Bacteria 1094
737 Ga0207683_10008676 3300026121 Bacteria 8692
738 Ga0207683_10008899 3300026121 Bacteria 8558
739 Ga0207683_10152765 3300026121 Bacteria 2084
740 Ga0207683_10268527 3300026121 Bacteria 1558
741 Ga0207683_10394119 3300026121 Bacteria 1273
742 Ga0207698_10011050 3300026142 Bacteria 5837
743 Ga0207698_10014161 3300026142 Bacteria 5290
744 Ga0207698_10029219 3300026142 Bacteria 3944
745 Ga0207698_10364095 3300026142 Bacteria 1370
746 Ga0209969_1004460 3300027360 Bacteria 1958
747 Ga0209967_1000754 3300027364 Bacteria 4160
748 Ga0209981_1000239 3300027378 Bacteria 7055
749 Ga0210000_1000579 3300027462 Bacteria 5008
750 Ga0210000_1003860 3300027462 Bacteria 2168
751 Ga0209995_1004874 3300027471 Bacteria 2154
752 Ga0209179_1008622 3300027512 Bacteria 1724
753 Ga0209179_1019414 3300027512 Bacteria 1309
754 Ga0209999_1000289 3300027543 Bacteria 7421
755 Ga0209999_1001900 3300027543 Bacteria 3629
756 Ga0209983_1007917 3300027665 Bacteria 2174
757 Ga0209282_1000105 3300027666 Bacteria 54842
758 Ga0209588_1020430 3300027671 Bacteria 2074
759 Ga0209971_1007306 3300027682 Bacteria 2621
760 Ga0209966_1001543 3300027695 Bacteria 4002
761 Ga0209998_10001521 3300027717 Bacteria 5575
762 Ga0209998_10002524 3300027717 Bacteria 4168
763 Ga0209813_10015681 3300027866 Bacteria 2057
764 Ga0209974_10001584 3300027876 Bacteria 8235
765 Ga0209974_10014301 3300027876 Bacteria 2642
766 Ga0207428_10000115 3300027907 Bacteria 109072
767 Ga0207428_10001793 3300027907 Bacteria 21978
768 Ga0207428_10013664 3300027907 Bacteria 7082
769 Ga0268266_10016915 3300028379 Bacteria 6231
770 Ga0268266_10048810 3300028379 Bacteria 3628
771 Ga0268266_10131011 3300028379 Bacteria 2243
772 Ga0268266_10358671 3300028379 Bacteria 1371
773 Ga0268266_10641677 3300028379 Bacteria 1022
774 Ga0268265_10006061 3300028380 Bacteria 8213
775 Ga0268264_10015470 3300028381 Bacteria 6255
776 Ga0268264_10073561 3300028381 Bacteria 2901
777 Ga0268264_10262149 3300028381 Bacteria 1610
778 Ga0268264_10310622 3300028381 Bacteria 1487
779 Ga0265337_1000403 3300028556 Bacteria 23321
780 Ga0265334_10057842 3300028573 Bacteria 1468
781 Ga0307515_10000292 3300028794 Bacteria 123160
782 Ga0307515_10008051 3300028794 Bacteria 20654
783 Ga0307515_10192792 3300028794 Bacteria 1941
784 Ga0307515_10298673 3300028794 Bacteria 1298
785 Ga0265338_10011769 3300028800 Bacteria 10059
786 Ga0265338_10122133 3300028800 Bacteria 2074
787 Ga0265338_10267035 3300028800 Bacteria 1255
788 Ga0265338_10469888 3300028800 Bacteria 888
789 Ga0307511_10000019 3300030521 Bacteria 117947
790 Ga0307512_10044663 3300030522 Bacteria 3639
791 Ga0307512_10151369 3300030522 Bacteria 1387
792 Ga0307512_10193253 3300030522 Bacteria 1118
793 Ga0316177_1138189 3300030731 Bacteria 6745
794 Ga0314311_1143830 3300030733 Bacteria 1334
795 Ga0316178_1024177 3300030735 Bacteria 4492
796 Ga0316181_1116699 3300030744 Bacteria 14877
797 Ga0316182_1438880 3300030745 Bacteria 1723
798 Ga0265760_10002646 3300031090 Bacteria 5241
799 Ga0265330_10006763 3300031235 Bacteria 5653
800 Ga0265330_10018509 3300031235 Bacteria 3199
801 Ga0265330_10142406 3300031235 Bacteria 1019
802 Ga0265332_10002834 3300031238 Bacteria 8597
803 Ga0265325_10000026 3300031241 Bacteria 109937
804 Ga0265325_10000258 3300031241 Bacteria 37821
805 Ga0265325_10008677 3300031241 Bacteria 5982
806 Ga0265325_10008781 3300031241 Bacteria 5941
807 Ga0265325_10016270 3300031241 Bacteria 4160
808 Ga0265325_10103956 3300031241 Bacteria 1387
809 Ga0265340_10104016 3300031247 Bacteria 1317
810 Ga0265339_10000165 3300031249 Bacteria 55381
811 Ga0265339_10003955 3300031249 Bacteria 10246
812 Ga0265331_10006990 3300031250 Bacteria 6589
813 Ga0265331_10040370 3300031250 Bacteria 2270
814 Ga0265331_10137524 3300031250 Bacteria 1112
815 Ga0265327_10073180 3300031251 Bacteria 1710
816 Ga0265316_10065041 3300031344 Bacteria 2824
817 Ga0265316_10082669 3300031344 Bacteria 2460
818 Ga0265316_10108823 3300031344 Bacteria 2101
819 Ga0265316_10290501 3300031344 Bacteria 1193
820 Ga0307513_10007727 3300031456 Bacteria 13883
821 Ga0307513_10011033 3300031456 Bacteria 11270
822 Ga0307513_10046515 3300031456 Bacteria 4729
823 Ga0307513_10077565 3300031456 Bacteria 3440
824 Ga0307513_10275792 3300031456 Bacteria 1462
825 Ga0307513_10289529 3300031456 Bacteria 1410
826 Ga0307509_10028152 3300031507 Bacteria 6249
827 Ga0307509_10057042 3300031507 Bacteria 4143
828 Ga0307509_10171889 3300031507 Bacteria 2044
829 Ga0307408_100009496 3300031548 Bacteria 6417
830 Ga0307408_100048329 3300031548 Bacteria 3051
831 Ga0307408_100196147 3300031548 Bacteria 1630
832 Ga0307408_100244608 3300031548 Bacteria 1476
833 Ga0265313_10000072 3300031595 Bacteria 98635
834 Ga0265313_10000300 3300031595 Bacteria 53631
835 Ga0265313_10013430 3300031595 Bacteria 4916
836 Ga0265313_10024597 3300031595 Bacteria 3213
837 Ga0307508_10000248 3300031616 Bacteria 65511
838 Ga0307508_10058543 3300031616 Bacteria 3408
839 Ga0307514_10000890 3300031649 Bacteria 46600
840 Ga0307514_10020138 3300031649 Bacteria 5448
841 Ga0265314_10002865 3300031711 Bacteria 17158
842 Ga0265314_10002886 3300031711 Bacteria 17071
843 Ga0265314_10039095 3300031711 Bacteria 3421
844 Ga0265342_10000082 3300031712 Bacteria 102532
845 Ga0265342_10000291 3300031712 Bacteria 56828
846 Ga0265342_10063168 3300031712 Bacteria 2177
847 Ga0316576_10021360 3300031727 Bacteria 4476
848 Ga0316578_10070369 3300031728 Bacteria 2071
849 Ga0307516_10367075 3300031730 Bacteria 1103
850 Ga0307405_10156598 3300031731 Bacteria 1608
851 Ga0307405_10252338 3300031731 Bacteria 1313
852 Ga0307405_10602380 3300031731 Bacteria 897
853 Ga0307410_10197495 3300031852 Bacteria 1534
854 Ga0307406_10001484 3300031901 Bacteria 12954
855 Ga0307406_10049376 3300031901 Bacteria 2662
856 Ga0307412_10311318 3300031911 Bacteria 1249
857 Ga0307412_10780538 3300031911 Bacteria 827
858 Ga0307416_100182306 3300032002 Bacteria 1969
859 Ga0307416_100663617 3300032002 Bacteria 1129
860 Ga0307416_100741787 3300032002 Bacteria 1074
861 Ga0307507_10023773 3300033179 Bacteria 6708
862 Ga0307507_10051930 3300033179 Bacteria 3939
863 Ga0307507_10115233 3300033179 Bacteria 2176
864 Ga0307507_10151277 3300033179 Bacteria 1745
865 Ga0373930_0001137 3300034816 Bacteria 3874
866 Ga0373930_0017644 3300034816 Bacteria 1363
867 Ga0373948_0000530 3300034817 Bacteria 4783
868 Ga0373950_0001280 3300034818 Bacteria 3254
869 Ga0373958_0000935 3300034819 Bacteria 3771
870 Ga0373959_0002074 3300034820 Bacteria 3196
871 Ga0373959_0002994 3300034820 Bacteria 2686
872 Ga0373959_0033674 3300034820 Bacteria 1046
873 Ga0373938_0000237 3300034957 Bacteria 8612
874 Ga0373938_0001173 3300034957 Bacteria 4225
875 Ga0373938_0001763 3300034957 Bacteria 3453
876 Ga0373926_0013479 3300035083 Bacteria 2774
877 Ga0373928_0000547 3300035084 Bacteria 7337
878 Ga0373928_0006668 3300035084 Bacteria 2221
879 Ga0373929_0000699 3300035085 Bacteria 6489
880 Ga0373929_0005610 3300035085 Bacteria 2263
881 Ga0373929_0008455 3300035085 Bacteria 1897
882 Ga0373934_0005867 3300035086 Bacteria 4545
883 Ga0373934_0067237 3300035086 Bacteria 1431
884 Ga0373940_0001972 3300035088 Bacteria 3877
885 Ga0373940_0100003 3300035088 Bacteria 879
886 Ga0373944_0025022 3300035089 Bacteria 1755
887 Ga0373949_0002043 3300035090 Bacteria 5344
888 Ga0373949_0003337 3300035090 Bacteria 3853
889 Ga0373951_0003295 3300035091 Bacteria 3949
890 Ga0373951_0007696 3300035091 Bacteria 2446
891 Ga0373952_0000858 3300035092 Bacteria 5523
892 Ga0373952_0008149 3300035092 Bacteria 1982
893 Ga0373923_0001865 3300035111 Bacteria 6270
894 Ga0373923_0002073 3300035111 Bacteria 6062
895 Ga0373923_0032951 3300035111 Bacteria 2096
896 Ga0373932_0003430 3300035112 Bacteria 3812
897 Ga0373936_0008179 3300035113 Bacteria 3932
898 Ga0373936_0043737 3300035113 Bacteria 1801
899 Ga0373936_0046394 3300035113 Bacteria 1752
900 Ga0373936_0048530 3300035113 Bacteria 1714
901 Ga0373936_0071413 3300035113 Bacteria 1431
902 Ga0373939_0002937 3300035114 Bacteria 4007
903 Ga0373939_0006052 3300035114 Bacteria 2904
904 Ga0373941_0015410 3300035115 Bacteria 2061
905 Ga0373945_0009515 3300035116 Bacteria 3186
906 Ga0373945_0022704 3300035116 Bacteria 2163
907 Ga0373945_0106128 3300035116 Bacteria 1104
908 Ga0373945_0127372 3300035116 Bacteria 1017
909 Ga0373953_0000963 3300035117 Bacteria 8054
910 Ga0373953_0025962 3300035117 Bacteria 2242
911 Ga0373954_0000012 3300035118 Bacteria 73616
912 Ga0373954_0001647 3300035118 Bacteria 9138
913 Ga0373954_0006896 3300035118 Bacteria 4959
914 Ga0373954_0015121 3300035118 Bacteria 3448
915 Ga0373954_0029687 3300035118 Bacteria 2519
916 Ga0373954_0058374 3300035118 Bacteria 1818
917 Ga0373954_0207291 3300035118 Bacteria 963
918 Ga0373956_0000080 3300035119 Bacteria 31907
919 Ga0373956_0010369 3300035119 Bacteria 3818
920 Ga0373956_0019862 3300035119 Bacteria 2852
921 Ga0373956_0033838 3300035119 Bacteria 2249
922 Ga0373956_0048845 3300035119 Bacteria 1896
923 Ga0373956_0084062 3300035119 Bacteria 1463
924 Ga0373957_0013058 3300035120 Bacteria 2810
925 Ga0373957_0020035 3300035120 Bacteria 2360
926 Ga0373957_0024477 3300035120 Bacteria 2168
927 Ga0373960_0003754 3300035121 Bacteria 3451
928 Ga0373960_0006948 3300035121 Bacteria 2668
929 Ga0373943_0000525 3300035170 Bacteria 16583
930 Ga0373943_0032108 3300035170 Bacteria 2494
931 Ga0373946_0003308 3300035171 Bacteria 5723
932 Ga0373946_0007183 3300035171 Bacteria 4068
933 Ga0373946_0012822 3300035171 Bacteria 3143
934 Ga0373946_0029824 3300035171 Bacteria 2174
935 Ga0373946_0066484 3300035171 Bacteria 1546
936 Ga0373946_0190897 3300035171 Bacteria 977
937 Ga0373955_0006219 3300035172 Bacteria 5431
938 Ga0373955_0009768 3300035172 Bacteria 4508
939 Ga0373955_0043040 3300035172 Bacteria 2428
940 Ga0373955_0060816 3300035172 Bacteria 2084
941 Ga0373955_0088264 3300035172 Bacteria 1763
942 Ga0373955_0165691 3300035172 Bacteria 1306
943 Ga0373942_0004844 3300035207 Bacteria 3125
944 Ga0373942_0011363 3300035207 Bacteria 2110
945 Ga0373961_0006553 3300035241 Bacteria 2796
946 Ga0373961_0012233 3300035241 Bacteria 2145
947 Ga0373961_0015940 3300035241 Bacteria 1930
948 Ga0373961_0018134 3300035241 Bacteria 1835
949 Ga0373961_0055458 3300035241 Bacteria 1187
950 Ga0373962_0005838 3300035242 Bacteria 2971
951 Ga0373962_0012645 3300035242 Bacteria 2130
952 Ga0373924_0002930 3300035410 Bacteria 5792
953 Ga0373924_0007061 3300035410 Bacteria 4043
954 Ga0373924_0027762 3300035410 Bacteria 2252
955 Ga0373924_0029209 3300035410 Bacteria 2203
956 Ga0373924_0032775 3300035410 Bacteria 2094
957 Ga0373924_0103106 3300035410 Bacteria 1228
958 Ga0373924_0126870 3300035410 Bacteria 1109
959 Ga0373931_0004454 3300035691 Bacteria 6400
960 Ga0373931_0022581 3300035691 Bacteria 3168
961 Ga0373931_0041907 3300035691 Bacteria 2406
962 Ga0373931_0092532 3300035691 Bacteria 1687
963 Ga0373931_0154193 3300035691 Bacteria 1341
964 Ga0373931_0247137 3300035691 Bacteria 1083
965 Ga0373935_0000086 3300035692 Bacteria 40589
966 Ga0373935_0001093 3300035692 Bacteria 14823
967 Ga0373935_0008051 3300035692 Bacteria 6319
968 Ga0373935_0074146 3300035692 Bacteria 2199
969 Ga0373935_0107985 3300035692 Bacteria 1843
970 Ga0373935_0330396 3300035692 Bacteria 1083
971 Ga0373927_0002359 3300035695 Bacteria 13770
972 Ga0373927_0004290 3300035695 Bacteria 10007
973 Ga0373927_0015519 3300035695 Bacteria 5031
974 Ga0373927_0026329 3300035695 Bacteria 3800
975 Ga0373927_0034659 3300035695 Bacteria 3282
976 Ga0373927_0048502 3300035695 Bacteria 2747
977 Ga0373933_0000373 3300035724 Bacteria 28708
978 Ga0373933_0000862 3300035724 Bacteria 18590
979 Ga0373933_0001549 3300035724 Bacteria 13464
980 Ga0373933_0005461 3300035724 Bacteria 6922
981 Ga0373933_0037862 3300035724 Bacteria 2832
982 Ga0373933_0052171 3300035724 Bacteria 2446
983 Ga0373933_0092684 3300035724 Bacteria 1866
984 Ga0373933_0100035 3300035724 Bacteria 1798
985 Ga0373933_0155419 3300035724 Bacteria 1450
986 Ga0373947_0000096 3300035725 Bacteria 44841
987 Ga0373947_0000288 3300035725 Bacteria 28482
988 Ga0373947_0000837 3300035725 Bacteria 18592
989 Ga0373947_0020805 3300035725 Bacteria 3792
990 Ga0373947_0042688 3300035725 Bacteria 2707
991 Ga0373947_0094304 3300035725 Bacteria 1871
992 Ga0373937_0000198 3300036401 Bacteria 59112
993 Ga0373937_0000996 3300036401 Bacteria 24045
994 Ga0373937_0001196 3300036401 Bacteria 21800
995 Ga0373937_0002420 3300036401 Bacteria 15516
996 Ga0373937_0004708 3300036401 Bacteria 11605
997 Ga0373937_0012002 3300036401 Bacteria 7606
998 Ga0373937_0016752 3300036401 Bacteria 6514
999 Ga0373937_0062971 3300036401 Bacteria 3410
1000 Ga0373937_0085628 3300036401 Bacteria 2916
1001 Ga0316584_0039976 3300036712 Bacteria 3494
1002 Ga0373925_0000071 3300037068 Bacteria 106825
1003 Ga0373925_0005184 3300037068 Bacteria 9753
1004 Ga0373925_0025094 3300037068 Bacteria 4353
1005 Ga0373925_0039484 3300037068 Bacteria 3491
1006 Ga0373925_0078281 3300037068 Bacteria 2511
1007 Ga0373925_0128987 3300037068 Bacteria 1970
1008 Ga0373925_0151336 3300037068 Bacteria 1822
1009 Ga0373925_0195558 3300037068 Bacteria 1606
1010 Ga0395899_0045204 3300037312 Bacteria 3281
1011 Ga0395900_0005355 3300037418 Bacteria 13446
1012 Ga0395900_0009172 3300037418 Bacteria 10138
1013 Ga0395900_0023179 3300037418 Bacteria 6354
1014 Ga0395900_0030518 3300037418 Bacteria 5535
1015 Ga0395900_0030673 3300037418 Bacteria 5520
1016 Ga0395900_0385494 3300037418 Bacteria 1369
1017 Ga0395898_0025102 3300037466 Bacteria 6009
1018 Ga0395898_0039335 3300037466 Bacteria 4681
1019 Ga0395898_0098632 3300037466 Bacteria 2805
1020 Ga0395898_0110477 3300037466 Bacteria 2635
1021 Ga0395905_0007343 3300037471 Bacteria 10975
1022 Ga0395905_0019208 3300037471 Bacteria 6481
1023 Ga0395905_0107527 3300037471 Bacteria 2619
1024 Ga0436364_0143743 3300037853 Bacteria 23977
1025 Ga0436364_1405230 3300037853 Bacteria 14749
1026 Ga0395901_0004298 3300038443 Bacteria 14368
1027 Ga0395901_0111770 3300038443 Bacteria 2869
1028 Ga0395901_0169640 3300038443 Bacteria 2290
1029 Ga0242420_001963 3300038996 Bacteria 2859
1030 Ga0436365_1178757 3300039437 Bacteria 823
1031 Ga0436365_1584283 3300039437 Bacteria 16431
1032 Ga0436360_1218633 3300039438 Bacteria 2178
1033 Ga0436361_0066245 3300039447 Bacteria 38634
1034 Ga0436362_0484821 3300039453 Bacteria 1804
1035 Ga0439436_0000775 3300041404 Bacteria 8654
1036 Ga0439436_0043605 3300041404 Bacteria 1279
1037 Ga0439438_000172 3300041405 Bacteria 28804
1038 Ga0439439_0006506 3300041406 Bacteria 2704
1039 Ga0439447_036061 3300041407 Bacteria 1223
1040 Ga0439447_043930 3300041407 Bacteria 1082
1041 Ga0439461_0002041 3300041410 Bacteria 3193
1042 Ga0439466_0000919 3300041411 Bacteria 11259
1043 Ga0439466_0052802 3300041411 Bacteria 1328
1044 Ga0439465_0001472 3300041413 Bacteria 7631
1045 Ga0439431_0000651 3300041997 Bacteria 7389
1046 Ga0439442_005663 3300042002 Bacteria 2500
1047 Ga0439445_0000311 3300042004 Bacteria 9444
1048 Ga0439432_000634 3300042006 Bacteria 13192
1049 Ga0439432_000839 3300042006 Bacteria 11492
1050 Ga0439432_048569 3300042006 Bacteria 1329
1051 Ga0439449_0001169 3300042007 Bacteria 10300
1052 Ga0439449_0071617 3300042007 Bacteria 1277
1053 Ga0439452_007246 3300042010 Bacteria 3410
1054 Ga0439452_014273 3300042010 Bacteria 2210
1055 Ga0439457_006925 3300042014 Bacteria 2742
1056 Ga0439462_0000245 3300042015 Bacteria 9690
1057 Ga0439463_009804 3300042016 Bacteria 2353
1058 Ga0450906_008920 3300042145 Bacteria 1925
1059 Ga0439446_0000318 3300042156 Bacteria 9223
1060 Ga0439446_0000836 3300042156 Bacteria 6584
1061 Ga0439434_0000294 3300042435 Bacteria 14301
1062 Ga0439434_0008498 3300042435 Bacteria 3010
1063 Ga0439434_0102640 3300042435 Bacteria 922
1064 Ga0439435_0000060 3300042436 Bacteria 12857
1065 Ga0450916_020341 3300042530 Bacteria 907
1066 Ga0450893_0012840 3300042532 Bacteria 1393
1067 Ga0466965_0019810 3300044683 Bacteria 3231
1068 Ga0466966_0053889 3300044684 Bacteria 2551
1069 Ga0466963_0103318 3300044694 Bacteria 1952
1070 Ga0466963_0169674 3300044694 Bacteria 1521
1071 Ga0466964_0022269 3300044706 Bacteria 2457
1072 Ga0453684_0389327 3300044712 Bacteria 1564
1073 Ga0466971_0110042 3300044719 Bacteria 1271
1074 Ga0466957_0151547 3300044842 Bacteria 1500
1075 Ga0466957_0198811 3300044842 Bacteria 1316
1076 Ga0466959_0153079 3300045049 Bacteria 1624
1077 Ga0466959_0181286 3300045049 Bacteria 1473
1078 Ga0466958_0019850 3300045836 Bacteria 3915
1079 Ga0466967_0002811 3300045976 Bacteria 11040
1080 Ga0466967_0008390 3300045976 Bacteria 7562
1081 Ga0466967_0309468 3300045976 Bacteria 1521
1082 Ga0466967_0677743 3300045976 Bacteria 1020
1083 Ga0495617_025618 3300046452 Bacteria 1988
1084 Ga0495617_043193 3300046452 Bacteria 1504
1085 Ga0495627_005899 3300046453 Bacteria 4868
1086 Ga0495592_0000117 3300046454 Bacteria 69975
1087 Ga0495592_0023908 3300046454 Bacteria 4648
1088 Ga0495592_0031275 3300046454 Bacteria 4023
1089 Ga0495592_0031460 3300046454 Bacteria 4010
1090 Ga0495592_0074670 3300046454 Bacteria 2463
1091 Ga0495592_0089572 3300046454 Bacteria 2209
1092 Ga0495592_0173566 3300046454 Bacteria 1474
1093 Ga0495592_0184893 3300046454 Bacteria 1417
1094 Ga0495592_0243356 3300046454 Bacteria 1192
1095 Ga0495592_0291141 3300046454 Bacteria 1064
1096 Ga0495603_0008338 3300046455 Bacteria 6265
1097 Ga0495603_0028846 3300046455 Bacteria 3348
1098 Ga0495603_0237029 3300046455 Bacteria 1051
1099 Ga0495591_000635 3300046458 Bacteria 26048
1100 Ga0495629_0000183 3300046459 Bacteria 56534
1101 Ga0495629_0008700 3300046459 Bacteria 7470
1102 Ga0495629_0010435 3300046459 Bacteria 6758
1103 Ga0495629_0022122 3300046459 Bacteria 4533
1104 Ga0495638_0001364 3300046460 Bacteria 22407
1105 Ga0495638_0019805 3300046460 Bacteria 4448
1106 Ga0495638_0044966 3300046460 Bacteria 2780
1107 Ga0495638_0149314 3300046460 Bacteria 1357
1108 Ga0495641_0014858 3300046461 Bacteria 4193
1109 Ga0495641_0024360 3300046461 Bacteria 2989
1110 Ga0495641_0048412 3300046461 Bacteria 1949
1111 Ga0495641_0062845 3300046461 Bacteria 1674
1112 Ga0495651_0000370 3300046462 Bacteria 34672
1113 Ga0495651_0000814 3300046462 Bacteria 24156
1114 Ga0495651_0002238 3300046462 Bacteria 14939
1115 Ga0495651_0006676 3300046462 Bacteria 8825
1116 Ga0495651_0007700 3300046462 Bacteria 8237
1117 Ga0495651_0009079 3300046462 Bacteria 7631
1118 Ga0495651_0018701 3300046462 Bacteria 5368
1119 Ga0495651_0080495 3300046462 Bacteria 2460
1120 Ga0495651_0106382 3300046462 Bacteria 2080
1121 Ga0495651_0132388 3300046462 Bacteria 1819
1122 Ga0495653_0000047 3300046463 Bacteria 111093
1123 Ga0495653_0005190 3300046463 Bacteria 10590
1124 Ga0495653_0007193 3300046463 Bacteria 9123
1125 Ga0495653_0010604 3300046463 Bacteria 7545
1126 Ga0495653_0096770 3300046463 Bacteria 2146
1127 Ga0495650_0001103 3300046471 Bacteria 29585
1128 Ga0495650_0001463 3300046471 Bacteria 22653
1129 Ga0495650_0094670 3300046471 Bacteria 1130
1130 Ga0495580_0007138 3300046472 Bacteria 8997
1131 Ga0495580_0025075 3300046472 Bacteria 4359
1132 Ga0495580_0070025 3300046472 Bacteria 2450
1133 Ga0495580_0154976 3300046472 Unclassified 1586
1134 Ga0495580_0188929 3300046472 Bacteria 1421
1135 Ga0495582_0001121 3300046473 Bacteria 15057
1136 Ga0495582_0024945 3300046473 Bacteria 3274
1137 Ga0495582_0223304 3300046473 Bacteria 1078
1138 Ga0495605_0000704 3300046474 Bacteria 24856
1139 Ga0495639_0050356 3300046475 Bacteria 1892
1140 Ga0495639_0196011 3300046475 Bacteria 987
1141 Ga0495662_0005350 3300046476 Bacteria 6428
1142 Ga0495662_0006315 3300046476 Bacteria 5925
1143 Ga0495662_0010112 3300046476 Bacteria 4626
1144 Ga0495662_0014982 3300046476 Bacteria 3766
1145 Ga0495662_0030200 3300046476 Bacteria 2616
1146 Ga0495662_0044862 3300046476 Bacteria 2134
1147 Ga0495662_0151810 3300046476 Bacteria 1141
1148 Ga0495662_0198283 3300046476 Bacteria 990
1149 Ga0495664_0000024 3300046477 Bacteria 126593
1150 Ga0495664_0005136 3300046477 Bacteria 7182
1151 Ga0495664_0057217 3300046477 Bacteria 2319
1152 Ga0495584_0010326 3300046491 Bacteria 4799
1153 Ga0495584_0063845 3300046491 Bacteria 1851
1154 Ga0495585_0003428 3300046492 Bacteria 10719
1155 Ga0495585_0117879 3300046492 Bacteria 1406
1156 Ga0495594_0005327 3300046499 Bacteria 6605
1157 Ga0495596_0000234 3300046500 Bacteria 37677
1158 Ga0495596_0000399 3300046500 Bacteria 27679
1159 Ga0495596_0000473 3300046500 Bacteria 25450
1160 Ga0495607_0003341 3300046501 Bacteria 12309
1161 Ga0495607_0005354 3300046501 Bacteria 9219
1162 Ga0495607_0005459 3300046501 Bacteria 9094
1163 Ga0495607_0009340 3300046501 Bacteria 6643
1164 Ga0495583_0000330 3300046506 Bacteria 74846
1165 Ga0495606_0000028 3300046507 Bacteria 251032
1166 Ga0495608_0000004 3300046511 Bacteria 355027
1167 Ga0495608_0002221 3300046511 Bacteria 14008
1168 Ga0495608_0005426 3300046511 Bacteria 9120
1169 Ga0495608_0006145 3300046511 Bacteria 8524
1170 Ga0495608_0015766 3300046511 Bacteria 5230
1171 Ga0495608_0074903 3300046511 Bacteria 2206
1172 Ga0495608_0270471 3300046511 Bacteria 1056
1173 Ga0495610_0001083 3300046512 Bacteria 24897
1174 Ga0495610_0011354 3300046512 Bacteria 5454
1175 Ga0495616_0003188 3300046513 Bacteria 10576
1176 Ga0495616_0005373 3300046513 Bacteria 7902
1177 Ga0495616_0008254 3300046513 Bacteria 6179
1178 Ga0495616_0010366 3300046513 Bacteria 5399
1179 Ga0495618_0000036 3300046514 Bacteria 101535
1180 Ga0495618_0007467 3300046514 Bacteria 6611
1181 Ga0495618_0010775 3300046514 Bacteria 5536
1182 Ga0495618_0013409 3300046514 Bacteria 4987
1183 Ga0495618_0022634 3300046514 Bacteria 3882
1184 Ga0495618_0032170 3300046514 Bacteria 3285
1185 Ga0495618_0051200 3300046514 Bacteria 2609
1186 Ga0495618_0058548 3300046514 Bacteria 2440
1187 Ga0495618_0089004 3300046514 Bacteria 1974
1188 Ga0495628_0000006 3300046516 Bacteria 306606
1189 Ga0495628_0000950 3300046516 Bacteria 26607
1190 Ga0495628_0011003 3300046516 Bacteria 7661
1191 Ga0495628_0021837 3300046516 Bacteria 5260
1192 Ga0495628_0037732 3300046516 Bacteria 3873
1193 Ga0495628_0063284 3300046516 Bacteria 2899
1194 Ga0495628_0084826 3300046516 Bacteria 2457
1195 Ga0495628_0113498 3300046516 Bacteria 2082
1196 Ga0495630_0000647 3300046517 Bacteria 25227
1197 Ga0495630_0000958 3300046517 Bacteria 20204
1198 Ga0495630_0027554 3300046517 Bacteria 4216
1199 Ga0495630_0037719 3300046517 Bacteria 3614
1200 Ga0495630_0053102 3300046517 Bacteria 3034
1201 Ga0495630_0141497 3300046517 Bacteria 1829
1202 Ga0495630_0153683 3300046517 Bacteria 1751
1203 Ga0495631_0000135 3300046518 Bacteria 50021
1204 Ga0495631_0088284 3300046518 Bacteria 1335
1205 Ga0495637_0067592 3300046520 Bacteria 1450
1206 Ga0495644_0000234 3300046523 Bacteria 26118
1207 Ga0495644_0000544 3300046523 Bacteria 15928
1208 Ga0495648_0000454 3300046524 Bacteria 44377
1209 Ga0495648_0000877 3300046524 Bacteria 31708
1210 Ga0495648_0003768 3300046524 Bacteria 13191
1211 Ga0495666_0001961 3300046526 Bacteria 10144
1212 Ga0495666_0038805 3300046526 Bacteria 2315
1213 Ga0495666_0045895 3300046526 Bacteria 2107
1214 Ga0495666_0069489 3300046526 Bacteria 1675
1215 Ga0495642_0053057 3300046528 Bacteria 1670
1216 Ga0495652_0000038 3300046529 Bacteria 129311
1217 Ga0495652_0002257 3300046529 Bacteria 20113
1218 Ga0495652_0005721 3300046529 Bacteria 11644
1219 Ga0495652_0051353 3300046529 Bacteria 3522
1220 Ga0495652_0067574 3300046529 Bacteria 2996
1221 Ga0495652_0098554 3300046529 Bacteria 2376
1222 Ga0495652_0150503 3300046529 Bacteria 1819
1223 Ga0495652_0311965 3300046529 Bacteria 1139
1224 Ga0495654_0000458 3300046530 Bacteria 34120
1225 Ga0495665_0000503 3300046531 Bacteria 19683
1226 Ga0495665_0065933 3300046531 Bacteria 1911
1227 Ga0495665_0171539 3300046531 Bacteria 1129
1228 Ga0495665_0263839 3300046531 Bacteria 885
1229 Ga0495640_0000001 3300046533 Bacteria 853827
1230 Ga0495640_0007495 3300046533 Bacteria 8573
1231 Ga0495640_0009446 3300046533 Bacteria 7597
1232 Ga0495640_0011562 3300046533 Bacteria 6786
1233 Ga0495640_0012982 3300046533 Bacteria 6347
1234 Ga0495640_0018366 3300046533 Bacteria 5190
1235 Ga0495640_0019735 3300046533 Bacteria 4972
1236 Ga0495640_0030156 3300046533 Bacteria 3886
1237 Ga0495640_0065064 3300046533 Bacteria 2463
1238 Ga0495640_0087440 3300046533 Bacteria 2061
1239 Ga0495640_0118754 3300046533 Bacteria 1721
1240 Ga0495586_0003967 3300046535 Bacteria 7940
1241 Ga0495586_0011977 3300046535 Bacteria 4608
1242 Ga0495586_0015139 3300046535 Bacteria 4104
1243 Ga0495586_0078426 3300046535 Bacteria 1812
1244 Ga0495586_0116328 3300046535 Bacteria 1491
1245 Ga0495587_0000004 3300046536 Bacteria 358433
1246 Ga0495587_0002205 3300046536 Bacteria 13019
1247 Ga0495587_0002956 3300046536 Bacteria 11364
1248 Ga0495587_0016926 3300046536 Bacteria 4535
1249 Ga0495587_0044529 3300046536 Bacteria 2639
1250 Ga0495587_0046773 3300046536 Bacteria 2567
1251 Ga0495587_0101778 3300046536 Bacteria 1654
1252 Ga0495587_0227286 3300046536 Bacteria 1052
1253 Ga0495587_0237797 3300046536 Bacteria 1025
1254 Ga0495609_0002139 3300046538 Bacteria 12423
1255 Ga0495609_0003061 3300046538 Bacteria 9822
1256 Ga0495609_0068622 3300046538 Bacteria 1560
1257 Ga0495621_0043543 3300046539 Bacteria 1584
1258 Ga0495621_0051238 3300046539 Bacteria 1477
1259 Ga0495597_0000375 3300046542 Bacteria 39117
1260 Ga0495645_0000001 3300046543 Bacteria 657910
1261 Ga0495645_0000432 3300046543 Bacteria 28796
1262 Ga0495645_0001487 3300046543 Bacteria 15879
1263 Ga0495645_0008752 3300046543 Bacteria 7069
1264 Ga0495645_0024643 3300046543 Bacteria 4366
1265 Ga0495645_0028082 3300046543 Bacteria 4088
1266 Ga0495645_0105019 3300046543 Bacteria 2005
1267 Ga0495645_0239708 3300046543 Bacteria 1211
1268 Ga0495622_0024244 3300046557 Bacteria 2833
1269 Ga0495622_0027655 3300046557 Bacteria 2647
1270 Ga0495622_0076085 3300046557 Bacteria 1547
1271 Ga0495633_0002799 3300046558 Bacteria 12057
1272 Ga0495633_0005806 3300046558 Bacteria 7447
1273 Ga0495667_0000093 3300046559 Bacteria 65066
1274 Ga0495667_0001799 3300046559 Bacteria 14228
1275 Ga0495667_0008800 3300046559 Bacteria 6864
1276 Ga0495667_0010769 3300046559 Bacteria 6183
1277 Ga0495667_0026230 3300046559 Bacteria 3926
1278 Ga0495667_0029736 3300046559 Bacteria 3677
1279 Ga0495667_0067176 3300046559 Bacteria 2343
1280 Ga0495667_0130871 3300046559 Bacteria 1618
1281 Ga0495667_0256305 3300046559 Bacteria 1113
1282 Ga0495656_0000174 3300046615 Bacteria 22784
1283 Ga0495656_0002877 3300046615 Bacteria 5766
1284 Ga0495668_0001029 3300046616 Bacteria 29567
1285 Ga0495668_0007077 3300046616 Bacteria 7223
1286 Ga0495634_0000133 3300046642 Bacteria 64326
1287 Ga0495634_0004412 3300046642 Bacteria 11057
1288 Ga0495634_0014033 3300046642 Bacteria 5786
1289 Ga0495634_0016098 3300046642 Bacteria 5352
1290 Ga0495634_0033066 3300046642 Bacteria 3555
1291 Ga0495634_0034169 3300046642 Bacteria 3489
1292 Ga0495634_0035265 3300046642 Bacteria 3428
1293 Ga0495634_0114725 3300046642 Bacteria 1729
1294 Ga0495634_0206571 3300046642 Bacteria 1217
1295 Ga0495634_0326107 3300046642 Bacteria 923
1296 Ga0495611_0001362 3300046648 Bacteria 12296
1297 Ga0495611_0023408 3300046648 Bacteria 2680
1298 Ga0495625_0003687 3300046660 Bacteria 14983
1299 Ga0495625_0150502 3300046660 Bacteria 1565
1300 Ga0495635_0000003 3300046663 Bacteria 390055
1301 Ga0495635_0000646 3300046663 Bacteria 22393
1302 Ga0495635_0006494 3300046663 Bacteria 8155
1303 Ga0495635_0034212 3300046663 Bacteria 3524
1304 Ga0495635_0046921 3300046663 Bacteria 2980
1305 Ga0495635_0073971 3300046663 Bacteria 2334
1306 Ga0495635_0105275 3300046663 Bacteria 1927
1307 Ga0495635_0119512 3300046663 Bacteria 1798
1308 Ga0495635_0411470 3300046663 Bacteria 897
