F496110
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1940 | 716 | 1870 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300021361|Ga0213872_10000482|Ga0213872_1000048213 |
| Length | 298 |
| Sequence | MCRPQQVWHWNFPSLHRKDIAMSTPQTSAVTNTNGRLQGKVAIVTGAGCVGPGWGNGRAVAVLFAQAGATIFAVDKNAEAMEETIRRVREVGGTISAHTCDVTDSTSVAEMVAACEAQYGRVDILVNNVGGSAAGGPVALAEEKWDAQVDFNLKSVYLTCKHVLPVMEKQGKGAIVNTASTSGIRWTGSAQVAYAACKAGVIQLSRVVAVEYAKKGIRVNTVVPGQLHTPMVEVRLAGQRSGGDVDKLLESRVARIPLGFMGDGRDTANAALFLASDEAQFVTGTEIIVDGGMTARCD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 3 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 4 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 5 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 6 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 7 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 8 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 9 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 10 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 11 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 12 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 13 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 14 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 15 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 16 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 17 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 18 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 19 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 20 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 21 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 22 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 23 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 24 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 25 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 26 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 27 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 28 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 29 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 30 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 31 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 32 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 33 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 34 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 35 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 36 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 37 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 38 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 39 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 40 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 41 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 42 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 43 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 44 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 45 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 46 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 47 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 48 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 49 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 50 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 51 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 52 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 53 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 54 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 55 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 56 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 57 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 58 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 59 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 60 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 61 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 62 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 63 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 64 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 65 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 66 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 68 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 70 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 71 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 72 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 73 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 74 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 75 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 76 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 77 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 78 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 79 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 80 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 81 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 82 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 84 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 85 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 86 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 87 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 89 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 90 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 91 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 92 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 93 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 94 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 95 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 96 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 97 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 98 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 99 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 100 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 101 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 102 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 103 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 104 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 105 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 106 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 107 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 108 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 109 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 110 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 114 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 117 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 119 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 120 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 121 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 123 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 125 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 134 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 140 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 141 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 144 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 145 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 150 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 151 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 152 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 153 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 154 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 155 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 157 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 158 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 159 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 160 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 162 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 163 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 167 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 168 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 170 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 171 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 172 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 174 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 175 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 176 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 177 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 178 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 179 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 180 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 181 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 182 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 183 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 184 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 185 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 186 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 188 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 189 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 190 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 191 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 192 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 193 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 194 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 195 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 196 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 197 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 198 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 199 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 201 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 202 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 203 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 204 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 205 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 206 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 207 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 208 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 209 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 210 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 212 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 213 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 214 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 224 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 225 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 243 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 247 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 248 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 249 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 251 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 252 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 254 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 255 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 256 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 257 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 265 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 266 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 269 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 270 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 273 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 276 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 279 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 282 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 363 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 368 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 370 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 374 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 375 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 376 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 377 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 378 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 379 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 380 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 381 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 382 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 383 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 384 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 386 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 387 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 388 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 389 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 390 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 391 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 392 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 393 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 394 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 395 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 396 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 397 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 398 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 399 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 400 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 401 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 402 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 403 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 404 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 405 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 406 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 407 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 408 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 409 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 410 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 411 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 412 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 413 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 414 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 415 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 416 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 417 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 418 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 419 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 420 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 421 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 422 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 423 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 424 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 425 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 426 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 427 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 428 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 429 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 430 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 431 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 432 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 433 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 434 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 435 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 436 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 437 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 438 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 439 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 440 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 441 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 442 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 443 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 444 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 445 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 446 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 447 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 448 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 449 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 450 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 451 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 452 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 453 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 454 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 455 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 456 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 457 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 458 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 459 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 460 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 461 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 462 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 463 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 464 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 465 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 466 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 467 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 468 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 469 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 470 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 471 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 472 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 473 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 474 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 475 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 476 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 477 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 478 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 479 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 480 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 481 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 482 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 483 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 484 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 485 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 486 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 487 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 488 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 489 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 490 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 491 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 492 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 493 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 494 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 586 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 587 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 588 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 589 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 590 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 591 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 592 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 593 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 594 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 595 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 596 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 597 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 598 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 599 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 600 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 601 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 602 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 603 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 604 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 605 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 606 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 607 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 608 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 609 