1309 Ga0495659_0000220 3300046664 Bacteria 24427
1310 Ga0495659_0000800 3300046664 Bacteria 11274
1311 Ga0495661_0000013 3300046665 Bacteria 259387
1312 Ga0495661_0000842 3300046665 Bacteria 28593
1313 Ga0495661_0009170 3300046665 Bacteria 6798
1314 Ga0495661_0012410 3300046665 Bacteria 5752
1315 Ga0495588_0037137 3300046674 Bacteria 2474
1316 Ga0495657_0000143 3300046675 Bacteria 64334
1317 Ga0495657_0013257 3300046675 Bacteria 6088
1318 Ga0495657_0021999 3300046675 Bacteria 4571
1319 Ga0495657_0047823 3300046675 Bacteria 2889
1320 Ga0495657_0172690 3300046675 Bacteria 1330
1321 Ga0495657_0308428 3300046675 Bacteria 943
1322 Ga0495599_0000012 3300046678 Bacteria 181156
1323 Ga0495599_0004908 3300046678 Bacteria 7950
1324 Ga0495599_0018735 3300046678 Bacteria 4314
1325 Ga0495599_0027283 3300046678 Bacteria 3579
1326 Ga0495599_0075037 3300046678 Bacteria 2111
1327 Ga0495599_0109570 3300046678 Bacteria 1720
1328 Ga0495623_0000015 3300046679 Bacteria 117329
1329 Ga0495623_0001145 3300046679 Bacteria 17934
1330 Ga0495623_0004582 3300046679 Bacteria 9082
1331 Ga0495623_0007637 3300046679 Bacteria 7025
1332 Ga0495623_0058539 3300046679 Bacteria 2422
1333 Ga0495646_0000005 3300046680 Bacteria 266899
1334 Ga0495646_0002872 3300046680 Bacteria 10666
1335 Ga0495646_0006953 3300046680 Bacteria 7181
1336 Ga0495646_0024002 3300046680 Bacteria 3839
1337 Ga0495646_0051560 3300046680 Bacteria 2490
1338 Ga0495646_0082369 3300046680 Bacteria 1872
1339 Ga0495646_0299562 3300046680 Bacteria 851
1340 Ga0495647_0013152 3300046681 Bacteria 2863
1341 Ga0495647_0200982 3300046681 Bacteria 874
1342 Ga0495658_0000357 3300046683 Bacteria 25736
1343 Ga0495658_0009686 3300046683 Bacteria 4804
1344 Ga0495658_0020305 3300046683 Bacteria 3484
1345 Ga0495658_0021749 3300046683 Bacteria 3385
1346 Ga0495658_0064782 3300046683 Bacteria 2106
1347 Ga0495658_0069789 3300046683 Bacteria 2037
1348 Ga0495658_0275730 3300046683 Bacteria 1060
1349 Ga0495613_0002012 3300046689 Bacteria 15438
1350 Ga0495613_0009346 3300046689 Bacteria 7273
1351 Ga0495613_0081586 3300046689 Bacteria 2349
1352 Ga0495613_0143411 3300046689 Bacteria 1705
1353 Ga0495613_0160507 3300046689 Bacteria 1599
1354 Ga0495613_0555356 3300046689 Bacteria 768
1355 Ga0495624_0003776 3300046690 Bacteria 11191
1356 Ga0495624_0024161 3300046690 Bacteria 4000
1357 Ga0495624_0031164 3300046690 Bacteria 3470
1358 Ga0495624_0114792 3300046690 Bacteria 1655
1359 Ga0495624_0234012 3300046690 Bacteria 1112
1360 Ga0495624_0339736 3300046690 Bacteria 903
1361 Ga0495670_0000414 3300046691 Bacteria 20494
1362 Ga0495670_0001448 3300046691 Bacteria 11602
1363 Ga0495671_0001254 3300046692 Bacteria 17340
1364 Ga0495671_0015456 3300046692 Bacteria 4088
1365 Ga0495671_0040031 3300046692 Bacteria 2365
1366 Ga0495671_0169826 3300046692 Bacteria 1060
1367 Ga0495649_0008623 3300046694 Bacteria 6122
1368 Ga0495649_0044452 3300046694 Bacteria 2425
1369 Ga0495589_0035216 3300046794 Bacteria 2510
1370 Ga0495589_0125734 3300046794 Bacteria 1233
1371 Ga0495589_0151085 3300046794 Bacteria 1109
1372 Ga0495600_0000051 3300046809 Bacteria 69572
1373 Ga0495600_0003472 3300046809 Bacteria 9271
1374 Ga0495600_0007486 3300046809 Bacteria 6681
1375 Ga0495600_0019409 3300046809 Bacteria 4341
1376 Ga0495600_0022417 3300046809 Bacteria 4054
1377 Ga0495600_0037657 3300046809 Bacteria 3145
1378 Ga0495600_0190871 3300046809 Bacteria 1317
1379 Ga0495581_0001486 3300047315 Bacteria 13059
1380 Ga0495581_0010000 3300047315 Bacteria 5486
1381 Ga0495581_0012865 3300047315 Bacteria 4847
1382 Ga0495581_0015516 3300047315 Bacteria 4422
1383 Ga0495581_0041982 3300047315 Bacteria 2648
1384 Ga0495581_0117749 3300047315 Bacteria 1545
1385 Ga0495604_0000002 3300047317 Bacteria 530904
1386 Ga0495604_0003656 3300047317 Bacteria 12254
1387 Ga0495604_0017648 3300047317 Bacteria 5712
1388 Ga0495604_0048780 3300047317 Bacteria 3292
1389 Ga0495604_0115217 3300047317 Bacteria 1953
1390 Ga0495604_0137824 3300047317 Bacteria 1747
1391 Ga0495604_0212198 3300047317 Bacteria 1337
1392 Ga0495636_0000153 3300047318 Bacteria 27389
1393 Ga0495674_0000004 3300047319 Bacteria 531855
1394 Ga0495674_0007346 3300047319 Bacteria 10535
1395 Ga0495674_0024907 3300047319 Bacteria 5492
1396 Ga0495674_0025291 3300047319 Bacteria 5446
1397 Ga0495674_0048298 3300047319 Bacteria 3766
1398 Ga0495674_0051878 3300047319 Bacteria 3613
1399 Ga0495674_0069597 3300047319 Bacteria 3042
1400 Ga0495674_0155587 3300047319 Bacteria 1915
1401 Ga0495674_0215392 3300047319 Bacteria 1589
1402 Ga0495674_0441819 3300047319 Bacteria 1046
1403 Ga0495672_0007385 3300047320 Bacteria 8272
1404 Ga0495672_0013407 3300047320 Bacteria 5657
1405 Ga0495676_0008678 3300047321 Bacteria 9304
1406 Ga0495676_0036656 3300047321 Bacteria 4092
1407 Ga0495680_0000142 3300047322 Bacteria 72324
1408 Ga0495680_0001462 3300047322 Bacteria 25495
1409 Ga0495680_0001925 3300047322 Bacteria 21809
1410 Ga0495680_0005045 3300047322 Bacteria 12473
1411 Ga0495680_0011214 3300047322 Bacteria 7958
1412 Ga0495680_0012241 3300047322 Bacteria 7561
1413 Ga0495680_0017639 3300047322 Bacteria 6085
1414 Ga0495680_0027679 3300047322 Bacteria 4653
1415 Ga0495680_0054253 3300047322 Bacteria 3113
1416 Ga0495680_0054369 3300047322 Bacteria 3110
1417 Ga0495680_0081387 3300047322 Bacteria 2444
1418 Ga0495680_0308341 3300047322 Bacteria 1110
1419 Ga0495680_0480262 3300047322 Bacteria 846
1420 Ga0495683_0000086 3300047323 Bacteria 92967
1421 Ga0495683_0000919 3300047323 Bacteria 20760
1422 Ga0495683_0001329 3300047323 Bacteria 16577
1423 Ga0495687_000498 3300047443 Bacteria 47324
1424 Ga0495675_0000824 3300047444 Bacteria 19028
1425 Ga0495675_0004498 3300047444 Bacteria 8447
1426 Ga0495675_0005626 3300047444 Bacteria 7651
1427 Ga0495675_0057907 3300047444 Bacteria 2457
1428 Ga0495675_0087847 3300047444 Bacteria 1953
1429 Ga0495675_0099781 3300047444 Bacteria 1818
1430 Ga0495675_0287973 3300047444 Bacteria 978
1431 Ga0495677_0000593 3300047445 Bacteria 14849
1432 Ga0495679_000078 3300047446 Bacteria 91220
1433 Ga0495685_000010 3300047447 Bacteria 84950
1434 Ga0495685_006895 3300047447 Bacteria 3736
1435 Ga0495673_0003866 3300047469 Bacteria 9654
1436 Ga0495673_0004187 3300047469 Bacteria 9112
1437 Ga0495673_0007764 3300047469 Bacteria 6119
1438 Ga0495673_0105981 3300047469 Bacteria 1130
1439 Ga0495684_0000004 3300047471 Bacteria 307093
1440 Ga0495684_0001528 3300047471 Bacteria 18538
1441 Ga0495684_0006621 3300047471 Bacteria 8987
1442 Ga0495684_0033070 3300047471 Bacteria 3970
1443 Ga0495684_0040269 3300047471 Bacteria 3582
1444 Ga0495684_0042457 3300047471 Bacteria 3483
1445 Ga0495684_0100776 3300047471 Bacteria 2184
1446 Ga0495684_0101182 3300047471 Bacteria 2179
1447 Ga0495684_0110807 3300047471 Bacteria 2071
1448 Ga0495684_0199991 3300047471 Bacteria 1474
1449 Ga0495686_0059784 3300047472 Bacteria 2371
1450 Ga0495593_0004166 3300047673 Bacteria 8606
1451 Ga0495593_0025461 3300047673 Bacteria 3275
1452 Ga0495593_0078254 3300047673 Bacteria 1713
1453 Ga0495593_0156173 3300047673 Bacteria 1153
1454 Ga0495602_0000001 3300048088 Bacteria 510904
1455 Ga0495602_0004084 3300048088 Bacteria 15203
1456 Ga0495602_0038074 3300048088 Bacteria 4453
1457 Ga0495602_0067303 3300048088 Bacteria 3082
1458 Ga0495602_0227961 3300048088 Bacteria 1402
1459 Ga0495614_0001174 3300048089 Bacteria 11241
1460 Ga0495614_0106141 3300048089 Bacteria 1231
1461 Ga0495626_0001516 3300048091 Bacteria 18301
1462 Ga0496100_0000066 3300048903 Bacteria 58885
1463 Ga0496100_0002624 3300048903 Bacteria 9166
1464 Ga0496100_0032409 3300048903 Bacteria 3259
1465 Ga0496100_0040924 3300048903 Bacteria 2951
1466 Ga0496100_0088506 3300048903 Bacteria 2107
1467 Ga0496100_0096905 3300048903 Bacteria 2025
1468 Ga0496101_0000154 3300048904 Bacteria 58517
1469 Ga0496101_0003320 3300048904 Bacteria 10009
1470 Ga0496101_0015113 3300048904 Bacteria 5195
1471 Ga0496101_0020381 3300048904 Bacteria 4537
1472 Ga0496101_0048987 3300048904 Bacteria 3037
1473 Ga0496101_0412861 3300048904 Bacteria 1064
1474 Ga0496102_0000191 3300048905 Bacteria 83369
1475 Ga0496102_0006722 3300048905 Bacteria 9824
1476 Ga0496102_0024677 3300048905 Bacteria 5346
1477 Ga0496102_0025462 3300048905 Bacteria 5267
1478 Ga0496102_0062282 3300048905 Bacteria 3416
1479 Ga0496102_0107194 3300048905 Bacteria 2601
1480 Ga0496102_0130447 3300048905 Bacteria 2352
1481 Ga0496102_0166352 3300048905 Bacteria 2075
1482 Ga0496102_0283874 3300048905 Bacteria 1560
1483 Ga0496103_0000232 3300048906 Bacteria 54569
1484 Ga0496103_0002570 3300048906 Bacteria 11377
1485 Ga0496103_0010404 3300048906 Bacteria 5504
1486 Ga0496103_0022797 3300048906 Bacteria 3771
1487 Ga0496103_0123516 3300048906 Bacteria 1650
1488 Ga0496104_0000560 3300048907 Bacteria 31696
1489 Ga0496104_0001363 3300048907 Bacteria 21131
1490 Ga0496104_0005323 3300048907 Bacteria 11258
1491 Ga0496104_0030000 3300048907 Bacteria 5050
1492 Ga0496104_0094144 3300048907 Bacteria 2865
1493 Ga0496104_0196088 3300048907 Bacteria 1931
1494 Ga0496104_0453131 3300048907 Bacteria 1195
1495 Ga0496105_0001391 3300048908 Bacteria 16986
1496 Ga0496105_0002131 3300048908 Bacteria 14342
1497 Ga0496105_0011105 3300048908 Bacteria 7103
1498 Ga0496105_0020728 3300048908 Bacteria 5314
1499 Ga0496105_0038168 3300048908 Bacteria 3957
1500 Ga0496105_0045672 3300048908 Bacteria 3614
1501 Ga0496105_0101863 3300048908 Bacteria 2371
1502 Ga0496105_0166138 3300048908 Bacteria 1810
1503 Ga0496105_0194665 3300048908 Bacteria 1657
1504 Ga0496105_0437968 3300048908 Bacteria 1033
1505 Ga0496106_0002204 3300048909 Bacteria 14547
1506 Ga0496106_0004015 3300048909 Bacteria 10998
1507 Ga0496106_0046148 3300048909 Bacteria 3274
1508 Ga0496106_0173777 3300048909 Bacteria 1708
1509 Ga0496106_0188967 3300048909 Bacteria 1637
1510 Ga0496106_0283491 3300048909 Bacteria 1327
1511 Ga0496107_0001189 3300048910 Bacteria 15840
1512 Ga0496107_0005878 3300048910 Bacteria 8404
1513 Ga0496107_0023259 3300048910 Bacteria 4381
1514 Ga0496107_0048646 3300048910 Bacteria 3055
1515 Ga0496107_0060851 3300048910 Bacteria 2733
1516 Ga0496107_0461999 3300048910 Bacteria 942
1517 Ga0496108_0002494 3300048911 Bacteria 14730
1518 Ga0496108_0010537 3300048911 Bacteria 7512
1519 Ga0496108_0037485 3300048911 Bacteria 4038
1520 Ga0496108_0070746 3300048911 Bacteria 2944
1521 Ga0496108_0079757 3300048911 Bacteria 2772
1522 Ga0496108_0095796 3300048911 Bacteria 2527
1523 Ga0496108_0184186 3300048911 Bacteria 1809
1524 Ga0496108_0533793 3300048911 Bacteria 1024
1525 Ga0496109_0000567 3300048912 Bacteria 30903
1526 Ga0496109_0000700 3300048912 Bacteria 27897
1527 Ga0496109_0013437 3300048912 Bacteria 7102
1528 Ga0496109_0023062 3300048912 Bacteria 5520
1529 Ga0496109_0085694 3300048912 Bacteria 2908
1530 Ga0496110_0003520 3300048913 Bacteria 12018
1531 Ga0496110_0036662 3300048913 Bacteria 4259
1532 Ga0496110_0071860 3300048913 Bacteria 3069
1533 Ga0496110_0115960 3300048913 Bacteria 2411
1534 Ga0496110_0404582 3300048913 Bacteria 1244
1535 Ga0496110_0635255 3300048913 Bacteria 967
1536 Ga0496111_0002128 3300048914 Bacteria 11829
1537 Ga0496111_0009771 3300048914 Bacteria 6413
1538 Ga0496111_0030278 3300048914 Bacteria 3849
1539 Ga0496111_0127915 3300048914 Bacteria 1879
1540 Ga0496111_0262018 3300048914 Bacteria 1283
1541 Ga0496111_0281064 3300048914 Bacteria 1234
1542 Ga0496112_0002747 3300048915 Bacteria 14260
1543 Ga0496112_0006626 3300048915 Bacteria 10196
1544 Ga0496112_0054561 3300048915 Bacteria 3926
1545 Ga0496112_0067828 3300048915 Bacteria 3521
1546 Ga0496112_0131301 3300048915 Bacteria 2476
1547 Ga0496112_0238354 3300048915 Bacteria 1772
1548 Ga0496112_0446415 3300048915 Bacteria 1231
1549 Ga0496113_0001279 3300048916 Bacteria 13876
1550 Ga0496113_0006169 3300048916 Bacteria 7566
1551 Ga0496113_0020581 3300048916 Bacteria 4641
1552 Ga0496113_0057616 3300048916 Bacteria 2920
1553 Ga0496113_0064863 3300048916 Bacteria 2762
1554 Ga0496113_0136323 3300048916 Bacteria 1929
1555 Ga0496113_0190821 3300048916 Bacteria 1626
1556 Ga0496114_0018338 3300048917 Bacteria 5659
1557 Ga0496114_0029525 3300048917 Bacteria 4508
1558 Ga0496114_0033161 3300048917 Bacteria 4253
1559 Ga0496114_0274562 3300048917 Bacteria 1485
1560 Ga0496115_0001922 3300048918 Bacteria 14830
1561 Ga0496115_0010508 3300048918 Bacteria 6920
1562 Ga0496115_0017144 3300048918 Bacteria 5528
1563 Ga0496115_0024926 3300048918 Bacteria 4652
1564 Ga0496115_0040708 3300048918 Bacteria 3695
1565 Ga0496115_0046991 3300048918 Bacteria 3451
1566 Ga0496115_0168289 3300048918 Bacteria 1812
1567 Ga0496115_0247411 3300048918 Bacteria 1468
1568 Ga0496116_0008329 3300048919 Bacteria 9010
1569 Ga0496116_0010352 3300048919 Bacteria 7829
1570 Ga0496116_0096558 3300048919 Bacteria 1780
1571 Ga0496116_0229102 3300048919 Bacteria 944
1572 Ga0496117_0000956 3300048920 Bacteria 44190
1573 Ga0496117_0008683 3300048920 Bacteria 9605
1574 Ga0496117_0009904 3300048920 Bacteria 8771
1575 Ga0496117_0011583 3300048920 Bacteria 7885
1576 Ga0496117_0093919 3300048920 Bacteria 1922
1577 Ga0496118_0000494 3300048921 Bacteria 65421
1578 Ga0496118_0000757 3300048921 Bacteria 52154
1579 Ga0496118_0002208 3300048921 Bacteria 27018
1580 Ga0496118_0025727 3300048921 Bacteria 5036
1581 Ga0496119_0008642 3300048922 Bacteria 8913
1582 Ga0496121_0000099 3300048924 Bacteria 200160
1583 Ga0496121_0009644 3300048924 Bacteria 11058
1584 Ga0496121_0053371 3300048924 Bacteria 3387
1585 Ga0496121_0133576 3300048924 Bacteria 1852
1586 Ga0496121_0361856 3300048924 Bacteria 963
1587 Ga0496122_0002394 3300048925 Bacteria 26780
1588 Ga0496122_0012696 3300048925 Bacteria 8344
1589 Ga0496122_0042043 3300048925 Bacteria 3602
1590 Ga0496123_0002192 3300048926 Bacteria 24860
1591 Ga0496123_0046425 3300048926 Bacteria 2946
1592 Ga0496123_0124933 3300048926 Bacteria 1438
1593 Ga0496123_0224747 3300048926 Bacteria 944
1594 Ga0496124_0000284 3300048927 Bacteria 96345
1595 Ga0496124_0000962 3300048927 Bacteria 45849
1596 Ga0496124_0029765 3300048927 Bacteria 4858
1597 Ga0496124_0037548 3300048927 Bacteria 4212
1598 Ga0496124_0189006 3300048927 Bacteria 1578
1599 Ga0496125_0001570 3300048928 Bacteria 32554
1600 Ga0496125_0004558 3300048928 Bacteria 15894
1601 Ga0496125_0040720 3300048928 Bacteria 3982
1602 Ga0496125_0097126 3300048928 Bacteria 2184
1603 Ga0496126_0002134 3300048929 Bacteria 27578
1604 Ga0495678_000525 3300049459 Bacteria 37357
1605 Ga0495682_0008853 3300049460 Bacteria 3954
1606 Ga0501031_0013932 3300049568 Bacteria 5237
1607 Ga0501031_0035858 3300049568 Bacteria 3236
1608 Ga0501031_0125444 3300049568 Bacteria 1677
1609 Ga0501031_0243342 3300049568 Bacteria 1169
1610 Ga0501032_0037351 3300049569 Bacteria 3313
1611 Ga0501032_0043686 3300049569 Bacteria 3033
1612 Ga0501032_0091160 3300049569 Bacteria 2022
1613 Ga0501032_0341256 3300049569 Bacteria 965
1614 Ga0501033_0012682 3300049570 Bacteria 6428
1615 Ga0501033_0226769 3300049570 Bacteria 1328
1616 Ga0501034_0000070 3300049571 Bacteria 180933
1617 Ga0501034_0013989 3300049571 Bacteria 8259
1618 Ga0501034_0021659 3300049571 Bacteria 6547
1619 Ga0501034_0064750 3300049571 Bacteria 3669
1620 Ga0501034_0183838 3300049571 Bacteria 2054
1621 Ga0501034_0713752 3300049571 Bacteria 900
1622 Ga0501036_0020490 3300049572 Bacteria 5553
1623 Ga0501036_0025154 3300049572 Bacteria 5021
1624 Ga0501036_0056999 3300049572 Bacteria 3310
1625 Ga0501036_0389270 3300049572 Bacteria 1163
1626 Ga0501037_0014650 3300049573 Bacteria 5769
1627 Ga0501038_0007499 3300049574 Bacteria 10058
1628 Ga0501038_0040531 3300049574 Bacteria 4066
1629 Ga0501038_0058873 3300049574 Bacteria 3292
1630 Ga0501038_0148203 3300049574 Bacteria 1915
1631 Ga0501039_0062918 3300049575 Bacteria 2875
1632 Ga0501039_0078186 3300049575 Bacteria 2573
1633 Ga0501039_0260542 3300049575 Bacteria 1363
1634 Ga0501040_0296620 3300049576 Bacteria 1155
1635 Ga0501042_0242302 3300049578 Bacteria 1301
1636 Ga0501043_0000024 3300049579 Bacteria 154045
1637 Ga0501043_0001631 3300049579 Bacteria 19514
1638 Ga0501043_0033568 3300049579 Bacteria 4038
1639 Ga0501043_0398936 3300049579 Bacteria 1040
1640 Ga0501046_0000173 3300049580 Bacteria 65571
1641 Ga0501046_0001796 3300049580 Bacteria 20471
1642 Ga0501046_0004601 3300049580 Bacteria 12457
1643 Ga0501046_0058133 3300049580 Bacteria 3032
1644 Ga0501047_0000051 3300049581 Bacteria 154281
1645 Ga0501047_0000305 3300049581 Bacteria 56371
1646 Ga0501047_0008244 3300049581 Bacteria 9834
1647 Ga0501048_0000650 3300049582 Bacteria 25020
1648 Ga0501048_0001348 3300049582 Bacteria 18627
1649 Ga0501048_0010540 3300049582 Bacteria 6897
1650 Ga0501067_0014773 3300049583 Bacteria 4320
1651 Ga0501067_0284713 3300049583 Bacteria 920
1652 Ga0501068_0023440 3300049584 Bacteria 3617
1653 Ga0501068_0145873 3300049584 Bacteria 1486
1654 Ga0501068_0241952 3300049584 Bacteria 1149
1655 Ga0501069_0002445 3300049585 Bacteria 9469
1656 Ga0501069_0295782 3300049585 Bacteria 949
1657 Ga0501070_0012418 3300049586 Bacteria 7183
1658 Ga0501070_0051186 3300049586 Bacteria 3429
1659 Ga0501070_0088095 3300049586 Bacteria 2569
1660 Ga0501070_0108004 3300049586 Bacteria 2299
1661 Ga0501071_0216162 3300049587 Bacteria 1442
1662 Ga0501071_0230687 3300049587 Bacteria 1394
1663 Ga0501072_0223376 3300049588 Bacteria 1501
1664 Ga0501072_0252576 3300049588 Bacteria 1404
1665 Ga0501072_0348423 3300049588 Bacteria 1176
1666 Ga0501073_0013348 3300049589 Bacteria 5981
1667 Ga0501073_0210504 3300049589 Bacteria 1344
1668 Ga0501074_0002924 3300049590 Bacteria 11992
1669 Ga0501075_0044518 3300049591 Bacteria 3330
1670 Ga0501076_0271310 3300049592 Bacteria 1389
1671 Ga0501076_0313775 3300049592 Bacteria 1286
1672 Ga0501217_026806 3300049661 Bacteria 1395
1673 Ga0501249_000841 3300049679 Bacteria 6799
1674 Ga0501225_0003044 3300049705 Bacteria 5124
1675 Ga0501079_0071245 3300049741 Bacteria 2685
1676 Ga0501079_0099173 3300049741 Bacteria 2258
1677 Ga0501079_0103083 3300049741 Bacteria 2213
1678 Ga0501080_0013878 3300049742 Bacteria 7417
1679 Ga0501081_0273888 3300049743 Bacteria 1235
1680 Ga0501083_0010486 3300049744 Bacteria 6522
1681 Ga0501083_0047864 3300049744 Bacteria 2887
1682 Ga0501083_0095086 3300049744 Bacteria 1967
1683 Ga0501083_0111142 3300049744 Bacteria 1802
1684 Ga0501262_000282 3300049759 Bacteria 6144
1685 Ga0501263_013173 3300049760 Bacteria 1045
1686 Ga0501035_0003206 3300049822 Bacteria 15680
1687 Ga0501035_0037571 3300049822 Bacteria 4384
1688 Ga0501035_0110593 3300049822 Bacteria 2408
1689 Ga0501044_0000212 3300049823 Bacteria 73807
1690 Ga0501044_0019211 3300049823 Bacteria 7315
1691 Ga0501044_0032009 3300049823 Bacteria 5529
1692 Ga0501044_0079246 3300049823 Bacteria 3328
1693 Ga0501044_0136126 3300049823 Bacteria 2448
1694 Ga0501044_0291819 3300049823 Bacteria 1562
1695 Ga0501044_0310482 3300049823 Bacteria 1504
1696 Ga0501045_0016684 3300049824 Bacteria 5216
1697 Ga0501045_0047229 3300049824 Bacteria 3136
1698 Ga0501045_0151396 3300049824 Bacteria 1726
1699 nmdc:mga03683_131_c2 3300050489 Bacteria 14717
1700 nmdc:mga03683_4120_c1 3300050489 Bacteria 4780
1701 nmdc:mga03n38_13453_c1 3300050490 Bacteria 3109
1702 nmdc:mga03n38_15028_c1 3300050490 Bacteria 2982
1703 nmdc:mga03n38_65253_c1 3300050490 Bacteria 1669
1704 nmdc:mga00v17_26732_c1 3300050491 Bacteria 3365
1705 nmdc:mga00v17_27410_c1 3300050491 Bacteria 3326
1706 nmdc:mga00v17_69463_c1 3300050491 Bacteria 2180
1707 nmdc:mga0yw44_12622_c1 3300050492 Bacteria 4413
1708 nmdc:mga0yw44_13411_c1 3300050492 Bacteria 4315
1709 nmdc:mga0yw44_225837_c1 3300050492 Bacteria 1242
1710 nmdc:mga0yw44_99924_c1 3300050492 Bacteria 1847
1711 nmdc:mga0k408_2988_c1 3300050493 Bacteria 8964
1712 nmdc:mga0k408_34076_c1 3300050493 Bacteria 2914
1713 nmdc:mga0k408_35047_c1 3300050493 Bacteria 2876
1714 nmdc:mga0k408_4288_c1 3300050493 Bacteria 7571
1715 nmdc:mga0k408_49574_c1 3300050493 Bacteria 2431
1716 nmdc:mga06z11_1542_c1 3300050494 Bacteria 8556
1717 nmdc:mga06z11_31128_c1 3300050494 Bacteria 2589
1718 nmdc:mga06z11_34851_c1 3300050494 Bacteria 2473
1719 nmdc:mga06z11_37546_c1 3300050494 Bacteria 2400
1720 nmdc:mga06z11_6364_c1 3300050494 Bacteria 4798
1721 nmdc:mga06z11_87116_c2 3300050494 Bacteria 1372
1722 nmdc:mga04h51_22504_c1 3300050495 Bacteria 1908
1723 nmdc:mga04h51_23730_c1 3300050495 Bacteria 1871
1724 nmdc:mga04h51_37858_c1 3300050495 Bacteria 1559
1725 nmdc:mga04h51_38256_c1 3300050495 Bacteria 1552
1726 nmdc:mga07m45_1095_c1 3300050496 Bacteria 12086
1727 nmdc:mga07m45_18576_c1 3300050496 Bacteria 3756
1728 nmdc:mga07m45_5940_c1 3300050496 Bacteria 2387
1729 nmdc:mga07m45_61998_c1 3300050496 Bacteria 2119
1730 nmdc:mga05p37_34591_c1 3300050507 Bacteria 6189
1731 nmdc:mga05p37_5774_c1 3300050507 Bacteria 14558
1732 nmdc:mga05p37_828_c1 3300050507 Bacteria 34679
1733 nmdc:mga09592_21763_c1 3300050508 Bacteria 5287
1734 nmdc:mga09592_21943_c1 3300050508 Bacteria 5266
1735 nmdc:mga09592_349416_c1 3300050508 Bacteria 1280
1736 nmdc:mga0qj67_165_c1 3300050509 Bacteria 44307
1737 nmdc:mga06r32_112571_c1 3300050510 Bacteria 2678
1738 nmdc:mga06r32_513_c1 3300050510 Bacteria 33328
1739 nmdc:mga06r32_56178_c1 3300050510 Bacteria 3778
1740 nmdc:mga06r32_7918_c1 3300050510 Bacteria 9554
1741 nmdc:mga08y16_4405_c1 3300050511 Bacteria 14718
1742 nmdc:mga08y16_478747_c1 3300050511 Bacteria 1267
1743 nmdc:mga08y16_77507_c1 3300050511 Bacteria 3466
1744 nmdc:mga0n895_10588_c2 3300050512 Bacteria 7761
1745 nmdc:mga0n895_1284_c1 3300050512 Bacteria 18562
1746 nmdc:mga0n895_160658_c1 3300050512 Bacteria 2279
1747 nmdc:mga0n895_32422_c1 3300050512 Bacteria 5016
1748 nmdc:mga0n895_53866_c1 3300050512 Bacteria 3955
1749 nmdc:mga0n895_6751_c1 3300050512 Bacteria 9788
1750 nmdc:mga0n895_90_c1 3300050512 Bacteria 52593
1751 nmdc:mga0n895_91521_c1 3300050512 Bacteria 3044
1752 nmdc:mga0rr50_2923_c1 3300050513 Bacteria 9755
1753 nmdc:mga0rr50_31356_c1 3300050513 Bacteria 3774
1754 nmdc:mga0rr50_330469_c1 3300050513 Bacteria 1280
1755 nmdc:mga0rr50_7459_c1 3300050513 Bacteria 6749
1756 nmdc:mga0rr50_8687_c1 3300050513 Bacteria 6335
1757 nmdc:mga08x19_101005_c1 3300050514 Bacteria 1914
1758 nmdc:mga08x19_102452_c1 3300050514 Bacteria 1901
1759 nmdc:mga08x19_4374_c1 3300050514 Bacteria 8380
1760 nmdc:mga08x19_53960_c1 3300050514 Bacteria 2587
1761 nmdc:mga08x19_77997_c1 3300050514 Bacteria 2170
1762 nmdc:mga0a205_1140_c1 3300050515 Bacteria 22064
1763 nmdc:mga0a205_12519_c1 3300050515 Bacteria 7852
1764 nmdc:mga0a205_242721_c1 3300050515 Bacteria 1682
1765 nmdc:mga0a205_259772_c1 3300050515 Bacteria 1614
1766 nmdc:mga0a205_432198_c1 3300050515 Bacteria 1178
1767 nmdc:mga0sz30_1590_c1 3300050516 Bacteria 4772
1768 nmdc:mga0sz30_36051_c1 3300050516 Bacteria 2066
1769 Ga0495601_0000026 3300053077 Bacteria 126257
1770 Ga0495601_0000075 3300053077 Bacteria 54434
1771 Ga0495601_0003475 3300053077 Bacteria 9043
1772 Ga0495601_0007907 3300053077 Bacteria 6263
1773 Ga0495601_0008795 3300053077 Bacteria 5959
1774 Ga0495601_0013952 3300053077 Bacteria 4838
1775 Ga0495601_0019791 3300053077 Bacteria 4108
1776 Ga0495601_0021260 3300053077 Bacteria 3972
1777 Ga0495601_0045345 3300053077 Bacteria 2764
1778 Ga0495601_0056953 3300053077 Bacteria 2475
1779 Ga0495601_0098383 3300053077 Bacteria 1888
1780 Ga0495601_0281956 3300053077 Bacteria 1083
1781 Ga0495601_0348136 3300053077 Bacteria 964
1782 Ga0495612_0000005 3300053078 Bacteria 286943
1783 Ga0495612_0004321 3300053078 Bacteria 5894
1784 Ga0495612_0005901 3300053078 Bacteria 5051
1785 Ga0495612_0011526 3300053078 Bacteria 3564
1786 Ga0495612_0018362 3300053078 Bacteria 2801
1787 Ga0500610_0000112 3300053079 Bacteria 24798
1788 Ga0495595_0000058 3300053084 Bacteria 57705
1789 Ga0495595_0000311 3300053084 Bacteria 18978
1790 Ga0495595_0000650 3300053084 Bacteria 13209
1791 Ga0495595_0002803 3300053084 Bacteria 6859
1792 Ga0495595_0009800 3300053084 Bacteria 3971
1793 Ga0495595_0018149 3300053084 Bacteria 3037
1794 Ga0495619_0000003 3300053085 Bacteria 515784
1795 Ga0495619_0000301 3300053085 Bacteria 34829
1796 Ga0495619_0000315 3300053085 Bacteria 33904
1797 Ga0495619_0000645 3300053085 Bacteria 22971
1798 Ga0495619_0004564 3300053085 Bacteria 8848
1799 Ga0495619_0008284 3300053085 Bacteria 6574
1800 Ga0495619_0018578 3300053085 Bacteria 4411
1801 Ga0495619_0020045 3300053085 Bacteria 4256
1802 Ga0495619_0046550 3300053085 Bacteria 2852
1803 Ga0495619_0093547 3300053085 Bacteria 2038
1804 Ga0495619_0099418 3300053085 Bacteria 1978
1805 Ga0495619_0215579 3300053085 Bacteria 1329
1806 Ga0495619_0364211 3300053085 Bacteria 999
1807 Ga0500578_0010253 3300053086 Bacteria 6074
1808 Ga0500643_004510 3300053087 Bacteria 6263
1809 Ga0500644_0000805 3300053088 Bacteria 10649
1810 Ga0500644_0007117 3300053088 Bacteria 2899
1811 Ga0500647_0033508 3300053091 Bacteria 2450
1812 Ga0500651_0225020 3300053093 Bacteria 1099
1813 Ga0500566_0002965 3300053094 Bacteria 10133
1814 Ga0500566_0031163 3300053094 Bacteria 3110
1815 Ga0500566_0099650 3300053094 Bacteria 1595
1816 Ga0500566_0103179 3300053094 Bacteria 1560
1817 Ga0500566_0143510 3300053094 Bacteria 1264
1818 Ga0500640_000109 3300053095 Bacteria 15044
1819 Ga0500554_000127 3300053102 Bacteria 15148
1820 Ga0500572_000364 3300053111 Bacteria 16144
1821 Ga0500572_002316 3300053111 Bacteria 4608
1822 Ga0500593_042853 3300053117 Bacteria 2021
1823 Ga0500594_0007743 3300053118 Bacteria 2435
1824 Ga0500595_000002 3300053119 Bacteria 1074388
1825 Ga0500595_000654 3300053119 Bacteria 20823
1826 Ga0500595_036417 3300053119 Bacteria 1612
1827 Ga0500595_050461 3300053119 Bacteria 1292
1828 Ga0500597_014321 3300053120 Bacteria 2971
1829 Ga0500607_000040 3300053121 Bacteria 85325
1830 Ga0500614_000065 3300053123 Bacteria 23001
1831 Ga0500618_001458 3300053125 Bacteria 10508
1832 Ga0500642_0007198 3300053130 Bacteria 3724
1833 Ga0500655_013889 3300053133 Bacteria 1472
1834 Ga0500658_0000142 3300053134 Bacteria 34080
1835 Ga0500559_0004285 3300053136 Bacteria 6825
1836 Ga0500559_0004688 3300053136 Bacteria 6438
1837 Ga0500559_0009713 3300053136 Bacteria 4152
1838 Ga0500561_0035968 3300053137 Bacteria 1281
1839 Ga0500568_0000983 3300053139 Bacteria 19591
1840 Ga0500568_0116516 3300053139 Bacteria 997
1841 Ga0500586_037840 3300053145 Bacteria 1623
1842 Ga0500590_000575 3300053148 Bacteria 12923
1843 Ga0500590_078858 3300053148 Bacteria 1622
1844 Ga0500603_024525 3300053150 Bacteria 1509
1845 Ga0500604_0014219 3300053151 Bacteria 2165
1846 Ga0500604_0019835 3300053151 Bacteria 1887
1847 Ga0500616_0000002 3300053153 Bacteria 1611257
1848 Ga0500616_0013278 3300053153 Bacteria 4789
1849 Ga0500616_0033446 3300053153 Bacteria 2806
1850 Ga0500616_0081258 3300053153 Bacteria 1628
1851 Ga0500619_000062 3300053154 Bacteria 32808
1852 Ga0500622_0014031 3300053156 Bacteria 4308
1853 Ga0500622_0117387 3300053156 Bacteria 1294
1854 Ga0500630_045519 3300053159 Bacteria 2132
1855 Ga0500634_0011715 3300053161 Bacteria 4537
1856 Ga0500638_101029 3300053162 Bacteria 1345
1857 Ga0500639_006776 3300053163 Bacteria 5924
1858 Ga0500636_0012653 3300053177 Bacteria 4947
1859 Ga0500636_0022288 3300053177 Bacteria 3749
1860 Ga0500636_0113664 3300053177 Bacteria 1526
1861 Ga0500637_0085771 3300053178 Bacteria 1821
1862 Ga0500657_124458 3300053728 Bacteria 1014
1863 Ga0500645_000091 3300053730 Bacteria 70038
1864 Ga0500645_001379 3300053730 Bacteria 12409
1865 Ga0500552_015723 3300053733 Bacteria 1015
1866 Ga0500596_012353 3300053735 Bacteria 1296
1867 Ga0501084_0024349 3300054114 Bacteria 5049
1868 Ga0501082_0170102 3300060353 Bacteria 1894
1869 Ga0501082_0194886 3300060353 Bacteria 1762
1870 Ga0530510_0389233 3300061734 Bacteria 1050