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 610 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 611 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 614 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 615 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 616 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 617 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 618 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 619 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 620 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 621 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 622 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 623 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 624 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 625 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 626 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 627 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 628 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 629 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 630 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 631 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 632 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 633 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 634 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 635 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 636 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 637 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 638 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 639 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 640 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 641 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 642 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 643 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 644 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 645 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 646 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 647 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 648 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 649 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 650 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 651 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 652 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 653 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 654 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 655 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 656 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 657 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 658 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 659 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 660 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 661 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 662 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 663 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 664 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 665 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 666 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 667 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 670 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 671 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 673 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 674 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 675 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 676 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 677 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 678 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 679 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 680 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 681 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 682 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 683 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 684 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 685 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 686 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 687 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 688 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 689 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 690 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 691 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 692 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 693 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 694 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 695 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 696 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 697 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 698 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 699 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 700 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 701 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 702 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 703 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 704 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 705 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 706 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 707 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 708 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 709 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 710 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 711 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 712 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 713 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 714 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 715 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 716 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.13 |
| Metatranscriptomes | 0.26 |
| Isolates | 3.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.34 |
| Nodule | 0.67 |
| Rhizoplane | 5.67 |
| Rhizosphere | 76.8 |
| Stem | 0 |
| Stem Tuber | 0.05 |
| Unclassified | 5.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARSoilYngRDRAFT_c00576 | 3300000042 | Bacteria | 3981 |
| 2 | ARcpr5yngRDRAFT_c001137 | 3300000043 | Bacteria | 2997 |
| 3 | ARSoilOldRDRAFT_c000653 | 3300000044 | Bacteria | 3670 |
| 4 | ARCol0oldRDRAFT_c00755 | 3300000045 | Bacteria | 2730 |
| 5 | ARCol0yngRDRAFT_1001991 | 3300000652 | Bacteria | 1581 |
| 6 | JGI24032J14994_100465 | 3300001430 | Bacteria | 2116 |
| 7 | JGI24740J21852_10002833 | 3300001979 | Bacteria | 7750 |
| 8 | JGI24740J21852_10044403 | 3300001979 | Bacteria | 1319 |
| 9 | JGI24739J22299_10002387 | 3300001989 | Bacteria | 7244 |
| 10 | JGI24739J22299_10007118 | 3300001989 | Bacteria | 4210 |
| 11 | JGI24743J22301_10006200 | 3300001991 | Bacteria | 2028 |
| 12 | JGI24738J21930_10000453 | 3300002075 | Bacteria | 11626 |
| 13 | JGI24749J21850_1001528 | 3300002076 | Bacteria | 3275 |
| 14 | JGI24744J21845_10003861 | 3300002077 | Bacteria | 3097 |
| 15 | JGI24035J26624_1000356 | 3300002126 | Bacteria | 4312 |
| 16 | JGI24742J22300_10000709 | 3300002244 | Bacteria | 5049 |
| 17 | JGI25156J39149_1001517 | 3300002705 | Bacteria | 9640 |
| 18 | JGI25154J39366_1000333 | 3300002738 | Bacteria | 27260 |
| 19 | JGI25151J46595_10018445 | 3300003187 | Bacteria | 2995 |
| 20 | JGI25406J46586_10005393 | 3300003203 | Bacteria | 5933 |
| 21 | JGI25153J46596_10000151 | 3300003215 | Bacteria | 70139 |
| 22 | JGI25153J46596_10002286 | 3300003215 | Bacteria | 11161 |
| 23 | JGI25153J46596_10055377 | 3300003215 | Bacteria | 1110 |
| 24 | rootH2_10182889 | 3300003320 | Bacteria | 2136 |
| 25 | rootH1_10000649 | 3300003323 | Bacteria | 26896 |
| 26 | JGI25160J50197_1000163 | 3300003354 | Bacteria | 57578 |
| 27 | JGI25404J52841_10000106 | 3300003659 | Bacteria | 8317 |
| 28 | Ga0055538_1001362 | 3300003751 | Bacteria | 4807 |
| 29 | Ga0055538_1001370 | 3300003751 | Bacteria | 4796 |
| 30 | Ga0055539_1000145 | 3300003752 | Bacteria | 71820 |
| 31 | Ga0055533_1000866 | 3300003756 | Bacteria | 9241 |
| 32 | Ga0055533_1005873 | 3300003756 | Bacteria | 1904 |
| 33 | Ga0055533_1005885 | 3300003756 | Bacteria | 1902 |
| 34 | Ga0055532_1000469 | 3300003758 | Bacteria | 18242 |
| 35 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 36 | Ga0055525_1001053 | 3300003759 | Bacteria | 7112 |
| 37 | Ga0055535_1000999 | 3300003761 | Bacteria | 18242 |
| 38 | Ga0055542_1000385 | 3300003762 | Bacteria | 44928 |
| 39 | Ga0055529_1000831 | 3300003763 | Bacteria | 18242 |
| 40 | Ga0055526_1000314 | 3300003771 | Bacteria | 40385 |
| 41 | Ga0055526_1026726 | 3300003771 | Bacteria | 1809 |
| 42 | Ga0055537_1000688 | 3300003773 | Bacteria | 17628 |
| 43 | Ga0055524_1000031 | 3300003775 | Bacteria | 187744 |
| 44 | Ga0055524_1016351 | 3300003775 | Bacteria | 2665 |
| 45 | Ga0055524_1025859 | 3300003775 | Bacteria | 1829 |
| 46 | Ga0055536_1000638 | 3300003781 | Bacteria | 23865 |
| 47 | Ga0055536_1002200 | 3300003781 | Bacteria | 11106 |
| 48 | Ga0055536_1040464 | 3300003781 | Bacteria | 1109 |
| 49 | Ga0055534_1000488 | 3300003784 | Bacteria | 21993 |
| 50 | Ga0055530_10001927 | 3300003791 | Bacteria | 14155 |
| 51 | Ga0055540_1000149 | 3300003792 | Bacteria | 68747 |
| 52 | Ga0055540_1000275 | 3300003792 | Bacteria | 46202 |
| 53 | Ga0055540_1003439 | 3300003792 | Bacteria | 7649 |
| 54 | Ga0055531_10000062 | 3300003794 | Bacteria | 120504 |
| 55 | Ga0055541_1004944 | 3300003841 | Bacteria | 2374 |
| 56 | Ga0055541_1006873 | 3300003841 | Bacteria | 1904 |
| 57 | Ga0055541_1006878 | 3300003841 | Bacteria | 1902 |
| 58 | Ga0065165_1001672 | 3300005262 | Bacteria | 22433 |
| 59 | Ga0065714_10002324 | 3300005288 | Bacteria | 25506 |
| 60 | Ga0065714_10152351 | 3300005288 | Bacteria | 1098 |
| 61 | Ga0065704_10124798 | 3300005289 | Bacteria | 1712 |
| 62 | Ga0065715_10112482 | 3300005293 | Bacteria | 2528 |
| 63 | Ga0065707_10092907 | 3300005295 | Bacteria | 3690 |
| 64 | Ga0065707_10102207 | 3300005295 | Bacteria | 2820 |
| 65 | Ga0070658_10015415 | 3300005327 | Bacteria | 6115 |
| 66 | Ga0070658_10021036 | 3300005327 | Bacteria | 5226 |
| 67 | Ga0070658_10035934 | 3300005327 | Bacteria | 3992 |
| 68 | Ga0070658_10155946 | 3300005327 | Bacteria | 1914 |
| 69 | Ga0070658_10197897 | 3300005327 | Bacteria | 1695 |
| 70 | Ga0070676_10002407 | 3300005328 | Bacteria | 9583 |
| 71 | Ga0070683_100004780 | 3300005329 | Bacteria | 11211 |
| 72 | Ga0070683_100139715 | 3300005329 | Bacteria | 2295 |
| 73 | Ga0070690_100000577 | 3300005330 | Bacteria | 18482 |
| 74 | Ga0070690_100059684 | 3300005330 | Bacteria | 2453 |
| 75 | Ga0070670_100026119 | 3300005331 | Bacteria | 5027 |
| 76 | Ga0070670_100691356 | 3300005331 | Bacteria | 917 |
| 77 | Ga0070677_10000943 | 3300005333 | Bacteria | 9437 |
| 78 | Ga0070677_10039250 | 3300005333 | Bacteria | 1857 |
| 79 | Ga0068869_100040653 | 3300005334 | Bacteria | 3326 |
| 80 | Ga0070666_10030069 | 3300005335 | Bacteria | 3576 |
| 81 | Ga0070666_10038679 | 3300005335 | Bacteria | 3176 |
| 82 | Ga0070680_100008066 | 3300005336 | Bacteria | 8042 |
| 83 | Ga0070680_100028142 | 3300005336 | Bacteria | 4507 |
| 84 | Ga0070680_100032815 | 3300005336 | Bacteria | 4180 |
| 85 | Ga0070680_100097670 | 3300005336 | Bacteria | 2436 |
| 86 | Ga0070680_100407707 | 3300005336 | Bacteria | 1159 |
| 87 | Ga0070682_100002906 | 3300005337 | Bacteria | 9504 |
| 88 | Ga0070682_100026631 | 3300005337 | Bacteria | 3462 |
| 89 | Ga0070682_100333548 | 3300005337 | Bacteria | 1125 |
| 90 | Ga0068868_100000892 | 3300005338 | Bacteria | 20293 |
| 91 | Ga0070660_100003390 | 3300005339 | Bacteria | 10962 |
| 92 | Ga0070660_100052583 | 3300005339 | Bacteria | 3140 |
| 93 | Ga0070660_100192548 | 3300005339 | Bacteria | 1652 |
| 94 | Ga0070689_100002855 | 3300005340 | Bacteria | 11357 |
| 95 | Ga0070691_10001992 | 3300005341 | Bacteria | 9004 |
| 96 | Ga0070691_10214045 | 3300005341 | Bacteria | 1018 |
| 97 | Ga0070687_100000895 | 3300005343 | Bacteria | 10044 |
| 98 | Ga0070661_100000172 | 3300005344 | Bacteria | 53064 |
| 99 | Ga0070661_100000804 | 3300005344 | Bacteria | 22558 |
| 100 | Ga0070661_100143009 | 3300005344 | Bacteria | 1804 |
| 101 | Ga0070661_100220425 | 3300005344 | Bacteria | 1455 |
| 102 | Ga0070692_10000830 | 3300005345 | Bacteria | 10335 |
| 103 | Ga0070692_10072062 | 3300005345 | Bacteria | 1842 |
| 104 | Ga0070668_100005596 | 3300005347 | Bacteria | 9317 |
| 105 | Ga0070668_100015026 | 3300005347 | Bacteria | 5782 |
| 106 | Ga0070669_100010788 | 3300005353 | Bacteria | 6485 |
| 107 | Ga0070669_100044673 | 3300005353 | Bacteria | 3228 |
| 108 | Ga0070675_100007817 | 3300005354 | Bacteria | 8286 |
| 109 | Ga0070675_100040003 | 3300005354 | Bacteria | 3827 |
| 110 | Ga0070675_100199836 | 3300005354 | Bacteria | 1735 |
| 111 | Ga0070671_100000144 | 3300005355 | Bacteria | 46097 |
| 112 | Ga0070671_100046072 | 3300005355 | Bacteria | 3626 |
| 113 | Ga0070671_100047928 | 3300005355 | Bacteria | 3553 |
| 114 | Ga0070671_100050429 | 3300005355 | Bacteria | 3462 |
| 115 | Ga0070671_100512005 | 3300005355 | Bacteria | 1033 |
| 116 | Ga0070674_100003771 | 3300005356 | Bacteria | 8557 |
| 117 | Ga0070674_100267397 | 3300005356 | Bacteria | 1350 |
| 118 | Ga0070673_100003994 | 3300005364 | Bacteria | 9279 |
| 119 | Ga0070673_100007016 | 3300005364 | Bacteria | 7385 |
| 120 | Ga0070673_100251216 | 3300005364 | Bacteria | 1541 |
| 121 | Ga0070673_100339346 | 3300005364 | Bacteria | 1331 |
| 122 | Ga0070673_100394145 | 3300005364 | Bacteria | 1237 |
| 123 | Ga0070688_100009077 | 3300005365 | Bacteria | 5423 |
| 124 | Ga0070688_100011259 | 3300005365 | Bacteria | 4966 |
| 125 | Ga0070688_100019796 | 3300005365 | Bacteria | 3904 |
| 126 | Ga0070688_100045165 | 3300005365 | Bacteria | 2720 |
| 127 | Ga0070659_100005098 | 3300005366 | Bacteria | 9424 |
| 128 | Ga0070659_100234867 | 3300005366 | Bacteria | 1516 |
| 129 | Ga0070667_100003448 | 3300005367 | Bacteria | 13475 |
| 130 | Ga0070667_100022884 | 3300005367 | Bacteria | 5181 |
| 131 | Ga0070667_100029930 | 3300005367 | Bacteria | 4540 |
| 132 | Ga0070667_100089458 | 3300005367 | Bacteria | 2645 |
| 133 | Ga0070667_100385199 | 3300005367 | Bacteria | 1274 |
| 134 | Ga0070703_10005909 | 3300005406 | Bacteria | 3428 |
| 135 | Ga0070714_100015402 | 3300005435 | Bacteria | 6153 |
| 136 | Ga0070714_100272549 | 3300005435 | Bacteria | 1570 |
| 137 | Ga0070713_100005437 | 3300005436 | Bacteria | 8707 |
| 138 | Ga0070713_100040256 | 3300005436 | Bacteria | 3798 |
| 139 | Ga0070713_100042493 | 3300005436 | Bacteria | 3710 |
| 140 | Ga0070713_100314160 | 3300005436 | Bacteria | 1446 |
| 141 | Ga0070710_10002210 | 3300005437 | Bacteria | 9185 |
| 142 | Ga0070710_10172690 | 3300005437 | Bacteria | 1348 |
| 143 | Ga0070701_10000951 | 3300005438 | Bacteria | 10493 |
| 144 | Ga0070711_100026734 | 3300005439 | Bacteria | 3784 |
| 145 | Ga0070711_100300686 | 3300005439 | Bacteria | 1276 |
| 146 | Ga0070711_100391823 | 3300005439 | Bacteria | 1125 |
| 147 | Ga0070705_100003034 | 3300005440 | Bacteria | 8286 |
| 148 | Ga0070705_100019384 | 3300005440 | Bacteria | 3580 |
| 149 | Ga0070705_100020776 | 3300005440 | Bacteria | 3482 |
| 150 | Ga0070705_100344093 | 3300005440 | Bacteria | 1085 |
| 151 | Ga0070700_100001925 | 3300005441 | Bacteria | 10503 |
| 152 | Ga0070700_100148601 | 3300005441 | Bacteria | 1600 |
| 153 | Ga0070694_100013679 | 3300005444 | Bacteria | 5071 |
| 154 | Ga0070694_100017580 | 3300005444 | Bacteria | 4522 |
| 155 | Ga0070694_100195845 | 3300005444 | Bacteria | 1503 |
| 156 | Ga0070708_100011316 | 3300005445 | Bacteria | 7254 |
| 157 | Ga0070708_100076491 | 3300005445 | Bacteria | 3023 |
| 158 | Ga0070708_100155288 | 3300005445 | Bacteria | 2130 |
| 159 | Ga0070708_100228982 | 3300005445 | Bacteria | 1744 |
| 160 | Ga0070663_100000048 | 3300005455 | Bacteria | 53064 |
| 161 | Ga0070663_100008331 | 3300005455 | Bacteria | 6370 |
| 162 | Ga0070663_100066970 | 3300005455 | Bacteria | 2603 |
| 163 | Ga0070663_100408049 | 3300005455 | Bacteria | 1112 |
| 164 | Ga0070678_100019470 | 3300005456 | Bacteria | 4426 |
| 165 | Ga0070678_100031617 | 3300005456 | Bacteria | 3654 |
| 166 | Ga0070678_100032939 | 3300005456 | Bacteria | 3592 |
| 167 | Ga0070678_100168451 | 3300005456 | Bacteria | 1782 |
| 168 | Ga0070662_100009476 | 3300005457 | Bacteria | 6370 |
| 169 | Ga0070662_100125525 | 3300005457 | Bacteria | 1972 |
| 170 | Ga0070662_100399074 | 3300005457 | Bacteria | 1134 |
| 171 | Ga0070681_10079817 | 3300005458 | Bacteria | 3228 |
| 172 | Ga0070681_10113424 | 3300005458 | Bacteria | 2650 |
| 173 | Ga0070681_10168760 | 3300005458 | Bacteria | 2111 |
| 174 | Ga0070681_10237499 | 3300005458 | Bacteria | 1736 |
| 175 | Ga0070681_10343051 | 3300005458 | Bacteria | 1404 |
| 176 | Ga0070681_10423468 | 3300005458 | Bacteria | 1243 |
| 177 | Ga0068867_100011042 | 3300005459 | Bacteria | 6370 |
| 178 | Ga0068867_100062306 | 3300005459 | Bacteria | 2771 |
| 179 | Ga0068867_100093862 | 3300005459 | Bacteria | 2281 |
| 180 | Ga0070685_10040340 | 3300005466 | Bacteria | 2656 |
| 181 | Ga0070706_100167319 | 3300005467 | Bacteria | 2053 |
| 182 | Ga0070706_100448950 | 3300005467 | Bacteria | 1200 |
| 183 | Ga0070707_100005638 | 3300005468 | Bacteria | 11699 |
| 184 | Ga0070698_100096540 | 3300005471 | Bacteria | 2932 |
| 185 | Ga0070698_100436242 | 3300005471 | Bacteria | 1245 |
| 186 | Ga0070699_100034500 | 3300005518 | Bacteria | 4373 |
| 187 | Ga0070679_100019238 | 3300005530 | Bacteria | 6636 |
| 188 | Ga0070679_100088242 | 3300005530 | Bacteria | 3089 |
| 189 | Ga0070679_100095190 | 3300005530 | Bacteria | 2966 |
| 190 | Ga0070679_100260969 | 3300005530 | Bacteria | 1688 |
| 191 | Ga0070679_100309016 | 3300005530 | Bacteria | 1531 |
| 192 | Ga0070679_100468364 | 3300005530 | Bacteria | 1204 |
| 193 | Ga0070679_100589015 | 3300005530 | Bacteria | 1056 |
| 194 | Ga0070684_100001753 | 3300005535 | Bacteria | 15811 |
| 195 | Ga0070684_100016515 | 3300005535 | Bacteria | 6033 |
| 196 | Ga0070684_100104379 | 3300005535 | Bacteria | 2535 |
| 197 | Ga0070697_100014513 | 3300005536 | Bacteria | 6188 |
| 198 | Ga0068853_100005853 | 3300005539 | Bacteria | 9685 |
| 199 | Ga0070672_100025104 | 3300005543 | Bacteria | 4416 |
| 200 | Ga0070672_100030562 | 3300005543 | Bacteria | 4048 |
| 201 | Ga0070686_100000086 | 3300005544 | Bacteria | 65438 |
| 202 | Ga0070686_100008070 | 3300005544 | Bacteria | 5881 |
| 203 | Ga0070695_100002465 | 3300005545 | Bacteria | 10658 |
| 204 | Ga0070695_100007717 | 3300005545 | Bacteria | 6370 |
| 205 | Ga0070695_100057276 | 3300005545 | Bacteria | 2517 |
| 206 | Ga0070695_100226069 | 3300005545 | Bacteria | 1351 |
| 207 | Ga0070696_100004489 | 3300005546 | Bacteria | 9315 |
| 208 | Ga0070696_100054505 | 3300005546 | Bacteria | 2786 |
| 209 | Ga0070696_100149595 | 3300005546 | Bacteria | 1713 |
| 210 | Ga0070696_100397112 | 3300005546 | Bacteria | 1078 |
| 211 | Ga0070693_100053012 | 3300005547 | Bacteria | 2327 |
| 212 | Ga0070693_100096016 | 3300005547 | Bacteria | 1796 |
| 213 | Ga0070665_100008890 | 3300005548 | Bacteria | 10173 |
| 214 | Ga0070665_100053124 | 3300005548 | Bacteria | 4064 |
| 215 | Ga0070704_100000280 | 3300005549 | Bacteria | 22434 |
| 216 | Ga0070704_100053958 | 3300005549 | Bacteria | 2843 |
| 217 | Ga0070704_100140072 | 3300005549 | Bacteria | 1887 |
| 218 | Ga0070704_100487516 | 3300005549 | Bacteria | 1067 |
| 219 | Ga0068855_100001526 | 3300005563 | Bacteria | 29026 |
| 220 | Ga0068855_100027435 | 3300005563 | Bacteria | 6811 |
| 221 | Ga0068855_100037526 | 3300005563 | Bacteria | 5761 |
| 222 | Ga0068855_100097674 | 3300005563 | Bacteria | 3383 |
| 223 | Ga0068855_100171536 | 3300005563 | Bacteria | 2457 |
| 224 | Ga0070664_100000119 | 3300005564 | Bacteria | 52383 |
| 225 | Ga0070664_100008530 | 3300005564 | Bacteria | 8286 |
| 226 | Ga0070664_100044515 | 3300005564 | Bacteria | 3748 |
| 227 | Ga0068857_100005404 | 3300005577 | Bacteria | 10892 |
| 228 | Ga0068857_100031359 | 3300005577 | Bacteria | 4696 |
| 229 | Ga0068857_100067804 | 3300005577 | Bacteria | 3176 |
| 230 | Ga0068857_100636776 | 3300005577 | Bacteria | 1010 |
| 231 | Ga0068854_100003207 | 3300005578 | Bacteria | 10203 |
| 232 | Ga0068854_100010312 | 3300005578 | Bacteria | 6056 |
| 233 | Ga0068856_100000308 | 3300005614 | Bacteria | 53511 |
| 234 | Ga0068856_100010687 | 3300005614 | Bacteria | 8918 |
| 235 | Ga0068856_100258975 | 3300005614 | Bacteria | 1755 |
| 236 | Ga0070702_100014862 | 3300005615 | Bacteria | 3961 |
| 237 | Ga0070702_100116622 | 3300005615 | Bacteria | 1665 |
| 238 | Ga0070702_100204860 | 3300005615 | Bacteria | 1309 |
| 239 | Ga0068852_100002326 | 3300005616 | Bacteria | 13065 |
| 240 | Ga0068852_100031324 | 3300005616 | Bacteria | 4387 |
| 241 | Ga0068852_100574103 | 3300005616 | Bacteria | 1130 |
| 242 | Ga0068859_100009076 | 3300005617 | Bacteria | 10044 |
| 243 | Ga0068859_100039394 | 3300005617 | Bacteria | 4741 |
| 244 | Ga0068859_100053408 | 3300005617 | Bacteria | 4064 |
| 245 | Ga0068864_100001754 | 3300005618 | Bacteria | 17838 |
| 246 | Ga0068864_100013586 | 3300005618 | Bacteria | 6750 |
| 247 | Ga0068864_100050852 | 3300005618 | Bacteria | 3568 |
| 248 | Ga0068864_100579545 | 3300005618 | Bacteria | 1087 |
| 249 | Ga0068866_10001865 | 3300005718 | Bacteria | 8828 |
| 250 | Ga0068861_100033242 | 3300005719 | Bacteria | 3803 |
| 251 | Ga0068861_100062553 | 3300005719 | Bacteria | 2860 |
| 252 | Ga0068861_100247729 | 3300005719 | Bacteria | 1519 |
| 253 | Ga0068870_10000419 | 3300005840 | Bacteria | 15983 |
| 254 | Ga0068863_100000340 | 3300005841 | Bacteria | 47641 |
| 255 | Ga0068863_100026204 | 3300005841 | Bacteria | 5563 |
| 256 | Ga0068863_100071220 | 3300005841 | Bacteria | 3289 |
| 257 | Ga0068858_100009413 | 3300005842 | Bacteria | 9322 |
| 258 | Ga0068858_100029243 | 3300005842 | Bacteria | 5116 |
| 259 | Ga0068858_100099646 | 3300005842 | Bacteria | 2709 |
| 260 | Ga0068858_100532949 | 3300005842 | Bacteria | 1136 |
| 261 | Ga0068860_100052206 | 3300005843 | Bacteria | 3889 |
| 262 | Ga0068860_100071592 | 3300005843 | Bacteria | 3294 |
| 263 | Ga0068860_100073526 | 3300005843 | Bacteria | 3249 |
| 264 | Ga0068860_100781709 | 3300005843 | Bacteria | 967 |
| 265 | Ga0068862_100006116 | 3300005844 | Bacteria | 10017 |
| 266 | Ga0068862_100041473 | 3300005844 | Bacteria | 3916 |
| 267 | Ga0068862_100767656 | 3300005844 | Bacteria | 939 |
| 268 | Ga0081455_10000007 | 3300005937 | Bacteria | 269394 |
| 269 | Ga0081540_1000002 | 3300005983 | Bacteria | 251149 |
| 270 | Ga0081539_10000394 | 3300005985 | Bacteria | 93943 |
| 271 | Ga0081539_10000668 | 3300005985 | Bacteria | 68754 |
| 272 | Ga0070717_10003040 | 3300006028 | Bacteria | 11964 |
| 273 | Ga0070717_10121840 | 3300006028 | Bacteria | 2235 |
| 274 | Ga0070717_10139779 | 3300006028 | Bacteria | 2088 |
| 275 | Ga0070717_10323784 | 3300006028 | Bacteria | 1374 |
| 276 | Ga0075365_10003142 | 3300006038 | Bacteria | 8419 |
| 277 | Ga0075365_10100662 | 3300006038 | Bacteria | 1978 |
| 278 | Ga0075365_10178335 | 3300006038 | Bacteria | 1485 |
| 279 | Ga0075365_10252205 | 3300006038 | Bacteria | 1240 |
| 280 | Ga0075365_10467938 | 3300006038 | Bacteria | 890 |
| 281 | Ga0075368_10003305 | 3300006042 | Bacteria | 5370 |
| 282 | Ga0075368_10030278 | 3300006042 | Bacteria | 2095 |
| 283 | Ga0075363_100000734 | 3300006048 | Bacteria | 11140 |
| 284 | Ga0075363_100017534 | 3300006048 | Bacteria | 3552 |
| 285 | Ga0075363_100041451 | 3300006048 | Bacteria | 2428 |
| 286 | Ga0075363_100043053 | 3300006048 | Bacteria | 2387 |
| 287 | Ga0075364_10027040 | 3300006051 | Bacteria | 3662 |
| 288 | Ga0075364_10102231 | 3300006051 | Bacteria | 1908 |
| 289 | Ga0075432_10028982 | 3300006058 | Bacteria | 1910 |
| 290 | Ga0075432_10032292 | 3300006058 | Bacteria | 1814 |
| 291 | Ga0070715_10005346 | 3300006163 | Bacteria | 4276 |
| 292 | Ga0070715_10016579 | 3300006163 | Bacteria | 2771 |
| 293 | Ga0070716_100001217 | 3300006173 | Bacteria | 11316 |
| 294 | Ga0070712_100005950 | 3300006175 | Bacteria | 7542 |
| 295 | Ga0070712_100012114 | 3300006175 | Bacteria | 5480 |
| 296 | Ga0070712_100175548 | 3300006175 | Bacteria | 1666 |
| 297 | Ga0075362_10000286 | 3300006177 | Bacteria | 14260 |
| 298 | Ga0075362_10080265 | 3300006177 | Bacteria | 1503 |
| 299 | Ga0075362_10109557 | 3300006177 | Bacteria | 1298 |
| 300 | Ga0075362_10168438 | 3300006177 | Bacteria | 1057 |
| 301 | Ga0075367_10000730 | 3300006178 | Bacteria | 12773 |
| 302 | Ga0075367_10002322 | 3300006178 | Bacteria | 8645 |
| 303 | Ga0075367_10003087 | 3300006178 | Bacteria | 7820 |
| 304 | Ga0075367_10038840 | 3300006178 | Bacteria | 2773 |
| 305 | Ga0075367_10137112 | 3300006178 | Bacteria | 1514 |
| 306 | Ga0075367_10352577 | 3300006178 | Bacteria | 929 |
| 307 | Ga0075369_10079221 | 3300006186 | Bacteria | 1455 |
| 308 | Ga0075369_10110757 | 3300006186 | Bacteria | 1237 |
| 309 | Ga0075369_10153483 | 3300006186 | Bacteria | 1053 |
| 310 | Ga0075366_10001531 | 3300006195 | Bacteria | 11562 |
| 311 | Ga0075366_10005069 | 3300006195 | Bacteria | 7122 |
| 312 | Ga0075366_10015235 | 3300006195 | Bacteria | 4402 |
| 313 | Ga0075366_10027421 | 3300006195 | Bacteria | 3342 |
| 314 | Ga0075366_10034195 | 3300006195 | Bacteria | 2994 |
| 315 | Ga0097621_100000880 | 3300006237 | Bacteria | 21059 |
| 316 | Ga0097621_100010589 | 3300006237 | Bacteria | 6755 |
| 317 | Ga0097621_100066478 | 3300006237 | Bacteria | 2969 |
| 318 | Ga0075370_10001459 | 3300006353 | Bacteria | 10271 |
| 319 | Ga0075370_10007230 | 3300006353 | Bacteria | 5646 |
| 320 | Ga0075370_10065979 | 3300006353 | Bacteria | 2064 |
| 321 | Ga0075370_10079544 | 3300006353 | Bacteria | 1883 |
| 322 | Ga0075370_10149080 | 3300006353 | Bacteria | 1370 |
| 323 | Ga0068871_100006040 | 3300006358 | Bacteria | 8523 |
| 324 | Ga0068871_100008998 | 3300006358 | Bacteria | 7211 |
| 325 | Ga0068871_100036409 | 3300006358 | Bacteria | 3918 |
| 326 | Ga0075428_100001723 | 3300006844 | Bacteria | 23380 |
| 327 | Ga0075428_100006547 | 3300006844 | Bacteria | 12951 |
| 328 | Ga0075430_100000201 | 3300006846 | Bacteria | 40551 |
| 329 | Ga0075431_100000260 | 3300006847 | Bacteria | 40551 |
| 330 | Ga0075431_100001007 | 3300006847 | Bacteria | 25062 |
| 331 | Ga0075431_100052381 | 3300006847 | Bacteria | 4208 |
| 332 | Ga0075433_10000007 | 3300006852 | Bacteria | 75995 |
| 333 | Ga0075433_10019271 | 3300006852 | Bacteria | 5682 |
| 334 | Ga0075433_10297785 | 3300006852 | Bacteria | 1428 |
| 335 | Ga0075434_100000091 | 3300006871 | Bacteria | 49489 |
| 336 | Ga0075434_100005079 | 3300006871 | Bacteria | 11948 |
| 337 | Ga0075434_100054318 | 3300006871 | Bacteria | 3980 |
| 338 | Ga0075434_100243466 | 3300006871 | Bacteria | 1818 |
| 339 | Ga0075434_100459202 | 3300006871 | Bacteria | 1295 |
| 340 | Ga0075429_100001265 | 3300006880 | Bacteria | 20558 |
| 341 | Ga0075429_100070114 | 3300006880 | Bacteria | 3051 |
| 342 | Ga0068865_100000615 | 3300006881 | Bacteria | 20013 |
| 343 | Ga0068865_100080765 | 3300006881 | Bacteria | 2333 |
| 344 | Ga0068865_100121213 | 3300006881 | Bacteria | 1945 |
| 345 | Ga0075436_100015888 | 3300006914 | Bacteria | 5152 |
| 346 | Ga0075436_100017933 | 3300006914 | Bacteria | 4847 |
| 347 | Ga0075436_100028258 | 3300006914 | Bacteria | 3858 |
| 348 | Ga0075436_100068532 | 3300006914 | Bacteria | 2451 |
| 349 | Ga0075436_100104260 | 3300006914 | Bacteria | 1977 |
| 350 | Ga0097620_100009075 | 3300006931 | Bacteria | 10044 |
| 351 | Ga0097620_100039391 | 3300006931 | Bacteria | 4741 |
| 352 | Ga0097620_100053406 | 3300006931 | Bacteria | 4064 |
| 353 | Ga0075435_100001029 | 3300007076 | Bacteria | 17685 |
| 354 | Ga0075435_100001714 | 3300007076 | Bacteria | 14245 |
| 355 | Ga0075435_100011790 | 3300007076 | Bacteria | 6450 |
| 356 | Ga0075435_100066884 | 3300007076 | Bacteria | 2925 |
| 357 | Ga0099794_10003104 | 3300007265 | Bacteria | 6284 |
| 358 | Ga0099794_10056087 | 3300007265 | Bacteria | 1905 |
| 359 | Ga0099795_10017367 | 3300007788 | Bacteria | 2293 |
| 360 | Ga0105251_10003023 | 3300009011 | Bacteria | 12543 |
| 361 | Ga0105251_10018333 | 3300009011 | Bacteria | 3724 |
| 362 | Ga0105251_10147661 | 3300009011 | Bacteria | 1062 |
| 363 | Ga0105244_10004322 | 3300009036 | Bacteria | 9823 |
| 364 | Ga0105244_10013636 | 3300009036 | Bacteria | 4737 |
| 365 | Ga0105244_10146237 | 3300009036 | Bacteria | 1134 |
| 366 | Ga0105250_10001271 | 3300009092 | Bacteria | 13873 |
| 367 | Ga0105240_10014700 | 3300009093 | Bacteria | 10677 |
| 368 | Ga0105240_10025813 | 3300009093 | Bacteria | 7715 |
| 369 | Ga0105240_10083154 | 3300009093 | Bacteria | 3929 |
| 370 | Ga0105240_10090355 | 3300009093 | Bacteria | 3743 |
| 371 | Ga0105240_10146942 | 3300009093 | Bacteria | 2812 |
| 372 | Ga0105240_10347407 | 3300009093 | Bacteria | 1684 |
| 373 | Ga0111539_10001412 | 3300009094 | Bacteria | 31985 |
| 374 | Ga0111539_10026413 | 3300009094 | Bacteria | 7099 |
| 375 | Ga0111539_10103262 | 3300009094 | Bacteria | 3346 |
| 376 | Ga0111539_10195935 | 3300009094 | Bacteria | 2356 |
| 377 | Ga0111539_10537663 | 3300009094 | Bacteria | 1361 |
| 378 | Ga0111539_10672746 | 3300009094 | Bacteria | 1205 |
| 379 | Ga0105245_10027580 | 3300009098 | Bacteria | 5004 |
| 380 | Ga0105245_10041176 | 3300009098 | Bacteria | 4118 |
| 381 | Ga0105245_10097858 | 3300009098 | Bacteria | 2710 |
| 382 | Ga0105245_10201283 | 3300009098 | Bacteria | 1912 |
| 383 | Ga0105245_10350161 | 3300009098 | Bacteria | 1463 |
| 384 | Ga0105247_10026019 | 3300009101 | Bacteria | 3532 |
| 385 | Ga0105247_10113547 | 3300009101 | Bacteria | 1746 |
| 386 | Ga0105247_10150151 | 3300009101 | Bacteria | 1535 |
| 387 | Ga0105247_10330992 | 3300009101 | Bacteria | 1065 |
| 388 | Ga0114129_10002772 | 3300009147 | Bacteria | 24406 |
| 389 | Ga0114129_10017987 | 3300009147 | Bacteria | 10065 |
| 390 | Ga0114129_10078906 | 3300009147 | Bacteria | 4578 |
| 391 | Ga0114129_10686652 | 3300009147 | Bacteria | 1317 |
| 392 | Ga0105243_10007677 | 3300009148 | Bacteria | 8286 |
| 393 | Ga0105243_10024994 | 3300009148 | Bacteria | 4561 |
| 394 | Ga0105243_10030527 | 3300009148 | Bacteria | 4150 |
| 395 | Ga0105243_10045128 | 3300009148 | Bacteria | 3462 |
| 396 | Ga0105243_10429047 | 3300009148 | Bacteria | 1235 |
| 397 | Ga0105241_10021798 | 3300009174 | Bacteria | 4740 |
| 398 | Ga0105241_10023847 | 3300009174 | Bacteria | 4540 |
| 399 | Ga0105241_10168092 | 3300009174 | Bacteria | 1809 |
| 400 | Ga0105242_10004266 | 3300009176 | Bacteria | 11145 |
| 401 | Ga0105242_10007702 | 3300009176 | Bacteria | 8286 |
| 402 | Ga0105242_10211388 | 3300009176 | Bacteria | 1729 |
| 403 | Ga0105248_10004655 | 3300009177 | Bacteria | 15184 |
| 404 | Ga0105248_10043196 | 3300009177 | Bacteria | 5054 |
| 405 | Ga0105248_10047663 | 3300009177 | Bacteria | 4806 |
| 406 | Ga0105248_10057813 | 3300009177 | Bacteria | 4354 |
| 407 | Ga0105248_10338938 | 3300009177 | Bacteria | 1693 |
| 408 | Ga0105237_10042077 | 3300009545 | Bacteria | 4607 |
| 409 | Ga0105237_10208558 | 3300009545 | Bacteria | 1954 |
| 410 | Ga0105238_10110783 | 3300009551 | Bacteria | 2725 |
| 411 | Ga0105238_10111936 | 3300009551 | Bacteria | 2710 |
| 412 | Ga0105249_10010100 | 3300009553 | Bacteria | 8286 |
| 413 | Ga0105249_10283720 | 3300009553 | Bacteria | 1655 |
| 414 | Ga0105249_11020688 | 3300009553 | Bacteria | 896 |
| 415 | Ga0105239_10086648 | 3300010375 | Bacteria | 3452 |
| 416 | Ga0105239_10118061 | 3300010375 | Bacteria | 2944 |
| 417 | Ga0105239_10219286 | 3300010375 | Bacteria | 2133 |
| 418 | Ga0105239_10253389 | 3300010375 | Bacteria | 1977 |
| 419 | Ga0105246_10001908 | 3300011119 | Bacteria | 12559 |
| 420 | Ga0105246_10183283 | 3300011119 | Bacteria | 1614 |
| 421 | Ga0105246_10239225 | 3300011119 | Bacteria | 1434 |
| 422 | Ga0157373_10001235 | 3300013100 | Bacteria | 19546 |
| 423 | Ga0157373_10004667 | 3300013100 | Bacteria | 10306 |
| 424 | Ga0157371_10000419 | 3300013102 | Bacteria | 52509 |
| 425 | Ga0157371_10004765 | 3300013102 | Bacteria | 11693 |
| 426 | Ga0157371_10105612 | 3300013102 | Bacteria | 1998 |
| 427 | Ga0157371_10174573 | 3300013102 | Bacteria | 1536 |
| 428 | Ga0157370_10000002 | 3300013104 | Bacteria | 431400 |
| 429 | Ga0157370_10061748 | 3300013104 | Bacteria | 3556 |
| 430 | Ga0157370_10553966 | 3300013104 | Bacteria | 1054 |
| 431 | Ga0157369_10001303 | 3300013105 | Bacteria | 31024 |
| 432 | Ga0157369_10022078 | 3300013105 | Bacteria | 7112 |
| 433 | Ga0157369_10042262 | 3300013105 | Bacteria | 4973 |
| 434 | Ga0157369_10119185 | 3300013105 | Bacteria | 2801 |
| 435 | Ga0157369_10522966 | 3300013105 | Bacteria | 1227 |
| 436 | Ga0157374_10010364 | 3300013296 | Bacteria | 8018 |
| 437 | Ga0157374_10029962 | 3300013296 | Bacteria | 4937 |
| 438 | Ga0157378_10009964 | 3300013297 | Bacteria | 8286 |
| 439 | Ga0157378_10035863 | 3300013297 | Bacteria | 4389 |
| 440 | Ga0157378_10077532 | 3300013297 | Bacteria | 2996 |
| 441 | Ga0163162_10011627 | 3300013306 | Bacteria | 8584 |
| 442 | Ga0163162_10017148 | 3300013306 | Bacteria | 7086 |
| 443 | Ga0163162_10054423 | 3300013306 | Bacteria | 4025 |
| 444 | Ga0163162_10061637 | 3300013306 | Bacteria | 3788 |
| 445 | Ga0163162_10067500 | 3300013306 | Bacteria | 3626 |
| 446 | Ga0163162_10167493 | 3300013306 | Bacteria | 2321 |
| 447 | Ga0157372_10002873 | 3300013307 | Bacteria | 18620 |
| 448 | Ga0157372_10028009 | 3300013307 | Bacteria | 6144 |
| 449 | Ga0157372_10088265 | 3300013307 | Bacteria | 3521 |
| 450 | Ga0157372_10279203 | 3300013307 | Bacteria | 1942 |
| 451 | Ga0157372_10801131 | 3300013307 | Bacteria | 1095 |
| 452 | Ga0157375_10007981 | 3300013308 | Bacteria | 9268 |
| 453 | Ga0157375_10059865 | 3300013308 | Bacteria | 3774 |
| 454 | Ga0157375_10062691 | 3300013308 | Bacteria | 3695 |
| 455 | Ga0157375_10219908 | 3300013308 | Bacteria | 2058 |
| 456 | Ga0157375_10474743 | 3300013308 | Bacteria | 1416 |
| 457 | Ga0163163_10006941 | 3300014325 | Bacteria | 9948 |
| 458 | Ga0163163_10026981 | 3300014325 | Bacteria | 5496 |
| 459 | Ga0163163_10071319 | 3300014325 | Bacteria | 3461 |
| 460 | Ga0157380_10004902 | 3300014326 | Bacteria | 9325 |
| 461 | Ga0157380_10287406 | 3300014326 | Bacteria | 1508 |
| 462 | Ga0182008_10017556 | 3300014497 | Bacteria | 3711 |
| 463 | Ga0182008_10039281 | 3300014497 | Bacteria | 2365 |
| 464 | Ga0182008_10050232 | 3300014497 | Bacteria | 2070 |
| 465 | Ga0182008_10105766 | 3300014497 | Bacteria | 1392 |
| 466 | Ga0182008_10107420 | 3300014497 | Bacteria | 1381 |
| 467 | Ga0157377_10002529 | 3300014745 | Bacteria | 8107 |
| 468 | Ga0157379_10000036 | 3300014968 | Bacteria | 81888 |
| 469 | Ga0157379_10024663 | 3300014968 | Bacteria | 5338 |
| 470 | Ga0157379_10044610 | 3300014968 | Bacteria | 3957 |
| 471 | Ga0157376_10027787 | 3300014969 | Bacteria | 4489 |
| 472 | Ga0157376_10234851 | 3300014969 | Bacteria | 1705 |
| 473 | Ga0182006_1002183 | 3300015261 | Bacteria | 10853 |
| 474 | Ga0182006_1003839 | 3300015261 | Bacteria | 7545 |
| 475 | Ga0182006_1006307 | 3300015261 | Bacteria | 5526 |
| 476 | Ga0182006_1012230 | 3300015261 | Bacteria | 3756 |
| 477 | Ga0182007_10007789 | 3300015262 | Bacteria | 4453 |
| 478 | Ga0182007_10011471 | 3300015262 | Bacteria | 3449 |
| 479 | Ga0182005_1001297 | 3300015265 | Bacteria | 10282 |
| 480 | Ga0182005_1006013 | 3300015265 | Bacteria | 3748 |
| 481 | Ga0163161_10006198 | 3300017792 | Bacteria | 8286 |
| 482 | Ga0206356_11256461 | 3300020070 | Bacteria | 3409 |
| 483 | Ga0206356_11423983 | 3300020070 | Bacteria | 933 |
| 484 | Ga0206353_11376502 | 3300020082 | Bacteria | 1855 |
| 485 | Ga0154015_1416319 | 3300020610 | Bacteria | 12687 |
| 486 | Ga0213873_10026857 | 3300021358 | Bacteria | 1401 |
| 487 | Ga0213872_10000482 | 3300021361 | Bacteria | 32036 |
| 488 | Ga0213875_10011286 | 3300021388 | Bacteria | 4449 |
| 489 | Ga0228598_1011274 | 3300024227 | Bacteria | 1779 |
| 490 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 491 | Ga0209784_100243 | 3300025224 | Bacteria | 35204 |
| 492 | Ga0209784_100808 | 3300025224 | Bacteria | 7230 |
| 493 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 494 | Ga0209566_100742 | 3300025225 | Bacteria | 18112 |
| 495 | Ga0209566_100934 | 3300025225 | Bacteria | 13351 |
| 496 | Ga0209674_100010 | 3300025226 | Bacteria | 1038638 |
| 497 | Ga0209674_100081 | 3300025226 | Bacteria | 201146 |
| 498 | Ga0209674_101205 | 3300025226 | Bacteria | 7374 |
| 499 | Ga0209672_100624 | 3300025228 | Bacteria | 18296 |
| 500 | Ga0209147_100414 | 3300025229 | Bacteria | 28331 |
| 501 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 502 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 503 | Ga0209563_100026 | 3300025230 | Bacteria | 559453 |
| 504 | Ga0209258_100618 | 3300025242 | Bacteria | 28331 |
| 505 | Ga0209646_1000065 | 3300025246 | Bacteria | 245452 |
| 506 | Ga0209026_1010214 | 3300025250 | Bacteria | 1768 |
| 507 | Ga0209677_100013 | 3300025253 | Bacteria | 548200 |
| 508 | Ga0209677_101179 | 3300025253 | Bacteria | 11992 |
| 509 | Ga0209148_1000113 | 3300025254 | Bacteria | 195646 |
| 510 | Ga0209148_1006097 | 3300025254 | Bacteria | 2653 |
| 511 | Ga0209759_1001010 | 3300025256 | Bacteria | 19015 |
| 512 | Ga0209759_1001214 | 3300025256 | Bacteria | 15844 |
| 513 | Ga0209759_1001322 | 3300025256 | Bacteria | 14570 |
| 514 | Ga0209759_1003788 | 3300025256 | Bacteria | 5892 |
| 515 | Ga0209565_1000176 | 3300025263 | Bacteria | 81062 |
| 516 | Ga0207666_1000147 | 3300025271 | Bacteria | 11003 |
| 517 | Ga0207666_1001482 | 3300025271 | Bacteria | 2775 |
| 518 | Ga0209455_1000501 | 3300025272 | Bacteria | 28331 |
| 519 | Ga0209673_1014335 | 3300025273 | Bacteria | 3070 |
| 520 | Ga0209130_1001660 | 3300025284 | Bacteria | 13597 |
| 521 | Ga0207673_1000767 | 3300025290 | Bacteria | 3463 |
| 522 | Ga0209675_1000218 | 3300025291 | Bacteria | 60057 |
| 523 | Ga0209675_1003302 | 3300025291 | Bacteria | 7746 |
| 524 | Ga0209676_1000627 | 3300025292 | Bacteria | 51086 |
| 525 | Ga0209676_1000855 | 3300025292 | Bacteria | 39250 |
| 526 | Ga0209676_1001271 | 3300025292 | Bacteria | 26199 |
| 527 | Ga0209676_1001369 | 3300025292 | Bacteria | 23919 |
| 528 | Ga0209676_1008057 | 3300025292 | Bacteria | 4788 |
| 529 | Ga0209025_1000028 | 3300025294 | Bacteria | 490678 |
| 530 | Ga0209025_1002169 | 3300025294 | Bacteria | 21834 |
| 531 | Ga0209025_1004673 | 3300025294 | Bacteria | 11705 |
| 532 | Ga0209025_1029115 | 3300025294 | Bacteria | 2684 |
| 533 | Ga0209025_1059610 | 3300025294 | Bacteria | 1439 |
| 534 | Ga0209564_1000135 | 3300025295 | Bacteria | 188117 |
| 535 | Ga0209564_1000421 | 3300025295 | Bacteria | 74558 |
| 536 | Ga0209758_1000063 | 3300025297 | Bacteria | 315999 |
| 537 | Ga0209758_1000120 | 3300025297 | Bacteria | 192212 |
| 538 | Ga0209758_1005062 | 3300025297 | Bacteria | 10452 |
| 539 | Ga0209050_1000100 | 3300025298 | Bacteria | 231385 |
| 540 | Ga0209050_1000537 | 3300025298 | Bacteria | 62966 |
| 541 | Ga0209256_1000107 | 3300025299 | Bacteria | 186233 |
| 542 | Ga0209256_1000263 | 3300025299 | Bacteria | 92812 |
| 543 | Ga0209256_1002000 | 3300025299 | Bacteria | 18244 |
| 544 | Ga0209256_1010514 | 3300025299 | Bacteria | 3858 |
| 545 | Ga0207426_1000018 | 3300025302 | Bacteria | 566740 |
| 546 | Ga0209051_1000067 | 3300025303 | Bacteria | 227181 |
| 547 | Ga0209051_1000302 | 3300025303 | Bacteria | 77692 |
| 548 | Ga0209051_1000345 | 3300025303 | Bacteria | 69229 |
| 549 | Ga0209257_1000095 | 3300025304 | Bacteria | 259437 |
| 550 | Ga0209257_1002834 | 3300025304 | Bacteria | 16262 |
| 551 | Ga0207697_10002326 | 3300025315 | Bacteria | 9897 |
| 552 | Ga0207697_10077030 | 3300025315 | Bacteria | 1402 |
| 553 | Ga0207696_1002217 | 3300025711 | Bacteria | 9716 |
| 554 | Ga0207655_1005104 | 3300025728 | Bacteria | 9061 |
| 555 | Ga0207655_1008924 | 3300025728 | Bacteria | 6293 |
| 556 | Ga0207655_1019123 | 3300025728 | Bacteria | 3598 |
| 557 | Ga0207713_1002340 | 3300025735 | Bacteria | 13916 |
| 558 | Ga0207653_10001409 | 3300025885 | Bacteria | 7795 |
| 559 | Ga0207682_10001723 | 3300025893 | Bacteria | 10024 |
| 560 | Ga0207692_10022169 | 3300025898 | Bacteria | 2919 |