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10537663 Ga0111539_105376632 239
2 3300009147 Ga0114129_10078906 Ga0114129_100789063 239
3 3300035410 Ga0373924_0002930 Ga0373924_0002930_48_767 239
4 3300045976 Ga0466967_0309468 Ga0466967_0309468_725_1444 239
5 3300046460 Ga0495638_0149314 Ga0495638_0149314_222_941 239
6 3300046681 Ga0495647_0200982 Ga0495647_0200982_119_838 239
7 3300046689 Ga0495613_0555356 Ga0495613_0555356_32_751 239
8 3300048907 Ga0496104_0000560 Ga0496104_0000560_18332_19051 239
9 3300048908 Ga0496105_0001391 Ga0496105_0001391_546_1265 239
10 3300048911 Ga0496108_0079757 Ga0496108_0079757_587_1306 239
11 3300048912 Ga0496109_0023062 Ga0496109_0023062_3383_4102 239
12 3300048913 Ga0496110_0003520 Ga0496110_0003520_7745_8464 239
13 3300048914 Ga0496111_0009771 Ga0496111_0009771_1564_2283 239
14 3300048915 Ga0496112_0002747 Ga0496112_0002747_12058_12777 239
15 3300048916 Ga0496113_0006169 Ga0496113_0006169_619_1338 239
16 3300050490 nmdc:mga03n38_15028_c1 nmdc:mga03n38_15028_c1_576_1295 239
17 3300050491 nmdc:mga00v17_69463_c1 nmdc:mga00v17_69463_c1_891_1610 239
18 3300050492 nmdc:mga0yw44_13411_c1 nmdc:mga0yw44_13411_c1_1124_1843 239
19 3300050492 nmdc:mga0yw44_225837_c1 nmdc:mga0yw44_225837_c1_178_897 239
20 3300050494 nmdc:mga06z11_1542_c1 nmdc:mga06z11_1542_c1_1336_2055 239
21 3300050495 nmdc:mga04h51_37858_c1 nmdc:mga04h51_37858_c1_351_1070 239
22 3300050507 nmdc:mga05p37_34591_c1 nmdc:mga05p37_34591_c1_3402_4121 239
23 3300050510 nmdc:mga06r32_112571_c1 nmdc:mga06r32_112571_c1_1557_2276 239
24 3300050511 nmdc:mga08y16_478747_c1 nmdc:mga08y16_478747_c1_334_1053 239
25 3300053119 Ga0500595_050461 Ga0500595_050461_552_1271 239
26 3300053137 Ga0500561_0035968 Ga0500561_0035968_313_1032 239
27 3300005842 Ga0068858_100532949 Ga0068858_1005329492 240
28 3300026035 Ga0207703_10672537 Ga0207703_106725372 240
29 iso_pu_bacteria 2857465823 2857472508 244
30 3300009177 Ga0105248_10043196 Ga0105248_100431964 245
31 3300025941 Ga0207711_10046935 Ga0207711_100469353 245
32 3300047444 Ga0495675_0287973 Ga0495675_0287973_72_809 245
33 3300053077 Ga0495601_0021260 Ga0495601_0021260_2145_2882 245
34 iso_pu_bacteria 2939593269 2939594473 245
35 3300025292 Ga0209676_1008057 Ga0209676_10080576 248
36 3300048927 Ga0496124_0000284 Ga0496124_0000284_87807_88625 248
37 3300015261 Ga0182006_1003839 Ga0182006_10038391 249
38 3300025292 Ga0209676_1001271 Ga0209676_100127116 249
39 3300025294 Ga0209025_1004673 Ga0209025_10046731 249
40 3300050515 nmdc:mga0a205_259772_c1 nmdc:mga0a205_259772_c1_199_1008 249
41 3300003781 Ga0055536_1040464 Ga0055536_10404641 250
42 3300025292 Ga0209676_1000855 Ga0209676_100085525 250
43 3300005364 Ga0070673_100003994 Ga0070673_1000039942 252
44 3300005366 Ga0070659_100234867 Ga0070659_1002348672 252
45 3300025960 Ga0207651_10013806 Ga0207651_100138063 252
46 3300007076 Ga0075435_100066884 Ga0075435_1000668843 254
47 3300003771 Ga0055526_1000314 Ga0055526_100031431 255
48 3300003775 Ga0055524_1000031 Ga0055524_100003153 255
49 3300025291 Ga0209675_1003302 Ga0209675_10033028 255
50 3300025295 Ga0209564_1000135 Ga0209564_1000135138 255
51 3300025299 Ga0209256_1000107 Ga0209256_1000107137 255
52 3300048926 Ga0496123_0224747 Ga0496123_0224747_94_927 255
53 3300021388 Ga0213875_10011286 Ga0213875_100112863 256
54 3300037853 Ga0436364_1405230 Ga0436364_1405230_12434_13243 256
55 3300013105 Ga0157369_10022078 Ga0157369_100220784 258
56 3300046642 Ga0495634_0326107 Ga0495634_0326107_133_909 258
57 3300053145 Ga0500586_037840 Ga0500586_037840_141_917 258
58 3300028379 Ga0268266_10131011 Ga0268266_101310111 259
59 3300035089 Ga0373944_0025022 Ga0373944_0025022_223_1038 259
60 3300035113 Ga0373936_0008179 Ga0373936_0008179_373_1188 259
61 3300035116 Ga0373945_0106128 Ga0373945_0106128_149_964 259
62 3300035170 Ga0373943_0000525 Ga0373943_0000525_11565_12380 259
63 3300035171 Ga0373946_0003308 Ga0373946_0003308_1797_2612 259
64 3300035410 Ga0373924_0027762 Ga0373924_0027762_959_1774 259
65 3300035692 Ga0373935_0008051 Ga0373935_0008051_2039_2854 259
66 3300035695 Ga0373927_0004290 Ga0373927_0004290_1757_2572 259
67 3300035725 Ga0373947_0000837 Ga0373947_0000837_9530_10345 259
68 3300037068 Ga0373925_0005184 Ga0373925_0005184_7597_8412 259
69 3300046472 Ga0495580_0188929 Ga0495580_0188929_560_1375 259
70 3300046476 Ga0495662_0198283 Ga0495662_0198283_141_956 259
71 3300046514 Ga0495618_0032170 Ga0495618_0032170_834_1649 259
72 3300046514 Ga0495618_0089004 Ga0495618_0089004_1016_1831 259
73 3300046517 Ga0495630_0053102 Ga0495630_0053102_290_1105 259
74 3300046531 Ga0495665_0065933 Ga0495665_0065933_65_880 259
75 3300046533 Ga0495640_0087440 Ga0495640_0087440_1061_1876 259
76 3300046642 Ga0495634_0014033 Ga0495634_0014033_1849_2664 259
77 3300046663 Ga0495635_0411470 Ga0495635_0411470_38_853 259
78 3300046683 Ga0495658_0021749 Ga0495658_0021749_2453_3268 259
79 3300046689 Ga0495613_0081586 Ga0495613_0081586_1031_1846 259
80 3300046690 Ga0495624_0024161 Ga0495624_0024161_448_1263 259
81 3300047315 Ga0495581_0041982 Ga0495581_0041982_475_1290 259
82 3300047319 Ga0495674_0007346 Ga0495674_0007346_9609_10424 259
83 3300047322 Ga0495680_0308341 Ga0495680_0308341_265_1080 259
84 3300047322 Ga0495680_0480262 Ga0495680_0480262_26_805 259
85 3300047471 Ga0495684_0040269 Ga0495684_0040269_1757_2572 259
86 3300047471 Ga0495684_0042457 Ga0495684_0042457_1320_2135 259
87 3300047673 Ga0495593_0025461 Ga0495593_0025461_2376_3191 259
88 3300048088 Ga0495602_0227961 Ga0495602_0227961_402_1181 259
89 3300053077 Ga0495601_0281956 Ga0495601_0281956_132_947 259
90 3300053085 Ga0495619_0364211 Ga0495619_0364211_64_879 259
91 3300053728 Ga0500657_124458 Ga0500657_124458_47_862 259
92 iso_pu_bacteria 2899370129 2899373573 259
93 3300009147 Ga0114129_10686652 Ga0114129_106866522 260
94 3300006163 Ga0070715_10016579 Ga0070715_100165793 261
95 3300007076 Ga0075435_100001029 Ga0075435_10000102916 261
96 3300025905 Ga0207685_10010229 Ga0207685_100102293 261
97 3300027360 Ga0209969_1004460 Ga0209969_10044602 261
98 3300027364 Ga0209967_1000754 Ga0209967_10007541 261
99 3300027378 Ga0209981_1000239 Ga0209981_10002397 261
100 3300027462 Ga0210000_1003860 Ga0210000_10038602 261
101 3300027471 Ga0209995_1004874 Ga0209995_10048742 261
102 3300027543 Ga0209999_1001900 Ga0209999_10019003 261
103 3300035120 Ga0373957_0020035 Ga0373957_0020035_1426_2211 261
104 3300035724 Ga0373933_0005461 Ga0373933_0005461_4579_5364 261
105 3300036401 Ga0373937_0085628 Ga0373937_0085628_1596_2381 261
106 3300049568 Ga0501031_0125444 Ga0501031_0125444_203_988 261
107 3300049572 Ga0501036_0056999 Ga0501036_0056999_74_859 261
108 3300049576 Ga0501040_0296620 Ga0501040_0296620_115_900 261
109 3300049580 Ga0501046_0058133 Ga0501046_0058133_295_1080 261
110 3300049584 Ga0501068_0145873 Ga0501068_0145873_41_826 261
111 3300049588 Ga0501072_0223376 Ga0501072_0223376_301_1086 261
112 3300049591 Ga0501075_0044518 Ga0501075_0044518_611_1396 261
113 3300049741 Ga0501079_0103083 Ga0501079_0103083_836_1621 261
114 3300049824 Ga0501045_0047229 Ga0501045_0047229_1313_2098 261
115 3300050513 nmdc:mga0rr50_7459_c1 nmdc:mga0rr50_7459_c1_2265_3053 261
116 3300050515 nmdc:mga0a205_242721_c1 nmdc:mga0a205_242721_c1_743_1531 261
117 3300054114 Ga0501084_0024349 Ga0501084_0024349_2006_2791 261
118 iso_pu_bacteria 2818991446 2819600873 261
119 iso_pu_bacteria 2831265667 2831267493 261
120 iso_pu_bacteria 2838054893 2838055998 261
121 iso_pu_bacteria 2881927736 2881928903 261
122 iso_pu_bacteria 2928037797 2928042956 261
123 iso_pu_bacteria 2928044640 2928050385 261
124 iso_pu_bacteria 2954767861 2954768288 261
125 iso_pu_bacteria 8055225921 8055225980 261
126 3300005336 Ga0070680_100097670 Ga0070680_1000976703 262
127 3300005440 Ga0070705_100019384 Ga0070705_1000193842 262
128 3300005444 Ga0070694_100017580 Ga0070694_1000175802 262
129 3300005458 Ga0070681_10237499 Ga0070681_102374992 262
130 3300005467 Ga0070706_100167319 Ga0070706_1001673193 262
131 3300005530 Ga0070679_100095190 Ga0070679_1000951902 262
132 3300005536 Ga0070697_100014513 Ga0070697_1000145133 262
133 3300005545 Ga0070695_100002465 Ga0070695_1000024659 262
134 3300005545 Ga0070695_100226069 Ga0070695_1002260692 262
135 3300005546 Ga0070696_100054505 Ga0070696_1000545054 262
136 3300005546 Ga0070696_100397112 Ga0070696_1003971122 262
137 3300005547 Ga0070693_100096016 Ga0070693_1000960162 262
138 3300005549 Ga0070704_100487516 Ga0070704_1004875162 262
139 3300005985 Ga0081539_10000668 Ga0081539_1000066855 262
140 3300006847 Ga0075431_100052381 Ga0075431_1000523812 262
141 3300006871 Ga0075434_100005079 Ga0075434_1000050792 262
142 3300006880 Ga0075429_100070114 Ga0075429_1000701144 262
143 3300006914 Ga0075436_100017933 Ga0075436_1000179333 262
144 3300006914 Ga0075436_100028258 Ga0075436_1000282586 262
145 3300007076 Ga0075435_100001714 Ga0075435_10000171415 262
146 3300025910 Ga0207684_10126446 Ga0207684_101264463 262
147 3300025912 Ga0207707_10159070 Ga0207707_101590702 262
148 3300025921 Ga0207652_10193030 Ga0207652_101930302 262
149 3300026075 Ga0207708_10075557 Ga0207708_100755572 262
150 3300030522 Ga0307512_10044663 Ga0307512_100446632 262
151 3300032002 Ga0307416_100663617 Ga0307416_1006636171 262
152 3300035086 Ga0373934_0067237 Ga0373934_0067237_384_1172 262
153 3300035111 Ga0373923_0032951 Ga0373923_0032951_1043_1831 262
154 3300035118 Ga0373954_0000012 Ga0373954_0000012_23292_24080 262
155 3300035691 Ga0373931_0092532 Ga0373931_0092532_784_1572 262
156 3300035691 Ga0373931_0247137 Ga0373931_0247137_194_982 262
157 3300035724 Ga0373933_0001549 Ga0373933_0001549_8100_8888 262
158 3300036401 Ga0373937_0002420 Ga0373937_0002420_10175_10963 262
159 3300037312 Ga0395899_0045204 Ga0395899_0045204_2058_2846 262
160 3300041410 Ga0439461_0002041 Ga0439461_0002041_673_1467 262
161 3300042156 Ga0439446_0000318 Ga0439446_0000318_293_1087 262
162 3300042435 Ga0439434_0000294 Ga0439434_0000294_8878_9672 262
163 3300042436 Ga0439435_0000060 Ga0439435_0000060_3833_4627 262
164 3300044683 Ga0466965_0019810 Ga0466965_0019810_2432_3220 262
165 3300046454 Ga0495592_0031460 Ga0495592_0031460_3046_3834 262
166 3300046462 Ga0495651_0106382 Ga0495651_0106382_1237_2025 262
167 3300046476 Ga0495662_0006315 Ga0495662_0006315_906_1694 262
168 3300046511 Ga0495608_0006145 Ga0495608_0006145_4058_4846 262
169 3300046514 Ga0495618_0051200 Ga0495618_0051200_611_1399 262
170 3300046516 Ga0495628_0021837 Ga0495628_0021837_52_840 262
171 3300046517 Ga0495630_0141497 Ga0495630_0141497_35_823 262
172 3300046526 Ga0495666_0038805 Ga0495666_0038805_284_1072 262
173 3300046528 Ga0495642_0053057 Ga0495642_0053057_658_1446 262
174 3300046529 Ga0495652_0311965 Ga0495652_0311965_20_808 262
175 3300046533 Ga0495640_0012982 Ga0495640_0012982_1880_2668 262
176 3300046535 Ga0495586_0003967 Ga0495586_0003967_5510_6298 262
177 3300046536 Ga0495587_0046773 Ga0495587_0046773_546_1334 262
178 3300046543 Ga0495645_0028082 Ga0495645_0028082_1432_2220 262
179 3300046559 Ga0495667_0010769 Ga0495667_0010769_2229_3017 262
180 3300046642 Ga0495634_0004412 Ga0495634_0004412_4760_5548 262
181 3300046663 Ga0495635_0046921 Ga0495635_0046921_300_1088 262
182 3300046683 Ga0495658_0020305 Ga0495658_0020305_2053_2841 262
183 3300046690 Ga0495624_0234012 Ga0495624_0234012_192_980 262
184 3300046809 Ga0495600_0019409 Ga0495600_0019409_245_1033 262
185 3300047317 Ga0495604_0003656 Ga0495604_0003656_11275_12063 262
186 3300047319 Ga0495674_0441819 Ga0495674_0441819_151_939 262
187 3300047322 Ga0495680_0001925 Ga0495680_0001925_3167_3955 262
188 3300047471 Ga0495684_0101182 Ga0495684_0101182_245_1033 262
189 3300047673 Ga0495593_0078254 Ga0495593_0078254_228_1016 262
190 3300049578 Ga0501042_0242302 Ga0501042_0242302_489_1277 262
191 3300049583 Ga0501067_0284713 Ga0501067_0284713_35_823 262
192 3300049585 Ga0501069_0295782 Ga0501069_0295782_53_841 262
193 3300049661 Ga0501217_026806 Ga0501217_026806_468_1265 262
194 3300050510 nmdc:mga06r32_56178_c1 nmdc:mga06r32_56178_c1_2966_3754 262
195 3300050512 nmdc:mga0n895_6751_c1 nmdc:mga0n895_6751_c1_338_1126 262
196 3300050512 nmdc:mga0n895_90_c1 nmdc:mga0n895_90_c1_46149_46937 262
197 3300050513 nmdc:mga0rr50_2923_c1 nmdc:mga0rr50_2923_c1_5455_6243 262
198 3300050514 nmdc:mga08x19_101005_c1 nmdc:mga08x19_101005_c1_217_1005 262
199 3300050514 nmdc:mga08x19_102452_c1 nmdc:mga08x19_102452_c1_881_1669 262
200 3300050514 nmdc:mga08x19_4374_c1 nmdc:mga08x19_4374_c1_3582_4412 262
201 3300050514 nmdc:mga08x19_77997_c1 nmdc:mga08x19_77997_c1_239_1051 262
202 3300053077 Ga0495601_0045345 Ga0495601_0045345_1484_2272 262
203 3300061734 Ga0530510_0389233 Ga0530510_0389233_247_1035 262
204 iso_pu_bacteria 2513020051 2513228983 262
205 iso_pu_bacteria 2513237087 2513590126 262
206 iso_pu_bacteria 2545555834 2545672586 262
207 iso_pu_bacteria 2599185214 2599621134 262
208 iso_pu_bacteria 2599185226 2599675152 262
209 iso_pu_bacteria 2599185227 2599678250 262
210 iso_pu_bacteria 2599185229 2599690645 262
211 iso_pu_bacteria 2643221547 2643757462 262
212 iso_pu_bacteria 2738541317 2738948640 262
213 iso_pu_bacteria 2847930680 2847932446 262
214 iso_pu_bacteria 2855730933 2855733452 262
215 iso_pu_bacteria 2855767633 2855772331 262
216 iso_pu_bacteria 2881412998 2881417918 262
217 iso_pu_bacteria 2883577096 2883577378 262
218 iso_pu_bacteria 2885270888 2885277359 262
219 iso_pu_bacteria 2887375801 2887377366 262
220 iso_pu_bacteria 2894772417 2894774891 262
221 iso_pu_bacteria 2904449895 2904455833 262
222 iso_pu_bacteria 2904456579 2904461523 262
223 iso_pu_bacteria 2913308742 2913313657 262
224 iso_pu_bacteria 2928084124 2928088310 262
225 iso_pu_bacteria 2929199973 2929203757 262
226 iso_pu_bacteria 2929520902 2929522985 262
227 iso_pu_bacteria 2935732158 2935733593 262
228 iso_pu_bacteria 2935732158 2935733609 262
229 iso_pu_bacteria 2935741537 2935742972 262
230 iso_pu_bacteria 2935741537 2935742988 262
231 iso_pu_bacteria 2941531003 2941537451 262
232 iso_pu_bacteria 2954711539 2954720576 262
233 iso_pu_bacteria 2954721474 2954730124 262
234 iso_pu_bacteria 2954731030 2954731911 262
235 iso_pu_bacteria 2954740390 2954748844 262
236 iso_pu_bacteria 2954749733 2954750621 262
237 iso_pu_bacteria 8055225921 8055226922 262
238 iso_pu_bacteria 8055909800 8055915945 262
239 3300005441 Ga0070700_100148601 Ga0070700_1001486012 263
240 3300005618 Ga0068864_100579545 Ga0068864_1005795451 263
241 3300006237 Ga0097621_100066478 Ga0097621_1000664782 263
242 3300006358 Ga0068871_100008998 Ga0068871_1000089985 263
243 3300009094 Ga0111539_10103262 Ga0111539_101032623 263
244 3300009177 Ga0105248_10047663 Ga0105248_100476636 263
245 3300026116 Ga0207674_10550578 Ga0207674_105505782 263
246 3300028794 Ga0307515_10192792 Ga0307515_101927922 263
247 3300031456 Ga0307513_10289529 Ga0307513_102895292 263
248 3300035085 Ga0373929_0005610 Ga0373929_0005610_250_1041 263
249 3300035171 Ga0373946_0029824 Ga0373946_0029824_652_1461 263
250 3300035691 Ga0373931_0022581 Ga0373931_0022581_1229_2020 263
251 3300035695 Ga0373927_0026329 Ga0373927_0026329_1441_2250 263
252 3300044706 Ga0466964_0022269 Ga0466964_0022269_932_1732 263
253 3300045976 Ga0466967_0008390 Ga0466967_0008390_6650_7450 263
254 3300046454 Ga0495592_0173566 Ga0495592_0173566_334_1143 263
255 3300046473 Ga0495582_0223304 Ga0495582_0223304_242_1033 263
256 3300046475 Ga0495639_0196011 Ga0495639_0196011_38_847 263
257 3300046476 Ga0495662_0014982 Ga0495662_0014982_1937_2746 263
258 3300046514 Ga0495618_0007467 Ga0495618_0007467_1968_2777 263
259 3300046517 Ga0495630_0027554 Ga0495630_0027554_1396_2205 263
260 3300046517 Ga0495630_0153683 Ga0495630_0153683_554_1345 263
261 3300046529 Ga0495652_0098554 Ga0495652_0098554_1152_1961 263
262 3300046533 Ga0495640_0007495 Ga0495640_0007495_6107_6916 263
263 3300046533 Ga0495640_0019735 Ga0495640_0019735_2101_2892 263
264 3300046535 Ga0495586_0015139 Ga0495586_0015139_1197_1988 263
265 3300046543 Ga0495645_0008752 Ga0495645_0008752_175_984 263
266 3300046642 Ga0495634_0034169 Ga0495634_0034169_960_1769 263
267 3300046642 Ga0495634_0035265 Ga0495634_0035265_2231_3022 263
268 3300046675 Ga0495657_0308428 Ga0495657_0308428_44_865 263
269 3300046680 Ga0495646_0082369 Ga0495646_0082369_122_931 263
270 3300046690 Ga0495624_0114792 Ga0495624_0114792_168_959 263
271 3300046690 Ga0495624_0339736 Ga0495624_0339736_20_829 263
272 3300047315 Ga0495581_0117749 Ga0495581_0117749_72_863 263
273 3300047319 Ga0495674_0215392 Ga0495674_0215392_159_968 263
274 3300047471 Ga0495684_0006621 Ga0495684_0006621_6415_7224 263
275 3300050508 nmdc:mga09592_349416_c1 nmdc:mga09592_349416_c1_472_1266 263
276 3300053077 Ga0495601_0056953 Ga0495601_0056953_707_1516 263
277 3300053077 Ga0495601_0348136 Ga0495601_0348136_59_850 263
278 3300053078 Ga0495612_0004321 Ga0495612_0004321_1251_2060 263
279 3300053085 Ga0495619_0018578 Ga0495619_0018578_2281_3090 263
280 3300053088 Ga0500644_0007117 Ga0500644_0007117_1048_1860 263
281 3300053153 Ga0500616_0081258 Ga0500616_0081258_105_908 263
282 iso_pu_bacteria 2837678835 2837679615 263
283 3300003759 Ga0055525_1000001 Ga0055525_1000001854 264
284 3300005719 Ga0068861_100062553 Ga0068861_1000625532 264
285 3300005841 Ga0068863_100071220 Ga0068863_1000712204 264
286 3300005844 Ga0068862_100041473 Ga0068862_1000414732 264
287 3300025230 Ga0209563_100007 Ga0209563_100007244 264
288 3300025972 Ga0207668_10068701 Ga0207668_100687013 264
289 3300026118 Ga0207675_100033365 Ga0207675_1000333653 264
290 3300028794 Ga0307515_10000292 Ga0307515_1000029272 264
291 3300031507 Ga0307509_10028152 Ga0307509_100281525 264
292 3300031730 Ga0307516_10367075 Ga0307516_103670752 264
293 3300033179 Ga0307507_10051930 Ga0307507_100519303 264
294 3300037418 Ga0395900_0030673 Ga0395900_0030673_1780_2607 264
295 3300037466 Ga0395898_0025102 Ga0395898_0025102_4592_5422 264
296 3300037466 Ga0395898_0039335 Ga0395898_0039335_1344_2171 264
297 3300037471 Ga0395905_0107527 Ga0395905_0107527_1252_2082 264
298 3300038443 Ga0395901_0004298 Ga0395901_0004298_957_1784 264
299 3300046526 Ga0495666_0045895 Ga0495666_0045895_1028_1822 264
300 iso_pu_bacteria 2643221556 2643802497 264
301 iso_pu_bacteria 2643221684 2644475920 264
302 3300005288 Ga0065714_10152351 Ga0065714_101523512 265
303 3300005333 Ga0070677_10039250 Ga0070677_100392503 265
304 3300005347 Ga0070668_100015026 Ga0070668_1000150264 265
305 3300005354 Ga0070675_100040003 Ga0070675_1000400035 265
306 3300005364 Ga0070673_100339346 Ga0070673_1003393461 265
307 3300005367 Ga0070667_100029930 Ga0070667_1000299305 265
308 3300005436 Ga0070713_100314160 Ga0070713_1003141601 265
309 3300005445 Ga0070708_100011316 Ga0070708_1000113162 265
310 3300005468 Ga0070707_100005638 Ga0070707_1000056383 265
311 3300005471 Ga0070698_100096540 Ga0070698_1000965403 265
312 3300005518 Ga0070699_100034500 Ga0070699_1000345003 265
313 3300005543 Ga0070672_100025104 Ga0070672_1000251044 265
314 3300005548 Ga0070665_100053124 Ga0070665_1000531246 265
315 3300005616 Ga0068852_100574103 Ga0068852_1005741031 265
316 3300006028 Ga0070717_10323784 Ga0070717_103237841 265
317 3300006175 Ga0070712_100012114 Ga0070712_1000121144 265
318 3300006914 Ga0075436_100068532 Ga0075436_1000685322 265
319 3300013306 Ga0163162_10011627 Ga0163162_100116272 265
320 3300024227 Ga0228598_1011274 Ga0228598_10112742 265
321 3300025915 Ga0207693_10032045 Ga0207693_100320452 265
322 3300025915 Ga0207693_10222535 Ga0207693_102225351 265
323 3300025916 Ga0207663_10556355 Ga0207663_105563551 265
324 3300025922 Ga0207646_10014392 Ga0207646_100143929 265
325 3300025926 Ga0207659_10017661 Ga0207659_100176611 265
326 3300025940 Ga0207691_10034563 Ga0207691_100345635 265
327 3300025972 Ga0207668_10062991 Ga0207668_100629912 265
328 3300028379 Ga0268266_10016915 Ga0268266_100169159 265
329 3300028800 Ga0265338_10469888 Ga0265338_104698881 265
330 3300031090 Ga0265760_10002646 Ga0265760_100026463 265
331 3300031241 Ga0265325_10103956 Ga0265325_101039562 265
332 3300031249 Ga0265339_10000165 Ga0265339_100001653 265
333 3300031456 Ga0307513_10011033 Ga0307513_1001103310 265
334 3300031595 Ga0265313_10000300 Ga0265313_1000030048 265
335 3300044684 Ga0466966_0053889 Ga0466966_0053889_1252_2049 265
336 3300044694 Ga0466963_0103318 Ga0466963_0103318_1136_1933 265
337 3300044719 Ga0466971_0110042 Ga0466971_0110042_26_823 265
338 3300045049 Ga0466959_0153079 Ga0466959_0153079_239_1036 265
339 3300046452 Ga0495617_043193 Ga0495617_043193_153_968 265
340 3300046460 Ga0495638_0001364 Ga0495638_0001364_6941_7756 265
341 3300046474 Ga0495605_0000704 Ga0495605_0000704_14671_15486 265
342 3300046491 Ga0495584_0063845 Ga0495584_0063845_39_854 265
343 3300046492 Ga0495585_0117879 Ga0495585_0117879_25_840 265
344 3300046501 Ga0495607_0005354 Ga0495607_0005354_4463_5278 265
345 3300046506 Ga0495583_0000330 Ga0495583_0000330_18613_19428 265
346 3300046511 Ga0495608_0074903 Ga0495608_0074903_373_1170 265
347 3300046513 Ga0495616_0003188 Ga0495616_0003188_6902_7717 265
348 3300046523 Ga0495644_0000544 Ga0495644_0000544_9756_10571 265
349 3300046524 Ga0495648_0000877 Ga0495648_0000877_19893_20708 265
350 3300046538 Ga0495609_0002139 Ga0495609_0002139_10767_11582 265
351 3300046542 Ga0495597_0000375 Ga0495597_0000375_3632_4462 265
352 3300046558 Ga0495633_0002799 Ga0495633_0002799_7094_7909 265
353 3300046615 Ga0495656_0002877 Ga0495656_0002877_411_1226 265
354 3300046648 Ga0495611_0001362 Ga0495611_0001362_7138_7953 265
355 3300046660 Ga0495625_0003687 Ga0495625_0003687_14073_14888 265
356 3300046664 Ga0495659_0000800 Ga0495659_0000800_6530_7345 265
357 3300046665 Ga0495661_0009170 Ga0495661_0009170_2529_3344 265
358 3300046691 Ga0495670_0001448 Ga0495670_0001448_6711_7526 265
359 3300046692 Ga0495671_0015456 Ga0495671_0015456_3127_3942 265
360 3300047318 Ga0495636_0000153 Ga0495636_0000153_18913_19728 265
361 3300047320 Ga0495672_0007385 Ga0495672_0007385_3930_4745 265
362 3300047323 Ga0495683_0001329 Ga0495683_0001329_224_1039 265
363 3300047443 Ga0495687_000498 Ga0495687_000498_33377_34192 265
364 3300047445 Ga0495677_0000593 Ga0495677_0000593_224_1039 265
365 3300047447 Ga0495685_000010 Ga0495685_000010_203_1018 265
366 3300047469 Ga0495673_0003866 Ga0495673_0003866_4467_5282 265
367 3300047472 Ga0495686_0059784 Ga0495686_0059784_1260_2075 265
368 3300048908 Ga0496105_0011105 Ga0496105_0011105_5056_5853 265
369 3300048928 Ga0496125_0004558 Ga0496125_0004558_12019_12816 265
370 3300049459 Ga0495678_000525 Ga0495678_000525_24927_25742 265
371 3300049460 Ga0495682_0008853 Ga0495682_0008853_2298_3113 265
372 3300049568 Ga0501031_0035858 Ga0501031_0035858_1475_2284 265
373 3300049568 Ga0501031_0243342 Ga0501031_0243342_48_845 265
374 3300049569 Ga0501032_0037351 Ga0501032_0037351_1349_2146 265
375 3300049569 Ga0501032_0091160 Ga0501032_0091160_872_1681 265
376 3300049570 Ga0501033_0226769 Ga0501033_0226769_55_864 265
377 3300049571 Ga0501034_0000070 Ga0501034_0000070_133774_134571 265
378 3300049571 Ga0501034_0013989 Ga0501034_0013989_1762_2559 265
379 3300049571 Ga0501034_0021659 Ga0501034_0021659_2505_3314 265
380 3300049571 Ga0501034_0064750 Ga0501034_0064750_1144_1941 265
381 3300049572 Ga0501036_0025154 Ga0501036_0025154_1403_2200 265
382 3300049572 Ga0501036_0389270 Ga0501036_0389270_334_1143 265
383 3300049574 Ga0501038_0040531 Ga0501038_0040531_2268_3077 265
384 3300049574 Ga0501038_0058873 Ga0501038_0058873_1342_2139 265
385 3300049575 Ga0501039_0260542 Ga0501039_0260542_124_921 265
386 3300049581 Ga0501047_0008244 Ga0501047_0008244_5462_6259 265
387 3300049584 Ga0501068_0241952 Ga0501068_0241952_197_994 265
388 3300049586 Ga0501070_0012418 Ga0501070_0012418_1475_2284 265
389 3300049741 Ga0501079_0099173 Ga0501079_0099173_271_1068 265
390 3300049744 Ga0501083_0047864 Ga0501083_0047864_287_1084 265
391 3300049760 Ga0501263_013173 Ga0501263_013173_151_948 265
392 3300049822 Ga0501035_0110593 Ga0501035_0110593_1009_1818 265
393 3300049823 Ga0501044_0079246 Ga0501044_0079246_1799_2608 265
394 3300049823 Ga0501044_0291819 Ga0501044_0291819_407_1204 265
395 3300060353 Ga0501082_0194886 Ga0501082_0194886_854_1651 265
396 iso_pu_bacteria 2857576091 2857580740 265
397 3300000042 ARSoilYngRDRAFT_c00576 ARSoilYngRDRAFT_005762 266