| 561 | Ga0207692_10120478 | 3300025898 | Bacteria | 1469 |
| 562 | Ga0207692_10317278 | 3300025898 | Bacteria | 953 |
| 563 | Ga0207710_10005311 | 3300025900 | Bacteria | 5559 |
| 564 | Ga0207710_10005447 | 3300025900 | Bacteria | 5480 |
| 565 | Ga0207710_10060865 | 3300025900 | Bacteria | 1712 |
| 566 | Ga0207688_10000167 | 3300025901 | Bacteria | 28809 |
| 567 | Ga0207688_10097804 | 3300025901 | Bacteria | 1692 |
| 568 | Ga0207688_10171623 | 3300025901 | Bacteria | 1290 |
| 569 | Ga0207680_10023271 | 3300025903 | Bacteria | 3380 |
| 570 | Ga0207680_10044018 | 3300025903 | Bacteria | 2622 |
| 571 | Ga0207647_10002561 | 3300025904 | Bacteria | 13747 |
| 572 | Ga0207647_10057430 | 3300025904 | Bacteria | 2386 |
| 573 | Ga0207685_10010229 | 3300025905 | Bacteria | 2760 |
| 574 | Ga0207685_10020155 | 3300025905 | Bacteria | 2211 |
| 575 | Ga0207685_10136186 | 3300025905 | Bacteria | 1096 |
| 576 | Ga0207699_10001489 | 3300025906 | Bacteria | 11129 |
| 577 | Ga0207699_10106411 | 3300025906 | Bacteria | 1790 |
| 578 | Ga0207645_10005140 | 3300025907 | Bacteria | 9571 |
| 579 | Ga0207645_10125221 | 3300025907 | Bacteria | 1670 |
| 580 | Ga0207645_10172079 | 3300025907 | Bacteria | 1420 |
| 581 | Ga0207643_10004063 | 3300025908 | Bacteria | 7870 |
| 582 | Ga0207705_10017729 | 3300025909 | Bacteria | 5093 |
| 583 | Ga0207705_10081845 | 3300025909 | Bacteria | 2353 |
| 584 | Ga0207684_10126446 | 3300025910 | Bacteria | 2194 |
| 585 | Ga0207684_10318850 | 3300025910 | Bacteria | 1340 |
| 586 | Ga0207654_10026883 | 3300025911 | Bacteria | 3122 |
| 587 | Ga0207707_10016807 | 3300025912 | Bacteria | 6375 |
| 588 | Ga0207707_10040964 | 3300025912 | Bacteria | 4044 |
| 589 | Ga0207707_10058268 | 3300025912 | Bacteria | 3361 |
| 590 | Ga0207707_10159070 | 3300025912 | Bacteria | 1975 |
| 591 | Ga0207707_10378882 | 3300025912 | Bacteria | 1216 |
| 592 | Ga0207695_10005378 | 3300025913 | Bacteria | 17020 |
| 593 | Ga0207695_10045076 | 3300025913 | Bacteria | 4685 |
| 594 | Ga0207695_10188244 | 3300025913 | Bacteria | 1982 |
| 595 | Ga0207695_10242936 | 3300025913 | Bacteria | 1701 |
| 596 | Ga0207671_10035659 | 3300025914 | Bacteria | 3690 |
| 597 | Ga0207671_10588322 | 3300025914 | Bacteria | 887 |
| 598 | Ga0207693_10008449 | 3300025915 | Bacteria | 8426 |
| 599 | Ga0207693_10032045 | 3300025915 | Bacteria | 4150 |
| 600 | Ga0207693_10132042 | 3300025915 | Bacteria | 1963 |
| 601 | Ga0207693_10181051 | 3300025915 | Bacteria | 1658 |
| 602 | Ga0207693_10222535 | 3300025915 | Bacteria | 1482 |
| 603 | Ga0207663_10070179 | 3300025916 | Bacteria | 2257 |
| 604 | Ga0207663_10144020 | 3300025916 | Bacteria | 1664 |
| 605 | Ga0207663_10556355 | 3300025916 | Bacteria | 897 |
| 606 | Ga0207660_10020078 | 3300025917 | Bacteria | 4479 |
| 607 | Ga0207660_10029553 | 3300025917 | Bacteria | 3761 |
| 608 | Ga0207660_10041239 | 3300025917 | Bacteria | 3234 |
| 609 | Ga0207660_10199301 | 3300025917 | Bacteria | 1563 |
| 610 | Ga0207662_10000195 | 3300025918 | Bacteria | 28315 |
| 611 | Ga0207662_10021822 | 3300025918 | Bacteria | 3664 |
| 612 | Ga0207662_10198917 | 3300025918 | Bacteria | 1296 |
| 613 | Ga0207657_10012031 | 3300025919 | Bacteria | 8558 |
| 614 | Ga0207657_10141998 | 3300025919 | Bacteria | 1961 |
| 615 | Ga0207657_10145041 | 3300025919 | Bacteria | 1937 |
| 616 | Ga0207657_10251829 | 3300025919 | Bacteria | 1407 |
| 617 | Ga0207657_10302416 | 3300025919 | Bacteria | 1267 |
| 618 | Ga0207649_10000168 | 3300025920 | Bacteria | 53468 |
| 619 | Ga0207649_10000944 | 3300025920 | Bacteria | 18174 |
| 620 | Ga0207649_10026440 | 3300025920 | Bacteria | 3395 |
| 621 | Ga0207649_10293310 | 3300025920 | Bacteria | 1187 |
| 622 | Ga0207652_10027911 | 3300025921 | Bacteria | 4708 |
| 623 | Ga0207652_10028891 | 3300025921 | Bacteria | 4629 |
| 624 | Ga0207652_10074387 | 3300025921 | Bacteria | 2958 |
| 625 | Ga0207652_10193030 | 3300025921 | Bacteria | 1832 |
| 626 | Ga0207646_10014392 | 3300025922 | Bacteria | 7516 |
| 627 | Ga0207681_10004024 | 3300025923 | Bacteria | 9118 |
| 628 | Ga0207681_10033795 | 3300025923 | Bacteria | 3357 |
| 629 | Ga0207694_10170107 | 3300025924 | Bacteria | 1764 |
| 630 | Ga0207650_10011209 | 3300025925 | Bacteria | 6165 |
| 631 | Ga0207650_10241511 | 3300025925 | Bacteria | 1460 |
| 632 | Ga0207659_10001128 | 3300025926 | Bacteria | 15843 |
| 633 | Ga0207659_10017661 | 3300025926 | Bacteria | 4662 |
| 634 | Ga0207659_10105888 | 3300025926 | Bacteria | 2129 |
| 635 | Ga0207687_10016099 | 3300025927 | Bacteria | 4908 |
| 636 | Ga0207700_10005022 | 3300025928 | Bacteria | 7870 |
| 637 | Ga0207700_10038774 | 3300025928 | Bacteria | 3461 |
| 638 | Ga0207700_10038856 | 3300025928 | Bacteria | 3458 |
| 639 | Ga0207700_10530417 | 3300025928 | Bacteria | 1044 |
| 640 | Ga0207664_10037901 | 3300025929 | Bacteria | 3734 |
| 641 | Ga0207664_10310225 | 3300025929 | Bacteria | 1390 |
| 642 | Ga0207644_10016379 | 3300025931 | Bacteria | 4987 |
| 643 | Ga0207644_10029859 | 3300025931 | Bacteria | 3784 |
| 644 | Ga0207644_10048690 | 3300025931 | Bacteria | 3032 |
| 645 | Ga0207644_10534818 | 3300025931 | Bacteria | 969 |
| 646 | Ga0207690_10010455 | 3300025932 | Bacteria | 5516 |
| 647 | Ga0207690_10307559 | 3300025932 | Bacteria | 1242 |
| 648 | Ga0207706_10010273 | 3300025933 | Bacteria | 8558 |
| 649 | Ga0207706_10019439 | 3300025933 | Bacteria | 6112 |
| 650 | Ga0207706_10053277 | 3300025933 | Bacteria | 3572 |
| 651 | Ga0207706_10160825 | 3300025933 | Bacteria | 1974 |
| 652 | Ga0207706_10409685 | 3300025933 | Bacteria | 1175 |
| 653 | Ga0207686_10002278 | 3300025934 | Bacteria | 10539 |
| 654 | Ga0207686_10009205 | 3300025934 | Bacteria | 5356 |
| 655 | Ga0207686_10196287 | 3300025934 | Bacteria | 1442 |
| 656 | Ga0207709_10002480 | 3300025935 | Bacteria | 11563 |
| 657 | Ga0207709_10103755 | 3300025935 | Bacteria | 1885 |
| 658 | Ga0207670_10000792 | 3300025936 | Bacteria | 16529 |
| 659 | Ga0207669_10001389 | 3300025937 | Bacteria | 10299 |
| 660 | Ga0207669_10165189 | 3300025937 | Bacteria | 1569 |
| 661 | Ga0207704_10478771 | 3300025938 | Bacteria | 999 |
| 662 | Ga0207665_10034351 | 3300025939 | Bacteria | 3364 |
| 663 | Ga0207691_10009001 | 3300025940 | Bacteria | 9573 |
| 664 | Ga0207691_10034563 | 3300025940 | Bacteria | 4699 |
| 665 | Ga0207711_10009422 | 3300025941 | Bacteria | 8151 |
| 666 | Ga0207711_10011627 | 3300025941 | Bacteria | 7313 |
| 667 | Ga0207711_10046935 | 3300025941 | Bacteria | 3691 |
| 668 | Ga0207711_10539283 | 3300025941 | Bacteria | 1088 |
| 669 | Ga0207689_10000008 | 3300025942 | Bacteria | 127942 |
| 670 | Ga0207661_10002577 | 3300025944 | Bacteria | 12474 |
| 671 | Ga0207661_10254323 | 3300025944 | Bacteria | 1563 |
| 672 | Ga0207679_10000085 | 3300025945 | Bacteria | 82493 |
| 673 | Ga0207679_10004919 | 3300025945 | Bacteria | 8331 |
| 674 | Ga0207679_10149819 | 3300025945 | Bacteria | 1897 |
| 675 | Ga0207679_10158555 | 3300025945 | Bacteria | 1850 |
| 676 | Ga0207667_10008690 | 3300025949 | Bacteria | 12035 |
| 677 | Ga0207667_10017077 | 3300025949 | Bacteria | 8183 |
| 678 | Ga0207667_10029863 | 3300025949 | Bacteria | 5905 |
| 679 | Ga0207667_10080722 | 3300025949 | Bacteria | 3370 |
| 680 | Ga0207651_10000292 | 3300025960 | Bacteria | 21406 |
| 681 | Ga0207651_10013806 | 3300025960 | Bacteria | 4638 |
| 682 | Ga0207651_10035767 | 3300025960 | Bacteria | 3234 |
| 683 | Ga0207651_10230681 | 3300025960 | Bacteria | 1503 |
| 684 | Ga0207712_10253608 | 3300025961 | Bacteria | 1423 |
| 685 | Ga0207712_10265581 | 3300025961 | Bacteria | 1394 |
| 686 | Ga0207668_10001329 | 3300025972 | Bacteria | 14678 |
| 687 | Ga0207668_10062991 | 3300025972 | Bacteria | 2614 |
| 688 | Ga0207668_10068701 | 3300025972 | Bacteria | 2520 |
| 689 | Ga0207668_10175610 | 3300025972 | Bacteria | 1685 |
| 690 | Ga0207668_10288539 | 3300025972 | Bacteria | 1349 |
| 691 | Ga0207640_10000946 | 3300025981 | Bacteria | 16207 |
| 692 | Ga0207640_10001339 | 3300025981 | Bacteria | 13347 |
| 693 | Ga0207658_10008697 | 3300025986 | Bacteria | 6898 |
| 694 | Ga0207658_10014450 | 3300025986 | Bacteria | 5406 |
| 695 | Ga0207658_10026305 | 3300025986 | Bacteria | 4079 |
| 696 | Ga0207658_10028752 | 3300025986 | Bacteria | 3919 |
| 697 | Ga0207658_10089957 | 3300025986 | Bacteria | 2378 |
| 698 | Ga0207677_10023807 | 3300026023 | Bacteria | 3790 |
| 699 | Ga0207677_10030325 | 3300026023 | Bacteria | 3450 |
| 700 | Ga0207703_10006686 | 3300026035 | Bacteria | 9198 |
| 701 | Ga0207703_10048343 | 3300026035 | Bacteria | 3434 |
| 702 | Ga0207703_10672537 | 3300026035 | Bacteria | 983 |
| 703 | Ga0207639_10061983 | 3300026041 | Bacteria | 2890 |
| 704 | Ga0207639_10198554 | 3300026041 | Bacteria | 1718 |
| 705 | Ga0207639_10310928 | 3300026041 | Bacteria | 1396 |
| 706 | Ga0207678_10000202 | 3300026067 | Bacteria | 52357 |
| 707 | Ga0207678_10009486 | 3300026067 | Bacteria | 8558 |
| 708 | Ga0207678_10092108 | 3300026067 | Bacteria | 2591 |
| 709 | Ga0207678_10564253 | 3300026067 | Bacteria | 996 |
| 710 | Ga0207708_10006642 | 3300026075 | Bacteria | 8558 |
| 711 | Ga0207708_10075557 | 3300026075 | Bacteria | 2584 |
| 712 | Ga0207708_10289801 | 3300026075 | Bacteria | 1329 |
| 713 | Ga0207708_10473437 | 3300026075 | Bacteria | 1046 |
| 714 | Ga0207702_10000294 | 3300026078 | Bacteria | 57746 |
| 715 | Ga0207702_10025513 | 3300026078 | Bacteria | 4906 |
| 716 | Ga0207702_10073289 | 3300026078 | Bacteria | 2952 |
| 717 | Ga0207641_10004156 | 3300026088 | Bacteria | 12612 |
| 718 | Ga0207641_10029014 | 3300026088 | Bacteria | 4574 |
| 719 | Ga0207641_10279426 | 3300026088 | Bacteria | 1570 |
| 720 | Ga0207648_10009518 | 3300026089 | Bacteria | 9297 |
| 721 | Ga0207648_10040099 | 3300026089 | Bacteria | 4115 |
| 722 | Ga0207648_10060737 | 3300026089 | Bacteria | 3296 |
| 723 | Ga0207676_10000182 | 3300026095 | Bacteria | 55544 |
| 724 | Ga0207676_10008809 | 3300026095 | Bacteria | 7183 |
| 725 | Ga0207676_10018336 | 3300026095 | Bacteria | 5086 |
| 726 | Ga0207676_10075023 | 3300026095 | Bacteria | 2727 |
| 727 | Ga0207674_10012281 | 3300026116 | Bacteria | 9578 |
| 728 | Ga0207674_10034038 | 3300026116 | Bacteria | 5328 |
| 729 | Ga0207674_10058447 | 3300026116 | Bacteria | 3906 |
| 730 | Ga0207674_10148377 | 3300026116 | Bacteria | 2303 |
| 731 | Ga0207674_10550578 | 3300026116 | Bacteria | 1114 |
| 732 | Ga0207674_10605528 | 3300026116 | Bacteria | 1058 |
| 733 | Ga0207675_100009202 | 3300026118 | Bacteria | 9264 |
| 734 | Ga0207675_100033365 | 3300026118 | Bacteria | 4796 |
| 735 | Ga0207675_100223631 | 3300026118 | Bacteria | 1814 |
| 736 | Ga0207675_100611305 | 3300026118 | Bacteria | 1094 |
| 737 | Ga0207683_10008676 | 3300026121 | Bacteria | 8692 |
| 738 | Ga0207683_10008899 | 3300026121 | Bacteria | 8558 |
| 739 | Ga0207683_10152765 | 3300026121 | Bacteria | 2084 |
| 740 | Ga0207683_10268527 | 3300026121 | Bacteria | 1558 |
| 741 | Ga0207683_10394119 | 3300026121 | Bacteria | 1273 |
| 742 | Ga0207698_10011050 | 3300026142 | Bacteria | 5837 |
| 743 | Ga0207698_10014161 | 3300026142 | Bacteria | 5290 |
| 744 | Ga0207698_10029219 | 3300026142 | Bacteria | 3944 |
| 745 | Ga0207698_10364095 | 3300026142 | Bacteria | 1370 |
| 746 | Ga0209969_1004460 | 3300027360 | Bacteria | 1958 |
| 747 | Ga0209967_1000754 | 3300027364 | Bacteria | 4160 |
| 748 | Ga0209981_1000239 | 3300027378 | Bacteria | 7055 |
| 749 | Ga0210000_1000579 | 3300027462 | Bacteria | 5008 |
| 750 | Ga0210000_1003860 | 3300027462 | Bacteria | 2168 |
| 751 | Ga0209995_1004874 | 3300027471 | Bacteria | 2154 |
| 752 | Ga0209179_1008622 | 3300027512 | Bacteria | 1724 |
| 753 | Ga0209179_1019414 | 3300027512 | Bacteria | 1309 |
| 754 | Ga0209999_1000289 | 3300027543 | Bacteria | 7421 |
| 755 | Ga0209999_1001900 | 3300027543 | Bacteria | 3629 |
| 756 | Ga0209983_1007917 | 3300027665 | Bacteria | 2174 |
| 757 | Ga0209282_1000105 | 3300027666 | Bacteria | 54842 |
| 758 | Ga0209588_1020430 | 3300027671 | Bacteria | 2074 |
| 759 | Ga0209971_1007306 | 3300027682 | Bacteria | 2621 |
| 760 | Ga0209966_1001543 | 3300027695 | Bacteria | 4002 |
| 761 | Ga0209998_10001521 | 3300027717 | Bacteria | 5575 |
| 762 | Ga0209998_10002524 | 3300027717 | Bacteria | 4168 |
| 763 | Ga0209813_10015681 | 3300027866 | Bacteria | 2057 |
| 764 | Ga0209974_10001584 | 3300027876 | Bacteria | 8235 |
| 765 | Ga0209974_10014301 | 3300027876 | Bacteria | 2642 |
| 766 | Ga0207428_10000115 | 3300027907 | Bacteria | 109072 |
| 767 | Ga0207428_10001793 | 3300027907 | Bacteria | 21978 |
| 768 | Ga0207428_10013664 | 3300027907 | Bacteria | 7082 |
| 769 | Ga0268266_10016915 | 3300028379 | Bacteria | 6231 |
| 770 | Ga0268266_10048810 | 3300028379 | Bacteria | 3628 |
| 771 | Ga0268266_10131011 | 3300028379 | Bacteria | 2243 |
| 772 | Ga0268266_10358671 | 3300028379 | Bacteria | 1371 |
| 773 | Ga0268266_10641677 | 3300028379 | Bacteria | 1022 |
| 774 | Ga0268265_10006061 | 3300028380 | Bacteria | 8213 |
| 775 | Ga0268264_10015470 | 3300028381 | Bacteria | 6255 |
| 776 | Ga0268264_10073561 | 3300028381 | Bacteria | 2901 |
| 777 | Ga0268264_10262149 | 3300028381 | Bacteria | 1610 |
| 778 | Ga0268264_10310622 | 3300028381 | Bacteria | 1487 |
| 779 | Ga0265337_1000403 | 3300028556 | Bacteria | 23321 |
| 780 | Ga0265334_10057842 | 3300028573 | Bacteria | 1468 |
| 781 | Ga0307515_10000292 | 3300028794 | Bacteria | 123160 |
| 782 | Ga0307515_10008051 | 3300028794 | Bacteria | 20654 |
| 783 | Ga0307515_10192792 | 3300028794 | Bacteria | 1941 |
| 784 | Ga0307515_10298673 | 3300028794 | Bacteria | 1298 |
| 785 | Ga0265338_10011769 | 3300028800 | Bacteria | 10059 |
| 786 | Ga0265338_10122133 | 3300028800 | Bacteria | 2074 |
| 787 | Ga0265338_10267035 | 3300028800 | Bacteria | 1255 |
| 788 | Ga0265338_10469888 | 3300028800 | Bacteria | 888 |
| 789 | Ga0307511_10000019 | 3300030521 | Bacteria | 117947 |
| 790 | Ga0307512_10044663 | 3300030522 | Bacteria | 3639 |
| 791 | Ga0307512_10151369 | 3300030522 | Bacteria | 1387 |
| 792 | Ga0307512_10193253 | 3300030522 | Bacteria | 1118 |
| 793 | Ga0316177_1138189 | 3300030731 | Bacteria | 6745 |
| 794 | Ga0314311_1143830 | 3300030733 | Bacteria | 1334 |
| 795 | Ga0316178_1024177 | 3300030735 | Bacteria | 4492 |
| 796 | Ga0316181_1116699 | 3300030744 | Bacteria | 14877 |
| 797 | Ga0316182_1438880 | 3300030745 | Bacteria | 1723 |
| 798 | Ga0265760_10002646 | 3300031090 | Bacteria | 5241 |
| 799 | Ga0265330_10006763 | 3300031235 | Bacteria | 5653 |
| 800 | Ga0265330_10018509 | 3300031235 | Bacteria | 3199 |
| 801 | Ga0265330_10142406 | 3300031235 | Bacteria | 1019 |
| 802 | Ga0265332_10002834 | 3300031238 | Bacteria | 8597 |
| 803 | Ga0265325_10000026 | 3300031241 | Bacteria | 109937 |
| 804 | Ga0265325_10000258 | 3300031241 | Bacteria | 37821 |
| 805 | Ga0265325_10008677 | 3300031241 | Bacteria | 5982 |
| 806 | Ga0265325_10008781 | 3300031241 | Bacteria | 5941 |
| 807 | Ga0265325_10016270 | 3300031241 | Bacteria | 4160 |
| 808 | Ga0265325_10103956 | 3300031241 | Bacteria | 1387 |
| 809 | Ga0265340_10104016 | 3300031247 | Bacteria | 1317 |
| 810 | Ga0265339_10000165 | 3300031249 | Bacteria | 55381 |
| 811 | Ga0265339_10003955 | 3300031249 | Bacteria | 10246 |
| 812 | Ga0265331_10006990 | 3300031250 | Bacteria | 6589 |
| 813 | Ga0265331_10040370 | 3300031250 | Bacteria | 2270 |
| 814 | Ga0265331_10137524 | 3300031250 | Bacteria | 1112 |
| 815 | Ga0265327_10073180 | 3300031251 | Bacteria | 1710 |
| 816 | Ga0265316_10065041 | 3300031344 | Bacteria | 2824 |
| 817 | Ga0265316_10082669 | 3300031344 | Bacteria | 2460 |
| 818 | Ga0265316_10108823 | 3300031344 | Bacteria | 2101 |
| 819 | Ga0265316_10290501 | 3300031344 | Bacteria | 1193 |
| 820 | Ga0307513_10007727 | 3300031456 | Bacteria | 13883 |
| 821 | Ga0307513_10011033 | 3300031456 | Bacteria | 11270 |
| 822 | Ga0307513_10046515 | 3300031456 | Bacteria | 4729 |
| 823 | Ga0307513_10077565 | 3300031456 | Bacteria | 3440 |
| 824 | Ga0307513_10275792 | 3300031456 | Bacteria | 1462 |
| 825 | Ga0307513_10289529 | 3300031456 | Bacteria | 1410 |
| 826 | Ga0307509_10028152 | 3300031507 | Bacteria | 6249 |
| 827 | Ga0307509_10057042 | 3300031507 | Bacteria | 4143 |
| 828 | Ga0307509_10171889 | 3300031507 | Bacteria | 2044 |
| 829 | Ga0307408_100009496 | 3300031548 | Bacteria | 6417 |
| 830 | Ga0307408_100048329 | 3300031548 | Bacteria | 3051 |
| 831 | Ga0307408_100196147 | 3300031548 | Bacteria | 1630 |
| 832 | Ga0307408_100244608 | 3300031548 | Bacteria | 1476 |
| 833 | Ga0265313_10000072 | 3300031595 | Bacteria | 98635 |
| 834 | Ga0265313_10000300 | 3300031595 | Bacteria | 53631 |
| 835 | Ga0265313_10013430 | 3300031595 | Bacteria | 4916 |
| 836 | Ga0265313_10024597 | 3300031595 | Bacteria | 3213 |
| 837 | Ga0307508_10000248 | 3300031616 | Bacteria | 65511 |
| 838 | Ga0307508_10058543 | 3300031616 | Bacteria | 3408 |
| 839 | Ga0307514_10000890 | 3300031649 | Bacteria | 46600 |
| 840 | Ga0307514_10020138 | 3300031649 | Bacteria | 5448 |
| 841 | Ga0265314_10002865 | 3300031711 | Bacteria | 17158 |
| 842 | Ga0265314_10002886 | 3300031711 | Bacteria | 17071 |
| 843 | Ga0265314_10039095 | 3300031711 | Bacteria | 3421 |
| 844 | Ga0265342_10000082 | 3300031712 | Bacteria | 102532 |
| 845 | Ga0265342_10000291 | 3300031712 | Bacteria | 56828 |
| 846 | Ga0265342_10063168 | 3300031712 | Bacteria | 2177 |
| 847 | Ga0316576_10021360 | 3300031727 | Bacteria | 4476 |
| 848 | Ga0316578_10070369 | 3300031728 | Bacteria | 2071 |
| 849 | Ga0307516_10367075 | 3300031730 | Bacteria | 1103 |
| 850 | Ga0307405_10156598 | 3300031731 | Bacteria | 1608 |
| 851 | Ga0307405_10252338 | 3300031731 | Bacteria | 1313 |
| 852 | Ga0307405_10602380 | 3300031731 | Bacteria | 897 |
| 853 | Ga0307410_10197495 | 3300031852 | Bacteria | 1534 |
| 854 | Ga0307406_10001484 | 3300031901 | Bacteria | 12954 |
| 855 | Ga0307406_10049376 | 3300031901 | Bacteria | 2662 |
| 856 | Ga0307412_10311318 | 3300031911 | Bacteria | 1249 |
| 857 | Ga0307412_10780538 | 3300031911 | Bacteria | 827 |
| 858 | Ga0307416_100182306 | 3300032002 | Bacteria | 1969 |
| 859 | Ga0307416_100663617 | 3300032002 | Bacteria | 1129 |
| 860 | Ga0307416_100741787 | 3300032002 | Bacteria | 1074 |
| 861 | Ga0307507_10023773 | 3300033179 | Bacteria | 6708 |
| 862 | Ga0307507_10051930 | 3300033179 | Bacteria | 3939 |
| 863 | Ga0307507_10115233 | 3300033179 | Bacteria | 2176 |
| 864 | Ga0307507_10151277 | 3300033179 | Bacteria | 1745 |
| 865 | Ga0373930_0001137 | 3300034816 | Bacteria | 3874 |
| 866 | Ga0373930_0017644 | 3300034816 | Bacteria | 1363 |
| 867 | Ga0373948_0000530 | 3300034817 | Bacteria | 4783 |
| 868 | Ga0373950_0001280 | 3300034818 | Bacteria | 3254 |
| 869 | Ga0373958_0000935 | 3300034819 | Bacteria | 3771 |
| 870 | Ga0373959_0002074 | 3300034820 | Bacteria | 3196 |
| 871 | Ga0373959_0002994 | 3300034820 | Bacteria | 2686 |
| 872 | Ga0373959_0033674 | 3300034820 | Bacteria | 1046 |
| 873 | Ga0373938_0000237 | 3300034957 | Bacteria | 8612 |
| 874 | Ga0373938_0001173 | 3300034957 | Bacteria | 4225 |
| 875 | Ga0373938_0001763 | 3300034957 | Bacteria | 3453 |
| 876 | Ga0373926_0013479 | 3300035083 | Bacteria | 2774 |
| 877 | Ga0373928_0000547 | 3300035084 | Bacteria | 7337 |
| 878 | Ga0373928_0006668 | 3300035084 | Bacteria | 2221 |
| 879 | Ga0373929_0000699 | 3300035085 | Bacteria | 6489 |
| 880 | Ga0373929_0005610 | 3300035085 | Bacteria | 2263 |
| 881 | Ga0373929_0008455 | 3300035085 | Bacteria | 1897 |
| 882 | Ga0373934_0005867 | 3300035086 | Bacteria | 4545 |
| 883 | Ga0373934_0067237 | 3300035086 | Bacteria | 1431 |
| 884 | Ga0373940_0001972 | 3300035088 | Bacteria | 3877 |
| 885 | Ga0373940_0100003 | 3300035088 | Bacteria | 879 |
| 886 | Ga0373944_0025022 | 3300035089 | Bacteria | 1755 |
| 887 | Ga0373949_0002043 | 3300035090 | Bacteria | 5344 |
| 888 | Ga0373949_0003337 | 3300035090 | Bacteria | 3853 |
| 889 | Ga0373951_0003295 | 3300035091 | Bacteria | 3949 |
| 890 | Ga0373951_0007696 | 3300035091 | Bacteria | 2446 |
| 891 | Ga0373952_0000858 | 3300035092 | Bacteria | 5523 |
| 892 | Ga0373952_0008149 | 3300035092 | Bacteria | 1982 |
| 893 | Ga0373923_0001865 | 3300035111 | Bacteria | 6270 |
| 894 | Ga0373923_0002073 | 3300035111 | Bacteria | 6062 |
| 895 | Ga0373923_0032951 | 3300035111 | Bacteria | 2096 |
| 896 | Ga0373932_0003430 | 3300035112 | Bacteria | 3812 |
| 897 | Ga0373936_0008179 | 3300035113 | Bacteria | 3932 |
| 898 | Ga0373936_0043737 | 3300035113 | Bacteria | 1801 |
| 899 | Ga0373936_0046394 | 3300035113 | Bacteria | 1752 |
| 900 | Ga0373936_0048530 | 3300035113 | Bacteria | 1714 |
| 901 | Ga0373936_0071413 | 3300035113 | Bacteria | 1431 |
| 902 | Ga0373939_0002937 | 3300035114 | Bacteria | 4007 |
| 903 | Ga0373939_0006052 | 3300035114 | Bacteria | 2904 |
| 904 | Ga0373941_0015410 | 3300035115 | Bacteria | 2061 |
| 905 | Ga0373945_0009515 | 3300035116 | Bacteria | 3186 |
| 906 | Ga0373945_0022704 | 3300035116 | Bacteria | 2163 |
| 907 | Ga0373945_0106128 | 3300035116 | Bacteria | 1104 |
| 908 | Ga0373945_0127372 | 3300035116 | Bacteria | 1017 |
| 909 | Ga0373953_0000963 | 3300035117 | Bacteria | 8054 |
| 910 | Ga0373953_0025962 | 3300035117 | Bacteria | 2242 |
| 911 | Ga0373954_0000012 | 3300035118 | Bacteria | 73616 |
| 912 | Ga0373954_0001647 | 3300035118 | Bacteria | 9138 |
| 913 | Ga0373954_0006896 | 3300035118 | Bacteria | 4959 |
| 914 | Ga0373954_0015121 | 3300035118 | Bacteria | 3448 |
| 915 | Ga0373954_0029687 | 3300035118 | Bacteria | 2519 |
| 916 | Ga0373954_0058374 | 3300035118 | Bacteria | 1818 |
| 917 | Ga0373954_0207291 | 3300035118 | Bacteria | 963 |
| 918 | Ga0373956_0000080 | 3300035119 | Bacteria | 31907 |
| 919 | Ga0373956_0010369 | 3300035119 | Bacteria | 3818 |
| 920 | Ga0373956_0019862 | 3300035119 | Bacteria | 2852 |
| 921 | Ga0373956_0033838 | 3300035119 | Bacteria | 2249 |
| 922 | Ga0373956_0048845 | 3300035119 | Bacteria | 1896 |
| 923 | Ga0373956_0084062 | 3300035119 | Bacteria | 1463 |
| 924 | Ga0373957_0013058 | 3300035120 | Bacteria | 2810 |
| 925 | Ga0373957_0020035 | 3300035120 | Bacteria | 2360 |
| 926 | Ga0373957_0024477 | 3300035120 | Bacteria | 2168 |
| 927 | Ga0373960_0003754 | 3300035121 | Bacteria | 3451 |
| 928 | Ga0373960_0006948 | 3300035121 | Bacteria | 2668 |
| 929 | Ga0373943_0000525 | 3300035170 | Bacteria | 16583 |
| 930 | Ga0373943_0032108 | 3300035170 | Bacteria | 2494 |
| 931 | Ga0373946_0003308 | 3300035171 | Bacteria | 5723 |
| 932 | Ga0373946_0007183 | 3300035171 | Bacteria | 4068 |
| 933 | Ga0373946_0012822 | 3300035171 | Bacteria | 3143 |
| 934 | Ga0373946_0029824 | 3300035171 | Bacteria | 2174 |
| 935 | Ga0373946_0066484 | 3300035171 | Bacteria | 1546 |
| 936 | Ga0373946_0190897 | 3300035171 | Bacteria | 977 |
| 937 | Ga0373955_0006219 | 3300035172 | Bacteria | 5431 |
| 938 | Ga0373955_0009768 | 3300035172 | Bacteria | 4508 |
| 939 | Ga0373955_0043040 | 3300035172 | Bacteria | 2428 |
| 940 | Ga0373955_0060816 | 3300035172 | Bacteria | 2084 |
| 941 | Ga0373955_0088264 | 3300035172 | Bacteria | 1763 |
| 942 | Ga0373955_0165691 | 3300035172 | Bacteria | 1306 |
| 943 | Ga0373942_0004844 | 3300035207 | Bacteria | 3125 |
| 944 | Ga0373942_0011363 | 3300035207 | Bacteria | 2110 |
| 945 | Ga0373961_0006553 | 3300035241 | Bacteria | 2796 |
| 946 | Ga0373961_0012233 | 3300035241 | Bacteria | 2145 |
| 947 | Ga0373961_0015940 | 3300035241 | Bacteria | 1930 |
| 948 | Ga0373961_0018134 | 3300035241 | Bacteria | 1835 |
| 949 | Ga0373961_0055458 | 3300035241 | Bacteria | 1187 |
| 950 | Ga0373962_0005838 | 3300035242 | Bacteria | 2971 |
| 951 | Ga0373962_0012645 | 3300035242 | Bacteria | 2130 |
| 952 | Ga0373924_0002930 | 3300035410 | Bacteria | 5792 |
| 953 | Ga0373924_0007061 | 3300035410 | Bacteria | 4043 |
| 954 | Ga0373924_0027762 | 3300035410 | Bacteria | 2252 |
| 955 | Ga0373924_0029209 | 3300035410 | Bacteria | 2203 |
| 956 | Ga0373924_0032775 | 3300035410 | Bacteria | 2094 |
| 957 | Ga0373924_0103106 | 3300035410 | Bacteria | 1228 |
| 958 | Ga0373924_0126870 | 3300035410 | Bacteria | 1109 |
| 959 | Ga0373931_0004454 | 3300035691 | Bacteria | 6400 |
| 960 | Ga0373931_0022581 | 3300035691 | Bacteria | 3168 |
| 961 | Ga0373931_0041907 | 3300035691 | Bacteria | 2406 |
| 962 | Ga0373931_0092532 | 3300035691 | Bacteria | 1687 |
| 963 | Ga0373931_0154193 | 3300035691 | Bacteria | 1341 |
| 964 | Ga0373931_0247137 | 3300035691 | Bacteria | 1083 |
| 965 | Ga0373935_0000086 | 3300035692 | Bacteria | 40589 |
| 966 | Ga0373935_0001093 | 3300035692 | Bacteria | 14823 |
| 967 | Ga0373935_0008051 | 3300035692 | Bacteria | 6319 |
| 968 | Ga0373935_0074146 | 3300035692 | Bacteria | 2199 |
| 969 | Ga0373935_0107985 | 3300035692 | Bacteria | 1843 |
| 970 | Ga0373935_0330396 | 3300035692 | Bacteria | 1083 |
| 971 | Ga0373927_0002359 | 3300035695 | Bacteria | 13770 |
| 972 | Ga0373927_0004290 | 3300035695 | Bacteria | 10007 |
| 973 | Ga0373927_0015519 | 3300035695 | Bacteria | 5031 |
| 974 | Ga0373927_0026329 | 3300035695 | Bacteria | 3800 |
| 975 | Ga0373927_0034659 | 3300035695 | Bacteria | 3282 |
| 976 | Ga0373927_0048502 | 3300035695 | Bacteria | 2747 |
| 977 | Ga0373933_0000373 | 3300035724 | Bacteria | 28708 |
| 978 | Ga0373933_0000862 | 3300035724 | Bacteria | 18590 |
| 979 | Ga0373933_0001549 | 3300035724 | Bacteria | 13464 |
| 980 | Ga0373933_0005461 | 3300035724 | Bacteria | 6922 |
| 981 | Ga0373933_0037862 | 3300035724 | Bacteria | 2832 |
| 982 | Ga0373933_0052171 | 3300035724 | Bacteria | 2446 |
| 983 | Ga0373933_0092684 | 3300035724 | Bacteria | 1866 |
| 984 | Ga0373933_0100035 | 3300035724 | Bacteria | 1798 |
| 985 | Ga0373933_0155419 | 3300035724 | Bacteria | 1450 |
| 986 | Ga0373947_0000096 | 3300035725 | Bacteria | 44841 |
| 987 | Ga0373947_0000288 | 3300035725 | Bacteria | 28482 |
| 988 | Ga0373947_0000837 | 3300035725 | Bacteria | 18592 |
| 989 | Ga0373947_0020805 | 3300035725 | Bacteria | 3792 |
| 990 | Ga0373947_0042688 | 3300035725 | Bacteria | 2707 |
| 991 | Ga0373947_0094304 | 3300035725 | Bacteria | 1871 |
| 992 | Ga0373937_0000198 | 3300036401 | Bacteria | 59112 |
| 993 | Ga0373937_0000996 | 3300036401 | Bacteria | 24045 |
| 994 | Ga0373937_0001196 | 3300036401 | Bacteria | 21800 |
| 995 | Ga0373937_0002420 | 3300036401 | Bacteria | 15516 |
| 996 | Ga0373937_0004708 | 3300036401 | Bacteria | 11605 |
| 997 | Ga0373937_0012002 | 3300036401 | Bacteria | 7606 |
| 998 | Ga0373937_0016752 | 3300036401 | Bacteria | 6514 |
| 999 | Ga0373937_0062971 | 3300036401 | Bacteria | 3410 |
| 1000 | Ga0373937_0085628 | 3300036401 | Bacteria | 2916 |
| 1001 | Ga0316584_0039976 | 3300036712 | Bacteria | 3494 |
| 1002 | Ga0373925_0000071 | 3300037068 | Bacteria | 106825 |
| 1003 | Ga0373925_0005184 | 3300037068 | Bacteria | 9753 |
| 1004 | Ga0373925_0025094 | 3300037068 | Bacteria | 4353 |
| 1005 | Ga0373925_0039484 | 3300037068 | Bacteria | 3491 |
| 1006 | Ga0373925_0078281 | 3300037068 | Bacteria | 2511 |
| 1007 | Ga0373925_0128987 | 3300037068 | Bacteria | 1970 |
| 1008 | Ga0373925_0151336 | 3300037068 | Bacteria | 1822 |
| 1009 | Ga0373925_0195558 | 3300037068 | Bacteria | 1606 |
| 1010 | Ga0395899_0045204 | 3300037312 | Bacteria | 3281 |
| 1011 | Ga0395900_0005355 | 3300037418 | Bacteria | 13446 |
| 1012 | Ga0395900_0009172 | 3300037418 | Bacteria | 10138 |
| 1013 | Ga0395900_0023179 | 3300037418 | Bacteria | 6354 |
| 1014 | Ga0395900_0030518 | 3300037418 | Bacteria | 5535 |
| 1015 | Ga0395900_0030673 | 3300037418 | Bacteria | 5520 |
| 1016 | Ga0395900_0385494 | 3300037418 | Bacteria | 1369 |
| 1017 | Ga0395898_0025102 | 3300037466 | Bacteria | 6009 |
| 1018 | Ga0395898_0039335 | 3300037466 | Bacteria | 4681 |
| 1019 | Ga0395898_0098632 | 3300037466 | Bacteria | 2805 |
| 1020 | Ga0395898_0110477 | 3300037466 | Bacteria | 2635 |
| 1021 | Ga0395905_0007343 | 3300037471 | Bacteria | 10975 |
| 1022 | Ga0395905_0019208 | 3300037471 | Bacteria | 6481 |
| 1023 | Ga0395905_0107527 | 3300037471 | Bacteria | 2619 |
| 1024 | Ga0436364_0143743 | 3300037853 | Bacteria | 23977 |
| 1025 | Ga0436364_1405230 | 3300037853 | Bacteria | 14749 |
| 1026 | Ga0395901_0004298 | 3300038443 | Bacteria | 14368 |
| 1027 | Ga0395901_0111770 | 3300038443 | Bacteria | 2869 |
| 1028 | Ga0395901_0169640 | 3300038443 | Bacteria | 2290 |
| 1029 | Ga0242420_001963 | 3300038996 | Bacteria | 2859 |
| 1030 | Ga0436365_1178757 | 3300039437 | Bacteria | 823 |
| 1031 | Ga0436365_1584283 | 3300039437 | Bacteria | 16431 |
| 1032 | Ga0436360_1218633 | 3300039438 | Bacteria | 2178 |
| 1033 | Ga0436361_0066245 | 3300039447 | Bacteria | 38634 |
| 1034 | Ga0436362_0484821 | 3300039453 | Bacteria | 1804 |
| 1035 | Ga0439436_0000775 | 3300041404 | Bacteria | 8654 |
| 1036 | Ga0439436_0043605 | 3300041404 | Bacteria | 1279 |
| 1037 | Ga0439438_000172 | 3300041405 | Bacteria | 28804 |
| 1038 | Ga0439439_0006506 | 3300041406 | Bacteria | 2704 |
| 1039 | Ga0439447_036061 | 3300041407 | Bacteria | 1223 |
| 1040 | Ga0439447_043930 | 3300041407 | Bacteria | 1082 |
| 1041 | Ga0439461_0002041 | 3300041410 | Bacteria | 3193 |
| 1042 | Ga0439466_0000919 | 3300041411 | Bacteria | 11259 |
| 1043 | Ga0439466_0052802 | 3300041411 | Bacteria | 1328 |
| 1044 | Ga0439465_0001472 | 3300041413 | Bacteria | 7631 |
| 1045 | Ga0439431_0000651 | 3300041997 | Bacteria | 7389 |
| 1046 | Ga0439442_005663 | 3300042002 | Bacteria | 2500 |
| 1047 | Ga0439445_0000311 | 3300042004 | Bacteria | 9444 |
| 1048 | Ga0439432_000634 | 3300042006 | Bacteria | 13192 |
| 1049 | Ga0439432_000839 | 3300042006 | Bacteria | 11492 |
| 1050 | Ga0439432_048569 | 3300042006 | Bacteria | 1329 |
| 1051 | Ga0439449_0001169 | 3300042007 | Bacteria | 10300 |
| 1052 | Ga0439449_0071617 | 3300042007 | Bacteria | 1277 |
| 1053 | Ga0439452_007246 | 3300042010 | Bacteria | 3410 |
| 1054 | Ga0439452_014273 | 3300042010 | Bacteria | 2210 |
| 1055 | Ga0439457_006925 | 3300042014 | Bacteria | 2742 |
| 1056 | Ga0439462_0000245 | 3300042015 | Bacteria | 9690 |
| 1057 | Ga0439463_009804 | 3300042016 | Bacteria | 2353 |
| 1058 | Ga0450906_008920 | 3300042145 | Bacteria | 1925 |
| 1059 | Ga0439446_0000318 | 3300042156 | Bacteria | 9223 |
| 1060 | Ga0439446_0000836 | 3300042156 | Bacteria | 6584 |
| 1061 | Ga0439434_0000294 | 3300042435 | Bacteria | 14301 |
| 1062 | Ga0439434_0008498 | 3300042435 | Bacteria | 3010 |
| 1063 | Ga0439434_0102640 | 3300042435 | Bacteria | 922 |
| 1064 | Ga0439435_0000060 | 3300042436 | Bacteria | 12857 |
| 1065 | Ga0450916_020341 | 3300042530 | Bacteria | 907 |
| 1066 | Ga0450893_0012840 | 3300042532 | Bacteria | 1393 |
| 1067 | Ga0466965_0019810 | 3300044683 | Bacteria | 3231 |
| 1068 | Ga0466966_0053889 | 3300044684 | Bacteria | 2551 |
| 1069 | Ga0466963_0103318 | 3300044694 | Bacteria | 1952 |
| 1070 | Ga0466963_0169674 | 3300044694 | Bacteria | 1521 |
| 1071 | Ga0466964_0022269 | 3300044706 | Bacteria | 2457 |
| 1072 | Ga0453684_0389327 | 3300044712 | Bacteria | 1564 |
| 1073 | Ga0466971_0110042 | 3300044719 | Bacteria | 1271 |
| 1074 | Ga0466957_0151547 | 3300044842 | Bacteria | 1500 |
| 1075 | Ga0466957_0198811 | 3300044842 | Bacteria | 1316 |
| 1076 | Ga0466959_0153079 | 3300045049 | Bacteria | 1624 |
| 1077 | Ga0466959_0181286 | 3300045049 | Bacteria | 1473 |
| 1078 | Ga0466958_0019850 | 3300045836 | Bacteria | 3915 |
| 1079 | Ga0466967_0002811 | 3300045976 | Bacteria | 11040 |
| 1080 | Ga0466967_0008390 | 3300045976 | Bacteria | 7562 |
| 1081 | Ga0466967_0309468 | 3300045976 | Bacteria | 1521 |
| 1082 | Ga0466967_0677743 | 3300045976 | Bacteria | 1020 |
| 1083 | Ga0495617_025618 | 3300046452 | Bacteria | 1988 |
| 1084 | Ga0495617_043193 | 3300046452 | Bacteria | 1504 |
| 1085 | Ga0495627_005899 | 3300046453 | Bacteria | 4868 |
| 1086 | Ga0495592_0000117 | 3300046454 | Bacteria | 69975 |
| 1087 | Ga0495592_0023908 | 3300046454 | Bacteria | 4648 |
| 1088 | Ga0495592_0031275 | 3300046454 | Bacteria | 4023 |
| 1089 | Ga0495592_0031460 | 3300046454 | Bacteria | 4010 |
| 1090 | Ga0495592_0074670 | 3300046454 | Bacteria | 2463 |
| 1091 | Ga0495592_0089572 | 3300046454 | Bacteria | 2209 |
| 1092 | Ga0495592_0173566 | 3300046454 | Bacteria | 1474 |
| 1093 | Ga0495592_0184893 | 3300046454 | Bacteria | 1417 |
| 1094 | Ga0495592_0243356 | 3300046454 | Bacteria | 1192 |
| 1095 | Ga0495592_0291141 | 3300046454 | Bacteria | 1064 |
| 1096 | Ga0495603_0008338 | 3300046455 | Bacteria | 6265 |
| 1097 | Ga0495603_0028846 | 3300046455 | Bacteria | 3348 |
| 1098 | Ga0495603_0237029 | 3300046455 | Bacteria | 1051 |
| 1099 | Ga0495591_000635 | 3300046458 | Bacteria | 26048 |
| 1100 | Ga0495629_0000183 | 3300046459 | Bacteria | 56534 |
| 1101 | Ga0495629_0008700 | 3300046459 | Bacteria | 7470 |
| 1102 | Ga0495629_0010435 | 3300046459 | Bacteria | 6758 |
| 1103 | Ga0495629_0022122 | 3300046459 | Bacteria | 4533 |
| 1104 | Ga0495638_0001364 | 3300046460 | Bacteria | 22407 |
| 1105 | Ga0495638_0019805 | 3300046460 | Bacteria | 4448 |
| 1106 | Ga0495638_0044966 | 3300046460 | Bacteria | 2780 |
| 1107 | Ga0495638_0149314 | 3300046460 | Bacteria | 1357 |
| 1108 | Ga0495641_0014858 | 3300046461 | Bacteria | 4193 |
| 1109 | Ga0495641_0024360 | 3300046461 | Bacteria | 2989 |
| 1110 | Ga0495641_0048412 | 3300046461 | Bacteria | 1949 |
| 1111 | Ga0495641_0062845 | 3300046461 | Bacteria | 1674 |
| 1112 | Ga0495651_0000370 | 3300046462 | Bacteria | 34672 |
| 1113 | Ga0495651_0000814 | 3300046462 | Bacteria | 24156 |
| 1114 | Ga0495651_0002238 | 3300046462 | Bacteria | 14939 |
| 1115 | Ga0495651_0006676 | 3300046462 | Bacteria | 8825 |
| 1116 | Ga0495651_0007700 | 3300046462 | Bacteria | 8237 |
| 1117 | Ga0495651_0009079 | 3300046462 | Bacteria | 7631 |
| 1118 | Ga0495651_0018701 | 3300046462 | Bacteria | 5368 |
| 1119 | Ga0495651_0080495 | 3300046462 | Bacteria | 2460 |
| 1120 | Ga0495651_0106382 | 3300046462 | Bacteria | 2080 |
| 1121 | Ga0495651_0132388 | 3300046462 | Bacteria | 1819 |
| 1122 | Ga0495653_0000047 | 3300046463 | Bacteria | 111093 |
| 1123 | Ga0495653_0005190 | 3300046463 | Bacteria | 10590 |
| 1124 | Ga0495653_0007193 | 3300046463 | Bacteria | 9123 |
| 1125 | Ga0495653_0010604 | 3300046463 | Bacteria | 7545 |
| 1126 | Ga0495653_0096770 | 3300046463 | Bacteria | 2146 |
| 1127 | Ga0495650_0001103 | 3300046471 | Bacteria | 29585 |
| 1128 | Ga0495650_0001463 | 3300046471 | Bacteria | 22653 |
| 1129 | Ga0495650_0094670 | 3300046471 | Bacteria | 1130 |
| 1130 | Ga0495580_0007138 | 3300046472 | Bacteria | 8997 |
| 1131 | Ga0495580_0025075 | 3300046472 | Bacteria | 4359 |
| 1132 | Ga0495580_0070025 | 3300046472 | Bacteria | 2450 |
| 1133 | Ga0495580_0154976 | 3300046472 | Unclassified | 1586 |
| 1134 | Ga0495580_0188929 | 3300046472 | Bacteria | 1421 |
| 1135 | Ga0495582_0001121 | 3300046473 | Bacteria | 15057 |
| 1136 | Ga0495582_0024945 | 3300046473 | Bacteria | 3274 |
| 1137 | Ga0495582_0223304 | 3300046473 | Bacteria | 1078 |
| 1138 | Ga0495605_0000704 | 3300046474 | Bacteria | 24856 |
| 1139 | Ga0495639_0050356 | 3300046475 | Bacteria | 1892 |
| 1140 | Ga0495639_0196011 | 3300046475 | Bacteria | 987 |
| 1141 | Ga0495662_0005350 | 3300046476 | Bacteria | 6428 |
| 1142 | Ga0495662_0006315 | 3300046476 | Bacteria | 5925 |
| 1143 | Ga0495662_0010112 | 3300046476 | Bacteria | 4626 |
| 1144 | Ga0495662_0014982 | 3300046476 | Bacteria | 3766 |
| 1145 | Ga0495662_0030200 | 3300046476 | Bacteria | 2616 |
| 1146 | Ga0495662_0044862 | 3300046476 | Bacteria | 2134 |
| 1147 | Ga0495662_0151810 | 3300046476 | Bacteria | 1141 |
| 1148 | Ga0495662_0198283 | 3300046476 | Bacteria | 990 |
| 1149 | Ga0495664_0000024 | 3300046477 | Bacteria | 126593 |
| 1150 | Ga0495664_0005136 | 3300046477 | Bacteria | 7182 |
| 1151 | Ga0495664_0057217 | 3300046477 | Bacteria | 2319 |
| 1152 | Ga0495584_0010326 | 3300046491 | Bacteria | 4799 |
| 1153 | Ga0495584_0063845 | 3300046491 | Bacteria | 1851 |
| 1154 | Ga0495585_0003428 | 3300046492 | Bacteria | 10719 |
| 1155 | Ga0495585_0117879 | 3300046492 | Bacteria | 1406 |
| 1156 | Ga0495594_0005327 | 3300046499 | Bacteria | 6605 |
| 1157 | Ga0495596_0000234 | 3300046500 | Bacteria | 37677 |
| 1158 | Ga0495596_0000399 | 3300046500 | Bacteria | 27679 |
| 1159 | Ga0495596_0000473 | 3300046500 | Bacteria | 25450 |
| 1160 | Ga0495607_0003341 | 3300046501 | Bacteria | 12309 |
| 1161 | Ga0495607_0005354 | 3300046501 | Bacteria | 9219 |
| 1162 | Ga0495607_0005459 | 3300046501 | Bacteria | 9094 |
| 1163 | Ga0495607_0009340 | 3300046501 | Bacteria | 6643 |
| 1164 | Ga0495583_0000330 | 3300046506 | Bacteria | 74846 |
| 1165 | Ga0495606_0000028 | 3300046507 | Bacteria | 251032 |
| 1166 | Ga0495608_0000004 | 3300046511 | Bacteria | 355027 |
| 1167 | Ga0495608_0002221 | 3300046511 | Bacteria | 14008 |
| 1168 | Ga0495608_0005426 | 3300046511 | Bacteria | 9120 |
| 1169 | Ga0495608_0006145 | 3300046511 | Bacteria | 8524 |
| 1170 | Ga0495608_0015766 | 3300046511 | Bacteria | 5230 |
| 1171 | Ga0495608_0074903 | 3300046511 | Bacteria | 2206 |
| 1172 | Ga0495608_0270471 | 3300046511 | Bacteria | 1056 |
| 1173 | Ga0495610_0001083 | 3300046512 | Bacteria | 24897 |
| 1174 | Ga0495610_0011354 | 3300046512 | Bacteria | 5454 |
| 1175 | Ga0495616_0003188 | 3300046513 | Bacteria | 10576 |
| 1176 | Ga0495616_0005373 | 3300046513 | Bacteria | 7902 |
| 1177 | Ga0495616_0008254 | 3300046513 | Bacteria | 6179 |
| 1178 | Ga0495616_0010366 | 3300046513 | Bacteria | 5399 |
| 1179 | Ga0495618_0000036 | 3300046514 | Bacteria | 101535 |
| 1180 | Ga0495618_0007467 | 3300046514 | Bacteria | 6611 |
| 1181 | Ga0495618_0010775 | 3300046514 | Bacteria | 5536 |
| 1182 | Ga0495618_0013409 | 3300046514 | Bacteria | 4987 |
| 1183 | Ga0495618_0022634 | 3300046514 | Bacteria | 3882 |
| 1184 | Ga0495618_0032170 | 3300046514 | Bacteria | 3285 |
| 1185 | Ga0495618_0051200 | 3300046514 | Bacteria | 2609 |
| 1186 | Ga0495618_0058548 | 3300046514 | Bacteria | 2440 |
| 1187 | Ga0495618_0089004 | 3300046514 | Bacteria | 1974 |
| 1188 | Ga0495628_0000006 | 3300046516 | Bacteria | 306606 |
| 1189 | Ga0495628_0000950 | 3300046516 | Bacteria | 26607 |
| 1190 | Ga0495628_0011003 | 3300046516 | Bacteria | 7661 |
| 1191 | Ga0495628_0021837 | 3300046516 | Bacteria | 5260 |
| 1192 | Ga0495628_0037732 | 3300046516 | Bacteria | 3873 |
| 1193 | Ga0495628_0063284 | 3300046516 | Bacteria | 2899 |
| 1194 | Ga0495628_0084826 | 3300046516 | Bacteria | 2457 |
| 1195 | Ga0495628_0113498 | 3300046516 | Bacteria | 2082 |
| 1196 | Ga0495630_0000647 | 3300046517 | Bacteria | 25227 |
| 1197 | Ga0495630_0000958 | 3300046517 | Bacteria | 20204 |
| 1198 | Ga0495630_0027554 | 3300046517 | Bacteria | 4216 |
| 1199 | Ga0495630_0037719 | 3300046517 | Bacteria | 3614 |
| 1200 | Ga0495630_0053102 | 3300046517 | Bacteria | 3034 |
| 1201 | Ga0495630_0141497 | 3300046517 | Bacteria | 1829 |
| 1202 | Ga0495630_0153683 | 3300046517 | Bacteria | 1751 |
| 1203 | Ga0495631_0000135 | 3300046518 | Bacteria | 50021 |
| 1204 | Ga0495631_0088284 | 3300046518 | Bacteria | 1335 |
| 1205 | Ga0495637_0067592 | 3300046520 | Bacteria | 1450 |
| 1206 | Ga0495644_0000234 | 3300046523 | Bacteria | 26118 |
| 1207 | Ga0495644_0000544 | 3300046523 | Bacteria | 15928 |
| 1208 | Ga0495648_0000454 | 3300046524 | Bacteria | 44377 |
| 1209 | Ga0495648_0000877 | 3300046524 | Bacteria | 31708 |
| 1210 | Ga0495648_0003768 | 3300046524 | Bacteria | 13191 |
| 1211 | Ga0495666_0001961 | 3300046526 | Bacteria | 10144 |
| 1212 | Ga0495666_0038805 | 3300046526 | Bacteria | 2315 |
| 1213 | Ga0495666_0045895 | 3300046526 | Bacteria | 2107 |
| 1214 | Ga0495666_0069489 | 3300046526 | Bacteria | 1675 |
| 1215 | Ga0495642_0053057 | 3300046528 | Bacteria | 1670 |
| 1216 | Ga0495652_0000038 | 3300046529 | Bacteria | 129311 |
| 1217 | Ga0495652_0002257 | 3300046529 | Bacteria | 20113 |
| 1218 | Ga0495652_0005721 | 3300046529 | Bacteria | 11644 |
| 1219 | Ga0495652_0051353 | 3300046529 | Bacteria | 3522 |
| 1220 | Ga0495652_0067574 | 3300046529 | Bacteria | 2996 |
| 1221 | Ga0495652_0098554 | 3300046529 | Bacteria | 2376 |
| 1222 | Ga0495652_0150503 | 3300046529 | Bacteria | 1819 |
| 1223 | Ga0495652_0311965 | 3300046529 | Bacteria | 1139 |
| 1224 | Ga0495654_0000458 | 3300046530 | Bacteria | 34120 |
| 1225 | Ga0495665_0000503 | 3300046531 | Bacteria | 19683 |
| 1226 | Ga0495665_0065933 | 3300046531 | Bacteria | 1911 |
| 1227 | Ga0495665_0171539 | 3300046531 | Bacteria | 1129 |
| 1228 | Ga0495665_0263839 | 3300046531 | Bacteria | 885 |