398 3300000043 ARcpr5yngRDRAFT_c001137 ARcpr5yngRDRAFT_0011373 266
399 3300000044 ARSoilOldRDRAFT_c000653 ARSoilOldRDRAFT_0006534 266
400 3300000045 ARCol0oldRDRAFT_c00755 ARCol0oldRDRAFT_007552 266
401 3300000652 ARCol0yngRDRAFT_1001991 ARCol0yngRDRAFT_10019911 266
402 3300001430 JGI24032J14994_100465 JGI24032J14994_1004652 266
403 3300001979 JGI24740J21852_10002833 JGI24740J21852_100028338 266
404 3300001979 JGI24740J21852_10044403 JGI24740J21852_100444032 266
405 3300001989 JGI24739J22299_10002387 JGI24739J22299_100023872 266
406 3300001989 JGI24739J22299_10007118 JGI24739J22299_100071184 266
407 3300001991 JGI24743J22301_10006200 JGI24743J22301_100062002 266
408 3300002075 JGI24738J21930_10000453 JGI24738J21930_100004538 266
409 3300002076 JGI24749J21850_1001528 JGI24749J21850_10015282 266
410 3300002077 JGI24744J21845_10003861 JGI24744J21845_100038612 266
411 3300002126 JGI24035J26624_1000356 JGI24035J26624_10003565 266
412 3300002244 JGI24742J22300_10000709 JGI24742J22300_100007097 266
413 3300002705 JGI25156J39149_1001517 JGI25156J39149_10015178 266
414 3300002738 JGI25154J39366_1000333 JGI25154J39366_100033314 266
415 3300003187 JGI25151J46595_10018445 JGI25151J46595_100184453 266
416 3300003203 JGI25406J46586_10005393 JGI25406J46586_100053933 266
417 3300003215 JGI25153J46596_10000151 JGI25153J46596_1000015116 266
418 3300003215 JGI25153J46596_10002286 JGI25153J46596_100022864 266
419 3300003215 JGI25153J46596_10055377 JGI25153J46596_100553772 266
420 3300003320 rootH2_10182889 rootH2_101828892 266
421 3300003323 rootH1_10000649 rootH1_1000064914 266
422 3300003354 JGI25160J50197_1000163 JGI25160J50197_100016336 266
423 3300003659 JGI25404J52841_10000106 JGI25404J52841_100001063 266
424 3300003751 Ga0055538_1001362 Ga0055538_10013625 266
425 3300003751 Ga0055538_1001370 Ga0055538_10013702 266
426 3300003752 Ga0055539_1000145 Ga0055539_100014561 266
427 3300003756 Ga0055533_1000866 Ga0055533_10008662 266
428 3300003756 Ga0055533_1005873 Ga0055533_10058732 266
429 3300003756 Ga0055533_1005885 Ga0055533_10058852 266
430 3300003758 Ga0055532_1000469 Ga0055532_10004693 266
431 3300003759 Ga0055525_1001053 Ga0055525_10010533 266
432 3300003761 Ga0055535_1000999 Ga0055535_10009993 266
433 3300003762 Ga0055542_1000385 Ga0055542_100038537 266
434 3300003763 Ga0055529_1000831 Ga0055529_100083115 266
435 3300003771 Ga0055526_1026726 Ga0055526_10267262 266
436 3300003773 Ga0055537_1000688 Ga0055537_100068816 266
437 3300003775 Ga0055524_1016351 Ga0055524_10163513 266
438 3300003775 Ga0055524_1025859 Ga0055524_10258592 266
439 3300003781 Ga0055536_1000638 Ga0055536_100063815 266
440 3300003781 Ga0055536_1002200 Ga0055536_10022008 266
441 3300003784 Ga0055534_1000488 Ga0055534_100048810 266
442 3300003791 Ga0055530_10001927 Ga0055530_100019277 266
443 3300003792 Ga0055540_1000149 Ga0055540_10001499 266
444 3300003792 Ga0055540_1000275 Ga0055540_10002755 266
445 3300003792 Ga0055540_1003439 Ga0055540_10034394 266
446 3300003794 Ga0055531_10000062 Ga0055531_1000006277 266
447 3300003841 Ga0055541_1004944 Ga0055541_10049442 266
448 3300003841 Ga0055541_1006873 Ga0055541_10068732 266
449 3300003841 Ga0055541_1006878 Ga0055541_10068782 266
450 3300005262 Ga0065165_1001672 Ga0065165_10016725 266
451 3300005288 Ga0065714_10002324 Ga0065714_1000232420 266
452 3300005289 Ga0065704_10124798 Ga0065704_101247982 266
453 3300005293 Ga0065715_10112482 Ga0065715_101124822 266
454 3300005295 Ga0065707_10092907 Ga0065707_100929074 266
455 3300005295 Ga0065707_10102207 Ga0065707_101022072 266
456 3300005327 Ga0070658_10015415 Ga0070658_100154152 266
457 3300005327 Ga0070658_10021036 Ga0070658_100210366 266
458 3300005327 Ga0070658_10035934 Ga0070658_100359342 266
459 3300005327 Ga0070658_10155946 Ga0070658_101559462 266
460 3300005327 Ga0070658_10197897 Ga0070658_101978971 266
461 3300005328 Ga0070676_10002407 Ga0070676_1000240710 266
462 3300005329 Ga0070683_100004780 Ga0070683_1000047802 266
463 3300005329 Ga0070683_100139715 Ga0070683_1001397152 266
464 3300005330 Ga0070690_100000577 Ga0070690_10000057718 266
465 3300005330 Ga0070690_100059684 Ga0070690_1000596842 266
466 3300005331 Ga0070670_100026119 Ga0070670_1000261193 266
467 3300005331 Ga0070670_100691356 Ga0070670_1006913561 266
468 3300005333 Ga0070677_10000943 Ga0070677_100009433 266
469 3300005334 Ga0068869_100040653 Ga0068869_1000406532 266
470 3300005335 Ga0070666_10030069 Ga0070666_100300694 266
471 3300005335 Ga0070666_10038679 Ga0070666_100386792 266
472 3300005336 Ga0070680_100008066 Ga0070680_1000080665 266
473 3300005336 Ga0070680_100028142 Ga0070680_1000281423 266
474 3300005336 Ga0070680_100032815 Ga0070680_1000328153 266
475 3300005336 Ga0070680_100407707 Ga0070680_1004077072 266
476 3300005337 Ga0070682_100002906 Ga0070682_1000029062 266
477 3300005337 Ga0070682_100026631 Ga0070682_1000266314 266
478 3300005337 Ga0070682_100333548 Ga0070682_1003335482 266
479 3300005338 Ga0068868_100000892 Ga0068868_1000008929 266
480 3300005339 Ga0070660_100003390 Ga0070660_10000339010 266
481 3300005339 Ga0070660_100052583 Ga0070660_1000525834 266
482 3300005339 Ga0070660_100192548 Ga0070660_1001925482 266
483 3300005340 Ga0070689_100002855 Ga0070689_1000028559 266
484 3300005341 Ga0070691_10001992 Ga0070691_100019922 266
485 3300005341 Ga0070691_10214045 Ga0070691_102140451 266
486 3300005343 Ga0070687_100000895 Ga0070687_1000008953 266
487 3300005344 Ga0070661_100000172 Ga0070661_10000017212 266
488 3300005344 Ga0070661_100000804 Ga0070661_1000008049 266
489 3300005344 Ga0070661_100143009 Ga0070661_1001430092 266
490 3300005344 Ga0070661_100220425 Ga0070661_1002204252 266
491 3300005345 Ga0070692_10000830 Ga0070692_100008303 266
492 3300005345 Ga0070692_10072062 Ga0070692_100720622 266
493 3300005347 Ga0070668_100005596 Ga0070668_1000055962 266
494 3300005353 Ga0070669_100010788 Ga0070669_1000107882 266
495 3300005353 Ga0070669_100044673 Ga0070669_1000446732 266
496 3300005354 Ga0070675_100007817 Ga0070675_1000078172 266
497 3300005354 Ga0070675_100199836 Ga0070675_1001998362 266
498 3300005355 Ga0070671_100000144 Ga0070671_1000001442 266
499 3300005355 Ga0070671_100046072 Ga0070671_1000460722 266
500 3300005355 Ga0070671_100047928 Ga0070671_1000479282 266
501 3300005355 Ga0070671_100050429 Ga0070671_1000504291 266
502 3300005355 Ga0070671_100512005 Ga0070671_1005120051 266
503 3300005356 Ga0070674_100003771 Ga0070674_1000037713 266
504 3300005356 Ga0070674_100267397 Ga0070674_1002673972 266
505 3300005364 Ga0070673_100007016 Ga0070673_1000070164 266
506 3300005364 Ga0070673_100251216 Ga0070673_1002512162 266
507 3300005364 Ga0070673_100394145 Ga0070673_1003941452 266
508 3300005365 Ga0070688_100009077 Ga0070688_1000090777 266
509 3300005365 Ga0070688_100011259 Ga0070688_1000112594 266
510 3300005365 Ga0070688_100019796 Ga0070688_1000197962 266
511 3300005365 Ga0070688_100045165 Ga0070688_1000451654 266
512 3300005366 Ga0070659_100005098 Ga0070659_10000509810 266
513 3300005367 Ga0070667_100003448 Ga0070667_1000034482 266
514 3300005367 Ga0070667_100022884 Ga0070667_1000228844 266
515 3300005367 Ga0070667_100089458 Ga0070667_1000894582 266
516 3300005367 Ga0070667_100385199 Ga0070667_1003851992 266
517 3300005406 Ga0070703_10005909 Ga0070703_100059092 266
518 3300005435 Ga0070714_100015402 Ga0070714_1000154024 266
519 3300005435 Ga0070714_100272549 Ga0070714_1002725492 266
520 3300005436 Ga0070713_100005437 Ga0070713_1000054374 266
521 3300005436 Ga0070713_100040256 Ga0070713_1000402565 266
522 3300005436 Ga0070713_100042493 Ga0070713_1000424932 266
523 3300005437 Ga0070710_10002210 Ga0070710_100022104 266
524 3300005437 Ga0070710_10172690 Ga0070710_101726902 266
525 3300005438 Ga0070701_10000951 Ga0070701_1000095110 266
526 3300005439 Ga0070711_100026734 Ga0070711_1000267344 266
527 3300005439 Ga0070711_100300686 Ga0070711_1003006862 266
528 3300005439 Ga0070711_100391823 Ga0070711_1003918231 266
529 3300005440 Ga0070705_100003034 Ga0070705_1000030342 266
530 3300005440 Ga0070705_100020776 Ga0070705_1000207764 266
531 3300005440 Ga0070705_100344093 Ga0070705_1003440932 266
532 3300005441 Ga0070700_100001925 Ga0070700_1000019253 266
533 3300005444 Ga0070694_100013679 Ga0070694_1000136794 266
534 3300005444 Ga0070694_100195845 Ga0070694_1001958452 266
535 3300005445 Ga0070708_100076491 Ga0070708_1000764913 266
536 3300005445 Ga0070708_100155288 Ga0070708_1001552882 266
537 3300005445 Ga0070708_100228982 Ga0070708_1002289821 266
538 3300005455 Ga0070663_100000048 Ga0070663_10000004837 266
539 3300005455 Ga0070663_100008331 Ga0070663_1000083316 266
540 3300005455 Ga0070663_100066970 Ga0070663_1000669703 266
541 3300005455 Ga0070663_100408049 Ga0070663_1004080492 266
542 3300005456 Ga0070678_100019470 Ga0070678_1000194703 266
543 3300005456 Ga0070678_100031617 Ga0070678_1000316174 266
544 3300005456 Ga0070678_100032939 Ga0070678_1000329393 266
545 3300005456 Ga0070678_100168451 Ga0070678_1001684512 266
546 3300005457 Ga0070662_100009476 Ga0070662_1000094766 266
547 3300005457 Ga0070662_100125525 Ga0070662_1001255252 266
548 3300005457 Ga0070662_100399074 Ga0070662_1003990741 266
549 3300005458 Ga0070681_10079817 Ga0070681_100798172 266
550 3300005458 Ga0070681_10113424 Ga0070681_101134243 266
551 3300005458 Ga0070681_10168760 Ga0070681_101687602 266
552 3300005458 Ga0070681_10343051 Ga0070681_103430512 266
553 3300005458 Ga0070681_10423468 Ga0070681_104234681 266
554 3300005459 Ga0068867_100011042 Ga0068867_1000110422 266
555 3300005459 Ga0068867_100062306 Ga0068867_1000623062 266
556 3300005459 Ga0068867_100093862 Ga0068867_1000938623 266
557 3300005466 Ga0070685_10040340 Ga0070685_100403402 266
558 3300005467 Ga0070706_100448950 Ga0070706_1004489502 266
559 3300005471 Ga0070698_100436242 Ga0070698_1004362421 266
560 3300005530 Ga0070679_100019238 Ga0070679_1000192386 266
561 3300005530 Ga0070679_100088242 Ga0070679_1000882423 266
562 3300005530 Ga0070679_100260969 Ga0070679_1002609692 266
563 3300005530 Ga0070679_100309016 Ga0070679_1003090161 266
564 3300005530 Ga0070679_100468364 Ga0070679_1004683642 266
565 3300005530 Ga0070679_100589015 Ga0070679_1005890152 266
566 3300005535 Ga0070684_100001753 Ga0070684_10000175315 266
567 3300005535 Ga0070684_100016515 Ga0070684_1000165155 266
568 3300005535 Ga0070684_100104379 Ga0070684_1001043791 266
569 3300005539 Ga0068853_100005853 Ga0068853_1000058533 266
570 3300005543 Ga0070672_100030562 Ga0070672_1000305623 266
571 3300005544 Ga0070686_100000086 Ga0070686_10000008654 266
572 3300005544 Ga0070686_100008070 Ga0070686_1000080705 266
573 3300005545 Ga0070695_100007717 Ga0070695_1000077172 266
574 3300005545 Ga0070695_100057276 Ga0070695_1000572761 266
575 3300005546 Ga0070696_100004489 Ga0070696_1000044892 266
576 3300005546 Ga0070696_100149595 Ga0070696_1001495951 266
577 3300005547 Ga0070693_100053012 Ga0070693_1000530122 266
578 3300005548 Ga0070665_100008890 Ga0070665_10000889010 266
579 3300005549 Ga0070704_100000280 Ga0070704_1000002803 266
580 3300005549 Ga0070704_100053958 Ga0070704_1000539582 266
581 3300005549 Ga0070704_100140072 Ga0070704_1001400722 266
582 3300005563 Ga0068855_100001526 Ga0068855_10000152615 266
583 3300005563 Ga0068855_100027435 Ga0068855_1000274353 266
584 3300005563 Ga0068855_100037526 Ga0068855_1000375266 266
585 3300005563 Ga0068855_100097674 Ga0068855_1000976742 266
586 3300005563 Ga0068855_100171536 Ga0068855_1001715362 266
587 3300005564 Ga0070664_100000119 Ga0070664_10000011912 266
588 3300005564 Ga0070664_100008530 Ga0070664_1000085309 266
589 3300005564 Ga0070664_100044515 Ga0070664_1000445154 266
590 3300005577 Ga0068857_100005404 Ga0068857_10000540410 266
591 3300005577 Ga0068857_100031359 Ga0068857_1000313594 266
592 3300005577 Ga0068857_100067804 Ga0068857_1000678045 266
593 3300005577 Ga0068857_100636776 Ga0068857_1006367762 266
594 3300005578 Ga0068854_100003207 Ga0068854_1000032072 266
595 3300005578 Ga0068854_100010312 Ga0068854_1000103125 266
596 3300005614 Ga0068856_100000308 Ga0068856_10000030812 266
597 3300005614 Ga0068856_100010687 Ga0068856_1000106872 266
598 3300005614 Ga0068856_100258975 Ga0068856_1002589752 266
599 3300005615 Ga0070702_100014862 Ga0070702_1000148624 266
600 3300005615 Ga0070702_100116622 Ga0070702_1001166222 266
601 3300005615 Ga0070702_100204860 Ga0070702_1002048602 266
602 3300005616 Ga0068852_100002326 Ga0068852_1000023264 266
603 3300005616 Ga0068852_100031324 Ga0068852_1000313246 266
604 3300005617 Ga0068859_100009076 Ga0068859_10000907610 266
605 3300005617 Ga0068859_100039394 Ga0068859_1000393944 266
606 3300005617 Ga0068859_100053408 Ga0068859_1000534084 266
607 3300005618 Ga0068864_100001754 Ga0068864_10000175414 266
608 3300005618 Ga0068864_100013586 Ga0068864_1000135865 266
609 3300005618 Ga0068864_100050852 Ga0068864_1000508524 266
610 3300005718 Ga0068866_10001865 Ga0068866_100018659 266
611 3300005719 Ga0068861_100033242 Ga0068861_1000332424 266
612 3300005719 Ga0068861_100247729 Ga0068861_1002477292 266
613 3300005840 Ga0068870_10000419 Ga0068870_1000041917 266
614 3300005841 Ga0068863_100000340 Ga0068863_10000034046 266
615 3300005841 Ga0068863_100026204 Ga0068863_1000262043 266
616 3300005842 Ga0068858_100009413 Ga0068858_1000094132 266
617 3300005842 Ga0068858_100029243 Ga0068858_1000292437 266
618 3300005842 Ga0068858_100099646 Ga0068858_1000996463 266
619 3300005843 Ga0068860_100052206 Ga0068860_1000522062 266
620 3300005843 Ga0068860_100071592 Ga0068860_1000715922 266
621 3300005843 Ga0068860_100073526 Ga0068860_1000735264 266
622 3300005843 Ga0068860_100781709 Ga0068860_1007817091 266
623 3300005844 Ga0068862_100006116 Ga0068862_10000611610 266
624 3300005844 Ga0068862_100767656 Ga0068862_1007676562 266
625 3300005937 Ga0081455_10000007 Ga0081455_10000007187 266
626 3300005983 Ga0081540_1000002 Ga0081540_1000002178 266
627 3300005985 Ga0081539_10000394 Ga0081539_100003943 266
628 3300006028 Ga0070717_10003040 Ga0070717_100030402 266
629 3300006028 Ga0070717_10121840 Ga0070717_101218402 266
630 3300006028 Ga0070717_10139779 Ga0070717_101397792 266
631 3300006038 Ga0075365_10003142 Ga0075365_100031421 266
632 3300006038 Ga0075365_10100662 Ga0075365_101006622 266
633 3300006038 Ga0075365_10178335 Ga0075365_101783352 266
634 3300006038 Ga0075365_10252205 Ga0075365_102522052 266
635 3300006038 Ga0075365_10467938 Ga0075365_104679382 266
636 3300006042 Ga0075368_10003305 Ga0075368_100033053 266
637 3300006042 Ga0075368_10030278 Ga0075368_100302782 266
638 3300006048 Ga0075363_100000734 Ga0075363_1000007349 266
639 3300006048 Ga0075363_100017534 Ga0075363_1000175342 266
640 3300006048 Ga0075363_100041451 Ga0075363_1000414513 266
641 3300006048 Ga0075363_100043053 Ga0075363_1000430532 266
642 3300006051 Ga0075364_10027040 Ga0075364_100270405 266
643 3300006051 Ga0075364_10102231 Ga0075364_101022312 266
644 3300006058 Ga0075432_10028982 Ga0075432_100289822 266
645 3300006058 Ga0075432_10032292 Ga0075432_100322922 266
646 3300006163 Ga0070715_10005346 Ga0070715_100053462 266
647 3300006173 Ga0070716_100001217 Ga0070716_10000121710 266
648 3300006175 Ga0070712_100005950 Ga0070712_1000059502 266
649 3300006175 Ga0070712_100175548 Ga0070712_1001755482 266
650 3300006177 Ga0075362_10000286 Ga0075362_1000028612 266
651 3300006177 Ga0075362_10080265 Ga0075362_100802652 266
652 3300006177 Ga0075362_10109557 Ga0075362_101095572 266
653 3300006177 Ga0075362_10168438 Ga0075362_101684382 266
654 3300006178 Ga0075367_10000730 Ga0075367_1000073010 266
655 3300006178 Ga0075367_10002322 Ga0075367_100023228 266
656 3300006178 Ga0075367_10003087 Ga0075367_100030875 266
657 3300006178 Ga0075367_10038840 Ga0075367_100388403 266
658 3300006178 Ga0075367_10137112 Ga0075367_101371122 266
659 3300006178 Ga0075367_10352577 Ga0075367_103525771 266
660 3300006186 Ga0075369_10079221 Ga0075369_100792212 266
661 3300006186 Ga0075369_10110757 Ga0075369_101107571 266
662 3300006186 Ga0075369_10153483 Ga0075369_101534832 266
663 3300006195 Ga0075366_10001531 Ga0075366_100015318 266
664 3300006195 Ga0075366_10005069 Ga0075366_100050697 266
665 3300006195 Ga0075366_10015235 Ga0075366_100152354 266
666 3300006195 Ga0075366_10027421 Ga0075366_100274213 266
667 3300006195 Ga0075366_10034195 Ga0075366_100341953 266
668 3300006237 Ga0097621_100000880 Ga0097621_10000088020 266
669 3300006237 Ga0097621_100010589 Ga0097621_1000105895 266
670 3300006353 Ga0075370_10001459 Ga0075370_100014592 266
671 3300006353 Ga0075370_10007230 Ga0075370_100072306 266
672 3300006353 Ga0075370_10065979 Ga0075370_100659792 266
673 3300006353 Ga0075370_10079544 Ga0075370_100795442 266
674 3300006353 Ga0075370_10149080 Ga0075370_101490802 266
675 3300006358 Ga0068871_100006040 Ga0068871_1000060409 266
676 3300006358 Ga0068871_100036409 Ga0068871_1000364092 266
677 3300006844 Ga0075428_100001723 Ga0075428_10000172314 266
678 3300006844 Ga0075428_100006547 Ga0075428_1000065473 266
679 3300006846 Ga0075430_100000201 Ga0075430_10000020114 266
680 3300006847 Ga0075431_100000260 Ga0075431_10000026014 266
681 3300006847 Ga0075431_100001007 Ga0075431_1000010071 266
682 3300006852 Ga0075433_10000007 Ga0075433_1000000765 266
683 3300006852 Ga0075433_10019271 Ga0075433_100192713 266
684 3300006852 Ga0075433_10297785 Ga0075433_102977851 266
685 3300006871 Ga0075434_100000091 Ga0075434_10000009133 266
686 3300006871 Ga0075434_100054318 Ga0075434_1000543187 266
687 3300006871 Ga0075434_100243466 Ga0075434_1002434662 266
688 3300006871 Ga0075434_100459202 Ga0075434_1004592022 266
689 3300006880 Ga0075429_100001265 Ga0075429_10000126513 266
690 3300006881 Ga0068865_100000615 Ga0068865_1000006152 266
691 3300006881 Ga0068865_100080765 Ga0068865_1000807652 266
692 3300006881 Ga0068865_100121213 Ga0068865_1001212131 266
693 3300006914 Ga0075436_100015888 Ga0075436_1000158884 266
694 3300006914 Ga0075436_100104260 Ga0075436_1001042602 266
695 3300006931 Ga0097620_100009075 Ga0097620_1000090753 266
696 3300006931 Ga0097620_100039391 Ga0097620_1000393914 266
697 3300006931 Ga0097620_100053406 Ga0097620_1000534064 266
698 3300007076 Ga0075435_100011790 Ga0075435_1000117901 266
699 3300007265 Ga0099794_10003104 Ga0099794_100031042 266
700 3300007265 Ga0099794_10056087 Ga0099794_100560873 266
701 3300007788 Ga0099795_10017367 Ga0099795_100173673 266
702 3300009011 Ga0105251_10003023 Ga0105251_100030238 266
703 3300009011 Ga0105251_10018333 Ga0105251_100183332 266
704 3300009011 Ga0105251_10147661 Ga0105251_101476611 266
705 3300009036 Ga0105244_10004322 Ga0105244_100043224 266
706 3300009036 Ga0105244_10013636 Ga0105244_100136365 266
707 3300009036 Ga0105244_10146237 Ga0105244_101462372 266
708 3300009092 Ga0105250_10001271 Ga0105250_100012715 266
709 3300009093 Ga0105240_10014700 Ga0105240_100147009 266
710 3300009093 Ga0105240_10025813 Ga0105240_100258137 266
711 3300009093 Ga0105240_10083154 Ga0105240_100831545 266
712 3300009093 Ga0105240_10090355 Ga0105240_100903552 266
713 3300009093 Ga0105240_10146942 Ga0105240_101469423 266
714 3300009093 Ga0105240_10347407 Ga0105240_103474072 266
715 3300009094 Ga0111539_10001412 Ga0111539_1000141217 266
716 3300009094 Ga0111539_10026413 Ga0111539_100264135 266
717 3300009094 Ga0111539_10195935 Ga0111539_101959352 266
718 3300009094 Ga0111539_10672746 Ga0111539_106727462 266
719 3300009098 Ga0105245_10027580 Ga0105245_100275804 266
720 3300009098 Ga0105245_10041176 Ga0105245_100411764 266
721 3300009098 Ga0105245_10097858 Ga0105245_100978584 266
722 3300009098 Ga0105245_10201283 Ga0105245_102012832 266
723 3300009098 Ga0105245_10350161 Ga0105245_103501612 266
724 3300009101 Ga0105247_10026019 Ga0105247_100260194 266
725 3300009101 Ga0105247_10113547 Ga0105247_101135472 266
726 3300009101 Ga0105247_10150151 Ga0105247_101501512 266
727 3300009101 Ga0105247_10330992 Ga0105247_103309922 266
728 3300009147 Ga0114129_10002772 Ga0114129_1000277227 266
729 3300009147 Ga0114129_10017987 Ga0114129_100179879 266
730 3300009148 Ga0105243_10007677 Ga0105243_100076779 266
731 3300009148 Ga0105243_10024994 Ga0105243_100249944 266
732 3300009148 Ga0105243_10030527 Ga0105243_100305272 266
733 3300009148 Ga0105243_10045128 Ga0105243_100451286 266
734 3300009148 Ga0105243_10429047 Ga0105243_104290472 266
735 3300009174 Ga0105241_10021798 Ga0105241_100217986 266
736 3300009174 Ga0105241_10023847 Ga0105241_100238474 266
737 3300009174 Ga0105241_10168092 Ga0105241_101680922 266
738 3300009176 Ga0105242_10004266 Ga0105242_100042669 266
739 3300009176 Ga0105242_10007702 Ga0105242_100077029 266
740 3300009176 Ga0105242_10211388 Ga0105242_102113882 266
741 3300009177 Ga0105248_10004655 Ga0105248_100046553 266
742 3300009177 Ga0105248_10057813 Ga0105248_100578134 266
743 3300009177 Ga0105248_10338938 Ga0105248_103389381 266
744 3300009545 Ga0105237_10042077 Ga0105237_100420773 266
745 3300009545 Ga0105237_10208558 Ga0105237_102085582 266
746 3300009551 Ga0105238_10110783 Ga0105238_101107832 266
747 3300009551 Ga0105238_10111936 Ga0105238_101119363 266
748 3300009553 Ga0105249_10010100 Ga0105249_100101009 266
749 3300009553 Ga0105249_10283720 Ga0105249_102837202 266
750 3300009553 Ga0105249_11020688 Ga0105249_110206882 266
751 3300010375 Ga0105239_10086648 Ga0105239_100866483 266
752 3300010375 Ga0105239_10118061 Ga0105239_101180614 266
753 3300010375 Ga0105239_10219286 Ga0105239_102192862 266
754 3300010375 Ga0105239_10253389 Ga0105239_102533892 266
755 3300011119 Ga0105246_10001908 Ga0105246_100019088 266
756 3300011119 Ga0105246_10183283 Ga0105246_101832832 266
757 3300011119 Ga0105246_10239225 Ga0105246_102392252 266
758 3300013100 Ga0157373_10001235 Ga0157373_1000123518 266
759 3300013100 Ga0157373_10004667 Ga0157373_100046679 266
760 3300013102 Ga0157371_10000419 Ga0157371_1000041912 266
761 3300013102 Ga0157371_10004765 Ga0157371_100047655 266
762 3300013102 Ga0157371_10105612 Ga0157371_101056122 266
763 3300013102 Ga0157371_10174573 Ga0157371_101745732 266
764 3300013104 Ga0157370_10000002 Ga0157370_10000002160 266
765 3300013104 Ga0157370_10061748 Ga0157370_100617484 266
766 3300013104 Ga0157370_10553966 Ga0157370_105539662 266
767 3300013105 Ga0157369_10001303 Ga0157369_1000130328 266
768 3300013105 Ga0157369_10042262 Ga0157369_100422622 266
769 3300013105 Ga0157369_10119185 Ga0157369_101191853 266
770 3300013105 Ga0157369_10522966 Ga0157369_105229661 266
771 3300013296 Ga0157374_10010364 Ga0157374_100103649 266
772 3300013296 Ga0157374_10029962 Ga0157374_100299625 266
773 3300013297 Ga0157378_10009964 Ga0157378_100099649 266
774 3300013297 Ga0157378_10035863 Ga0157378_100358632 266
775 3300013297 Ga0157378_10077532 Ga0157378_100775322 266
776 3300013306 Ga0163162_10017148 Ga0163162_100171483 266
777 3300013306 Ga0163162_10054423 Ga0163162_100544233 266
778 3300013306 Ga0163162_10061637 Ga0163162_100616374 266
779 3300013306 Ga0163162_10067500 Ga0163162_100675002 266
780 3300013306 Ga0163162_10167493 Ga0163162_101674932 266
781 3300013307 Ga0157372_10002873 Ga0157372_1000287312 266
782 3300013307 Ga0157372_10028009 Ga0157372_100280093 266
783 3300013307 Ga0157372_10088265 Ga0157372_100882653 266
784 3300013307 Ga0157372_10279203 Ga0157372_102792032 266
785 3300013307 Ga0157372_10801131 Ga0157372_108011312 266
786 3300013308 Ga0157375_10007981 Ga0157375_100079814 266
787 3300013308 Ga0157375_10059865 Ga0157375_100598652 266
788 3300013308 Ga0157375_10062691 Ga0157375_100626914 266
789 3300013308 Ga0157375_10219908 Ga0157375_102199083 266
790 3300013308 Ga0157375_10474743 Ga0157375_104747432 266
791 3300014325 Ga0163163_10006941 Ga0163163_100069416 266
792 3300014325 Ga0163163_10026981 Ga0163163_100269814 266
793 3300014325 Ga0163163_10071319 Ga0163163_100713192 266
794 3300014326 Ga0157380_10004902 Ga0157380_1000490210 266
795 3300014326 Ga0157380_10287406 Ga0157380_102874062 266
796 3300014497 Ga0182008_10017556 Ga0182008_100175564 266
797 3300014497 Ga0182008_10039281 Ga0182008_100392812 266
798 3300014497 Ga0182008_10050232 Ga0182008_100502322 266
799 3300014497 Ga0182008_10105766 Ga0182008_101057662 266
800 3300014497 Ga0182008_10107420 Ga0182008_101074202 266
801 3300014745 Ga0157377_10002529 Ga0157377_100025293 266
802 3300014968 Ga0157379_10000036 Ga0157379_1000003669 266
803 3300014968 Ga0157379_10024663 Ga0157379_100246633 266
804 3300014968 Ga0157379_10044610 Ga0157379_100446104 266
805 3300014969 Ga0157376_10027787 Ga0157376_100277875 266
806 3300014969 Ga0157376_10234851 Ga0157376_102348512 266
807 3300015261 Ga0182006_1002183 Ga0182006_100218310 266
808 3300015261 Ga0182006_1006307 Ga0182006_10063073 266
809 3300015261 Ga0182006_1012230 Ga0182006_10122305 266
810 3300015262 Ga0182007_10007789 Ga0182007_100077894 266
811 3300015262 Ga0182007_10011471 Ga0182007_100114713 266
812 3300015265 Ga0182005_1001297 Ga0182005_10012977 266
813 3300015265 Ga0182005_1006013 Ga0182005_10060133 266
814 3300017792 Ga0163161_10006198 Ga0163161_100061989 266
815 3300020070 Ga0206356_11256461 Ga0206356_112564613 266
816 3300020070 Ga0206356_11423983 Ga0206356_114239831 266
817 3300020082 Ga0206353_11376502 Ga0206353_113765021 266
818 3300020610 Ga0154015_1416319 Ga0154015_14163194 266
819 3300021358 Ga0213873_10026857 Ga0213873_100268572 266
820 3300021361 Ga0213872_10000482 Ga0213872_1000048213 266
821 3300025224 Ga0209784_100003 Ga0209784_10000339 266
822 3300025224 Ga0209784_100243 Ga0209784_10024321 266
823 3300025224 Ga0209784_100808 Ga0209784_1008082 266
824 3300025225 Ga0209566_100002 Ga0209566_1000021083 266
825 3300025225 Ga0209566_100742 Ga0209566_1007428 266
826 3300025225 Ga0209566_100934 Ga0209566_1009342 266
827 3300025226 Ga0209674_100010 Ga0209674_10001055 266
828 3300025226 Ga0209674_100081 Ga0209674_100081139 266
829 3300025226 Ga0209674_101205 Ga0209674_1012058 266
830 3300025228 Ga0209672_100624 Ga0209672_1006243 266
831 3300025229 Ga0209147_100414 Ga0209147_10041414 266
832 3300025230 Ga0209563_100004 Ga0209563_100004495 266
833 3300025230 Ga0209563_100026 Ga0209563_100026254 266
834 3300025242 Ga0209258_100618 Ga0209258_10061814 266
835 3300025246 Ga0209646_1000065 Ga0209646_1000065177 266
836 3300025250 Ga0209026_1010214 Ga0209026_10102141 266
837 3300025253 Ga0209677_100013 Ga0209677_100013118 266
838 3300025253 Ga0209677_101179 Ga0209677_1011799 266
839 3300025254 Ga0209148_1000113 Ga0209148_100011348 266
840 3300025254 Ga0209148_1006097 Ga0209148_10060973 266
841 3300025256 Ga0209759_1001010 Ga0209759_100101013 266
842 3300025256 Ga0209759_1001214 Ga0209759_10012145 266
843 3300025256 Ga0209759_1001322 Ga0209759_10013222 266
844 3300025256 Ga0209759_1003788 Ga0209759_10037886 266
845 3300025263 Ga0209565_1000176 Ga0209565_100017610 266
846 3300025271 Ga0207666_1000147 Ga0207666_10001474 266
847 3300025271 Ga0207666_1001482 Ga0207666_10014823 266
848 3300025272 Ga0209455_1000501 Ga0209455_100050114 266
849 3300025273 Ga0209673_1014335 Ga0209673_10143352 266
850 3300025284 Ga0209130_1001660 Ga0209130_10016603 266
851 3300025290 Ga0207673_1000767 Ga0207673_10007674 266
852 3300025291 Ga0209675_1000218 Ga0209675_100021828 266
853 3300025292 Ga0209676_1000627 Ga0209676_10006275 266
854 3300025292 Ga0209676_1001369 Ga0209676_100136915 266
855 3300025294 Ga0209025_1000028 Ga0209025_1000028287 266
856 3300025294 Ga0209025_1002169 Ga0209025_10021696 266
857 3300025294 Ga0209025_1029115 Ga0209025_10291152 266
858 3300025294 Ga0209025_1059610 Ga0209025_10596101 266
859 3300025295 Ga0209564_1000421 Ga0209564_100042110 266
860 3300025297 Ga0209758_1000063 Ga0209758_1000063104 266
861 3300025297 Ga0209758_1000120 Ga0209758_1000120132 266
862 3300025297 Ga0209758_1005062 Ga0209758_10050628 266
863 3300025298 Ga0209050_1000100 Ga0209050_1000100187 266
864 3300025298 Ga0209050_1000537 Ga0209050_100053751 266
865 3300025299 Ga0209256_1000263 Ga0209256_100026315 266
866 3300025299 Ga0209256_1002000 Ga0209256_100200010 266
867 3300025299 Ga0209256_1010514 Ga0209256_10105144 266
868 3300025302 Ga0207426_1000018 Ga0207426_1000018502 266
869 3300025303 Ga0209051_1000067 Ga0209051_100006740 266
870 3300025303 Ga0209051_1000302 Ga0209051_10003027 266
871 3300025303 Ga0209051_1000345 Ga0209051_100034510 266
872 3300025304 Ga0209257_1000095 Ga0209257_1000095201 266
873 3300025304 Ga0209257_1002834 Ga0209257_100283410 266
874 3300025315 Ga0207697_10002326 Ga0207697_100023261 266
875 3300025315 Ga0207697_10077030 Ga0207697_100770302 266
876 3300025711 Ga0207696_1002217 Ga0207696_10022176 266
877 3300025728 Ga0207655_1005104 Ga0207655_10051045 266
878 3300025728 Ga0207655_1008924 Ga0207655_10089245 266
879 3300025728 Ga0207655_1019123 Ga0207655_10191235 266
880 3300025735 Ga0207713_1002340 Ga0207713_100234010 266
881 3300025885 Ga0207653_10001409 Ga0207653_100014094 266
882 3300025893 Ga0207682_10001723 Ga0207682_100017234 266
883 3300025898 Ga0207692_10022169 Ga0207692_100221691 266
884 3300025898 Ga0207692_10120478 Ga0207692_101204782 266
885 3300025898 Ga0207692_10317278 Ga0207692_103172781 266
886 3300025900 Ga0207710_10005311 Ga0207710_100053118 266
887 3300025900 Ga0207710_10005447 Ga0207710_100054478 266
888 3300025900 Ga0207710_10060865 Ga0207710_100608652 266
889 3300025901 Ga0207688_10000167 Ga0207688_100001679 266
890 3300025901 Ga0207688_10097804 Ga0207688_100978042 266
891 3300025901 Ga0207688_10171623 Ga0207688_101716232 266
892 3300025903 Ga0207680_10023271 Ga0207680_100232712 266
893 3300025903 Ga0207680_10044018 Ga0207680_100440183 266
894 3300025904 Ga0207647_10002561 Ga0207647_1000256117 266
895 3300025904 Ga0207647_10057430 Ga0207647_100574302 266
896 3300025905 Ga0207685_10020155 Ga0207685_100201552 266
897 3300025905 Ga0207685_10136186 Ga0207685_101361861 266
898 3300025906 Ga0207699_10001489 Ga0207699_1000148911 266
899 3300025906 Ga0207699_10106411 Ga0207699_101064112 266
900 3300025907 Ga0207645_10005140 Ga0207645_1000514010 266
901 3300025907 Ga0207645_10125221 Ga0207645_101252211 266
902 3300025907 Ga0207645_10172079 Ga0207645_101720792 266
903 3300025908 Ga0207643_10004063 Ga0207643_100040636 266
904 3300025909 Ga0207705_10017729 Ga0207705_100177294 266
905 3300025909 Ga0207705_10081845 Ga0207705_100818453 266
906 3300025910 Ga0207684_10318850 Ga0207684_103188502 266
907 3300025911 Ga0207654_10026883 Ga0207654_100268833 266
908 3300025912 Ga0207707_10016807 Ga0207707_100168076 266
909 3300025912 Ga0207707_10040964 Ga0207707_100409642 266
910 3300025912 Ga0207707_10058268 Ga0207707_100582683 266
911 3300025912 Ga0207707_10378882 Ga0207707_103788822 266
912 3300025913 Ga0207695_10005378 Ga0207695_100053783 266
913 3300025913 Ga0207695_10045076 Ga0207695_100450764 266
914 3300025913 Ga0207695_10188244 Ga0207695_101882443 266
915 3300025913 Ga0207695_10242936 Ga0207695_102429362 266
916 3300025914 Ga0207671_10035659 Ga0207671_100356595 266
917 3300025914 Ga0207671_10588322 Ga0207671_105883221 266
918 3300025915 Ga0207693_10008449 Ga0207693_1000844910 266
919 3300025915 Ga0207693_10132042 Ga0207693_101320423 266
920 3300025915 Ga0207693_10181051 Ga0207693_101810512 266
921 3300025916 Ga0207663_10070179 Ga0207663_100701792 266
922 3300025916 Ga0207663_10144020 Ga0207663_101440202 266
923 3300025917 Ga0207660_10020078 Ga0207660_100200784 266
924 3300025917 Ga0207660_10029553 Ga0207660_100295534 266
925 3300025917 Ga0207660_10041239 Ga0207660_100412394 266
926 3300025917 Ga0207660_10199301 Ga0207660_101993012 266
927 3300025918 Ga0207662_10000195 Ga0207662_1000019510 266
928 3300025918 Ga0207662_10021822 Ga0207662_100218221 266
929 3300025918 Ga0207662_10198917 Ga0207662_101989172 266
930 3300025919 Ga0207657_10012031 Ga0207657_100120319 266
931 3300025919 Ga0207657_10141998 Ga0207657_101419982 266
932 3300025919 Ga0207657_10145041 Ga0207657_101450411 266
933 3300025919 Ga0207657_10251829 Ga0207657_102518291 266
934 3300025919 Ga0207657_10302416 Ga0207657_103024161 266
935 3300025920 Ga0207649_10000168 Ga0207649_1000016812 266
936 3300025920 Ga0207649_10000944 Ga0207649_1000094419 266
937 3300025920 Ga0207649_10026440 Ga0207649_100264405 266
938 3300025920 Ga0207649_10293310 Ga0207649_102933102 266
939 3300025921 Ga0207652_10027911 Ga0207652_100279114 266
940 3300025921 Ga0207652_10028891 Ga0207652_100288914 266
941 3300025921 Ga0207652_10074387 Ga0207652_100743872 266
942 3300025923 Ga0207681_10004024 Ga0207681_100040249 266
943 3300025923 Ga0207681_10033795 Ga0207681_100337953 266
944 3300025924 Ga0207694_10170107 Ga0207694_101701072 266
945 3300025925 Ga0207650_10011209 Ga0207650_100112096 266
946 3300025925 Ga0207650_10241511 Ga0207650_102415112 266
947 3300025926 Ga0207659_10001128 Ga0207659_1000112814 266
948 3300025926 Ga0207659_10105888 Ga0207659_101058882 266
949 3300025927 Ga0207687_10016099 Ga0207687_100160994 266
950 3300025928 Ga0207700_10005022 Ga0207700_100050226 266
951 3300025928 Ga0207700_10038774 Ga0207700_100387744 266
952 3300025928 Ga0207700_10038856 Ga0207700_100388563 266
953 3300025928 Ga0207700_10530417 Ga0207700_105304172 266
954 3300025929 Ga0207664_10037901 Ga0207664_100379012 266
955 3300025929 Ga0207664_10310225 Ga0207664_103102252 266
956 3300025931 Ga0207644_10016379 Ga0207644_100163794 266
957 3300025931 Ga0207644_10029859 Ga0207644_100298595 266
958 3300025931 Ga0207644_10048690 Ga0207644_100486902 266
959 3300025931 Ga0207644_10534818 Ga0207644_105348182 266
960 3300025932 Ga0207690_10010455 Ga0207690_100104555 266
961 3300025932 Ga0207690_10307559 Ga0207690_103075591 266
962 3300025933 Ga0207706_10010273 Ga0207706_100102739 266
963 3300025933 Ga0207706_10019439 Ga0207706_100194397 266
964 3300025933 Ga0207706_10053277 Ga0207706_100532774 266
965 3300025933 Ga0207706_10160825 Ga0207706_101608252 266
966 3300025933 Ga0207706_10409685 Ga0207706_104096852 266
967 3300025934 Ga0207686_10002278 Ga0207686_100022787 266
968 3300025934 Ga0207686_10009205 Ga0207686_100092055 266
969 3300025934 Ga0207686_10196287 Ga0207686_101962872 266
970 3300025935 Ga0207709_10002480 Ga0207709_100024803 266
971 3300025935 Ga0207709_10103755 Ga0207709_101037552 266
972 3300025936 Ga0207670_10000792 Ga0207670_100007924 266
973 3300025937 Ga0207669_10001389 Ga0207669_100013894 266
974 3300025937 Ga0207669_10165189 Ga0207669_101651892 266
975 3300025938 Ga0207704_10478771 Ga0207704_104787711 266
976 3300025939 Ga0207665_10034351 Ga0207665_100343514 266
977 3300025940 Ga0207691_10009001 Ga0207691_100090013 266
978 3300025941 Ga0207711_10009422 Ga0207711_100094228 266
979 3300025941 Ga0207711_10011627 Ga0207711_100116272 266
980 3300025941 Ga0207711_10539283 Ga0207711_105392832 266
981 3300025942 Ga0207689_10000008 Ga0207689_10000008118 266
982 3300025944 Ga0207661_10002577 Ga0207661_1000257713 266
983 3300025944 Ga0207661_10254323 Ga0207661_102543232 266
984 3300025945 Ga0207679_10000085 Ga0207679_1000008537 266
985 3300025945 Ga0207679_10004919 Ga0207679_100049199 266
986 3300025945 Ga0207679_10149819 Ga0207679_101498192 266
987 3300025945 Ga0207679_10158555 Ga0207679_101585552 266
988 3300025949 Ga0207667_10008690 Ga0207667_100086908 266
989 3300025949 Ga0207667_10017077 Ga0207667_100170779 266
990 3300025949 Ga0207667_10029863 Ga0207667_100298634 266
991 3300025949 Ga0207667_10080722 Ga0207667_100807221 266
992 3300025960 Ga0207651_10000292 Ga0207651_1000029213 266
993 3300025960 Ga0207651_10035767 Ga0207651_100357672 266
994 3300025960 Ga0207651_10230681 Ga0207651_102306812 266
995 3300025961 Ga0207712_10253608 Ga0207712_102536082 266
996 3300025961 Ga0207712_10265581 Ga0207712_102655812 266
997 3300025972 Ga0207668_10001329 Ga0207668_1000132910 266
998 3300025972 Ga0207668_10175610 Ga0207668_101756102 266
999 3300025972 Ga0207668_10288539 Ga0207668_102885392 266
1000 3300025981 Ga0207640_10000946 Ga0207640_1000094612 266
1001 3300025981 Ga0207640_10001339 Ga0207640_1000133913 266
1002 3300025986 Ga0207658_10008697 Ga0207658_100086977 266
1003 3300025986 Ga0207658_10014450 Ga0207658_100144503 266
1004 3300025986 Ga0207658_10026305 Ga0207658_100263054 266
1005 3300025986 Ga0207658_10028752 Ga0207658_100287523 266
1006 3300025986 Ga0207658_10089957 Ga0207658_100899572 266
1007 3300026023 Ga0207677_10023807 Ga0207677_100238074 266
1008 3300026023 Ga0207677_10030325 Ga0207677_100303253 266
1009 3300026035 Ga0207703_10006686 Ga0207703_100066864 266
1010 3300026035 Ga0207703_10048343 Ga0207703_100483432 266
1011 3300026041 Ga0207639_10061983 Ga0207639_100619833 266
1012 3300026041 Ga0207639_10198554 Ga0207639_101985542 266
1013 3300026041 Ga0207639_10310928 Ga0207639_103109283 266
1014 3300026067 Ga0207678_10000202 Ga0207678_1000020236 266
1015 3300026067 Ga0207678_10009486 Ga0207678_100094863 266
1016 3300026067 Ga0207678_10092108 Ga0207678_100921083 266
1017 3300026067 Ga0207678_10564253 Ga0207678_105642531 266
1018 3300026075 Ga0207708_10006642 Ga0207708_100066429 266
1019 3300026075 Ga0207708_10289801 Ga0207708_102898011 266
1020 3300026075 Ga0207708_10473437 Ga0207708_104734371 266
1021 3300026078 Ga0207702_10000294 Ga0207702_1000029446 266
1022 3300026078 Ga0207702_10025513 Ga0207702_100255135 266
1023 3300026078 Ga0207702_10073289 Ga0207702_100732896 266
1024 3300026088 Ga0207641_10004156 Ga0207641_100041562 266
1025 3300026088 Ga0207641_10029014 Ga0207641_100290142 266
1026 3300026088 Ga0207641_10279426 Ga0207641_102794262 266
1027 3300026089 Ga0207648_10009518 Ga0207648_100095189 266
1028 3300026089 Ga0207648_10040099 Ga0207648_100400992 266
1029 3300026089 Ga0207648_10060737 Ga0207648_100607373 266
1030 3300026095 Ga0207676_10000182 Ga0207676_1000018216 266
1031 3300026095 Ga0207676_10008809 Ga0207676_100088092 266
1032 3300026095 Ga0207676_10018336 Ga0207676_100183364 266
1033 3300026095 Ga0207676_10075023 Ga0207676_100750232 266
1034 3300026116 Ga0207674_10012281 Ga0207674_100122813 266
1035 3300026116 Ga0207674_10034038 Ga0207674_100340384 266
1036 3300026116 Ga0207674_10058447 Ga0207674_100584474 266
1037 3300026116 Ga0207674_10148377 Ga0207674_101483772 266
1038 3300026116 Ga0207674_10605528 Ga0207674_106055282 266
1039 3300026118 Ga0207675_100009202 Ga0207675_1000092024 266
1040 3300026118 Ga0207675_100223631 Ga0207675_1002236312 266
1041 3300026118 Ga0207675_100611305 Ga0207675_1006113052 266
1042 3300026121 Ga0207683_10008676 Ga0207683_100086767 266
1043 3300026121 Ga0207683_10008899 Ga0207683_100088993 266
1044 3300026121 Ga0207683_10152765 Ga0207683_101527652 266
1045 3300026121 Ga0207683_10268527 Ga0207683_102685272 266
1046 3300026121 Ga0207683_10394119 Ga0207683_103941192 266
1047 3300026142 Ga0207698_10011050 Ga0207698_100110505 266
1048 3300026142 Ga0207698_10014161 Ga0207698_100141614 266
1049 3300026142 Ga0207698_10029219 Ga0207698_100292194 266
1050 3300026142 Ga0207698_10364095 Ga0207698_103640952 266
1051 3300027462 Ga0210000_1000579 Ga0210000_10005791 266
1052 3300027512 Ga0209179_1008622 Ga0209179_10086221 266
1053 3300027512 Ga0209179_1019414 Ga0209179_10194142 266
1054 3300027543 Ga0209999_1000289 Ga0209999_10002896 266
1055 3300027665 Ga0209983_1007917 Ga0209983_10079172 266
1056 3300027666 Ga0209282_1000105 Ga0209282_10001057 266
1057 3300027671 Ga0209588_1020430 Ga0209588_10204302 266
1058 3300027682 Ga0209971_1007306 Ga0209971_10073062 266
1059 3300027695 Ga0209966_1001543 Ga0209966_10015433 266
1060 3300027717 Ga0209998_10001521 Ga0209998_100015216 266
1061 3300027717 Ga0209998_10002524 Ga0209998_100025244 266
1062 3300027866 Ga0209813_10015681 Ga0209813_100156812 266
1063 3300027876 Ga0209974_10001584 Ga0209974_100015842 266
1064 3300027876 Ga0209974_10014301 Ga0209974_100143012 266
1065 3300027907 Ga0207428_10000115 Ga0207428_1000011517 266
1066 3300027907 Ga0207428_10001793 Ga0207428_1000179318 266
1067 3300027907 Ga0207428_10013664 Ga0207428_100136644 266
1068 3300028379 Ga0268266_10048810 Ga0268266_100488102 266
1069 3300028379 Ga0268266_10358671 Ga0268266_103586712 266
1070 3300028379 Ga0268266_10641677 Ga0268266_106416771 266
1071 3300028380 Ga0268265_10006061 Ga0268265_100060612 266
1072 3300028381 Ga0268264_10015470 Ga0268264_100154704 266
1073 3300028381 Ga0268264_10073561 Ga0268264_100735613 266
1074 3300028381 Ga0268264_10262149 Ga0268264_102621492 266
1075 3300028381 Ga0268264_10310622 Ga0268264_103106222 266
1076 3300028556 Ga0265337_1000403 Ga0265337_10004032 266
1077 3300028573 Ga0265334_10057842 Ga0265334_100578422 266
1078 3300028794 Ga0307515_10008051 Ga0307515_100080519 266
1079 3300028794 Ga0307515_10298673 Ga0307515_102986731 266
1080 3300028800 Ga0265338_10011769 Ga0265338_100117692 266
1081 3300028800 Ga0265338_10122133 Ga0265338_101221334 266
1082 3300028800 Ga0265338_10267035 Ga0265338_102670352 266
1083 3300030521 Ga0307511_10000019 Ga0307511_100000199 266
1084 3300030522 Ga0307512_10151369 Ga0307512_101513692 266
1085 3300030522 Ga0307512_10193253 Ga0307512_101932532 266
1086 3300030731 Ga0316177_1138189 Ga0316177_11381893 266
1087 3300030733 Ga0314311_1143830 Ga0314311_11438302 266
1088 3300030735 Ga0316178_1024177 Ga0316178_10241774 266
1089 3300030744 Ga0316181_1116699 Ga0316181_111669912 266
1090 3300030745 Ga0316182_1438880 Ga0316182_14388802 266
1091 3300031235 Ga0265330_10006763 Ga0265330_100067635 266
1092 3300031235 Ga0265330_10018509 Ga0265330_100185094 266
1093 3300031235 Ga0265330_10142406 Ga0265330_101424062 266
1094 3300031238 Ga0265332_10002834 Ga0265332_100028342 266
1095 3300031241 Ga0265325_10000026 Ga0265325_100000264 266
1096 3300031241 Ga0265325_10000258 Ga0265325_1000025814 266
1097 3300031241 Ga0265325_10008677 Ga0265325_100086776 266
1098 3300031241 Ga0265325_10008781 Ga0265325_100087814 266
1099 3300031241 Ga0265325_10016270 Ga0265325_100162702 266
1100 3300031247 Ga0265340_10104016 Ga0265340_101040162 266
1101 3300031249 Ga0265339_10003955 Ga0265339_100039557 266
1102 3300031250 Ga0265331_10006990 Ga0265331_100069905 266
1103 3300031250 Ga0265331_10040370 Ga0265331_100403702 266
1104 3300031250 Ga0265331_10137524 Ga0265331_101375241 266
1105 3300031251 Ga0265327_10073180 Ga0265327_100731802 266
1106 3300031344 Ga0265316_10065041 Ga0265316_100650414 266
1107 3300031344 Ga0265316_10082669 Ga0265316_100826693 266
1108 3300031344 Ga0265316_10108823 Ga0265316_101088232 266
1109 3300031344 Ga0265316_10290501 Ga0265316_102905012 266
1110 3300031456 Ga0307513_10007727 Ga0307513_1000772711 266
1111 3300031456 Ga0307513_10046515 Ga0307513_100465153 266
1112 3300031456 Ga0307513_10077565 Ga0307513_100775652 266
1113 3300031456 Ga0307513_10275792 Ga0307513_102757922 266
1114 3300031507 Ga0307509_10057042 Ga0307509_100570425 266
1115 3300031507 Ga0307509_10171889 Ga0307509_101718892 266
1116 3300031548 Ga0307408_100009496 Ga0307408_1000094968 266
1117 3300031548 Ga0307408_100048329 Ga0307408_1000483291 266
1118 3300031548 Ga0307408_100196147 Ga0307408_1001961472 266
1119 3300031548 Ga0307408_100244608 Ga0307408_1002446082 266
1120 3300031595 Ga0265313_10000072 Ga0265313_1000007270 266
1121 3300031595 Ga0265313_10013430 Ga0265313_100134302 266
1122 3300031595 Ga0265313_10024597 Ga0265313_100245973 266
1123 3300031616 Ga0307508_10000248 Ga0307508_1000024845 266
1124 3300031616 Ga0307508_10058543 Ga0307508_100585433 266
1125 3300031649 Ga0307514_10000890 Ga0307514_1000089012 266
1126 3300031649 Ga0307514_10020138 Ga0307514_100201385 266
1127 3300031711 Ga0265314_10002865 Ga0265314_1000286512 266
1128 3300031711 Ga0265314_10002886 Ga0265314_100028866 266
1129 3300031711 Ga0265314_10039095 Ga0265314_100390953 266
1130 3300031712 Ga0265342_10000082 Ga0265342_1000008219 266
1131 3300031712 Ga0265342_10000291 Ga0265342_1000029134 266
1132 3300031712 Ga0265342_10063168 Ga0265342_100631682 266
1133 3300031727 Ga0316576_10021360 Ga0316576_100213601 266
1134 3300031728 Ga0316578_10070369 Ga0316578_100703692 266
1135 3300031731 Ga0307405_10156598 Ga0307405_101565982 266
1136 3300031731 Ga0307405_10252338 Ga0307405_102523382 266
1137 3300031731 Ga0307405_10602380 Ga0307405_106023801 266
1138 3300031852 Ga0307410_10197495 Ga0307410_101974952 266
1139 3300031901 Ga0307406_10001484 Ga0307406_100014848 266
1140 3300031901 Ga0307406_10049376 Ga0307406_100493762 266
1141 3300031911 Ga0307412_10311318 Ga0307412_103113181 266
1142 3300031911 Ga0307412_10780538 Ga0307412_107805381 266
1143 3300032002 Ga0307416_100182306 Ga0307416_1001823062 266
1144 3300032002 Ga0307416_100741787 Ga0307416_1007417871 266
1145 3300033179 Ga0307507_10023773 Ga0307507_100237733 266
1146 3300033179 Ga0307507_10115233 Ga0307507_101152332 266
1147 3300033179 Ga0307507_10151277 Ga0307507_101512772 266
1148 3300034816 Ga0373930_0001137 Ga0373930_0001137_327_1127 266
1149 3300034816 Ga0373930_0017644 Ga0373930_0017644_457_1257 266
1150 3300034817 Ga0373948_0000530 Ga0373948_0000530_2749_3549 266
1151 3300034818 Ga0373950_0001280 Ga0373950_0001280_2396_3196 266
1152 3300034819 Ga0373958_0000935 Ga0373958_0000935_2610_3410 266
1153 3300034820 Ga0373959_0002074 Ga0373959_0002074_696_1496 266
1154 3300034820 Ga0373959_0002994 Ga0373959_0002994_1435_2235 266
1155 3300034820 Ga0373959_0033674 Ga0373959_0033674_96_896 266
1156 3300034957 Ga0373938_0000237 Ga0373938_0000237_6611_7411 266
1157 3300034957 Ga0373938_0001173 Ga0373938_0001173_825_1625 266
1158 3300034957 Ga0373938_0001763 Ga0373938_0001763_745_1545 266
1159 3300035083 Ga0373926_0013479 Ga0373926_0013479_1715_2515 266
1160 3300035084 Ga0373928_0000547 Ga0373928_0000547_1799_2599 266
1161 3300035084 Ga0373928_0006668 Ga0373928_0006668_509_1309 266
1162 3300035085 Ga0373929_0000699 Ga0373929_0000699_3936_4736 266
1163 3300035085 Ga0373929_0008455 Ga0373929_0008455_129_929 266
1164 3300035086 Ga0373934_0005867 Ga0373934_0005867_3337_4137 266
1165 3300035088 Ga0373940_0001972 Ga0373940_0001972_2037_2837 266
1166 3300035088 Ga0373940_0100003 Ga0373940_0100003_22_822 266
1167 3300035090 Ga0373949_0002043 Ga0373949_0002043_2971_3771 266
1168 3300035090 Ga0373949_0003337 Ga0373949_0003337_1804_2604 266
1169 3300035091 Ga0373951_0003295 Ga0373951_0003295_1563_2363 266
1170 3300035091 Ga0373951_0007696 Ga0373951_0007696_672_1472 266
1171 3300035092 Ga0373952_0000858 Ga0373952_0000858_3023_3823 266
1172 3300035092 Ga0373952_0008149 Ga0373952_0008149_183_983 266
1173 3300035111 Ga0373923_0001865 Ga0373923_0001865_1640_2440 266
1174 3300035111 Ga0373923_0002073 Ga0373923_0002073_4655_5455 266
1175 3300035112 Ga0373932_0003430 Ga0373932_0003430_2784_3584 266
1176 3300035113 Ga0373936_0043737 Ga0373936_0043737_459_1259 266
1177 3300035113 Ga0373936_0046394 Ga0373936_0046394_88_888 266
1178 3300035113 Ga0373936_0048530 Ga0373936_0048530_416_1216 266
1179 3300035113 Ga0373936_0071413 Ga0373936_0071413_289_1089 266
1180 3300035114 Ga0373939_0002937 Ga0373939_0002937_1576_2376 266
1181 3300035114 Ga0373939_0006052 Ga0373939_0006052_1769_2569 266
1182 3300035115 Ga0373941_0015410 Ga0373941_0015410_661_1461 266
1183 3300035116 Ga0373945_0009515 Ga0373945_0009515_995_1795 266
1184 3300035116 Ga0373945_0022704 Ga0373945_0022704_1285_2085 266
1185 3300035116 Ga0373945_0127372 Ga0373945_0127372_67_867 266
1186 3300035117 Ga0373953_0000963 Ga0373953_0000963_3074_3874 266
1187 3300035117 Ga0373953_0025962 Ga0373953_0025962_111_911 266
1188 3300035118 Ga0373954_0001647 Ga0373954_0001647_6168_6968 266
1189 3300035118 Ga0373954_0006896 Ga0373954_0006896_2308_3108 266
1190 3300035118 Ga0373954_0015121 Ga0373954_0015121_565_1365 266
1191 3300035118 Ga0373954_0029687 Ga0373954_0029687_1186_1986 266
1192 3300035118 Ga0373954_0058374 Ga0373954_0058374_87_887 266
1193 3300035118 Ga0373954_0207291 Ga0373954_0207291_44_844 266
1194 3300035119 Ga0373956_0000080 Ga0373956_0000080_29459_30259 266
1195 3300035119 Ga0373956_0010369 Ga0373956_0010369_1646_2446 266
1196 3300035119 Ga0373956_0019862 Ga0373956_0019862_494_1294 266
1197 3300035119 Ga0373956_0033838 Ga0373956_0033838_142_942 266
1198 3300035119 Ga0373956_0048845 Ga0373956_0048845_55_855 266
1199 3300035119 Ga0373956_0084062 Ga0373956_0084062_186_986 266
1200 3300035120 Ga0373957_0013058 Ga0373957_0013058_1858_2658 266
1201 3300035120 Ga0373957_0024477 Ga0373957_0024477_538_1338 266
1202 3300035121 Ga0373960_0003754 Ga0373960_0003754_2613_3413 266
1203 3300035121 Ga0373960_0006948 Ga0373960_0006948_1228_2028 266
1204 3300035170 Ga0373943_0032108 Ga0373943_0032108_123_923 266
1205 3300035171 Ga0373946_0007183 Ga0373946_0007183_1456_2256 266
1206 3300035171 Ga0373946_0012822 Ga0373946_0012822_1624_2424 266
1207 3300035171 Ga0373946_0066484 Ga0373946_0066484_456_1256 266
1208 3300035171 Ga0373946_0190897 Ga0373946_0190897_112_912 266
1209 3300035172 Ga0373955_0006219 Ga0373955_0006219_3735_4535 266