| 1229 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 1230 | Ga0495640_0007495 | 3300046533 | Bacteria | 8573 |
| 1231 | Ga0495640_0009446 | 3300046533 | Bacteria | 7597 |
| 1232 | Ga0495640_0011562 | 3300046533 | Bacteria | 6786 |
| 1233 | Ga0495640_0012982 | 3300046533 | Bacteria | 6347 |
| 1234 | Ga0495640_0018366 | 3300046533 | Bacteria | 5190 |
| 1235 | Ga0495640_0019735 | 3300046533 | Bacteria | 4972 |
| 1236 | Ga0495640_0030156 | 3300046533 | Bacteria | 3886 |
| 1237 | Ga0495640_0065064 | 3300046533 | Bacteria | 2463 |
| 1238 | Ga0495640_0087440 | 3300046533 | Bacteria | 2061 |
| 1239 | Ga0495640_0118754 | 3300046533 | Bacteria | 1721 |
| 1240 | Ga0495586_0003967 | 3300046535 | Bacteria | 7940 |
| 1241 | Ga0495586_0011977 | 3300046535 | Bacteria | 4608 |
| 1242 | Ga0495586_0015139 | 3300046535 | Bacteria | 4104 |
| 1243 | Ga0495586_0078426 | 3300046535 | Bacteria | 1812 |
| 1244 | Ga0495586_0116328 | 3300046535 | Bacteria | 1491 |
| 1245 | Ga0495587_0000004 | 3300046536 | Bacteria | 358433 |
| 1246 | Ga0495587_0002205 | 3300046536 | Bacteria | 13019 |
| 1247 | Ga0495587_0002956 | 3300046536 | Bacteria | 11364 |
| 1248 | Ga0495587_0016926 | 3300046536 | Bacteria | 4535 |
| 1249 | Ga0495587_0044529 | 3300046536 | Bacteria | 2639 |
| 1250 | Ga0495587_0046773 | 3300046536 | Bacteria | 2567 |
| 1251 | Ga0495587_0101778 | 3300046536 | Bacteria | 1654 |
| 1252 | Ga0495587_0227286 | 3300046536 | Bacteria | 1052 |
| 1253 | Ga0495587_0237797 | 3300046536 | Bacteria | 1025 |
| 1254 | Ga0495609_0002139 | 3300046538 | Bacteria | 12423 |
| 1255 | Ga0495609_0003061 | 3300046538 | Bacteria | 9822 |
| 1256 | Ga0495609_0068622 | 3300046538 | Bacteria | 1560 |
| 1257 | Ga0495621_0043543 | 3300046539 | Bacteria | 1584 |
| 1258 | Ga0495621_0051238 | 3300046539 | Bacteria | 1477 |
| 1259 | Ga0495597_0000375 | 3300046542 | Bacteria | 39117 |
| 1260 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 1261 | Ga0495645_0000432 | 3300046543 | Bacteria | 28796 |
| 1262 | Ga0495645_0001487 | 3300046543 | Bacteria | 15879 |
| 1263 | Ga0495645_0008752 | 3300046543 | Bacteria | 7069 |
| 1264 | Ga0495645_0024643 | 3300046543 | Bacteria | 4366 |
| 1265 | Ga0495645_0028082 | 3300046543 | Bacteria | 4088 |
| 1266 | Ga0495645_0105019 | 3300046543 | Bacteria | 2005 |
| 1267 | Ga0495645_0239708 | 3300046543 | Bacteria | 1211 |
| 1268 | Ga0495622_0024244 | 3300046557 | Bacteria | 2833 |
| 1269 | Ga0495622_0027655 | 3300046557 | Bacteria | 2647 |
| 1270 | Ga0495622_0076085 | 3300046557 | Bacteria | 1547 |
| 1271 | Ga0495633_0002799 | 3300046558 | Bacteria | 12057 |
| 1272 | Ga0495633_0005806 | 3300046558 | Bacteria | 7447 |
| 1273 | Ga0495667_0000093 | 3300046559 | Bacteria | 65066 |
| 1274 | Ga0495667_0001799 | 3300046559 | Bacteria | 14228 |
| 1275 | Ga0495667_0008800 | 3300046559 | Bacteria | 6864 |
| 1276 | Ga0495667_0010769 | 3300046559 | Bacteria | 6183 |
| 1277 | Ga0495667_0026230 | 3300046559 | Bacteria | 3926 |
| 1278 | Ga0495667_0029736 | 3300046559 | Bacteria | 3677 |
| 1279 | Ga0495667_0067176 | 3300046559 | Bacteria | 2343 |
| 1280 | Ga0495667_0130871 | 3300046559 | Bacteria | 1618 |
| 1281 | Ga0495667_0256305 | 3300046559 | Bacteria | 1113 |
| 1282 | Ga0495656_0000174 | 3300046615 | Bacteria | 22784 |
| 1283 | Ga0495656_0002877 | 3300046615 | Bacteria | 5766 |
| 1284 | Ga0495668_0001029 | 3300046616 | Bacteria | 29567 |
| 1285 | Ga0495668_0007077 | 3300046616 | Bacteria | 7223 |
| 1286 | Ga0495634_0000133 | 3300046642 | Bacteria | 64326 |
| 1287 | Ga0495634_0004412 | 3300046642 | Bacteria | 11057 |
| 1288 | Ga0495634_0014033 | 3300046642 | Bacteria | 5786 |
| 1289 | Ga0495634_0016098 | 3300046642 | Bacteria | 5352 |
| 1290 | Ga0495634_0033066 | 3300046642 | Bacteria | 3555 |
| 1291 | Ga0495634_0034169 | 3300046642 | Bacteria | 3489 |
| 1292 | Ga0495634_0035265 | 3300046642 | Bacteria | 3428 |
| 1293 | Ga0495634_0114725 | 3300046642 | Bacteria | 1729 |
| 1294 | Ga0495634_0206571 | 3300046642 | Bacteria | 1217 |
| 1295 | Ga0495634_0326107 | 3300046642 | Bacteria | 923 |
| 1296 | Ga0495611_0001362 | 3300046648 | Bacteria | 12296 |
| 1297 | Ga0495611_0023408 | 3300046648 | Bacteria | 2680 |
| 1298 | Ga0495625_0003687 | 3300046660 | Bacteria | 14983 |
| 1299 | Ga0495625_0150502 | 3300046660 | Bacteria | 1565 |
| 1300 | Ga0495635_0000003 | 3300046663 | Bacteria | 390055 |
| 1301 | Ga0495635_0000646 | 3300046663 | Bacteria | 22393 |
| 1302 | Ga0495635_0006494 | 3300046663 | Bacteria | 8155 |
| 1303 | Ga0495635_0034212 | 3300046663 | Bacteria | 3524 |
| 1304 | Ga0495635_0046921 | 3300046663 | Bacteria | 2980 |
| 1305 | Ga0495635_0073971 | 3300046663 | Bacteria | 2334 |
| 1306 | Ga0495635_0105275 | 3300046663 | Bacteria | 1927 |
| 1307 | Ga0495635_0119512 | 3300046663 | Bacteria | 1798 |
| 1308 | Ga0495635_0411470 | 3300046663 | Bacteria | 897 |
| 1309 | Ga0495659_0000220 | 3300046664 | Bacteria | 24427 |
| 1310 | Ga0495659_0000800 | 3300046664 | Bacteria | 11274 |
| 1311 | Ga0495661_0000013 | 3300046665 | Bacteria | 259387 |
| 1312 | Ga0495661_0000842 | 3300046665 | Bacteria | 28593 |
| 1313 | Ga0495661_0009170 | 3300046665 | Bacteria | 6798 |
| 1314 | Ga0495661_0012410 | 3300046665 | Bacteria | 5752 |
| 1315 | Ga0495588_0037137 | 3300046674 | Bacteria | 2474 |
| 1316 | Ga0495657_0000143 | 3300046675 | Bacteria | 64334 |
| 1317 | Ga0495657_0013257 | 3300046675 | Bacteria | 6088 |
| 1318 | Ga0495657_0021999 | 3300046675 | Bacteria | 4571 |
| 1319 | Ga0495657_0047823 | 3300046675 | Bacteria | 2889 |
| 1320 | Ga0495657_0172690 | 3300046675 | Bacteria | 1330 |
| 1321 | Ga0495657_0308428 | 3300046675 | Bacteria | 943 |
| 1322 | Ga0495599_0000012 | 3300046678 | Bacteria | 181156 |
| 1323 | Ga0495599_0004908 | 3300046678 | Bacteria | 7950 |
| 1324 | Ga0495599_0018735 | 3300046678 | Bacteria | 4314 |
| 1325 | Ga0495599_0027283 | 3300046678 | Bacteria | 3579 |
| 1326 | Ga0495599_0075037 | 3300046678 | Bacteria | 2111 |
| 1327 | Ga0495599_0109570 | 3300046678 | Bacteria | 1720 |
| 1328 | Ga0495623_0000015 | 3300046679 | Bacteria | 117329 |
| 1329 | Ga0495623_0001145 | 3300046679 | Bacteria | 17934 |
| 1330 | Ga0495623_0004582 | 3300046679 | Bacteria | 9082 |
| 1331 | Ga0495623_0007637 | 3300046679 | Bacteria | 7025 |
| 1332 | Ga0495623_0058539 | 3300046679 | Bacteria | 2422 |
| 1333 | Ga0495646_0000005 | 3300046680 | Bacteria | 266899 |
| 1334 | Ga0495646_0002872 | 3300046680 | Bacteria | 10666 |
| 1335 | Ga0495646_0006953 | 3300046680 | Bacteria | 7181 |
| 1336 | Ga0495646_0024002 | 3300046680 | Bacteria | 3839 |
| 1337 | Ga0495646_0051560 | 3300046680 | Bacteria | 2490 |
| 1338 | Ga0495646_0082369 | 3300046680 | Bacteria | 1872 |
| 1339 | Ga0495646_0299562 | 3300046680 | Bacteria | 851 |
| 1340 | Ga0495647_0013152 | 3300046681 | Bacteria | 2863 |
| 1341 | Ga0495647_0200982 | 3300046681 | Bacteria | 874 |
| 1342 | Ga0495658_0000357 | 3300046683 | Bacteria | 25736 |
| 1343 | Ga0495658_0009686 | 3300046683 | Bacteria | 4804 |
| 1344 | Ga0495658_0020305 | 3300046683 | Bacteria | 3484 |
| 1345 | Ga0495658_0021749 | 3300046683 | Bacteria | 3385 |
| 1346 | Ga0495658_0064782 | 3300046683 | Bacteria | 2106 |
| 1347 | Ga0495658_0069789 | 3300046683 | Bacteria | 2037 |
| 1348 | Ga0495658_0275730 | 3300046683 | Bacteria | 1060 |
| 1349 | Ga0495613_0002012 | 3300046689 | Bacteria | 15438 |
| 1350 | Ga0495613_0009346 | 3300046689 | Bacteria | 7273 |
| 1351 | Ga0495613_0081586 | 3300046689 | Bacteria | 2349 |
| 1352 | Ga0495613_0143411 | 3300046689 | Bacteria | 1705 |
| 1353 | Ga0495613_0160507 | 3300046689 | Bacteria | 1599 |
| 1354 | Ga0495613_0555356 | 3300046689 | Bacteria | 768 |
| 1355 | Ga0495624_0003776 | 3300046690 | Bacteria | 11191 |
| 1356 | Ga0495624_0024161 | 3300046690 | Bacteria | 4000 |
| 1357 | Ga0495624_0031164 | 3300046690 | Bacteria | 3470 |
| 1358 | Ga0495624_0114792 | 3300046690 | Bacteria | 1655 |
| 1359 | Ga0495624_0234012 | 3300046690 | Bacteria | 1112 |
| 1360 | Ga0495624_0339736 | 3300046690 | Bacteria | 903 |
| 1361 | Ga0495670_0000414 | 3300046691 | Bacteria | 20494 |
| 1362 | Ga0495670_0001448 | 3300046691 | Bacteria | 11602 |
| 1363 | Ga0495671_0001254 | 3300046692 | Bacteria | 17340 |
| 1364 | Ga0495671_0015456 | 3300046692 | Bacteria | 4088 |
| 1365 | Ga0495671_0040031 | 3300046692 | Bacteria | 2365 |
| 1366 | Ga0495671_0169826 | 3300046692 | Bacteria | 1060 |
| 1367 | Ga0495649_0008623 | 3300046694 | Bacteria | 6122 |
| 1368 | Ga0495649_0044452 | 3300046694 | Bacteria | 2425 |
| 1369 | Ga0495589_0035216 | 3300046794 | Bacteria | 2510 |
| 1370 | Ga0495589_0125734 | 3300046794 | Bacteria | 1233 |
| 1371 | Ga0495589_0151085 | 3300046794 | Bacteria | 1109 |
| 1372 | Ga0495600_0000051 | 3300046809 | Bacteria | 69572 |
| 1373 | Ga0495600_0003472 | 3300046809 | Bacteria | 9271 |
| 1374 | Ga0495600_0007486 | 3300046809 | Bacteria | 6681 |
| 1375 | Ga0495600_0019409 | 3300046809 | Bacteria | 4341 |
| 1376 | Ga0495600_0022417 | 3300046809 | Bacteria | 4054 |
| 1377 | Ga0495600_0037657 | 3300046809 | Bacteria | 3145 |
| 1378 | Ga0495600_0190871 | 3300046809 | Bacteria | 1317 |
| 1379 | Ga0495581_0001486 | 3300047315 | Bacteria | 13059 |
| 1380 | Ga0495581_0010000 | 3300047315 | Bacteria | 5486 |
| 1381 | Ga0495581_0012865 | 3300047315 | Bacteria | 4847 |
| 1382 | Ga0495581_0015516 | 3300047315 | Bacteria | 4422 |
| 1383 | Ga0495581_0041982 | 3300047315 | Bacteria | 2648 |
| 1384 | Ga0495581_0117749 | 3300047315 | Bacteria | 1545 |
| 1385 | Ga0495604_0000002 | 3300047317 | Bacteria | 530904 |
| 1386 | Ga0495604_0003656 | 3300047317 | Bacteria | 12254 |
| 1387 | Ga0495604_0017648 | 3300047317 | Bacteria | 5712 |
| 1388 | Ga0495604_0048780 | 3300047317 | Bacteria | 3292 |
| 1389 | Ga0495604_0115217 | 3300047317 | Bacteria | 1953 |
| 1390 | Ga0495604_0137824 | 3300047317 | Bacteria | 1747 |
| 1391 | Ga0495604_0212198 | 3300047317 | Bacteria | 1337 |
| 1392 | Ga0495636_0000153 | 3300047318 | Bacteria | 27389 |
| 1393 | Ga0495674_0000004 | 3300047319 | Bacteria | 531855 |
| 1394 | Ga0495674_0007346 | 3300047319 | Bacteria | 10535 |
| 1395 | Ga0495674_0024907 | 3300047319 | Bacteria | 5492 |
| 1396 | Ga0495674_0025291 | 3300047319 | Bacteria | 5446 |
| 1397 | Ga0495674_0048298 | 3300047319 | Bacteria | 3766 |
| 1398 | Ga0495674_0051878 | 3300047319 | Bacteria | 3613 |
| 1399 | Ga0495674_0069597 | 3300047319 | Bacteria | 3042 |
| 1400 | Ga0495674_0155587 | 3300047319 | Bacteria | 1915 |
| 1401 | Ga0495674_0215392 | 3300047319 | Bacteria | 1589 |
| 1402 | Ga0495674_0441819 | 3300047319 | Bacteria | 1046 |
| 1403 | Ga0495672_0007385 | 3300047320 | Bacteria | 8272 |
| 1404 | Ga0495672_0013407 | 3300047320 | Bacteria | 5657 |
| 1405 | Ga0495676_0008678 | 3300047321 | Bacteria | 9304 |
| 1406 | Ga0495676_0036656 | 3300047321 | Bacteria | 4092 |
| 1407 | Ga0495680_0000142 | 3300047322 | Bacteria | 72324 |
| 1408 | Ga0495680_0001462 | 3300047322 | Bacteria | 25495 |
| 1409 | Ga0495680_0001925 | 3300047322 | Bacteria | 21809 |
| 1410 | Ga0495680_0005045 | 3300047322 | Bacteria | 12473 |
| 1411 | Ga0495680_0011214 | 3300047322 | Bacteria | 7958 |
| 1412 | Ga0495680_0012241 | 3300047322 | Bacteria | 7561 |
| 1413 | Ga0495680_0017639 | 3300047322 | Bacteria | 6085 |
| 1414 | Ga0495680_0027679 | 3300047322 | Bacteria | 4653 |
| 1415 | Ga0495680_0054253 | 3300047322 | Bacteria | 3113 |
| 1416 | Ga0495680_0054369 | 3300047322 | Bacteria | 3110 |
| 1417 | Ga0495680_0081387 | 3300047322 | Bacteria | 2444 |
| 1418 | Ga0495680_0308341 | 3300047322 | Bacteria | 1110 |
| 1419 | Ga0495680_0480262 | 3300047322 | Bacteria | 846 |
| 1420 | Ga0495683_0000086 | 3300047323 | Bacteria | 92967 |
| 1421 | Ga0495683_0000919 | 3300047323 | Bacteria | 20760 |
| 1422 | Ga0495683_0001329 | 3300047323 | Bacteria | 16577 |
| 1423 | Ga0495687_000498 | 3300047443 | Bacteria | 47324 |
| 1424 | Ga0495675_0000824 | 3300047444 | Bacteria | 19028 |
| 1425 | Ga0495675_0004498 | 3300047444 | Bacteria | 8447 |
| 1426 | Ga0495675_0005626 | 3300047444 | Bacteria | 7651 |
| 1427 | Ga0495675_0057907 | 3300047444 | Bacteria | 2457 |
| 1428 | Ga0495675_0087847 | 3300047444 | Bacteria | 1953 |
| 1429 | Ga0495675_0099781 | 3300047444 | Bacteria | 1818 |
| 1430 | Ga0495675_0287973 | 3300047444 | Bacteria | 978 |
| 1431 | Ga0495677_0000593 | 3300047445 | Bacteria | 14849 |
| 1432 | Ga0495679_000078 | 3300047446 | Bacteria | 91220 |
| 1433 | Ga0495685_000010 | 3300047447 | Bacteria | 84950 |
| 1434 | Ga0495685_006895 | 3300047447 | Bacteria | 3736 |
| 1435 | Ga0495673_0003866 | 3300047469 | Bacteria | 9654 |
| 1436 | Ga0495673_0004187 | 3300047469 | Bacteria | 9112 |
| 1437 | Ga0495673_0007764 | 3300047469 | Bacteria | 6119 |
| 1438 | Ga0495673_0105981 | 3300047469 | Bacteria | 1130 |
| 1439 | Ga0495684_0000004 | 3300047471 | Bacteria | 307093 |
| 1440 | Ga0495684_0001528 | 3300047471 | Bacteria | 18538 |
| 1441 | Ga0495684_0006621 | 3300047471 | Bacteria | 8987 |
| 1442 | Ga0495684_0033070 | 3300047471 | Bacteria | 3970 |
| 1443 | Ga0495684_0040269 | 3300047471 | Bacteria | 3582 |
| 1444 | Ga0495684_0042457 | 3300047471 | Bacteria | 3483 |
| 1445 | Ga0495684_0100776 | 3300047471 | Bacteria | 2184 |
| 1446 | Ga0495684_0101182 | 3300047471 | Bacteria | 2179 |
| 1447 | Ga0495684_0110807 | 3300047471 | Bacteria | 2071 |
| 1448 | Ga0495684_0199991 | 3300047471 | Bacteria | 1474 |
| 1449 | Ga0495686_0059784 | 3300047472 | Bacteria | 2371 |
| 1450 | Ga0495593_0004166 | 3300047673 | Bacteria | 8606 |
| 1451 | Ga0495593_0025461 | 3300047673 | Bacteria | 3275 |
| 1452 | Ga0495593_0078254 | 3300047673 | Bacteria | 1713 |
| 1453 | Ga0495593_0156173 | 3300047673 | Bacteria | 1153 |
| 1454 | Ga0495602_0000001 | 3300048088 | Bacteria | 510904 |
| 1455 | Ga0495602_0004084 | 3300048088 | Bacteria | 15203 |
| 1456 | Ga0495602_0038074 | 3300048088 | Bacteria | 4453 |
| 1457 | Ga0495602_0067303 | 3300048088 | Bacteria | 3082 |
| 1458 | Ga0495602_0227961 | 3300048088 | Bacteria | 1402 |
| 1459 | Ga0495614_0001174 | 3300048089 | Bacteria | 11241 |
| 1460 | Ga0495614_0106141 | 3300048089 | Bacteria | 1231 |
| 1461 | Ga0495626_0001516 | 3300048091 | Bacteria | 18301 |
| 1462 | Ga0496100_0000066 | 3300048903 | Bacteria | 58885 |
| 1463 | Ga0496100_0002624 | 3300048903 | Bacteria | 9166 |
| 1464 | Ga0496100_0032409 | 3300048903 | Bacteria | 3259 |
| 1465 | Ga0496100_0040924 | 3300048903 | Bacteria | 2951 |
| 1466 | Ga0496100_0088506 | 3300048903 | Bacteria | 2107 |
| 1467 | Ga0496100_0096905 | 3300048903 | Bacteria | 2025 |
| 1468 | Ga0496101_0000154 | 3300048904 | Bacteria | 58517 |
| 1469 | Ga0496101_0003320 | 3300048904 | Bacteria | 10009 |
| 1470 | Ga0496101_0015113 | 3300048904 | Bacteria | 5195 |
| 1471 | Ga0496101_0020381 | 3300048904 | Bacteria | 4537 |
| 1472 | Ga0496101_0048987 | 3300048904 | Bacteria | 3037 |
| 1473 | Ga0496101_0412861 | 3300048904 | Bacteria | 1064 |
| 1474 | Ga0496102_0000191 | 3300048905 | Bacteria | 83369 |
| 1475 | Ga0496102_0006722 | 3300048905 | Bacteria | 9824 |
| 1476 | Ga0496102_0024677 | 3300048905 | Bacteria | 5346 |
| 1477 | Ga0496102_0025462 | 3300048905 | Bacteria | 5267 |
| 1478 | Ga0496102_0062282 | 3300048905 | Bacteria | 3416 |
| 1479 | Ga0496102_0107194 | 3300048905 | Bacteria | 2601 |
| 1480 | Ga0496102_0130447 | 3300048905 | Bacteria | 2352 |
| 1481 | Ga0496102_0166352 | 3300048905 | Bacteria | 2075 |
| 1482 | Ga0496102_0283874 | 3300048905 | Bacteria | 1560 |
| 1483 | Ga0496103_0000232 | 3300048906 | Bacteria | 54569 |
| 1484 | Ga0496103_0002570 | 3300048906 | Bacteria | 11377 |
| 1485 | Ga0496103_0010404 | 3300048906 | Bacteria | 5504 |
| 1486 | Ga0496103_0022797 | 3300048906 | Bacteria | 3771 |
| 1487 | Ga0496103_0123516 | 3300048906 | Bacteria | 1650 |
| 1488 | Ga0496104_0000560 | 3300048907 | Bacteria | 31696 |
| 1489 | Ga0496104_0001363 | 3300048907 | Bacteria | 21131 |
| 1490 | Ga0496104_0005323 | 3300048907 | Bacteria | 11258 |
| 1491 | Ga0496104_0030000 | 3300048907 | Bacteria | 5050 |
| 1492 | Ga0496104_0094144 | 3300048907 | Bacteria | 2865 |
| 1493 | Ga0496104_0196088 | 3300048907 | Bacteria | 1931 |
| 1494 | Ga0496104_0453131 | 3300048907 | Bacteria | 1195 |
| 1495 | Ga0496105_0001391 | 3300048908 | Bacteria | 16986 |
| 1496 | Ga0496105_0002131 | 3300048908 | Bacteria | 14342 |
| 1497 | Ga0496105_0011105 | 3300048908 | Bacteria | 7103 |
| 1498 | Ga0496105_0020728 | 3300048908 | Bacteria | 5314 |
| 1499 | Ga0496105_0038168 | 3300048908 | Bacteria | 3957 |
| 1500 | Ga0496105_0045672 | 3300048908 | Bacteria | 3614 |
| 1501 | Ga0496105_0101863 | 3300048908 | Bacteria | 2371 |
| 1502 | Ga0496105_0166138 | 3300048908 | Bacteria | 1810 |
| 1503 | Ga0496105_0194665 | 3300048908 | Bacteria | 1657 |
| 1504 | Ga0496105_0437968 | 3300048908 | Bacteria | 1033 |
| 1505 | Ga0496106_0002204 | 3300048909 | Bacteria | 14547 |
| 1506 | Ga0496106_0004015 | 3300048909 | Bacteria | 10998 |
| 1507 | Ga0496106_0046148 | 3300048909 | Bacteria | 3274 |
| 1508 | Ga0496106_0173777 | 3300048909 | Bacteria | 1708 |
| 1509 | Ga0496106_0188967 | 3300048909 | Bacteria | 1637 |
| 1510 | Ga0496106_0283491 | 3300048909 | Bacteria | 1327 |
| 1511 | Ga0496107_0001189 | 3300048910 | Bacteria | 15840 |
| 1512 | Ga0496107_0005878 | 3300048910 | Bacteria | 8404 |
| 1513 | Ga0496107_0023259 | 3300048910 | Bacteria | 4381 |
| 1514 | Ga0496107_0048646 | 3300048910 | Bacteria | 3055 |
| 1515 | Ga0496107_0060851 | 3300048910 | Bacteria | 2733 |
| 1516 | Ga0496107_0461999 | 3300048910 | Bacteria | 942 |
| 1517 | Ga0496108_0002494 | 3300048911 | Bacteria | 14730 |
| 1518 | Ga0496108_0010537 | 3300048911 | Bacteria | 7512 |
| 1519 | Ga0496108_0037485 | 3300048911 | Bacteria | 4038 |
| 1520 | Ga0496108_0070746 | 3300048911 | Bacteria | 2944 |
| 1521 | Ga0496108_0079757 | 3300048911 | Bacteria | 2772 |
| 1522 | Ga0496108_0095796 | 3300048911 | Bacteria | 2527 |
| 1523 | Ga0496108_0184186 | 3300048911 | Bacteria | 1809 |
| 1524 | Ga0496108_0533793 | 3300048911 | Bacteria | 1024 |
| 1525 | Ga0496109_0000567 | 3300048912 | Bacteria | 30903 |
| 1526 | Ga0496109_0000700 | 3300048912 | Bacteria | 27897 |
| 1527 | Ga0496109_0013437 | 3300048912 | Bacteria | 7102 |
| 1528 | Ga0496109_0023062 | 3300048912 | Bacteria | 5520 |
| 1529 | Ga0496109_0085694 | 3300048912 | Bacteria | 2908 |
| 1530 | Ga0496110_0003520 | 3300048913 | Bacteria | 12018 |
| 1531 | Ga0496110_0036662 | 3300048913 | Bacteria | 4259 |
| 1532 | Ga0496110_0071860 | 3300048913 | Bacteria | 3069 |
| 1533 | Ga0496110_0115960 | 3300048913 | Bacteria | 2411 |
| 1534 | Ga0496110_0404582 | 3300048913 | Bacteria | 1244 |
| 1535 | Ga0496110_0635255 | 3300048913 | Bacteria | 967 |
| 1536 | Ga0496111_0002128 | 3300048914 | Bacteria | 11829 |
| 1537 | Ga0496111_0009771 | 3300048914 | Bacteria | 6413 |
| 1538 | Ga0496111_0030278 | 3300048914 | Bacteria | 3849 |
| 1539 | Ga0496111_0127915 | 3300048914 | Bacteria | 1879 |
| 1540 | Ga0496111_0262018 | 3300048914 | Bacteria | 1283 |
| 1541 | Ga0496111_0281064 | 3300048914 | Bacteria | 1234 |
| 1542 | Ga0496112_0002747 | 3300048915 | Bacteria | 14260 |
| 1543 | Ga0496112_0006626 | 3300048915 | Bacteria | 10196 |
| 1544 | Ga0496112_0054561 | 3300048915 | Bacteria | 3926 |
| 1545 | Ga0496112_0067828 | 3300048915 | Bacteria | 3521 |
| 1546 | Ga0496112_0131301 | 3300048915 | Bacteria | 2476 |
| 1547 | Ga0496112_0238354 | 3300048915 | Bacteria | 1772 |
| 1548 | Ga0496112_0446415 | 3300048915 | Bacteria | 1231 |
| 1549 | Ga0496113_0001279 | 3300048916 | Bacteria | 13876 |
| 1550 | Ga0496113_0006169 | 3300048916 | Bacteria | 7566 |
| 1551 | Ga0496113_0020581 | 3300048916 | Bacteria | 4641 |
| 1552 | Ga0496113_0057616 | 3300048916 | Bacteria | 2920 |
| 1553 | Ga0496113_0064863 | 3300048916 | Bacteria | 2762 |
| 1554 | Ga0496113_0136323 | 3300048916 | Bacteria | 1929 |
| 1555 | Ga0496113_0190821 | 3300048916 | Bacteria | 1626 |
| 1556 | Ga0496114_0018338 | 3300048917 | Bacteria | 5659 |
| 1557 | Ga0496114_0029525 | 3300048917 | Bacteria | 4508 |
| 1558 | Ga0496114_0033161 | 3300048917 | Bacteria | 4253 |
| 1559 | Ga0496114_0274562 | 3300048917 | Bacteria | 1485 |
| 1560 | Ga0496115_0001922 | 3300048918 | Bacteria | 14830 |
| 1561 | Ga0496115_0010508 | 3300048918 | Bacteria | 6920 |