1210 3300035172 Ga0373955_0009768 Ga0373955_0009768_3550_4350 266
1211 3300035172 Ga0373955_0043040 Ga0373955_0043040_1375_2175 266
1212 3300035172 Ga0373955_0060816 Ga0373955_0060816_558_1358 266
1213 3300035172 Ga0373955_0088264 Ga0373955_0088264_196_996 266
1214 3300035172 Ga0373955_0165691 Ga0373955_0165691_68_868 266
1215 3300035207 Ga0373942_0004844 Ga0373942_0004844_1080_1880 266
1216 3300035207 Ga0373942_0011363 Ga0373942_0011363_903_1703 266
1217 3300035241 Ga0373961_0006553 Ga0373961_0006553_1099_1899 266
1218 3300035241 Ga0373961_0012233 Ga0373961_0012233_716_1516 266
1219 3300035241 Ga0373961_0015940 Ga0373961_0015940_101_901 266
1220 3300035241 Ga0373961_0018134 Ga0373961_0018134_347_1147 266
1221 3300035241 Ga0373961_0055458 Ga0373961_0055458_327_1127 266
1222 3300035242 Ga0373962_0005838 Ga0373962_0005838_198_998 266
1223 3300035242 Ga0373962_0012645 Ga0373962_0012645_218_1018 266
1224 3300035410 Ga0373924_0007061 Ga0373924_0007061_2662_3462 266
1225 3300035410 Ga0373924_0029209 Ga0373924_0029209_1181_1981 266
1226 3300035410 Ga0373924_0032775 Ga0373924_0032775_294_1094 266
1227 3300035410 Ga0373924_0103106 Ga0373924_0103106_384_1184 266
1228 3300035410 Ga0373924_0126870 Ga0373924_0126870_19_819 266
1229 3300035691 Ga0373931_0004454 Ga0373931_0004454_4911_5711 266
1230 3300035691 Ga0373931_0041907 Ga0373931_0041907_929_1729 266
1231 3300035691 Ga0373931_0154193 Ga0373931_0154193_250_1050 266
1232 3300035692 Ga0373935_0000086 Ga0373935_0000086_37988_38788 266
1233 3300035692 Ga0373935_0001093 Ga0373935_0001093_11453_12253 266
1234 3300035692 Ga0373935_0074146 Ga0373935_0074146_363_1163 266
1235 3300035692 Ga0373935_0107985 Ga0373935_0107985_947_1747 266
1236 3300035692 Ga0373935_0330396 Ga0373935_0330396_198_998 266
1237 3300035695 Ga0373927_0002359 Ga0373927_0002359_7769_8569 266
1238 3300035695 Ga0373927_0015519 Ga0373927_0015519_3742_4542 266
1239 3300035695 Ga0373927_0034659 Ga0373927_0034659_1905_2705 266
1240 3300035695 Ga0373927_0048502 Ga0373927_0048502_237_1037 266
1241 3300035724 Ga0373933_0000373 Ga0373933_0000373_10081_10881 266
1242 3300035724 Ga0373933_0000862 Ga0373933_0000862_6102_6902 266
1243 3300035724 Ga0373933_0037862 Ga0373933_0037862_1859_2659 266
1244 3300035724 Ga0373933_0052171 Ga0373933_0052171_1218_2018 266
1245 3300035724 Ga0373933_0092684 Ga0373933_0092684_998_1798 266
1246 3300035724 Ga0373933_0100035 Ga0373933_0100035_552_1352 266
1247 3300035724 Ga0373933_0155419 Ga0373933_0155419_305_1105 266
1248 3300035725 Ga0373947_0000096 Ga0373947_0000096_18493_19293 266
1249 3300035725 Ga0373947_0000288 Ga0373947_0000288_26603_27403 266
1250 3300035725 Ga0373947_0020805 Ga0373947_0020805_2229_3029 266
1251 3300035725 Ga0373947_0042688 Ga0373947_0042688_454_1254 266
1252 3300035725 Ga0373947_0094304 Ga0373947_0094304_151_951 266
1253 3300036401 Ga0373937_0000198 Ga0373937_0000198_41762_42562 266
1254 3300036401 Ga0373937_0000996 Ga0373937_0000996_21327_22127 266
1255 3300036401 Ga0373937_0001196 Ga0373937_0001196_16572_17372 266
1256 3300036401 Ga0373937_0004708 Ga0373937_0004708_10292_11092 266
1257 3300036401 Ga0373937_0012002 Ga0373937_0012002_2875_3675 266
1258 3300036401 Ga0373937_0016752 Ga0373937_0016752_3259_4059 266
1259 3300036401 Ga0373937_0062971 Ga0373937_0062971_834_1634 266
1260 3300036712 Ga0316584_0039976 Ga0316584_0039976_396_1196 266
1261 3300037068 Ga0373925_0000071 Ga0373925_0000071_33064_33864 266
1262 3300037068 Ga0373925_0025094 Ga0373925_0025094_2142_2942 266
1263 3300037068 Ga0373925_0039484 Ga0373925_0039484_2357_3157 266
1264 3300037068 Ga0373925_0078281 Ga0373925_0078281_443_1243 266
1265 3300037068 Ga0373925_0128987 Ga0373925_0128987_681_1481 266
1266 3300037068 Ga0373925_0151336 Ga0373925_0151336_970_1770 266
1267 3300037068 Ga0373925_0195558 Ga0373925_0195558_649_1449 266
1268 3300037418 Ga0395900_0005355 Ga0395900_0005355_3423_4256 266
1269 3300037418 Ga0395900_0009172 Ga0395900_0009172_2045_2845 266
1270 3300037418 Ga0395900_0023179 Ga0395900_0023179_3593_4393 266
1271 3300037418 Ga0395900_0030518 Ga0395900_0030518_3902_4702 266
1272 3300037418 Ga0395900_0385494 Ga0395900_0385494_364_1164 266
1273 3300037466 Ga0395898_0098632 Ga0395898_0098632_1988_2788 266
1274 3300037466 Ga0395898_0110477 Ga0395898_0110477_130_930 266
1275 3300037471 Ga0395905_0007343 Ga0395905_0007343_1284_2102 266
1276 3300037471 Ga0395905_0019208 Ga0395905_0019208_1637_2437 266
1277 3300037853 Ga0436364_0143743 Ga0436364_0143743_836_1636 266
1278 3300038443 Ga0395901_0111770 Ga0395901_0111770_1770_2570 266
1279 3300038443 Ga0395901_0169640 Ga0395901_0169640_296_1096 266
1280 3300038996 Ga0242420_001963 Ga0242420_001963_2047_2847 266
1281 3300039437 Ga0436365_1178757 Ga0436365_1178757_13_813 266
1282 3300039437 Ga0436365_1584283 Ga0436365_1584283_10666_11466 266
1283 3300039438 Ga0436360_1218633 Ga0436360_1218633_436_1236 266
1284 3300039447 Ga0436361_0066245 Ga0436361_0066245_30936_31814 266
1285 3300039453 Ga0436362_0484821 Ga0436362_0484821_100_900 266
1286 3300041404 Ga0439436_0000775 Ga0439436_0000775_5949_6749 266
1287 3300041404 Ga0439436_0043605 Ga0439436_0043605_39_839 266
1288 3300041405 Ga0439438_000172 Ga0439438_000172_11089_11907 266
1289 3300041406 Ga0439439_0006506 Ga0439439_0006506_1098_1898 266
1290 3300041407 Ga0439447_036061 Ga0439447_036061_114_914 266
1291 3300041407 Ga0439447_043930 Ga0439447_043930_243_1061 266
1292 3300041411 Ga0439466_0000919 Ga0439466_0000919_7016_7816 266
1293 3300041411 Ga0439466_0052802 Ga0439466_0052802_208_1008 266
1294 3300041413 Ga0439465_0001472 Ga0439465_0001472_3497_4297 266
1295 3300041997 Ga0439431_0000651 Ga0439431_0000651_3448_4248 266
1296 3300042002 Ga0439442_005663 Ga0439442_005663_398_1198 266
1297 3300042004 Ga0439445_0000311 Ga0439445_0000311_1598_2398 266
1298 3300042006 Ga0439432_000634 Ga0439432_000634_784_1584 266
1299 3300042006 Ga0439432_000839 Ga0439432_000839_8187_8987 266
1300 3300042006 Ga0439432_048569 Ga0439432_048569_214_1014 266
1301 3300042007 Ga0439449_0001169 Ga0439449_0001169_5274_6074 266
1302 3300042007 Ga0439449_0071617 Ga0439449_0071617_167_967 266
1303 3300042010 Ga0439452_007246 Ga0439452_007246_2184_2984 266
1304 3300042010 Ga0439452_014273 Ga0439452_014273_1374_2174 266
1305 3300042014 Ga0439457_006925 Ga0439457_006925_288_1088 266
1306 3300042015 Ga0439462_0000245 Ga0439462_0000245_1588_2388 266
1307 3300042016 Ga0439463_009804 Ga0439463_009804_1428_2246 266
1308 3300042145 Ga0450906_008920 Ga0450906_008920_699_1499 266
1309 3300042156 Ga0439446_0000836 Ga0439446_0000836_588_1388 266
1310 3300042435 Ga0439434_0008498 Ga0439434_0008498_1111_1911 266
1311 3300042435 Ga0439434_0102640 Ga0439434_0102640_106_906 266
1312 3300042530 Ga0450916_020341 Ga0450916_020341_42_842 266
1313 3300042532 Ga0450893_0012840 Ga0450893_0012840_526_1326 266
1314 3300044694 Ga0466963_0169674 Ga0466963_0169674_370_1170 266
1315 3300044712 Ga0453684_0389327 Ga0453684_0389327_456_1256 266
1316 3300044842 Ga0466957_0151547 Ga0466957_0151547_613_1413 266
1317 3300044842 Ga0466957_0198811 Ga0466957_0198811_178_1008 266
1318 3300045049 Ga0466959_0181286 Ga0466959_0181286_532_1332 266
1319 3300045836 Ga0466958_0019850 Ga0466958_0019850_2654_3490 266
1320 3300045976 Ga0466967_0002811 Ga0466967_0002811_5621_6421 266
1321 3300045976 Ga0466967_0677743 Ga0466967_0677743_39_839 266
1322 3300046452 Ga0495617_025618 Ga0495617_025618_1165_1965 266
1323 3300046453 Ga0495627_005899 Ga0495627_005899_161_1027 266
1324 3300046454 Ga0495592_0000117 Ga0495592_0000117_37606_38406 266
1325 3300046454 Ga0495592_0023908 Ga0495592_0023908_2828_3628 266
1326 3300046454 Ga0495592_0031275 Ga0495592_0031275_754_1563 266
1327 3300046454 Ga0495592_0074670 Ga0495592_0074670_1187_1987 266
1328 3300046454 Ga0495592_0089572 Ga0495592_0089572_172_972 266
1329 3300046454 Ga0495592_0184893 Ga0495592_0184893_507_1307 266
1330 3300046454 Ga0495592_0243356 Ga0495592_0243356_284_1084 266
1331 3300046454 Ga0495592_0291141 Ga0495592_0291141_141_941 266
1332 3300046455 Ga0495603_0008338 Ga0495603_0008338_1696_2496 266
1333 3300046455 Ga0495603_0028846 Ga0495603_0028846_1890_2690 266
1334 3300046455 Ga0495603_0237029 Ga0495603_0237029_200_1000 266
1335 3300046458 Ga0495591_000635 Ga0495591_000635_1781_2590 266
1336 3300046459 Ga0495629_0000183 Ga0495629_0000183_24996_25796 266
1337 3300046459 Ga0495629_0008700 Ga0495629_0008700_3883_4683 266
1338 3300046459 Ga0495629_0010435 Ga0495629_0010435_3723_4532 266
1339 3300046459 Ga0495629_0022122 Ga0495629_0022122_1225_2025 266
1340 3300046460 Ga0495638_0019805 Ga0495638_0019805_908_1708 266
1341 3300046460 Ga0495638_0044966 Ga0495638_0044966_1944_2753 266
1342 3300046461 Ga0495641_0014858 Ga0495641_0014858_3111_3911 266
1343 3300046461 Ga0495641_0024360 Ga0495641_0024360_577_1377 266
1344 3300046461 Ga0495641_0048412 Ga0495641_0048412_717_1517 266
1345 3300046461 Ga0495641_0062845 Ga0495641_0062845_268_1068 266
1346 3300046462 Ga0495651_0000370 Ga0495651_0000370_6535_7335 266
1347 3300046462 Ga0495651_0000814 Ga0495651_0000814_21846_22646 266
1348 3300046462 Ga0495651_0002238 Ga0495651_0002238_6999_7808 266
1349 3300046462 Ga0495651_0006676 Ga0495651_0006676_4371_5171 266
1350 3300046462 Ga0495651_0007700 Ga0495651_0007700_1406_2206 266
1351 3300046462 Ga0495651_0009079 Ga0495651_0009079_2381_3181 266
1352 3300046462 Ga0495651_0018701 Ga0495651_0018701_3517_4317 266
1353 3300046462 Ga0495651_0080495 Ga0495651_0080495_1426_2226 266
1354 3300046462 Ga0495651_0132388 Ga0495651_0132388_31_831 266
1355 3300046463 Ga0495653_0000047 Ga0495653_0000047_67013_67813 266
1356 3300046463 Ga0495653_0005190 Ga0495653_0005190_821_1630 266
1357 3300046463 Ga0495653_0007193 Ga0495653_0007193_6114_6932 266
1358 3300046463 Ga0495653_0010604 Ga0495653_0010604_756_1592 266
1359 3300046463 Ga0495653_0096770 Ga0495653_0096770_506_1306 266
1360 3300046471 Ga0495650_0001103 Ga0495650_0001103_20674_21492 266
1361 3300046471 Ga0495650_0001463 Ga0495650_0001463_20232_21032 266
1362 3300046471 Ga0495650_0094670 Ga0495650_0094670_64_864 266
1363 3300046472 Ga0495580_0007138 Ga0495580_0007138_2418_3227 266
1364 3300046472 Ga0495580_0025075 Ga0495580_0025075_352_1152 266
1365 3300046472 Ga0495580_0070025 Ga0495580_0070025_1597_2397 266
1366 3300046472 Ga0495580_0154976 Ga0495580_0154976_237_1046 266
1367 3300046473 Ga0495582_0001121 Ga0495582_0001121_7467_8267 266
1368 3300046473 Ga0495582_0024945 Ga0495582_0024945_652_1461 266
1369 3300046475 Ga0495639_0050356 Ga0495639_0050356_905_1705 266
1370 3300046476 Ga0495662_0005350 Ga0495662_0005350_2397_3197 266
1371 3300046476 Ga0495662_0010112 Ga0495662_0010112_3686_4495 266
1372 3300046476 Ga0495662_0030200 Ga0495662_0030200_754_1554 266
1373 3300046476 Ga0495662_0044862 Ga0495662_0044862_309_1109 266
1374 3300046476 Ga0495662_0151810 Ga0495662_0151810_91_891 266
1375 3300046477 Ga0495664_0000024 Ga0495664_0000024_37860_38660 266
1376 3300046477 Ga0495664_0005136 Ga0495664_0005136_2659_3468 266
1377 3300046477 Ga0495664_0057217 Ga0495664_0057217_46_846 266
1378 3300046491 Ga0495584_0010326 Ga0495584_0010326_879_1679 266
1379 3300046492 Ga0495585_0003428 Ga0495585_0003428_3461_4261 266
1380 3300046499 Ga0495594_0005327 Ga0495594_0005327_5597_6397 266
1381 3300046500 Ga0495596_0000234 Ga0495596_0000234_9078_9890 266
1382 3300046500 Ga0495596_0000399 Ga0495596_0000399_6226_7044 266
1383 3300046500 Ga0495596_0000473 Ga0495596_0000473_17643_18452 266
1384 3300046501 Ga0495607_0003341 Ga0495607_0003341_10203_11003 266
1385 3300046501 Ga0495607_0005459 Ga0495607_0005459_4604_5416 266
1386 3300046501 Ga0495607_0009340 Ga0495607_0009340_3107_3907 266
1387 3300046507 Ga0495606_0000028 Ga0495606_0000028_146810_147628 266
1388 3300046511 Ga0495608_0000004 Ga0495608_0000004_104366_105166 266
1389 3300046511 Ga0495608_0002221 Ga0495608_0002221_2289_3089 266
1390 3300046511 Ga0495608_0005426 Ga0495608_0005426_1083_1892 266
1391 3300046511 Ga0495608_0015766 Ga0495608_0015766_4055_4855 266
1392 3300046511 Ga0495608_0270471 Ga0495608_0270471_154_954 266
1393 3300046512 Ga0495610_0001083 Ga0495610_0001083_19343_20155 266
1394 3300046512 Ga0495610_0011354 Ga0495610_0011354_2440_3240 266
1395 3300046513 Ga0495616_0005373 Ga0495616_0005373_3089_3925 266
1396 3300046513 Ga0495616_0008254 Ga0495616_0008254_4620_5432 266
1397 3300046513 Ga0495616_0010366 Ga0495616_0010366_2831_3631 266
1398 3300046514 Ga0495618_0000036 Ga0495618_0000036_55176_55976 266
1399 3300046514 Ga0495618_0010775 Ga0495618_0010775_1993_2802 266
1400 3300046514 Ga0495618_0013409 Ga0495618_0013409_90_890 266
1401 3300046514 Ga0495618_0022634 Ga0495618_0022634_2267_3067 266
1402 3300046514 Ga0495618_0058548 Ga0495618_0058548_1614_2414 266
1403 3300046516 Ga0495628_0000006 Ga0495628_0000006_45567_46367 266
1404 3300046516 Ga0495628_0000950 Ga0495628_0000950_10719_11519 266
1405 3300046516 Ga0495628_0011003 Ga0495628_0011003_6151_6951 266
1406 3300046516 Ga0495628_0037732 Ga0495628_0037732_1030_1863 266
1407 3300046516 Ga0495628_0063284 Ga0495628_0063284_483_1283 266
1408 3300046516 Ga0495628_0084826 Ga0495628_0084826_216_1016 266
1409 3300046516 Ga0495628_0113498 Ga0495628_0113498_693_1502 266
1410 3300046517 Ga0495630_0000647 Ga0495630_0000647_21722_22522 266
1411 3300046517 Ga0495630_0000958 Ga0495630_0000958_12032_12841 266
1412 3300046517 Ga0495630_0037719 Ga0495630_0037719_61_861 266
1413 3300046518 Ga0495631_0000135 Ga0495631_0000135_42427_43227 266
1414 3300046518 Ga0495631_0088284 Ga0495631_0088284_191_991 266
1415 3300046520 Ga0495637_0067592 Ga0495637_0067592_523_1323 266
1416 3300046523 Ga0495644_0000234 Ga0495644_0000234_1064_1864 266
1417 3300046524 Ga0495648_0000454 Ga0495648_0000454_34025_34834 266
1418 3300046524 Ga0495648_0003768 Ga0495648_0003768_10958_11767 266
1419 3300046526 Ga0495666_0001961 Ga0495666_0001961_926_1735 266
1420 3300046526 Ga0495666_0069489 Ga0495666_0069489_699_1499 266
1421 3300046529 Ga0495652_0000038 Ga0495652_0000038_40578_41378 266
1422 3300046529 Ga0495652_0002257 Ga0495652_0002257_11920_12720 266
1423 3300046529 Ga0495652_0005721 Ga0495652_0005721_9665_10465 266
1424 3300046529 Ga0495652_0051353 Ga0495652_0051353_1410_2210 266
1425 3300046529 Ga0495652_0067574 Ga0495652_0067574_1803_2612 266
1426 3300046529 Ga0495652_0150503 Ga0495652_0150503_51_851 266
1427 3300046530 Ga0495654_0000458 Ga0495654_0000458_20674_21492 266
1428 3300046531 Ga0495665_0000503 Ga0495665_0000503_2495_3304 266
1429 3300046531 Ga0495665_0171539 Ga0495665_0171539_223_1023 266
1430 3300046531 Ga0495665_0263839 Ga0495665_0263839_11_844 266
1431 3300046533 Ga0495640_0000001 Ga0495640_0000001_52753_53553 266
1432 3300046533 Ga0495640_0009446 Ga0495640_0009446_1115_1915 266
1433 3300046533 Ga0495640_0011562 Ga0495640_0011562_5397_6206 266
1434 3300046533 Ga0495640_0018366 Ga0495640_0018366_2750_3550 266
1435 3300046533 Ga0495640_0030156 Ga0495640_0030156_1680_2480 266
1436 3300046533 Ga0495640_0065064 Ga0495640_0065064_1641_2441 266
1437 3300046533 Ga0495640_0118754 Ga0495640_0118754_307_1107 266
1438 3300046535 Ga0495586_0011977 Ga0495586_0011977_3566_4375 266
1439 3300046535 Ga0495586_0078426 Ga0495586_0078426_296_1096 266
1440 3300046535 Ga0495586_0116328 Ga0495586_0116328_56_856 266
1441 3300046536 Ga0495587_0000004 Ga0495587_0000004_107831_108631 266
1442 3300046536 Ga0495587_0002205 Ga0495587_0002205_9964_10773 266
1443 3300046536 Ga0495587_0002956 Ga0495587_0002956_2767_3567 266
1444 3300046536 Ga0495587_0016926 Ga0495587_0016926_2489_3289 266
1445 3300046536 Ga0495587_0044529 Ga0495587_0044529_919_1719 266
1446 3300046536 Ga0495587_0101778 Ga0495587_0101778_122_922 266
1447 3300046536 Ga0495587_0227286 Ga0495587_0227286_124_924 266
1448 3300046536 Ga0495587_0237797 Ga0495587_0237797_175_975 266
1449 3300046538 Ga0495609_0003061 Ga0495609_0003061_4380_5192 266
1450 3300046538 Ga0495609_0068622 Ga0495609_0068622_76_876 266
1451 3300046539 Ga0495621_0043543 Ga0495621_0043543_32_856 266
1452 3300046539 Ga0495621_0051238 Ga0495621_0051238_106_906 266
1453 3300046543 Ga0495645_0000001 Ga0495645_0000001_249950_250750 266
1454 3300046543 Ga0495645_0000432 Ga0495645_0000432_24464_25264 266
1455 3300046543 Ga0495645_0001487 Ga0495645_0001487_6961_7761 266
1456 3300046543 Ga0495645_0024643 Ga0495645_0024643_753_1562 266
1457 3300046543 Ga0495645_0105019 Ga0495645_0105019_935_1735 266
1458 3300046543 Ga0495645_0239708 Ga0495645_0239708_260_1060 266
1459 3300046557 Ga0495622_0024244 Ga0495622_0024244_599_1399 266
1460 3300046557 Ga0495622_0027655 Ga0495622_0027655_208_1008 266
1461 3300046557 Ga0495622_0076085 Ga0495622_0076085_726_1526 266
1462 3300046558 Ga0495633_0005806 Ga0495633_0005806_317_1117 266
1463 3300046559 Ga0495667_0000093 Ga0495667_0000093_31696_32496 266
1464 3300046559 Ga0495667_0001799 Ga0495667_0001799_1584_2384 266
1465 3300046559 Ga0495667_0008800 Ga0495667_0008800_4063_4863 266
1466 3300046559 Ga0495667_0026230 Ga0495667_0026230_70_870 266
1467 3300046559 Ga0495667_0029736 Ga0495667_0029736_2243_3043 266
1468 3300046559 Ga0495667_0067176 Ga0495667_0067176_306_1115 266
1469 3300046559 Ga0495667_0130871 Ga0495667_0130871_86_886 266
1470 3300046559 Ga0495667_0256305 Ga0495667_0256305_286_1086 266
1471 3300046615 Ga0495656_0000174 Ga0495656_0000174_2781_3581 266
1472 3300046616 Ga0495668_0001029 Ga0495668_0001029_20667_21485 266
1473 3300046616 Ga0495668_0007077 Ga0495668_0007077_6279_7097 266
1474 3300046642 Ga0495634_0000133 Ga0495634_0000133_37596_38396 266
1475 3300046642 Ga0495634_0016098 Ga0495634_0016098_3723_4532 266
1476 3300046642 Ga0495634_0033066 Ga0495634_0033066_1181_1981 266
1477 3300046642 Ga0495634_0114725 Ga0495634_0114725_439_1239 266
1478 3300046642 Ga0495634_0206571 Ga0495634_0206571_48_848 266
1479 3300046648 Ga0495611_0023408 Ga0495611_0023408_1014_1814 266
1480 3300046660 Ga0495625_0150502 Ga0495625_0150502_290_1090 266
1481 3300046663 Ga0495635_0000003 Ga0495635_0000003_249581_250381 266
1482 3300046663 Ga0495635_0000646 Ga0495635_0000646_5525_6334 266
1483 3300046663 Ga0495635_0006494 Ga0495635_0006494_5964_6764 266
1484 3300046663 Ga0495635_0034212 Ga0495635_0034212_2060_2860 266
1485 3300046663 Ga0495635_0073971 Ga0495635_0073971_599_1399 266
1486 3300046663 Ga0495635_0105275 Ga0495635_0105275_158_958 266
1487 3300046663 Ga0495635_0119512 Ga0495635_0119512_259_1059 266
1488 3300046664 Ga0495659_0000220 Ga0495659_0000220_3831_4631 266
1489 3300046665 Ga0495661_0000013 Ga0495661_0000013_105218_106036 266
1490 3300046665 Ga0495661_0000842 Ga0495661_0000842_15158_15967 266
1491 3300046665 Ga0495661_0012410 Ga0495661_0012410_513_1325 266
1492 3300046674 Ga0495588_0037137 Ga0495588_0037137_867_1667 266
1493 3300046675 Ga0495657_0000143 Ga0495657_0000143_37563_38363 266
1494 3300046675 Ga0495657_0013257 Ga0495657_0013257_1280_2080 266
1495 3300046675 Ga0495657_0021999 Ga0495657_0021999_3001_3801 266
1496 3300046675 Ga0495657_0047823 Ga0495657_0047823_734_1534 266
1497 3300046675 Ga0495657_0172690 Ga0495657_0172690_473_1282 266
1498 3300046678 Ga0495599_0000012 Ga0495599_0000012_47845_48645 266
1499 3300046678 Ga0495599_0004908 Ga0495599_0004908_4620_5420 266
1500 3300046678 Ga0495599_0018735 Ga0495599_0018735_3060_3869 266
1501 3300046678 Ga0495599_0027283 Ga0495599_0027283_2620_3420 266
1502 3300046678 Ga0495599_0075037 Ga0495599_0075037_1196_1996 266
1503 3300046678 Ga0495599_0109570 Ga0495599_0109570_158_958 266
1504 3300046679 Ga0495623_0000015 Ga0495623_0000015_84908_85708 266
1505 3300046679 Ga0495623_0001145 Ga0495623_0001145_4480_5298 266
1506 3300046679 Ga0495623_0004582 Ga0495623_0004582_7633_8433 266
1507 3300046679 Ga0495623_0007637 Ga0495623_0007637_2864_3673 266
1508 3300046679 Ga0495623_0058539 Ga0495623_0058539_1323_2123 266
1509 3300046680 Ga0495646_0000005 Ga0495646_0000005_162121_162921 266
1510 3300046680 Ga0495646_0002872 Ga0495646_0002872_1619_2428 266
1511 3300046680 Ga0495646_0006953 Ga0495646_0006953_4229_5029 266
1512 3300046680 Ga0495646_0024002 Ga0495646_0024002_928_1728 266
1513 3300046680 Ga0495646_0051560 Ga0495646_0051560_1386_2222 266
1514 3300046680 Ga0495646_0299562 Ga0495646_0299562_31_831 266
1515 3300046681 Ga0495647_0013152 Ga0495647_0013152_1024_1824 266
1516 3300046683 Ga0495658_0000357 Ga0495658_0000357_8700_9500 266
1517 3300046683 Ga0495658_0009686 Ga0495658_0009686_1641_2441 266
1518 3300046683 Ga0495658_0064782 Ga0495658_0064782_1038_1838 266
1519 3300046683 Ga0495658_0069789 Ga0495658_0069789_1076_1876 266
1520 3300046683 Ga0495658_0275730 Ga0495658_0275730_175_975 266
1521 3300046689 Ga0495613_0002012 Ga0495613_0002012_13622_14431 266
1522 3300046689 Ga0495613_0009346 Ga0495613_0009346_3528_4328 266
1523 3300046689 Ga0495613_0143411 Ga0495613_0143411_224_1024 266
1524 3300046689 Ga0495613_0160507 Ga0495613_0160507_547_1347 266
1525 3300046690 Ga0495624_0003776 Ga0495624_0003776_4366_5175 266
1526 3300046690 Ga0495624_0031164 Ga0495624_0031164_1144_1944 266
1527 3300046691 Ga0495670_0000414 Ga0495670_0000414_4841_5641 266
1528 3300046692 Ga0495671_0001254 Ga0495671_0001254_4641_5453 266
1529 3300046692 Ga0495671_0040031 Ga0495671_0040031_981_1781 266
1530 3300046692 Ga0495671_0169826 Ga0495671_0169826_121_930 266
1531 3300046694 Ga0495649_0008623 Ga0495649_0008623_760_1572 266
1532 3300046694 Ga0495649_0044452 Ga0495649_0044452_1103_1912 266
1533 3300046794 Ga0495589_0035216 Ga0495589_0035216_1009_1818 266
1534 3300046794 Ga0495589_0125734 Ga0495589_0125734_25_837 266
1535 3300046794 Ga0495589_0151085 Ga0495589_0151085_262_1062 266
1536 3300046809 Ga0495600_0000051 Ga0495600_0000051_40741_41541 266
1537 3300046809 Ga0495600_0003472 Ga0495600_0003472_5255_6064 266
1538 3300046809 Ga0495600_0007486 Ga0495600_0007486_2662_3462 266
1539 3300046809 Ga0495600_0022417 Ga0495600_0022417_515_1315 266
1540 3300046809 Ga0495600_0037657 Ga0495600_0037657_1896_2696 266
1541 3300046809 Ga0495600_0190871 Ga0495600_0190871_214_1014 266
1542 3300047315 Ga0495581_0001486 Ga0495581_0001486_1162_1971 266
1543 3300047315 Ga0495581_0010000 Ga0495581_0010000_3861_4661 266
1544 3300047315 Ga0495581_0012865 Ga0495581_0012865_3968_4768 266
1545 3300047315 Ga0495581_0015516 Ga0495581_0015516_1664_2464 266
1546 3300047317 Ga0495604_0000002 Ga0495604_0000002_280268_281068 266
1547 3300047317 Ga0495604_0017648 Ga0495604_0017648_3911_4711 266
1548 3300047317 Ga0495604_0048780 Ga0495604_0048780_2227_3036 266
1549 3300047317 Ga0495604_0115217 Ga0495604_0115217_108_908 266
1550 3300047317 Ga0495604_0137824 Ga0495604_0137824_904_1704 266
1551 3300047317 Ga0495604_0212198 Ga0495604_0212198_205_1038 266
1552 3300047319 Ga0495674_0000004 Ga0495674_0000004_279817_280617 266
1553 3300047319 Ga0495674_0024907 Ga0495674_0024907_763_1563 266
1554 3300047319 Ga0495674_0025291 Ga0495674_0025291_2791_3591 266
1555 3300047319 Ga0495674_0048298 Ga0495674_0048298_2758_3558 266
1556 3300047319 Ga0495674_0051878 Ga0495674_0051878_2112_2921 266
1557 3300047319 Ga0495674_0069597 Ga0495674_0069597_249_1049 266
1558 3300047319 Ga0495674_0155587 Ga0495674_0155587_1016_1816 266
1559 3300047320 Ga0495672_0013407 Ga0495672_0013407_151_963 266
1560 3300047321 Ga0495676_0008678 Ga0495676_0008678_5158_5967 266
1561 3300047321 Ga0495676_0036656 Ga0495676_0036656_719_1519 266
1562 3300047322 Ga0495680_0000142 Ga0495680_0000142_68267_69067 266
1563 3300047322 Ga0495680_0001462 Ga0495680_0001462_3167_3967 266
1564 3300047322 Ga0495680_0005045 Ga0495680_0005045_11114_11914 266
1565 3300047322 Ga0495680_0011214 Ga0495680_0011214_4151_4960 266
1566 3300047322 Ga0495680_0012241 Ga0495680_0012241_3155_3955 266
1567 3300047322 Ga0495680_0017639 Ga0495680_0017639_3129_3929 266
1568 3300047322 Ga0495680_0027679 Ga0495680_0027679_3558_4394 266
1569 3300047322 Ga0495680_0054253 Ga0495680_0054253_1795_2595 266
1570 3300047322 Ga0495680_0054369 Ga0495680_0054369_1822_2622 266
1571 3300047322 Ga0495680_0081387 Ga0495680_0081387_583_1401 266
1572 3300047323 Ga0495683_0000086 Ga0495683_0000086_80624_81442 266
1573 3300047323 Ga0495683_0000919 Ga0495683_0000919_15243_16052 266
1574 3300047444 Ga0495675_0000824 Ga0495675_0000824_14408_15208 266
1575 3300047444 Ga0495675_0004498 Ga0495675_0004498_3527_4345 266