| 1562 | Ga0496115_0017144 | 3300048918 | Bacteria | 5528 |
| 1563 | Ga0496115_0024926 | 3300048918 | Bacteria | 4652 |
| 1564 | Ga0496115_0040708 | 3300048918 | Bacteria | 3695 |
| 1565 | Ga0496115_0046991 | 3300048918 | Bacteria | 3451 |
| 1566 | Ga0496115_0168289 | 3300048918 | Bacteria | 1812 |
| 1567 | Ga0496115_0247411 | 3300048918 | Bacteria | 1468 |
| 1568 | Ga0496116_0008329 | 3300048919 | Bacteria | 9010 |
| 1569 | Ga0496116_0010352 | 3300048919 | Bacteria | 7829 |
| 1570 | Ga0496116_0096558 | 3300048919 | Bacteria | 1780 |
| 1571 | Ga0496116_0229102 | 3300048919 | Bacteria | 944 |
| 1572 | Ga0496117_0000956 | 3300048920 | Bacteria | 44190 |
| 1573 | Ga0496117_0008683 | 3300048920 | Bacteria | 9605 |
| 1574 | Ga0496117_0009904 | 3300048920 | Bacteria | 8771 |
| 1575 | Ga0496117_0011583 | 3300048920 | Bacteria | 7885 |
| 1576 | Ga0496117_0093919 | 3300048920 | Bacteria | 1922 |
| 1577 | Ga0496118_0000494 | 3300048921 | Bacteria | 65421 |
| 1578 | Ga0496118_0000757 | 3300048921 | Bacteria | 52154 |
| 1579 | Ga0496118_0002208 | 3300048921 | Bacteria | 27018 |
| 1580 | Ga0496118_0025727 | 3300048921 | Bacteria | 5036 |
| 1581 | Ga0496119_0008642 | 3300048922 | Bacteria | 8913 |
| 1582 | Ga0496121_0000099 | 3300048924 | Bacteria | 200160 |
| 1583 | Ga0496121_0009644 | 3300048924 | Bacteria | 11058 |
| 1584 | Ga0496121_0053371 | 3300048924 | Bacteria | 3387 |
| 1585 | Ga0496121_0133576 | 3300048924 | Bacteria | 1852 |
| 1586 | Ga0496121_0361856 | 3300048924 | Bacteria | 963 |
| 1587 | Ga0496122_0002394 | 3300048925 | Bacteria | 26780 |
| 1588 | Ga0496122_0012696 | 3300048925 | Bacteria | 8344 |
| 1589 | Ga0496122_0042043 | 3300048925 | Bacteria | 3602 |
| 1590 | Ga0496123_0002192 | 3300048926 | Bacteria | 24860 |
| 1591 | Ga0496123_0046425 | 3300048926 | Bacteria | 2946 |
| 1592 | Ga0496123_0124933 | 3300048926 | Bacteria | 1438 |
| 1593 | Ga0496123_0224747 | 3300048926 | Bacteria | 944 |
| 1594 | Ga0496124_0000284 | 3300048927 | Bacteria | 96345 |
| 1595 | Ga0496124_0000962 | 3300048927 | Bacteria | 45849 |
| 1596 | Ga0496124_0029765 | 3300048927 | Bacteria | 4858 |
| 1597 | Ga0496124_0037548 | 3300048927 | Bacteria | 4212 |
| 1598 | Ga0496124_0189006 | 3300048927 | Bacteria | 1578 |
| 1599 | Ga0496125_0001570 | 3300048928 | Bacteria | 32554 |
| 1600 | Ga0496125_0004558 | 3300048928 | Bacteria | 15894 |
| 1601 | Ga0496125_0040720 | 3300048928 | Bacteria | 3982 |
| 1602 | Ga0496125_0097126 | 3300048928 | Bacteria | 2184 |
| 1603 | Ga0496126_0002134 | 3300048929 | Bacteria | 27578 |
| 1604 | Ga0495678_000525 | 3300049459 | Bacteria | 37357 |
| 1605 | Ga0495682_0008853 | 3300049460 | Bacteria | 3954 |
| 1606 | Ga0501031_0013932 | 3300049568 | Bacteria | 5237 |
| 1607 | Ga0501031_0035858 | 3300049568 | Bacteria | 3236 |
| 1608 | Ga0501031_0125444 | 3300049568 | Bacteria | 1677 |
| 1609 | Ga0501031_0243342 | 3300049568 | Bacteria | 1169 |
| 1610 | Ga0501032_0037351 | 3300049569 | Bacteria | 3313 |
| 1611 | Ga0501032_0043686 | 3300049569 | Bacteria | 3033 |
| 1612 | Ga0501032_0091160 | 3300049569 | Bacteria | 2022 |
| 1613 | Ga0501032_0341256 | 3300049569 | Bacteria | 965 |
| 1614 | Ga0501033_0012682 | 3300049570 | Bacteria | 6428 |
| 1615 | Ga0501033_0226769 | 3300049570 | Bacteria | 1328 |
| 1616 | Ga0501034_0000070 | 3300049571 | Bacteria | 180933 |
| 1617 | Ga0501034_0013989 | 3300049571 | Bacteria | 8259 |
| 1618 | Ga0501034_0021659 | 3300049571 | Bacteria | 6547 |
| 1619 | Ga0501034_0064750 | 3300049571 | Bacteria | 3669 |
| 1620 | Ga0501034_0183838 | 3300049571 | Bacteria | 2054 |
| 1621 | Ga0501034_0713752 | 3300049571 | Bacteria | 900 |
| 1622 | Ga0501036_0020490 | 3300049572 | Bacteria | 5553 |
| 1623 | Ga0501036_0025154 | 3300049572 | Bacteria | 5021 |
| 1624 | Ga0501036_0056999 | 3300049572 | Bacteria | 3310 |
| 1625 | Ga0501036_0389270 | 3300049572 | Bacteria | 1163 |
| 1626 | Ga0501037_0014650 | 3300049573 | Bacteria | 5769 |
| 1627 | Ga0501038_0007499 | 3300049574 | Bacteria | 10058 |
| 1628 | Ga0501038_0040531 | 3300049574 | Bacteria | 4066 |
| 1629 | Ga0501038_0058873 | 3300049574 | Bacteria | 3292 |
| 1630 | Ga0501038_0148203 | 3300049574 | Bacteria | 1915 |
| 1631 | Ga0501039_0062918 | 3300049575 | Bacteria | 2875 |
| 1632 | Ga0501039_0078186 | 3300049575 | Bacteria | 2573 |
| 1633 | Ga0501039_0260542 | 3300049575 | Bacteria | 1363 |
| 1634 | Ga0501040_0296620 | 3300049576 | Bacteria | 1155 |
| 1635 | Ga0501042_0242302 | 3300049578 | Bacteria | 1301 |
| 1636 | Ga0501043_0000024 | 3300049579 | Bacteria | 154045 |
| 1637 | Ga0501043_0001631 | 3300049579 | Bacteria | 19514 |
| 1638 | Ga0501043_0033568 | 3300049579 | Bacteria | 4038 |
| 1639 | Ga0501043_0398936 | 3300049579 | Bacteria | 1040 |
| 1640 | Ga0501046_0000173 | 3300049580 | Bacteria | 65571 |
| 1641 | Ga0501046_0001796 | 3300049580 | Bacteria | 20471 |
| 1642 | Ga0501046_0004601 | 3300049580 | Bacteria | 12457 |
| 1643 | Ga0501046_0058133 | 3300049580 | Bacteria | 3032 |
| 1644 | Ga0501047_0000051 | 3300049581 | Bacteria | 154281 |
| 1645 | Ga0501047_0000305 | 3300049581 | Bacteria | 56371 |
| 1646 | Ga0501047_0008244 | 3300049581 | Bacteria | 9834 |
| 1647 | Ga0501048_0000650 | 3300049582 | Bacteria | 25020 |
| 1648 | Ga0501048_0001348 | 3300049582 | Bacteria | 18627 |
| 1649 | Ga0501048_0010540 | 3300049582 | Bacteria | 6897 |
| 1650 | Ga0501067_0014773 | 3300049583 | Bacteria | 4320 |
| 1651 | Ga0501067_0284713 | 3300049583 | Bacteria | 920 |
| 1652 | Ga0501068_0023440 | 3300049584 | Bacteria | 3617 |
| 1653 | Ga0501068_0145873 | 3300049584 | Bacteria | 1486 |
| 1654 | Ga0501068_0241952 | 3300049584 | Bacteria | 1149 |
| 1655 | Ga0501069_0002445 | 3300049585 | Bacteria | 9469 |
| 1656 | Ga0501069_0295782 | 3300049585 | Bacteria | 949 |
| 1657 | Ga0501070_0012418 | 3300049586 | Bacteria | 7183 |
| 1658 | Ga0501070_0051186 | 3300049586 | Bacteria | 3429 |
| 1659 | Ga0501070_0088095 | 3300049586 | Bacteria | 2569 |
| 1660 | Ga0501070_0108004 | 3300049586 | Bacteria | 2299 |
| 1661 | Ga0501071_0216162 | 3300049587 | Bacteria | 1442 |
| 1662 | Ga0501071_0230687 | 3300049587 | Bacteria | 1394 |
| 1663 | Ga0501072_0223376 | 3300049588 | Bacteria | 1501 |
| 1664 | Ga0501072_0252576 | 3300049588 | Bacteria | 1404 |
| 1665 | Ga0501072_0348423 | 3300049588 | Bacteria | 1176 |
| 1666 | Ga0501073_0013348 | 3300049589 | Bacteria | 5981 |
| 1667 | Ga0501073_0210504 | 3300049589 | Bacteria | 1344 |
| 1668 | Ga0501074_0002924 | 3300049590 | Bacteria | 11992 |
| 1669 | Ga0501075_0044518 | 3300049591 | Bacteria | 3330 |
| 1670 | Ga0501076_0271310 | 3300049592 | Bacteria | 1389 |
| 1671 | Ga0501076_0313775 | 3300049592 | Bacteria | 1286 |
| 1672 | Ga0501217_026806 | 3300049661 | Bacteria | 1395 |
| 1673 | Ga0501249_000841 | 3300049679 | Bacteria | 6799 |
| 1674 | Ga0501225_0003044 | 3300049705 | Bacteria | 5124 |
| 1675 | Ga0501079_0071245 | 3300049741 | Bacteria | 2685 |
| 1676 | Ga0501079_0099173 | 3300049741 | Bacteria | 2258 |
| 1677 | Ga0501079_0103083 | 3300049741 | Bacteria | 2213 |
| 1678 | Ga0501080_0013878 | 3300049742 | Bacteria | 7417 |
| 1679 | Ga0501081_0273888 | 3300049743 | Bacteria | 1235 |
| 1680 | Ga0501083_0010486 | 3300049744 | Bacteria | 6522 |
| 1681 | Ga0501083_0047864 | 3300049744 | Bacteria | 2887 |
| 1682 | Ga0501083_0095086 | 3300049744 | Bacteria | 1967 |
| 1683 | Ga0501083_0111142 | 3300049744 | Bacteria | 1802 |
| 1684 | Ga0501262_000282 | 3300049759 | Bacteria | 6144 |
| 1685 | Ga0501263_013173 | 3300049760 | Bacteria | 1045 |
| 1686 | Ga0501035_0003206 | 3300049822 | Bacteria | 15680 |
| 1687 | Ga0501035_0037571 | 3300049822 | Bacteria | 4384 |
| 1688 | Ga0501035_0110593 | 3300049822 | Bacteria | 2408 |
| 1689 | Ga0501044_0000212 | 3300049823 | Bacteria | 73807 |
| 1690 | Ga0501044_0019211 | 3300049823 | Bacteria | 7315 |
| 1691 | Ga0501044_0032009 | 3300049823 | Bacteria | 5529 |
| 1692 | Ga0501044_0079246 | 3300049823 | Bacteria | 3328 |
| 1693 | Ga0501044_0136126 | 3300049823 | Bacteria | 2448 |
| 1694 | Ga0501044_0291819 | 3300049823 | Bacteria | 1562 |
| 1695 | Ga0501044_0310482 | 3300049823 | Bacteria | 1504 |
| 1696 | Ga0501045_0016684 | 3300049824 | Bacteria | 5216 |
| 1697 | Ga0501045_0047229 | 3300049824 | Bacteria | 3136 |
| 1698 | Ga0501045_0151396 | 3300049824 | Bacteria | 1726 |
| 1699 | nmdc:mga03683_131_c2 | 3300050489 | Bacteria | 14717 |
| 1700 | nmdc:mga03683_4120_c1 | 3300050489 | Bacteria | 4780 |
| 1701 | nmdc:mga03n38_13453_c1 | 3300050490 | Bacteria | 3109 |
| 1702 | nmdc:mga03n38_15028_c1 | 3300050490 | Bacteria | 2982 |
| 1703 | nmdc:mga03n38_65253_c1 | 3300050490 | Bacteria | 1669 |
| 1704 | nmdc:mga00v17_26732_c1 | 3300050491 | Bacteria | 3365 |
| 1705 | nmdc:mga00v17_27410_c1 | 3300050491 | Bacteria | 3326 |
| 1706 | nmdc:mga00v17_69463_c1 | 3300050491 | Bacteria | 2180 |
| 1707 | nmdc:mga0yw44_12622_c1 | 3300050492 | Bacteria | 4413 |
| 1708 | nmdc:mga0yw44_13411_c1 | 3300050492 | Bacteria | 4315 |
| 1709 | nmdc:mga0yw44_225837_c1 | 3300050492 | Bacteria | 1242 |
| 1710 | nmdc:mga0yw44_99924_c1 | 3300050492 | Bacteria | 1847 |
| 1711 | nmdc:mga0k408_2988_c1 | 3300050493 | Bacteria | 8964 |
| 1712 | nmdc:mga0k408_34076_c1 | 3300050493 | Bacteria | 2914 |
| 1713 | nmdc:mga0k408_35047_c1 | 3300050493 | Bacteria | 2876 |
| 1714 | nmdc:mga0k408_4288_c1 | 3300050493 | Bacteria | 7571 |
| 1715 | nmdc:mga0k408_49574_c1 | 3300050493 | Bacteria | 2431 |
| 1716 | nmdc:mga06z11_1542_c1 | 3300050494 | Bacteria | 8556 |
| 1717 | nmdc:mga06z11_31128_c1 | 3300050494 | Bacteria | 2589 |
| 1718 | nmdc:mga06z11_34851_c1 | 3300050494 | Bacteria | 2473 |
| 1719 | nmdc:mga06z11_37546_c1 | 3300050494 | Bacteria | 2400 |
| 1720 | nmdc:mga06z11_6364_c1 | 3300050494 | Bacteria | 4798 |
| 1721 | nmdc:mga06z11_87116_c2 | 3300050494 | Bacteria | 1372 |
| 1722 | nmdc:mga04h51_22504_c1 | 3300050495 | Bacteria | 1908 |
| 1723 | nmdc:mga04h51_23730_c1 | 3300050495 | Bacteria | 1871 |
| 1724 | nmdc:mga04h51_37858_c1 | 3300050495 | Bacteria | 1559 |
| 1725 | nmdc:mga04h51_38256_c1 | 3300050495 | Bacteria | 1552 |
| 1726 | nmdc:mga07m45_1095_c1 | 3300050496 | Bacteria | 12086 |
| 1727 | nmdc:mga07m45_18576_c1 | 3300050496 | Bacteria | 3756 |
| 1728 | nmdc:mga07m45_5940_c1 | 3300050496 | Bacteria | 2387 |
| 1729 | nmdc:mga07m45_61998_c1 | 3300050496 | Bacteria | 2119 |
| 1730 | nmdc:mga05p37_34591_c1 | 3300050507 | Bacteria | 6189 |
| 1731 | nmdc:mga05p37_5774_c1 | 3300050507 | Bacteria | 14558 |
| 1732 | nmdc:mga05p37_828_c1 | 3300050507 | Bacteria | 34679 |
| 1733 | nmdc:mga09592_21763_c1 | 3300050508 | Bacteria | 5287 |
| 1734 | nmdc:mga09592_21943_c1 | 3300050508 | Bacteria | 5266 |
| 1735 | nmdc:mga09592_349416_c1 | 3300050508 | Bacteria | 1280 |
| 1736 | nmdc:mga0qj67_165_c1 | 3300050509 | Bacteria | 44307 |
| 1737 | nmdc:mga06r32_112571_c1 | 3300050510 | Bacteria | 2678 |
| 1738 | nmdc:mga06r32_513_c1 | 3300050510 | Bacteria | 33328 |
| 1739 | nmdc:mga06r32_56178_c1 | 3300050510 | Bacteria | 3778 |
| 1740 | nmdc:mga06r32_7918_c1 | 3300050510 | Bacteria | 9554 |
| 1741 | nmdc:mga08y16_4405_c1 | 3300050511 | Bacteria | 14718 |
| 1742 | nmdc:mga08y16_478747_c1 | 3300050511 | Bacteria | 1267 |
| 1743 | nmdc:mga08y16_77507_c1 | 3300050511 | Bacteria | 3466 |
| 1744 | nmdc:mga0n895_10588_c2 | 3300050512 | Bacteria | 7761 |
| 1745 | nmdc:mga0n895_1284_c1 | 3300050512 | Bacteria | 18562 |
| 1746 | nmdc:mga0n895_160658_c1 | 3300050512 | Bacteria | 2279 |
| 1747 | nmdc:mga0n895_32422_c1 | 3300050512 | Bacteria | 5016 |
| 1748 | nmdc:mga0n895_53866_c1 | 3300050512 | Bacteria | 3955 |
| 1749 | nmdc:mga0n895_6751_c1 | 3300050512 | Bacteria | 9788 |
| 1750 | nmdc:mga0n895_90_c1 | 3300050512 | Bacteria | 52593 |
| 1751 | nmdc:mga0n895_91521_c1 | 3300050512 | Bacteria | 3044 |
| 1752 | nmdc:mga0rr50_2923_c1 | 3300050513 | Bacteria | 9755 |
| 1753 | nmdc:mga0rr50_31356_c1 | 3300050513 | Bacteria | 3774 |
| 1754 | nmdc:mga0rr50_330469_c1 | 3300050513 | Bacteria | 1280 |
| 1755 | nmdc:mga0rr50_7459_c1 | 3300050513 | Bacteria | 6749 |
| 1756 | nmdc:mga0rr50_8687_c1 | 3300050513 | Bacteria | 6335 |
| 1757 | nmdc:mga08x19_101005_c1 | 3300050514 | Bacteria | 1914 |
| 1758 | nmdc:mga08x19_102452_c1 | 3300050514 | Bacteria | 1901 |
| 1759 | nmdc:mga08x19_4374_c1 | 3300050514 | Bacteria | 8380 |
| 1760 | nmdc:mga08x19_53960_c1 | 3300050514 | Bacteria | 2587 |
| 1761 | nmdc:mga08x19_77997_c1 | 3300050514 | Bacteria | 2170 |
| 1762 | nmdc:mga0a205_1140_c1 | 3300050515 | Bacteria | 22064 |
| 1763 | nmdc:mga0a205_12519_c1 | 3300050515 | Bacteria | 7852 |
| 1764 | nmdc:mga0a205_242721_c1 | 3300050515 | Bacteria | 1682 |
| 1765 | nmdc:mga0a205_259772_c1 | 3300050515 | Bacteria | 1614 |
| 1766 | nmdc:mga0a205_432198_c1 | 3300050515 | Bacteria | 1178 |
| 1767 | nmdc:mga0sz30_1590_c1 | 3300050516 | Bacteria | 4772 |
| 1768 | nmdc:mga0sz30_36051_c1 | 3300050516 | Bacteria | 2066 |
| 1769 | Ga0495601_0000026 | 3300053077 | Bacteria | 126257 |
| 1770 | Ga0495601_0000075 | 3300053077 | Bacteria | 54434 |
| 1771 | Ga0495601_0003475 | 3300053077 | Bacteria | 9043 |
| 1772 | Ga0495601_0007907 | 3300053077 | Bacteria | 6263 |
| 1773 | Ga0495601_0008795 | 3300053077 | Bacteria | 5959 |
| 1774 | Ga0495601_0013952 | 3300053077 | Bacteria | 4838 |
| 1775 | Ga0495601_0019791 | 3300053077 | Bacteria | 4108 |
| 1776 | Ga0495601_0021260 | 3300053077 | Bacteria | 3972 |
| 1777 | Ga0495601_0045345 | 3300053077 | Bacteria | 2764 |
| 1778 | Ga0495601_0056953 | 3300053077 | Bacteria | 2475 |
| 1779 | Ga0495601_0098383 | 3300053077 | Bacteria | 1888 |
| 1780 | Ga0495601_0281956 | 3300053077 | Bacteria | 1083 |
| 1781 | Ga0495601_0348136 | 3300053077 | Bacteria | 964 |
| 1782 | Ga0495612_0000005 | 3300053078 | Bacteria | 286943 |
| 1783 | Ga0495612_0004321 | 3300053078 | Bacteria | 5894 |
| 1784 | Ga0495612_0005901 | 3300053078 | Bacteria | 5051 |
| 1785 | Ga0495612_0011526 | 3300053078 | Bacteria | 3564 |
| 1786 | Ga0495612_0018362 | 3300053078 | Bacteria | 2801 |
| 1787 | Ga0500610_0000112 | 3300053079 | Bacteria | 24798 |
| 1788 | Ga0495595_0000058 | 3300053084 | Bacteria | 57705 |
| 1789 | Ga0495595_0000311 | 3300053084 | Bacteria | 18978 |
| 1790 | Ga0495595_0000650 | 3300053084 | Bacteria | 13209 |
| 1791 | Ga0495595_0002803 | 3300053084 | Bacteria | 6859 |
| 1792 | Ga0495595_0009800 | 3300053084 | Bacteria | 3971 |
| 1793 | Ga0495595_0018149 | 3300053084 | Bacteria | 3037 |
| 1794 | Ga0495619_0000003 | 3300053085 | Bacteria | 515784 |
| 1795 | Ga0495619_0000301 | 3300053085 | Bacteria | 34829 |
| 1796 | Ga0495619_0000315 | 3300053085 | Bacteria | 33904 |
| 1797 | Ga0495619_0000645 | 3300053085 | Bacteria | 22971 |
| 1798 | Ga0495619_0004564 | 3300053085 | Bacteria | 8848 |
| 1799 | Ga0495619_0008284 | 3300053085 | Bacteria | 6574 |
| 1800 | Ga0495619_0018578 | 3300053085 | Bacteria | 4411 |
| 1801 | Ga0495619_0020045 | 3300053085 | Bacteria | 4256 |
| 1802 | Ga0495619_0046550 | 3300053085 | Bacteria | 2852 |
| 1803 | Ga0495619_0093547 | 3300053085 | Bacteria | 2038 |
| 1804 | Ga0495619_0099418 | 3300053085 | Bacteria | 1978 |
| 1805 | Ga0495619_0215579 | 3300053085 | Bacteria | 1329 |
| 1806 | Ga0495619_0364211 | 3300053085 | Bacteria | 999 |
| 1807 | Ga0500578_0010253 | 3300053086 | Bacteria | 6074 |
| 1808 | Ga0500643_004510 | 3300053087 | Bacteria | 6263 |
| 1809 | Ga0500644_0000805 | 3300053088 | Bacteria | 10649 |
| 1810 | Ga0500644_0007117 | 3300053088 | Bacteria | 2899 |
| 1811 | Ga0500647_0033508 | 3300053091 | Bacteria | 2450 |
| 1812 | Ga0500651_0225020 | 3300053093 | Bacteria | 1099 |
| 1813 | Ga0500566_0002965 | 3300053094 | Bacteria | 10133 |
| 1814 | Ga0500566_0031163 | 3300053094 | Bacteria | 3110 |
| 1815 | Ga0500566_0099650 | 3300053094 | Bacteria | 1595 |
| 1816 | Ga0500566_0103179 | 3300053094 | Bacteria | 1560 |
| 1817 | Ga0500566_0143510 | 3300053094 | Bacteria | 1264 |
| 1818 | Ga0500640_000109 | 3300053095 | Bacteria | 15044 |
| 1819 | Ga0500554_000127 | 3300053102 | Bacteria | 15148 |
| 1820 | Ga0500572_000364 | 3300053111 | Bacteria | 16144 |
| 1821 | Ga0500572_002316 | 3300053111 | Bacteria | 4608 |
| 1822 | Ga0500593_042853 | 3300053117 | Bacteria | 2021 |
| 1823 | Ga0500594_0007743 | 3300053118 | Bacteria | 2435 |
| 1824 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1825 | Ga0500595_000654 | 3300053119 | Bacteria | 20823 |
| 1826 | Ga0500595_036417 | 3300053119 | Bacteria | 1612 |
| 1827 | Ga0500595_050461 | 3300053119 | Bacteria | 1292 |
| 1828 | Ga0500597_014321 | 3300053120 | Bacteria | 2971 |
| 1829 | Ga0500607_000040 | 3300053121 | Bacteria | 85325 |
| 1830 | Ga0500614_000065 | 3300053123 | Bacteria | 23001 |
| 1831 | Ga0500618_001458 | 3300053125 | Bacteria | 10508 |
| 1832 | Ga0500642_0007198 | 3300053130 | Bacteria | 3724 |
| 1833 | Ga0500655_013889 | 3300053133 | Bacteria | 1472 |
| 1834 | Ga0500658_0000142 | 3300053134 | Bacteria | 34080 |
| 1835 | Ga0500559_0004285 | 3300053136 | Bacteria | 6825 |
| 1836 | Ga0500559_0004688 | 3300053136 | Bacteria | 6438 |
| 1837 | Ga0500559_0009713 | 3300053136 | Bacteria | 4152 |
| 1838 | Ga0500561_0035968 | 3300053137 | Bacteria | 1281 |
| 1839 | Ga0500568_0000983 | 3300053139 | Bacteria | 19591 |
| 1840 | Ga0500568_0116516 | 3300053139 | Bacteria | 997 |
| 1841 | Ga0500586_037840 | 3300053145 | Bacteria | 1623 |
| 1842 | Ga0500590_000575 | 3300053148 | Bacteria | 12923 |
| 1843 | Ga0500590_078858 | 3300053148 | Bacteria | 1622 |
| 1844 | Ga0500603_024525 | 3300053150 | Bacteria | 1509 |
| 1845 | Ga0500604_0014219 | 3300053151 | Bacteria | 2165 |
| 1846 | Ga0500604_0019835 | 3300053151 | Bacteria | 1887 |
| 1847 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1848 | Ga0500616_0013278 | 3300053153 | Bacteria | 4789 |
| 1849 | Ga0500616_0033446 | 3300053153 | Bacteria | 2806 |
| 1850 | Ga0500616_0081258 | 3300053153 | Bacteria | 1628 |
| 1851 | Ga0500619_000062 | 3300053154 | Bacteria | 32808 |
| 1852 | Ga0500622_0014031 | 3300053156 | Bacteria | 4308 |
| 1853 | Ga0500622_0117387 | 3300053156 | Bacteria | 1294 |
| 1854 | Ga0500630_045519 | 3300053159 | Bacteria | 2132 |
| 1855 | Ga0500634_0011715 | 3300053161 | Bacteria | 4537 |
| 1856 | Ga0500638_101029 | 3300053162 | Bacteria | 1345 |
| 1857 | Ga0500639_006776 | 3300053163 | Bacteria | 5924 |
| 1858 | Ga0500636_0012653 | 3300053177 | Bacteria | 4947 |
| 1859 | Ga0500636_0022288 | 3300053177 | Bacteria | 3749 |
| 1860 | Ga0500636_0113664 | 3300053177 | Bacteria | 1526 |
| 1861 | Ga0500637_0085771 | 3300053178 | Bacteria | 1821 |
| 1862 | Ga0500657_124458 | 3300053728 | Bacteria | 1014 |
| 1863 | Ga0500645_000091 | 3300053730 | Bacteria | 70038 |
| 1864 | Ga0500645_001379 | 3300053730 | Bacteria | 12409 |
| 1865 | Ga0500552_015723 | 3300053733 | Bacteria | 1015 |
| 1866 | Ga0500596_012353 | 3300053735 | Bacteria | 1296 |
| 1867 | Ga0501084_0024349 | 3300054114 | Bacteria | 5049 |
| 1868 | Ga0501082_0170102 | 3300060353 | Bacteria | 1894 |
| 1869 | Ga0501082_0194886 | 3300060353 | Bacteria | 1762 |
| 1870 | Ga0530510_0389233 | 3300061734 | Bacteria | 1050 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_10537663 | Ga0111539_105376632 | 239 |
| 2 | 3300009147 | Ga0114129_10078906 | Ga0114129_100789063 | 239 |
| 3 | 3300035410 | Ga0373924_0002930 | Ga0373924_0002930_48_767 | 239 |
| 4 | 3300045976 | Ga0466967_0309468 | Ga0466967_0309468_725_1444 | 239 |
| 5 | 3300046460 | Ga0495638_0149314 | Ga0495638_0149314_222_941 | 239 |
| 6 | 3300046681 | Ga0495647_0200982 | Ga0495647_0200982_119_838 | 239 |
| 7 | 3300046689 | Ga0495613_0555356 | Ga0495613_0555356_32_751 | 239 |
| 8 | 3300048907 | Ga0496104_0000560 | Ga0496104_0000560_18332_19051 | 239 |
| 9 | 3300048908 | Ga0496105_0001391 | Ga0496105_0001391_546_1265 | 239 |
| 10 | 3300048911 | Ga0496108_0079757 | Ga0496108_0079757_587_1306 | 239 |
| 11 | 3300048912 | Ga0496109_0023062 | Ga0496109_0023062_3383_4102 | 239 |
| 12 | 3300048913 | Ga0496110_0003520 | Ga0496110_0003520_7745_8464 | 239 |
| 13 | 3300048914 | Ga0496111_0009771 | Ga0496111_0009771_1564_2283 | 239 |
| 14 | 3300048915 | Ga0496112_0002747 | Ga0496112_0002747_12058_12777 | 239 |
| 15 | 3300048916 | Ga0496113_0006169 | Ga0496113_0006169_619_1338 | 239 |