1576 3300047444 Ga0495675_0005626 Ga0495675_0005626_3723_4532 266
1577 3300047444 Ga0495675_0057907 Ga0495675_0057907_216_1016 266
1578 3300047444 Ga0495675_0087847 Ga0495675_0087847_837_1670 266
1579 3300047444 Ga0495675_0099781 Ga0495675_0099781_808_1608 266
1580 3300047446 Ga0495679_000078 Ga0495679_000078_35423_36232 266
1581 3300047447 Ga0495685_006895 Ga0495685_006895_1152_1964 266
1582 3300047469 Ga0495673_0004187 Ga0495673_0004187_6014_6823 266
1583 3300047469 Ga0495673_0007764 Ga0495673_0007764_1597_2415 266
1584 3300047469 Ga0495673_0105981 Ga0495673_0105981_49_861 266
1585 3300047471 Ga0495684_0000004 Ga0495684_0000004_260693_261493 266
1586 3300047471 Ga0495684_0001528 Ga0495684_0001528_1787_2587 266
1587 3300047471 Ga0495684_0033070 Ga0495684_0033070_2650_3468 266
1588 3300047471 Ga0495684_0100776 Ga0495684_0100776_1109_1918 266
1589 3300047471 Ga0495684_0110807 Ga0495684_0110807_444_1244 266
1590 3300047471 Ga0495684_0199991 Ga0495684_0199991_298_1098 266
1591 3300047673 Ga0495593_0004166 Ga0495593_0004166_581_1390 266
1592 3300047673 Ga0495593_0156173 Ga0495593_0156173_283_1083 266
1593 3300048088 Ga0495602_0000001 Ga0495602_0000001_249623_250423 266
1594 3300048088 Ga0495602_0004084 Ga0495602_0004084_6218_7018 266
1595 3300048088 Ga0495602_0038074 Ga0495602_0038074_2513_3313 266
1596 3300048088 Ga0495602_0067303 Ga0495602_0067303_1102_1902 266
1597 3300048089 Ga0495614_0001174 Ga0495614_0001174_4177_4986 266
1598 3300048089 Ga0495614_0106141 Ga0495614_0106141_241_1041 266
1599 3300048091 Ga0495626_0001516 Ga0495626_0001516_13107_13943 266
1600 3300048903 Ga0496100_0000066 Ga0496100_0000066_44325_45128 266
1601 3300048903 Ga0496100_0002624 Ga0496100_0002624_1985_2785 266
1602 3300048903 Ga0496100_0032409 Ga0496100_0032409_2348_3148 266
1603 3300048903 Ga0496100_0040924 Ga0496100_0040924_1041_1841 266
1604 3300048903 Ga0496100_0088506 Ga0496100_0088506_1081_1881 266
1605 3300048903 Ga0496100_0096905 Ga0496100_0096905_745_1545 266
1606 3300048904 Ga0496101_0000154 Ga0496101_0000154_44298_45101 266
1607 3300048904 Ga0496101_0003320 Ga0496101_0003320_7362_8162 266
1608 3300048904 Ga0496101_0015113 Ga0496101_0015113_4033_4833 266
1609 3300048904 Ga0496101_0020381 Ga0496101_0020381_1622_2422 266
1610 3300048904 Ga0496101_0048987 Ga0496101_0048987_1389_2189 266
1611 3300048904 Ga0496101_0412861 Ga0496101_0412861_250_1050 266
1612 3300048905 Ga0496102_0000191 Ga0496102_0000191_44302_45105 266
1613 3300048905 Ga0496102_0006722 Ga0496102_0006722_1992_2801 266
1614 3300048905 Ga0496102_0024677 Ga0496102_0024677_2448_3248 266
1615 3300048905 Ga0496102_0025462 Ga0496102_0025462_2887_3687 266
1616 3300048905 Ga0496102_0062282 Ga0496102_0062282_2337_3137 266
1617 3300048905 Ga0496102_0107194 Ga0496102_0107194_1405_2205 266
1618 3300048905 Ga0496102_0130447 Ga0496102_0130447_1425_2243 266
1619 3300048905 Ga0496102_0166352 Ga0496102_0166352_600_1400 266
1620 3300048905 Ga0496102_0283874 Ga0496102_0283874_642_1442 266
1621 3300048906 Ga0496103_0000232 Ga0496103_0000232_15350_16153 266
1622 3300048906 Ga0496103_0002570 Ga0496103_0002570_2527_3336 266
1623 3300048906 Ga0496103_0010404 Ga0496103_0010404_1478_2278 266
1624 3300048906 Ga0496103_0022797 Ga0496103_0022797_691_1491 266
1625 3300048906 Ga0496103_0123516 Ga0496103_0123516_610_1410 266
1626 3300048907 Ga0496104_0001363 Ga0496104_0001363_9699_10499 266
1627 3300048907 Ga0496104_0005323 Ga0496104_0005323_8988_9791 266
1628 3300048907 Ga0496104_0030000 Ga0496104_0030000_2398_3198 266
1629 3300048907 Ga0496104_0094144 Ga0496104_0094144_492_1292 266
1630 3300048907 Ga0496104_0196088 Ga0496104_0196088_95_895 266
1631 3300048907 Ga0496104_0453131 Ga0496104_0453131_142_945 266
1632 3300048908 Ga0496105_0002131 Ga0496105_0002131_12254_13054 266
1633 3300048908 Ga0496105_0020728 Ga0496105_0020728_2215_3015 266
1634 3300048908 Ga0496105_0038168 Ga0496105_0038168_68_871 266
1635 3300048908 Ga0496105_0045672 Ga0496105_0045672_1517_2317 266
1636 3300048908 Ga0496105_0101863 Ga0496105_0101863_1127_1927 266
1637 3300048908 Ga0496105_0166138 Ga0496105_0166138_523_1323 266
1638 3300048908 Ga0496105_0194665 Ga0496105_0194665_228_1028 266
1639 3300048908 Ga0496105_0437968 Ga0496105_0437968_210_1010 266
1640 3300048909 Ga0496106_0002204 Ga0496106_0002204_10614_11414 266
1641 3300048909 Ga0496106_0004015 Ga0496106_0004015_5287_6087 266
1642 3300048909 Ga0496106_0046148 Ga0496106_0046148_901_1701 266
1643 3300048909 Ga0496106_0173777 Ga0496106_0173777_358_1158 266
1644 3300048909 Ga0496106_0188967 Ga0496106_0188967_606_1406 266
1645 3300048909 Ga0496106_0283491 Ga0496106_0283491_428_1228 266
1646 3300048910 Ga0496107_0001189 Ga0496107_0001189_3176_3976 266
1647 3300048910 Ga0496107_0005878 Ga0496107_0005878_3425_4225 266
1648 3300048910 Ga0496107_0023259 Ga0496107_0023259_549_1349 266
1649 3300048910 Ga0496107_0048646 Ga0496107_0048646_2191_2991 266
1650 3300048910 Ga0496107_0060851 Ga0496107_0060851_1913_2713 266
1651 3300048910 Ga0496107_0461999 Ga0496107_0461999_34_834 266
1652 3300048911 Ga0496108_0002494 Ga0496108_0002494_6992_7792 266
1653 3300048911 Ga0496108_0010537 Ga0496108_0010537_2167_2967 266
1654 3300048911 Ga0496108_0037485 Ga0496108_0037485_1072_1872 266
1655 3300048911 Ga0496108_0070746 Ga0496108_0070746_1936_2736 266
1656 3300048911 Ga0496108_0095796 Ga0496108_0095796_154_954 266
1657 3300048911 Ga0496108_0184186 Ga0496108_0184186_572_1372 266
1658 3300048911 Ga0496108_0533793 Ga0496108_0533793_171_971 266
1659 3300048912 Ga0496109_0000567 Ga0496109_0000567_1089_1889 266
1660 3300048912 Ga0496109_0000700 Ga0496109_0000700_24348_25148 266
1661 3300048912 Ga0496109_0013437 Ga0496109_0013437_5252_6052 266
1662 3300048912 Ga0496109_0085694 Ga0496109_0085694_23_823 266
1663 3300048913 Ga0496110_0036662 Ga0496110_0036662_1517_2317 266
1664 3300048913 Ga0496110_0071860 Ga0496110_0071860_1632_2432 266
1665 3300048913 Ga0496110_0115960 Ga0496110_0115960_250_1050 266
1666 3300048913 Ga0496110_0404582 Ga0496110_0404582_293_1093 266
1667 3300048913 Ga0496110_0635255 Ga0496110_0635255_82_882 266
1668 3300048914 Ga0496111_0002128 Ga0496111_0002128_3491_4291 266
1669 3300048914 Ga0496111_0030278 Ga0496111_0030278_396_1196 266
1670 3300048914 Ga0496111_0127915 Ga0496111_0127915_545_1345 266
1671 3300048914 Ga0496111_0262018 Ga0496111_0262018_451_1251 266
1672 3300048914 Ga0496111_0281064 Ga0496111_0281064_303_1103 266
1673 3300048915 Ga0496112_0006626 Ga0496112_0006626_4891_5691 266
1674 3300048915 Ga0496112_0054561 Ga0496112_0054561_1068_1868 266
1675 3300048915 Ga0496112_0067828 Ga0496112_0067828_663_1463 266
1676 3300048915 Ga0496112_0131301 Ga0496112_0131301_1351_2151 266
1677 3300048915 Ga0496112_0238354 Ga0496112_0238354_124_924 266
1678 3300048915 Ga0496112_0446415 Ga0496112_0446415_329_1129 266
1679 3300048916 Ga0496113_0001279 Ga0496113_0001279_10219_11019 266
1680 3300048916 Ga0496113_0020581 Ga0496113_0020581_1236_2036 266
1681 3300048916 Ga0496113_0057616 Ga0496113_0057616_718_1518 266
1682 3300048916 Ga0496113_0064863 Ga0496113_0064863_1903_2703 266
1683 3300048916 Ga0496113_0136323 Ga0496113_0136323_313_1113 266
1684 3300048916 Ga0496113_0190821 Ga0496113_0190821_419_1219 266
1685 3300048917 Ga0496114_0018338 Ga0496114_0018338_1899_2699 266
1686 3300048917 Ga0496114_0029525 Ga0496114_0029525_1275_2075 266
1687 3300048917 Ga0496114_0033161 Ga0496114_0033161_2380_3180 266
1688 3300048917 Ga0496114_0274562 Ga0496114_0274562_534_1334 266
1689 3300048918 Ga0496115_0001922 Ga0496115_0001922_12548_13348 266
1690 3300048918 Ga0496115_0010508 Ga0496115_0010508_4178_4978 266
1691 3300048918 Ga0496115_0017144 Ga0496115_0017144_262_1062 266
1692 3300048918 Ga0496115_0024926 Ga0496115_0024926_3062_3862 266
1693 3300048918 Ga0496115_0040708 Ga0496115_0040708_2323_3123 266
1694 3300048918 Ga0496115_0046991 Ga0496115_0046991_1177_1977 266
1695 3300048918 Ga0496115_0168289 Ga0496115_0168289_668_1468 266
1696 3300048918 Ga0496115_0247411 Ga0496115_0247411_176_976 266
1697 3300048919 Ga0496116_0008329 Ga0496116_0008329_4728_5540 266
1698 3300048919 Ga0496116_0010352 Ga0496116_0010352_5476_6276 266
1699 3300048919 Ga0496116_0096558 Ga0496116_0096558_282_1082 266
1700 3300048919 Ga0496116_0229102 Ga0496116_0229102_89_922 266
1701 3300048920 Ga0496117_0000956 Ga0496117_0000956_38454_39257 266
1702 3300048920 Ga0496117_0008683 Ga0496117_0008683_2635_3435 266
1703 3300048920 Ga0496117_0009904 Ga0496117_0009904_5937_6737 266
1704 3300048920 Ga0496117_0011583 Ga0496117_0011583_6699_7508 266
1705 3300048920 Ga0496117_0093919 Ga0496117_0093919_470_1303 266
1706 3300048921 Ga0496118_0000494 Ga0496118_0000494_44309_45112 266
1707 3300048921 Ga0496118_0000757 Ga0496118_0000757_36737_37546 266
1708 3300048921 Ga0496118_0002208 Ga0496118_0002208_17395_18195 266
1709 3300048921 Ga0496118_0025727 Ga0496118_0025727_1081_1881 266
1710 3300048922 Ga0496119_0008642 Ga0496119_0008642_5959_6762 266
1711 3300048924 Ga0496121_0000099 Ga0496121_0000099_64147_64947 266
1712 3300048924 Ga0496121_0009644 Ga0496121_0009644_3370_4182 266
1713 3300048924 Ga0496121_0053371 Ga0496121_0053371_1587_2387 266
1714 3300048924 Ga0496121_0133576 Ga0496121_0133576_374_1174 266
1715 3300048924 Ga0496121_0361856 Ga0496121_0361856_132_932 266
1716 3300048925 Ga0496122_0002394 Ga0496122_0002394_21251_22063 266
1717 3300048925 Ga0496122_0012696 Ga0496122_0012696_3880_4746 266
1718 3300048925 Ga0496122_0042043 Ga0496122_0042043_2082_2882 266
1719 3300048926 Ga0496123_0002192 Ga0496123_0002192_19399_20211 266
1720 3300048926 Ga0496123_0046425 Ga0496123_0046425_1014_1880 266
1721 3300048926 Ga0496123_0124933 Ga0496123_0124933_151_951 266
1722 3300048927 Ga0496124_0000962 Ga0496124_0000962_17655_18455 266
1723 3300048927 Ga0496124_0029765 Ga0496124_0029765_822_1625 266
1724 3300048927 Ga0496124_0037548 Ga0496124_0037548_2479_3345 266
1725 3300048927 Ga0496124_0189006 Ga0496124_0189006_744_1568 266
1726 3300048928 Ga0496125_0001570 Ga0496125_0001570_26643_27476 266
1727 3300048928 Ga0496125_0040720 Ga0496125_0040720_1166_1978 266
1728 3300048928 Ga0496125_0097126 Ga0496125_0097126_715_1515 266
1729 3300048929 Ga0496126_0002134 Ga0496126_0002134_4294_5112 266
1730 3300049568 Ga0501031_0013932 Ga0501031_0013932_3776_4576 266
1731 3300049569 Ga0501032_0043686 Ga0501032_0043686_1381_2181 266
1732 3300049569 Ga0501032_0341256 Ga0501032_0341256_146_946 266
1733 3300049570 Ga0501033_0012682 Ga0501033_0012682_1173_1973 266
1734 3300049571 Ga0501034_0183838 Ga0501034_0183838_41_841 266
1735 3300049571 Ga0501034_0713752 Ga0501034_0713752_67_867 266
1736 3300049572 Ga0501036_0020490 Ga0501036_0020490_3749_4549 266
1737 3300049573 Ga0501037_0014650 Ga0501037_0014650_1194_1994 266
1738 3300049574 Ga0501038_0007499 Ga0501038_0007499_843_1643 266
1739 3300049574 Ga0501038_0148203 Ga0501038_0148203_773_1573 266
1740 3300049575 Ga0501039_0062918 Ga0501039_0062918_905_1705 266
1741 3300049575 Ga0501039_0078186 Ga0501039_0078186_496_1296 266
1742 3300049579 Ga0501043_0000024 Ga0501043_0000024_20538_21371 266
1743 3300049579 Ga0501043_0001631 Ga0501043_0001631_13698_14498 266
1744 3300049579 Ga0501043_0033568 Ga0501043_0033568_564_1364 266
1745 3300049579 Ga0501043_0398936 Ga0501043_0398936_183_983 266
1746 3300049580 Ga0501046_0000173 Ga0501046_0000173_20538_21371 266
1747 3300049580 Ga0501046_0001796 Ga0501046_0001796_5017_5817 266
1748 3300049580 Ga0501046_0004601 Ga0501046_0004601_11094_11894 266
1749 3300049581 Ga0501047_0000051 Ga0501047_0000051_132911_133744 266
1750 3300049581 Ga0501047_0000305 Ga0501047_0000305_37545_38345 266
1751 3300049582 Ga0501048_0000650 Ga0501048_0000650_3386_4219 266
1752 3300049582 Ga0501048_0001348 Ga0501048_0001348_12981_13781 266
1753 3300049582 Ga0501048_0010540 Ga0501048_0010540_5122_5922 266
1754 3300049583 Ga0501067_0014773 Ga0501067_0014773_1155_1955 266
1755 3300049584 Ga0501068_0023440 Ga0501068_0023440_1004_1804 266
1756 3300049585 Ga0501069_0002445 Ga0501069_0002445_910_1710 266
1757 3300049586 Ga0501070_0051186 Ga0501070_0051186_1077_1877 266
1758 3300049586 Ga0501070_0088095 Ga0501070_0088095_1192_1992 266
1759 3300049586 Ga0501070_0108004 Ga0501070_0108004_1121_1921 266
1760 3300049587 Ga0501071_0216162 Ga0501071_0216162_403_1203 266
1761 3300049587 Ga0501071_0230687 Ga0501071_0230687_277_1077 266
1762 3300049588 Ga0501072_0252576 Ga0501072_0252576_238_1038 266
1763 3300049588 Ga0501072_0348423 Ga0501072_0348423_354_1154 266
1764 3300049589 Ga0501073_0013348 Ga0501073_0013348_3778_4578 266
1765 3300049589 Ga0501073_0210504 Ga0501073_0210504_463_1263 266
1766 3300049590 Ga0501074_0002924 Ga0501074_0002924_9904_10704 266
1767 3300049592 Ga0501076_0271310 Ga0501076_0271310_520_1320 266
1768 3300049592 Ga0501076_0313775 Ga0501076_0313775_366_1166 266
1769 3300049679 Ga0501249_000841 Ga0501249_000841_2155_2955 266
1770 3300049705 Ga0501225_0003044 Ga0501225_0003044_4014_4814 266
1771 3300049741 Ga0501079_0071245 Ga0501079_0071245_146_946 266
1772 3300049742 Ga0501080_0013878 Ga0501080_0013878_4149_4949 266
1773 3300049743 Ga0501081_0273888 Ga0501081_0273888_179_979 266
1774 3300049744 Ga0501083_0010486 Ga0501083_0010486_729_1529 266
1775 3300049744 Ga0501083_0095086 Ga0501083_0095086_378_1181 266
1776 3300049744 Ga0501083_0111142 Ga0501083_0111142_574_1374 266
1777 3300049759 Ga0501262_000282 Ga0501262_000282_2295_3095 266
1778 3300049822 Ga0501035_0003206 Ga0501035_0003206_7675_8475 266
1779 3300049822 Ga0501035_0037571 Ga0501035_0037571_3216_4016 266
1780 3300049823 Ga0501044_0000212 Ga0501044_0000212_60773_61573 266
1781 3300049823 Ga0501044_0019211 Ga0501044_0019211_1179_1979 266
1782 3300049823 Ga0501044_0032009 Ga0501044_0032009_2900_3700 266
1783 3300049823 Ga0501044_0136126 Ga0501044_0136126_1472_2305 266
1784 3300049823 Ga0501044_0310482 Ga0501044_0310482_165_965 266
1785 3300049824 Ga0501045_0016684 Ga0501045_0016684_2550_3350 266
1786 3300049824 Ga0501045_0151396 Ga0501045_0151396_766_1566 266
1787 3300050489 nmdc:mga03683_131_c2 nmdc:mga03683_131_c2_5581_6381 266
1788 3300050489 nmdc:mga03683_4120_c1 nmdc:mga03683_4120_c1_342_1145 266
1789 3300050490 nmdc:mga03n38_13453_c1 nmdc:mga03n38_13453_c1_1022_1822 266
1790 3300050490 nmdc:mga03n38_65253_c1 nmdc:mga03n38_65253_c1_328_1128 266
1791 3300050491 nmdc:mga00v17_26732_c1 nmdc:mga00v17_26732_c1_589_1389 266
1792 3300050491 nmdc:mga00v17_27410_c1 nmdc:mga00v17_27410_c1_263_1063 266
1793 3300050492 nmdc:mga0yw44_12622_c1 nmdc:mga0yw44_12622_c1_718_1518 266
1794 3300050492 nmdc:mga0yw44_99924_c1 nmdc:mga0yw44_99924_c1_1029_1829 266
1795 3300050493 nmdc:mga0k408_2988_c1 nmdc:mga0k408_2988_c1_2546_3346 266
1796 3300050493 nmdc:mga0k408_34076_c1 nmdc:mga0k408_34076_c1_1436_2236 266
1797 3300050493 nmdc:mga0k408_35047_c1 nmdc:mga0k408_35047_c1_1309_2109 266
1798 3300050493 nmdc:mga0k408_4288_c1 nmdc:mga0k408_4288_c1_5287_6087 266
1799 3300050493 nmdc:mga0k408_49574_c1 nmdc:mga0k408_49574_c1_98_901 266
1800 3300050494 nmdc:mga06z11_31128_c1 nmdc:mga06z11_31128_c1_1115_1915 266
1801 3300050494 nmdc:mga06z11_34851_c1 nmdc:mga06z11_34851_c1_679_1479 266
1802 3300050494 nmdc:mga06z11_37546_c1 nmdc:mga06z11_37546_c1_517_1317 266
1803 3300050494 nmdc:mga06z11_6364_c1 nmdc:mga06z11_6364_c1_157_957 266
1804 3300050494 nmdc:mga06z11_87116_c2 nmdc:mga06z11_87116_c2_22_822 266
1805 3300050495 nmdc:mga04h51_22504_c1 nmdc:mga04h51_22504_c1_423_1223 266
1806 3300050495 nmdc:mga04h51_23730_c1 nmdc:mga04h51_23730_c1_436_1239 266
1807 3300050495 nmdc:mga04h51_38256_c1 nmdc:mga04h51_38256_c1_156_956 266
1808 3300050496 nmdc:mga07m45_1095_c1 nmdc:mga07m45_1095_c1_4381_5181 266
1809 3300050496 nmdc:mga07m45_18576_c1 nmdc:mga07m45_18576_c1_764_1567 266
1810 3300050496 nmdc:mga07m45_5940_c1 nmdc:mga07m45_5940_c1_267_1067 266
1811 3300050496 nmdc:mga07m45_61998_c1 nmdc:mga07m45_61998_c1_1139_1939 266
1812 3300050507 nmdc:mga05p37_5774_c1 nmdc:mga05p37_5774_c1_1214_2014 266
1813 3300050507 nmdc:mga05p37_828_c1 nmdc:mga05p37_828_c1_12778_13578 266
1814 3300050508 nmdc:mga09592_21763_c1 nmdc:mga09592_21763_c1_926_1726 266
1815 3300050508 nmdc:mga09592_21943_c1 nmdc:mga09592_21943_c1_4095_4901 266
1816 3300050509 nmdc:mga0qj67_165_c1 nmdc:mga0qj67_165_c1_12939_13739 266
1817 3300050510 nmdc:mga06r32_513_c1 nmdc:mga06r32_513_c1_12866_13666 266
1818 3300050510 nmdc:mga06r32_7918_c1 nmdc:mga06r32_7918_c1_1012_1818 266
1819 3300050511 nmdc:mga08y16_4405_c1 nmdc:mga08y16_4405_c1_12778_13578 266
1820 3300050511 nmdc:mga08y16_77507_c1 nmdc:mga08y16_77507_c1_2411_3211 266
1821 3300050512 nmdc:mga0n895_10588_c2 nmdc:mga0n895_10588_c2_3968_4768 266
1822 3300050512 nmdc:mga0n895_1284_c1 nmdc:mga0n895_1284_c1_14033_14833 266
1823 3300050512 nmdc:mga0n895_160658_c1 nmdc:mga0n895_160658_c1_286_1086 266
1824 3300050512 nmdc:mga0n895_32422_c1 nmdc:mga0n895_32422_c1_697_1497 266
1825 3300050512 nmdc:mga0n895_53866_c1 nmdc:mga0n895_53866_c1_42_842 266
1826 3300050512 nmdc:mga0n895_91521_c1 nmdc:mga0n895_91521_c1_44_844 266
1827 3300050513 nmdc:mga0rr50_31356_c1 nmdc:mga0rr50_31356_c1_2039_2839 266
1828 3300050513 nmdc:mga0rr50_330469_c1 nmdc:mga0rr50_330469_c1_338_1138 266
1829 3300050513 nmdc:mga0rr50_8687_c1 nmdc:mga0rr50_8687_c1_3080_3880 266
1830 3300050514 nmdc:mga08x19_53960_c1 nmdc:mga08x19_53960_c1_1352_2152 266
1831 3300050515 nmdc:mga0a205_1140_c1 nmdc:mga0a205_1140_c1_9423_10223 266
1832 3300050515 nmdc:mga0a205_12519_c1 nmdc:mga0a205_12519_c1_5784_6584 266
1833 3300050515 nmdc:mga0a205_432198_c1 nmdc:mga0a205_432198_c1_77_877 266
1834 3300050516 nmdc:mga0sz30_1590_c1 nmdc:mga0sz30_1590_c1_3453_4253 266
1835 3300050516 nmdc:mga0sz30_36051_c1 nmdc:mga0sz30_36051_c1_760_1560 266
1836 3300053077 Ga0495601_0000026 Ga0495601_0000026_37652_38452 266
1837 3300053077 Ga0495601_0000075 Ga0495601_0000075_25110_25910 266
1838 3300053077 Ga0495601_0003475 Ga0495601_0003475_1977_2777 266
1839 3300053077 Ga0495601_0007907 Ga0495601_0007907_2400_3200 266
1840 3300053077 Ga0495601_0008795 Ga0495601_0008795_4059_4859 266
1841 3300053077 Ga0495601_0013952 Ga0495601_0013952_3168_3968 266
1842 3300053077 Ga0495601_0019791 Ga0495601_0019791_3100_3900 266
1843 3300053077 Ga0495601_0098383 Ga0495601_0098383_366_1166 266
1844 3300053078 Ga0495612_0000005 Ga0495612_0000005_25904_26704 266
1845 3300053078 Ga0495612_0005901 Ga0495612_0005901_2502_3302 266
1846 3300053078 Ga0495612_0011526 Ga0495612_0011526_143_943 266
1847 3300053078 Ga0495612_0018362 Ga0495612_0018362_694_1494 266
1848 3300053079 Ga0500610_0000112 Ga0500610_0000112_4083_4925 266
1849 3300053084 Ga0495595_0000058 Ga0495595_0000058_20115_20915 266
1850 3300053084 Ga0495595_0000311 Ga0495595_0000311_13017_13817 266
1851 3300053084 Ga0495595_0000650 Ga0495595_0000650_12383_13183 266
1852 3300053084 Ga0495595_0002803 Ga0495595_0002803_2599_3399 266
1853 3300053084 Ga0495595_0009800 Ga0495595_0009800_133_933 266
1854 3300053084 Ga0495595_0018149 Ga0495595_0018149_1670_2470 266
1855 3300053085 Ga0495619_0000003 Ga0495619_0000003_254745_255545 266
1856 3300053085 Ga0495619_0000301 Ga0495619_0000301_24226_25026 266
1857 3300053085 Ga0495619_0000315 Ga0495619_0000315_27832_28632 266
1858 3300053085 Ga0495619_0000645 Ga0495619_0000645_12841_13641 266
1859 3300053085 Ga0495619_0004564 Ga0495619_0004564_239_1039 266
1860 3300053085 Ga0495619_0008284 Ga0495619_0008284_1634_2434 266
1861 3300053085 Ga0495619_0020045 Ga0495619_0020045_2797_3597 266
1862 3300053085 Ga0495619_0046550 Ga0495619_0046550_236_1036 266
1863 3300053085 Ga0495619_0093547 Ga0495619_0093547_631_1431 266
1864 3300053085 Ga0495619_0099418 Ga0495619_0099418_1001_1801 266
1865 3300053085 Ga0495619_0215579 Ga0495619_0215579_217_1017 266
1866 3300053086 Ga0500578_0010253 Ga0500578_0010253_4390_5193 266
1867 3300053087 Ga0500643_004510 Ga0500643_004510_351_1151 266
1868 3300053088 Ga0500644_0000805 Ga0500644_0000805_7366_8166 266
1869 3300053091 Ga0500647_0033508 Ga0500647_0033508_1358_2158 266
1870 3300053093 Ga0500651_0225020 Ga0500651_0225020_218_1027 266
1871 3300053094 Ga0500566_0002965 Ga0500566_0002965_7605_8408 266
1872 3300053094 Ga0500566_0031163 Ga0500566_0031163_1915_2715 266
1873 3300053094 Ga0500566_0099650 Ga0500566_0099650_421_1224 266
1874 3300053094 Ga0500566_0103179 Ga0500566_0103179_463_1272 266
1875 3300053094 Ga0500566_0143510 Ga0500566_0143510_108_908 266
1876 3300053095 Ga0500640_000109 Ga0500640_000109_5558_6361 266
1877 3300053102 Ga0500554_000127 Ga0500554_000127_10460_11263 266
1878 3300053111 Ga0500572_000364 Ga0500572_000364_12743_13543 266
1879 3300053111 Ga0500572_002316 Ga0500572_002316_1108_1911 266
1880 3300053117 Ga0500593_042853 Ga0500593_042853_1125_1925 266
1881 3300053118 Ga0500594_0007743 Ga0500594_0007743_390_1193 266
1882 3300053119 Ga0500595_000002 Ga0500595_000002_734758_735558 266
1883 3300053119 Ga0500595_000654 Ga0500595_000654_11422_12225 266
1884 3300053119 Ga0500595_036417 Ga0500595_036417_505_1305 266
1885 3300053120 Ga0500597_014321 Ga0500597_014321_1746_2549 266
1886 3300053121 Ga0500607_000040 Ga0500607_000040_28317_29150 266
1887 3300053123 Ga0500614_000065 Ga0500614_000065_14322_15125 266
1888 3300053125 Ga0500618_001458 Ga0500618_001458_6811_7629 266
1889 3300053130 Ga0500642_0007198 Ga0500642_0007198_2846_3646 266
1890 3300053133 Ga0500655_013889 Ga0500655_013889_373_1176 266
1891 3300053134 Ga0500658_0000142 Ga0500658_0000142_15570_16370 266
1892 3300053136 Ga0500559_0004285 Ga0500559_0004285_2654_3454 266
1893 3300053136 Ga0500559_0004688 Ga0500559_0004688_839_1642 266
1894 3300053136 Ga0500559_0009713 Ga0500559_0009713_159_959 266
1895 3300053139 Ga0500568_0000983 Ga0500568_0000983_7016_7816 266
1896 3300053139 Ga0500568_0116516 Ga0500568_0116516_158_958 266
1897 3300053148 Ga0500590_000575 Ga0500590_000575_6532_7332 266
1898 3300053148 Ga0500590_078858 Ga0500590_078858_415_1218 266
1899 3300053150 Ga0500603_024525 Ga0500603_024525_450_1253 266
1900 3300053151 Ga0500604_0014219 Ga0500604_0014219_228_1031 266
1901 3300053151 Ga0500604_0019835 Ga0500604_0019835_37_837 266
1902 3300053153 Ga0500616_0000002 Ga0500616_0000002_786369_787169 266
1903 3300053153 Ga0500616_0013278 Ga0500616_0013278_593_1393 266
1904 3300053153 Ga0500616_0033446 Ga0500616_0033446_18_818 266
1905 3300053154 Ga0500619_000062 Ga0500619_000062_16474_17274 266
1906 3300053156 Ga0500622_0014031 Ga0500622_0014031_2534_3343 266
1907 3300053156 Ga0500622_0117387 Ga0500622_0117387_421_1221 266
1908 3300053159 Ga0500630_045519 Ga0500630_045519_1245_2048 266
1909 3300053161 Ga0500634_0011715 Ga0500634_0011715_3538_4338 266
1910 3300053162 Ga0500638_101029 Ga0500638_101029_247_1050 266
1911 3300053163 Ga0500639_006776 Ga0500639_006776_1368_2168 266
1912 3300053177 Ga0500636_0012653 Ga0500636_0012653_584_1384 266
1913 3300053177 Ga0500636_0022288 Ga0500636_0022288_1499_2308 266
1914 3300053177 Ga0500636_0113664 Ga0500636_0113664_145_945 266
1915 3300053178 Ga0500637_0085771 Ga0500637_0085771_87_890 266
1916 3300053730 Ga0500645_000091 Ga0500645_000091_64165_64977 266
1917 3300053730 Ga0500645_001379 Ga0500645_001379_5805_6608 266
1918 3300053733 Ga0500552_015723 Ga0500552_015723_100_900 266
1919 3300053735 Ga0500596_012353 Ga0500596_012353_239_1039 266
1920 3300060353 Ga0501082_0170102 Ga0501082_0170102_210_1010 266
1921 iso_pu_bacteria 2513237151 2513961995 266
1922 iso_pu_bacteria 2599185178 2599448609 266
1923 iso_pu_bacteria 2619619299 2621300641 266
1924 iso_pu_bacteria 2738541265 2738673305 266
1925 iso_pu_bacteria 2738541282 2738751698 266
1926 iso_pu_bacteria 2738541303 2738860739 266
1927 iso_pu_bacteria 2773857670 2774120211 266
1928 iso_pu_bacteria 2773857672 2774129891 266
1929 iso_pu_bacteria 2784132072 2784311858 266
1930 iso_pu_bacteria 2808606401 2809063841 266
1931 iso_pu_bacteria 2808606404 2809079809 266
1932 iso_pu_bacteria 2808606405 2809084174 266
1933 iso_pu_bacteria 2880518877 2880523473 266
1934 iso_pu_bacteria 2894023352 2894027592 266
1935 iso_pu_bacteria 2900577576 2900579879 266
1936 iso_pu_bacteria 2928058823 2928059737 266
1937 iso_pu_bacteria 2945934425 2945934678 266
1938 iso_pu_bacteria 2988728565 2988729132 266
1939 iso_pu_bacteria 2990088156 2990093288 266
1940 iso_pu_bacteria 8039098773 8039102178 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

40

240

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

51

294

0.91

PF08659

KR

KR domain

41

209

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jc8-assembly1.cif.gz_B crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans 0.9881 3 266
5jc8-assembly1.cif.gz_C crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans 0.9874 3 266
5jc8-assembly1.cif.gz_A crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans 0.9818 3 266
5jc8-assembly1.cif.gz_D crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans 0.9816 3 266
5jc8-assembly1.cif.gz_B crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans 0.9804 3 266
ID Description Score Start End Superfamily
5jc8D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9816 3 266 3.40.50.720
5jc8D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9743 3 266 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9568 5 262 3.40.50.720
5k9zA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9543 4 263 3.40.50.720
af_P37440_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9537 3 262 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2D6SHR2-F1-model_v4 3-oxoacyl-ACP reductase 0.9844 29 266 GO:0016491
AF-A0A0P9MHY1-F1-model_v4 Membrane protein 0.9832 135 266 GO:0016616
AF-A0A4Q4CLH7-F1-model_v4 SDR family oxidoreductase 0.978 68 266 GO:0016491
AF-A0A2D6SHR2-F1-model_v4 3-oxoacyl-ACP reductase 0.9763 29 266 GO:0016491
AF-A0A0P9MHY1-F1-model_v4 Membrane protein 0.9759 135 266 GO:0016616

Feature Viewer

pLDDT pTM Quality
92.91 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map