| 16 | 3300050490 | nmdc:mga03n38_15028_c1 | nmdc:mga03n38_15028_c1_576_1295 | 239 |
| 17 | 3300050491 | nmdc:mga00v17_69463_c1 | nmdc:mga00v17_69463_c1_891_1610 | 239 |
| 18 | 3300050492 | nmdc:mga0yw44_13411_c1 | nmdc:mga0yw44_13411_c1_1124_1843 | 239 |
| 19 | 3300050492 | nmdc:mga0yw44_225837_c1 | nmdc:mga0yw44_225837_c1_178_897 | 239 |
| 20 | 3300050494 | nmdc:mga06z11_1542_c1 | nmdc:mga06z11_1542_c1_1336_2055 | 239 |
| 21 | 3300050495 | nmdc:mga04h51_37858_c1 | nmdc:mga04h51_37858_c1_351_1070 | 239 |
| 22 | 3300050507 | nmdc:mga05p37_34591_c1 | nmdc:mga05p37_34591_c1_3402_4121 | 239 |
| 23 | 3300050510 | nmdc:mga06r32_112571_c1 | nmdc:mga06r32_112571_c1_1557_2276 | 239 |
| 24 | 3300050511 | nmdc:mga08y16_478747_c1 | nmdc:mga08y16_478747_c1_334_1053 | 239 |
| 25 | 3300053119 | Ga0500595_050461 | Ga0500595_050461_552_1271 | 239 |
| 26 | 3300053137 | Ga0500561_0035968 | Ga0500561_0035968_313_1032 | 239 |
| 27 | 3300005842 | Ga0068858_100532949 | Ga0068858_1005329492 | 240 |
| 28 | 3300026035 | Ga0207703_10672537 | Ga0207703_106725372 | 240 |
| 29 | iso_pu_bacteria | 2857465823 | 2857472508 | 244 |
| 30 | 3300009177 | Ga0105248_10043196 | Ga0105248_100431964 | 245 |
| 31 | 3300025941 | Ga0207711_10046935 | Ga0207711_100469353 | 245 |
| 32 | 3300047444 | Ga0495675_0287973 | Ga0495675_0287973_72_809 | 245 |
| 33 | 3300053077 | Ga0495601_0021260 | Ga0495601_0021260_2145_2882 | 245 |
| 34 | iso_pu_bacteria | 2939593269 | 2939594473 | 245 |
| 35 | 3300025292 | Ga0209676_1008057 | Ga0209676_10080576 | 248 |
| 36 | 3300048927 | Ga0496124_0000284 | Ga0496124_0000284_87807_88625 | 248 |
| 37 | 3300015261 | Ga0182006_1003839 | Ga0182006_10038391 | 249 |
| 38 | 3300025292 | Ga0209676_1001271 | Ga0209676_100127116 | 249 |
| 39 | 3300025294 | Ga0209025_1004673 | Ga0209025_10046731 | 249 |
| 40 | 3300050515 | nmdc:mga0a205_259772_c1 | nmdc:mga0a205_259772_c1_199_1008 | 249 |
| 41 | 3300003781 | Ga0055536_1040464 | Ga0055536_10404641 | 250 |
| 42 | 3300025292 | Ga0209676_1000855 | Ga0209676_100085525 | 250 |
| 43 | 3300005364 | Ga0070673_100003994 | Ga0070673_1000039942 | 252 |
| 44 | 3300005366 | Ga0070659_100234867 | Ga0070659_1002348672 | 252 |
| 45 | 3300025960 | Ga0207651_10013806 | Ga0207651_100138063 | 252 |
| 46 | 3300007076 | Ga0075435_100066884 | Ga0075435_1000668843 | 254 |
| 47 | 3300003771 | Ga0055526_1000314 | Ga0055526_100031431 | 255 |
| 48 | 3300003775 | Ga0055524_1000031 | Ga0055524_100003153 | 255 |
| 49 | 3300025291 | Ga0209675_1003302 | Ga0209675_10033028 | 255 |
| 50 | 3300025295 | Ga0209564_1000135 | Ga0209564_1000135138 | 255 |
| 51 | 3300025299 | Ga0209256_1000107 | Ga0209256_1000107137 | 255 |
| 52 | 3300048926 | Ga0496123_0224747 | Ga0496123_0224747_94_927 | 255 |
| 53 | 3300021388 | Ga0213875_10011286 | Ga0213875_100112863 | 256 |
| 54 | 3300037853 | Ga0436364_1405230 | Ga0436364_1405230_12434_13243 | 256 |
| 55 | 3300013105 | Ga0157369_10022078 | Ga0157369_100220784 | 258 |
| 56 | 3300046642 | Ga0495634_0326107 | Ga0495634_0326107_133_909 | 258 |
| 57 | 3300053145 | Ga0500586_037840 | Ga0500586_037840_141_917 | 258 |
| 58 | 3300028379 | Ga0268266_10131011 | Ga0268266_101310111 | 259 |
| 59 | 3300035089 | Ga0373944_0025022 | Ga0373944_0025022_223_1038 | 259 |
| 60 | 3300035113 | Ga0373936_0008179 | Ga0373936_0008179_373_1188 | 259 |
| 61 | 3300035116 | Ga0373945_0106128 | Ga0373945_0106128_149_964 | 259 |
| 62 | 3300035170 | Ga0373943_0000525 | Ga0373943_0000525_11565_12380 | 259 |
| 63 | 3300035171 | Ga0373946_0003308 | Ga0373946_0003308_1797_2612 | 259 |
| 64 | 3300035410 | Ga0373924_0027762 | Ga0373924_0027762_959_1774 | 259 |
| 65 | 3300035692 | Ga0373935_0008051 | Ga0373935_0008051_2039_2854 | 259 |
| 66 | 3300035695 | Ga0373927_0004290 | Ga0373927_0004290_1757_2572 | 259 |
| 67 | 3300035725 | Ga0373947_0000837 | Ga0373947_0000837_9530_10345 | 259 |
| 68 | 3300037068 | Ga0373925_0005184 | Ga0373925_0005184_7597_8412 | 259 |
| 69 | 3300046472 | Ga0495580_0188929 | Ga0495580_0188929_560_1375 | 259 |
| 70 | 3300046476 | Ga0495662_0198283 | Ga0495662_0198283_141_956 | 259 |
| 71 | 3300046514 | Ga0495618_0032170 | Ga0495618_0032170_834_1649 | 259 |
| 72 | 3300046514 | Ga0495618_0089004 | Ga0495618_0089004_1016_1831 | 259 |
| 73 | 3300046517 | Ga0495630_0053102 | Ga0495630_0053102_290_1105 | 259 |
| 74 | 3300046531 | Ga0495665_0065933 | Ga0495665_0065933_65_880 | 259 |
| 75 | 3300046533 | Ga0495640_0087440 | Ga0495640_0087440_1061_1876 | 259 |
| 76 | 3300046642 | Ga0495634_0014033 | Ga0495634_0014033_1849_2664 | 259 |
| 77 | 3300046663 | Ga0495635_0411470 | Ga0495635_0411470_38_853 | 259 |
| 78 | 3300046683 | Ga0495658_0021749 | Ga0495658_0021749_2453_3268 | 259 |
| 79 | 3300046689 | Ga0495613_0081586 | Ga0495613_0081586_1031_1846 | 259 |
| 80 | 3300046690 | Ga0495624_0024161 | Ga0495624_0024161_448_1263 | 259 |
| 81 | 3300047315 | Ga0495581_0041982 | Ga0495581_0041982_475_1290 | 259 |
| 82 | 3300047319 | Ga0495674_0007346 | Ga0495674_0007346_9609_10424 | 259 |
| 83 | 3300047322 | Ga0495680_0308341 | Ga0495680_0308341_265_1080 | 259 |
| 84 | 3300047322 | Ga0495680_0480262 | Ga0495680_0480262_26_805 | 259 |
| 85 | 3300047471 | Ga0495684_0040269 | Ga0495684_0040269_1757_2572 | 259 |
| 86 | 3300047471 | Ga0495684_0042457 | Ga0495684_0042457_1320_2135 | 259 |
| 87 | 3300047673 | Ga0495593_0025461 | Ga0495593_0025461_2376_3191 | 259 |
| 88 | 3300048088 | Ga0495602_0227961 | Ga0495602_0227961_402_1181 | 259 |
| 89 | 3300053077 | Ga0495601_0281956 | Ga0495601_0281956_132_947 | 259 |
| 90 | 3300053085 | Ga0495619_0364211 | Ga0495619_0364211_64_879 | 259 |
| 91 | 3300053728 | Ga0500657_124458 | Ga0500657_124458_47_862 | 259 |
| 92 | iso_pu_bacteria | 2899370129 | 2899373573 | 259 |
| 93 | 3300009147 | Ga0114129_10686652 | Ga0114129_106866522 | 260 |
| 94 | 3300006163 | Ga0070715_10016579 | Ga0070715_100165793 | 261 |
| 95 | 3300007076 | Ga0075435_100001029 | Ga0075435_10000102916 | 261 |
| 96 | 3300025905 | Ga0207685_10010229 | Ga0207685_100102293 | 261 |
| 97 | 3300027360 | Ga0209969_1004460 | Ga0209969_10044602 | 261 |
| 98 | 3300027364 | Ga0209967_1000754 | Ga0209967_10007541 | 261 |
| 99 | 3300027378 | Ga0209981_1000239 | Ga0209981_10002397 | 261 |
| 100 | 3300027462 | Ga0210000_1003860 | Ga0210000_10038602 | 261 |
| 101 | 3300027471 | Ga0209995_1004874 | Ga0209995_10048742 | 261 |
| 102 | 3300027543 | Ga0209999_1001900 | Ga0209999_10019003 | 261 |
| 103 | 3300035120 | Ga0373957_0020035 | Ga0373957_0020035_1426_2211 | 261 |
| 104 | 3300035724 | Ga0373933_0005461 | Ga0373933_0005461_4579_5364 | 261 |
| 105 | 3300036401 | Ga0373937_0085628 | Ga0373937_0085628_1596_2381 | 261 |
| 106 | 3300049568 | Ga0501031_0125444 | Ga0501031_0125444_203_988 | 261 |
| 107 | 3300049572 | Ga0501036_0056999 | Ga0501036_0056999_74_859 | 261 |
| 108 | 3300049576 | Ga0501040_0296620 | Ga0501040_0296620_115_900 | 261 |
| 109 | 3300049580 | Ga0501046_0058133 | Ga0501046_0058133_295_1080 | 261 |
| 110 | 3300049584 | Ga0501068_0145873 | Ga0501068_0145873_41_826 | 261 |
| 111 | 3300049588 | Ga0501072_0223376 | Ga0501072_0223376_301_1086 | 261 |
| 112 | 3300049591 | Ga0501075_0044518 | Ga0501075_0044518_611_1396 | 261 |
| 113 | 3300049741 | Ga0501079_0103083 | Ga0501079_0103083_836_1621 | 261 |
| 114 | 3300049824 | Ga0501045_0047229 | Ga0501045_0047229_1313_2098 | 261 |
| 115 | 3300050513 | nmdc:mga0rr50_7459_c1 | nmdc:mga0rr50_7459_c1_2265_3053 | 261 |
| 116 | 3300050515 | nmdc:mga0a205_242721_c1 | nmdc:mga0a205_242721_c1_743_1531 | 261 |
| 117 | 3300054114 | Ga0501084_0024349 | Ga0501084_0024349_2006_2791 | 261 |
| 118 | iso_pu_bacteria | 2818991446 | 2819600873 | 261 |
| 119 | iso_pu_bacteria | 2831265667 | 2831267493 | 261 |
| 120 | iso_pu_bacteria | 2838054893 | 2838055998 | 261 |
| 121 | iso_pu_bacteria | 2881927736 | 2881928903 | 261 |
| 122 | iso_pu_bacteria | 2928037797 | 2928042956 | 261 |
| 123 | iso_pu_bacteria | 2928044640 | 2928050385 | 261 |
| 124 | iso_pu_bacteria | 2954767861 | 2954768288 | 261 |
| 125 | iso_pu_bacteria | 8055225921 | 8055225980 | 261 |
| 126 | 3300005336 | Ga0070680_100097670 | Ga0070680_1000976703 | 262 |
| 127 | 3300005440 | Ga0070705_100019384 | Ga0070705_1000193842 | 262 |
| 128 | 3300005444 | Ga0070694_100017580 | Ga0070694_1000175802 | 262 |
| 129 | 3300005458 | Ga0070681_10237499 | Ga0070681_102374992 | 262 |
| 130 | 3300005467 | Ga0070706_100167319 | Ga0070706_1001673193 | 262 |
| 131 | 3300005530 | Ga0070679_100095190 | Ga0070679_1000951902 | 262 |
| 132 | 3300005536 | Ga0070697_100014513 | Ga0070697_1000145133 | 262 |
| 133 | 3300005545 | Ga0070695_100002465 | Ga0070695_1000024659 | 262 |
| 134 | 3300005545 | Ga0070695_100226069 | Ga0070695_1002260692 | 262 |
| 135 | 3300005546 | Ga0070696_100054505 | Ga0070696_1000545054 | 262 |
| 136 | 3300005546 | Ga0070696_100397112 | Ga0070696_1003971122 | 262 |
| 137 | 3300005547 | Ga0070693_100096016 | Ga0070693_1000960162 | 262 |
| 138 | 3300005549 | Ga0070704_100487516 | Ga0070704_1004875162 | 262 |
| 139 | 3300005985 | Ga0081539_10000668 | Ga0081539_1000066855 | 262 |
| 140 | 3300006847 | Ga0075431_100052381 | Ga0075431_1000523812 | 262 |
| 141 | 3300006871 | Ga0075434_100005079 | Ga0075434_1000050792 | 262 |
| 142 | 3300006880 | Ga0075429_100070114 | Ga0075429_1000701144 | 262 |
| 143 | 3300006914 | Ga0075436_100017933 | Ga0075436_1000179333 | 262 |
| 144 | 3300006914 | Ga0075436_100028258 | Ga0075436_1000282586 | 262 |
| 145 | 3300007076 | Ga0075435_100001714 | Ga0075435_10000171415 | 262 |
| 146 | 3300025910 | Ga0207684_10126446 | Ga0207684_101264463 | 262 |
| 147 | 3300025912 | Ga0207707_10159070 | Ga0207707_101590702 | 262 |
| 148 | 3300025921 | Ga0207652_10193030 | Ga0207652_101930302 | 262 |
| 149 | 3300026075 | Ga0207708_10075557 | Ga0207708_100755572 | 262 |
| 150 | 3300030522 | Ga0307512_10044663 | Ga0307512_100446632 | 262 |
| 151 | 3300032002 | Ga0307416_100663617 | Ga0307416_1006636171 | 262 |
| 152 | 3300035086 | Ga0373934_0067237 | Ga0373934_0067237_384_1172 | 262 |
| 153 | 3300035111 | Ga0373923_0032951 | Ga0373923_0032951_1043_1831 | 262 |
| 154 | 3300035118 | Ga0373954_0000012 | Ga0373954_0000012_23292_24080 | 262 |
| 155 | 3300035691 | Ga0373931_0092532 | Ga0373931_0092532_784_1572 | 262 |
| 156 | 3300035691 | Ga0373931_0247137 | Ga0373931_0247137_194_982 | 262 |
| 157 | 3300035724 | Ga0373933_0001549 | Ga0373933_0001549_8100_8888 | 262 |
| 158 | 3300036401 | Ga0373937_0002420 | Ga0373937_0002420_10175_10963 | 262 |
| 159 | 3300037312 | Ga0395899_0045204 | Ga0395899_0045204_2058_2846 | 262 |
| 160 | 3300041410 | Ga0439461_0002041 | Ga0439461_0002041_673_1467 | 262 |
| 161 | 3300042156 | Ga0439446_0000318 | Ga0439446_0000318_293_1087 | 262 |
| 162 | 3300042435 | Ga0439434_0000294 | Ga0439434_0000294_8878_9672 | 262 |
| 163 | 3300042436 | Ga0439435_0000060 | Ga0439435_0000060_3833_4627 | 262 |
| 164 | 3300044683 | Ga0466965_0019810 | Ga0466965_0019810_2432_3220 | 262 |
| 165 | 3300046454 | Ga0495592_0031460 | Ga0495592_0031460_3046_3834 | 262 |
| 166 | 3300046462 | Ga0495651_0106382 | Ga0495651_0106382_1237_2025 | 262 |
| 167 | 3300046476 | Ga0495662_0006315 | Ga0495662_0006315_906_1694 | 262 |
| 168 | 3300046511 | Ga0495608_0006145 | Ga0495608_0006145_4058_4846 | 262 |
| 169 | 3300046514 | Ga0495618_0051200 | Ga0495618_0051200_611_1399 | 262 |
| 170 | 3300046516 | Ga0495628_0021837 | Ga0495628_0021837_52_840 | 262 |
| 171 | 3300046517 | Ga0495630_0141497 | Ga0495630_0141497_35_823 | 262 |
| 172 | 3300046526 | Ga0495666_0038805 | Ga0495666_0038805_284_1072 | 262 |
| 173 | 3300046528 | Ga0495642_0053057 | Ga0495642_0053057_658_1446 | 262 |
| 174 | 3300046529 | Ga0495652_0311965 | Ga0495652_0311965_20_808 | 262 |
| 175 | 3300046533 | Ga0495640_0012982 | Ga0495640_0012982_1880_2668 | 262 |
| 176 | 3300046535 | Ga0495586_0003967 | Ga0495586_0003967_5510_6298 | 262 |
| 177 | 3300046536 | Ga0495587_0046773 | Ga0495587_0046773_546_1334 | 262 |
| 178 | 3300046543 | Ga0495645_0028082 | Ga0495645_0028082_1432_2220 | 262 |
| 179 | 3300046559 | Ga0495667_0010769 | Ga0495667_0010769_2229_3017 | 262 |
| 180 | 3300046642 | Ga0495634_0004412 | Ga0495634_0004412_4760_5548 | 262 |
| 181 | 3300046663 | Ga0495635_0046921 | Ga0495635_0046921_300_1088 | 262 |
| 182 | 3300046683 | Ga0495658_0020305 | Ga0495658_0020305_2053_2841 | 262 |
| 183 | 3300046690 | Ga0495624_0234012 | Ga0495624_0234012_192_980 | 262 |
| 184 | 3300046809 | Ga0495600_0019409 | Ga0495600_0019409_245_1033 | 262 |
| 185 | 3300047317 | Ga0495604_0003656 | Ga0495604_0003656_11275_12063 | 262 |
| 186 | 3300047319 | Ga0495674_0441819 | Ga0495674_0441819_151_939 | 262 |
| 187 | 3300047322 | Ga0495680_0001925 | Ga0495680_0001925_3167_3955 | 262 |
| 188 | 3300047471 | Ga0495684_0101182 | Ga0495684_0101182_245_1033 | 262 |
| 189 | 3300047673 | Ga0495593_0078254 | Ga0495593_0078254_228_1016 | 262 |
| 190 | 3300049578 | Ga0501042_0242302 | Ga0501042_0242302_489_1277 | 262 |
| 191 | 3300049583 | Ga0501067_0284713 | Ga0501067_0284713_35_823 | 262 |
| 192 | 3300049585 | Ga0501069_0295782 | Ga0501069_0295782_53_841 | 262 |
| 193 | 3300049661 | Ga0501217_026806 | Ga0501217_026806_468_1265 | 262 |
| 194 | 3300050510 | nmdc:mga06r32_56178_c1 | nmdc:mga06r32_56178_c1_2966_3754 | 262 |
| 195 | 3300050512 | nmdc:mga0n895_6751_c1 | nmdc:mga0n895_6751_c1_338_1126 | 262 |
| 196 | 3300050512 | nmdc:mga0n895_90_c1 | nmdc:mga0n895_90_c1_46149_46937 | 262 |
| 197 | 3300050513 | nmdc:mga0rr50_2923_c1 | nmdc:mga0rr50_2923_c1_5455_6243 | 262 |
| 198 | 3300050514 | nmdc:mga08x19_101005_c1 | nmdc:mga08x19_101005_c1_217_1005 | 262 |
| 199 | 3300050514 | nmdc:mga08x19_102452_c1 | nmdc:mga08x19_102452_c1_881_1669 | 262 |
| 200 | 3300050514 | nmdc:mga08x19_4374_c1 | nmdc:mga08x19_4374_c1_3582_4412 | 262 |
| 201 | 3300050514 | nmdc:mga08x19_77997_c1 | nmdc:mga08x19_77997_c1_239_1051 | 262 |
| 202 | 3300053077 | Ga0495601_0045345 | Ga0495601_0045345_1484_2272 | 262 |
| 203 | 3300061734 | Ga0530510_0389233 | Ga0530510_0389233_247_1035 | 262 |
| 204 | iso_pu_bacteria | 2513020051 | 2513228983 | 262 |
| 205 | iso_pu_bacteria | 2513237087 | 2513590126 | 262 |
| 206 | iso_pu_bacteria | 2545555834 | 2545672586 | 262 |
| 207 | iso_pu_bacteria | 2599185214 | 2599621134 | 262 |
| 208 | iso_pu_bacteria | 2599185226 | 2599675152 | 262 |
| 209 | iso_pu_bacteria | 2599185227 | 2599678250 | 262 |
| 210 | iso_pu_bacteria | 2599185229 | 2599690645 | 262 |
| 211 | iso_pu_bacteria | 2643221547 | 2643757462 | 262 |
| 212 | iso_pu_bacteria | 2738541317 | 2738948640 | 262 |
| 213 | iso_pu_bacteria | 2847930680 | 2847932446 | 262 |
| 214 | iso_pu_bacteria | 2855730933 | 2855733452 | 262 |
| 215 | iso_pu_bacteria | 2855767633 | 2855772331 | 262 |
| 216 | iso_pu_bacteria | 2881412998 | 2881417918 | 262 |
| 217 | iso_pu_bacteria | 2883577096 | 2883577378 | 262 |
| 218 | iso_pu_bacteria | 2885270888 | 2885277359 | 262 |
| 219 | iso_pu_bacteria | 2887375801 | 2887377366 | 262 |
| 220 | iso_pu_bacteria | 2894772417 | 2894774891 | 262 |
| 221 | iso_pu_bacteria | 2904449895 | 2904455833 | 262 |
| 222 | iso_pu_bacteria | 2904456579 | 2904461523 | 262 |
| 223 | iso_pu_bacteria | 2913308742 | 2913313657 | 262 |
| 224 | iso_pu_bacteria | 2928084124 | 2928088310 | 262 |
| 225 | iso_pu_bacteria | 2929199973 | 2929203757 | 262 |
| 226 | iso_pu_bacteria | 2929520902 | 2929522985 | 262 |
| 227 | iso_pu_bacteria | 2935732158 | 2935733593 | 262 |
| 228 | iso_pu_bacteria | 2935732158 | 2935733609 | 262 |
| 229 | iso_pu_bacteria | 2935741537 | 2935742972 | 262 |
| 230 | iso_pu_bacteria | 2935741537 | 2935742988 | 262 |
| 231 | iso_pu_bacteria | 2941531003 | 2941537451 | 262 |
| 232 | iso_pu_bacteria | 2954711539 | 2954720576 | 262 |
| 233 | iso_pu_bacteria | 2954721474 | 2954730124 | 262 |
| 234 | iso_pu_bacteria | 2954731030 | 2954731911 | 262 |
| 235 | iso_pu_bacteria | 2954740390 | 2954748844 | 262 |
| 236 | iso_pu_bacteria | 2954749733 | 2954750621 | 262 |
| 237 | iso_pu_bacteria | 8055225921 | 8055226922 | 262 |
| 238 | iso_pu_bacteria | 8055909800 | 8055915945 | 262 |
| 239 | 3300005441 | Ga0070700_100148601 | Ga0070700_1001486012 | 263 |
| 240 | 3300005618 | Ga0068864_100579545 | Ga0068864_1005795451 | 263 |
| 241 | 3300006237 | Ga0097621_100066478 | Ga0097621_1000664782 | 263 |
| 242 | 3300006358 | Ga0068871_100008998 | Ga0068871_1000089985 | 263 |
| 243 | 3300009094 | Ga0111539_10103262 | Ga0111539_101032623 | 263 |
| 244 | 3300009177 | Ga0105248_10047663 | Ga0105248_100476636 | 263 |
| 245 | 3300026116 | Ga0207674_10550578 | Ga0207674_105505782 | 263 |
| 246 | 3300028794 | Ga0307515_10192792 | Ga0307515_101927922 | 263 |
| 247 | 3300031456 | Ga0307513_10289529 | Ga0307513_102895292 | 263 |
| 248 | 3300035085 | Ga0373929_0005610 | Ga0373929_0005610_250_1041 | 263 |
| 249 | 3300035171 | Ga0373946_0029824 | Ga0373946_0029824_652_1461 | 263 |
| 250 | 3300035691 | Ga0373931_0022581 | Ga0373931_0022581_1229_2020 | 263 |
| 251 | 3300035695 | Ga0373927_0026329 | Ga0373927_0026329_1441_2250 | 263 |
| 252 | 3300044706 | Ga0466964_0022269 | Ga0466964_0022269_932_1732 | 263 |
| 253 | 3300045976 | Ga0466967_0008390 | Ga0466967_0008390_6650_7450 | 263 |
| 254 | 3300046454 | Ga0495592_0173566 | Ga0495592_0173566_334_1143 | 263 |
| 255 | 3300046473 | Ga0495582_0223304 | Ga0495582_0223304_242_1033 | 263 |
| 256 | 3300046475 | Ga0495639_0196011 | Ga0495639_0196011_38_847 | 263 |
| 257 | 3300046476 | Ga0495662_0014982 | Ga0495662_0014982_1937_2746 | 263 |
| 258 | 3300046514 | Ga0495618_0007467 | Ga0495618_0007467_1968_2777 | 263 |
| 259 | 3300046517 | Ga0495630_0027554 | Ga0495630_0027554_1396_2205 | 263 |
| 260 | 3300046517 | Ga0495630_0153683 | Ga0495630_0153683_554_1345 | 263 |
| 261 | 3300046529 | Ga0495652_0098554 | Ga0495652_0098554_1152_1961 | 263 |
| 262 | 3300046533 | Ga0495640_0007495 | Ga0495640_0007495_6107_6916 | 263 |
| 263 | 3300046533 | Ga0495640_0019735 | Ga0495640_0019735_2101_2892 | 263 |
| 264 | 3300046535 | Ga0495586_0015139 | Ga0495586_0015139_1197_1988 | 263 |
| 265 | 3300046543 | Ga0495645_0008752 | Ga0495645_0008752_175_984 | 263 |
| 266 | 3300046642 | Ga0495634_0034169 | Ga0495634_0034169_960_1769 | 263 |
| 267 | 3300046642 | Ga0495634_0035265 | Ga0495634_0035265_2231_3022 | 263 |
| 268 | 3300046675 | Ga0495657_0308428 | Ga0495657_0308428_44_865 | 263 |
| 269 | 3300046680 | Ga0495646_0082369 | Ga0495646_0082369_122_931 | 263 |
| 270 | 3300046690 | Ga0495624_0114792 | Ga0495624_0114792_168_959 | 263 |
| 271 | 3300046690 | Ga0495624_0339736 | Ga0495624_0339736_20_829 | 263 |
| 272 | 3300047315 | Ga0495581_0117749 | Ga0495581_0117749_72_863 | 263 |
| 273 | 3300047319 | Ga0495674_0215392 | Ga0495674_0215392_159_968 | 263 |
| 274 | 3300047471 | Ga0495684_0006621 | Ga0495684_0006621_6415_7224 | 263 |
| 275 | 3300050508 | nmdc:mga09592_349416_c1 | nmdc:mga09592_349416_c1_472_1266 | 263 |
| 276 | 3300053077 | Ga0495601_0056953 | Ga0495601_0056953_707_1516 | 263 |
| 277 | 3300053077 | Ga0495601_0348136 | Ga0495601_0348136_59_850 | 263 |
| 278 | 3300053078 | Ga0495612_0004321 | Ga0495612_0004321_1251_2060 | 263 |
| 279 | 3300053085 | Ga0495619_0018578 | Ga0495619_0018578_2281_3090 | 263 |
| 280 | 3300053088 | Ga0500644_0007117 | Ga0500644_0007117_1048_1860 | 263 |
| 281 | 3300053153 | Ga0500616_0081258 | Ga0500616_0081258_105_908 | 263 |
| 282 | iso_pu_bacteria | 2837678835 | 2837679615 | 263 |
| 283 | 3300003759 | Ga0055525_1000001 | Ga0055525_1000001854 | 264 |
| 284 | 3300005719 | Ga0068861_100062553 | Ga0068861_1000625532 | 264 |
| 285 | 3300005841 | Ga0068863_100071220 | Ga0068863_1000712204 | 264 |
| 286 | 3300005844 | Ga0068862_100041473 | Ga0068862_1000414732 | 264 |
| 287 | 3300025230 | Ga0209563_100007 | Ga0209563_100007244 | 264 |
| 288 | 3300025972 | Ga0207668_10068701 | Ga0207668_100687013 | 264 |
| 289 | 3300026118 | Ga0207675_100033365 | Ga0207675_1000333653 | 264 |
| 290 | 3300028794 | Ga0307515_10000292 | Ga0307515_1000029272 | 264 |
| 291 | 3300031507 | Ga0307509_10028152 | Ga0307509_100281525 | 264 |
| 292 | 3300031730 | Ga0307516_10367075 | Ga0307516_103670752 | 264 |
| 293 | 3300033179 | Ga0307507_10051930 | Ga0307507_100519303 | 264 |
| 294 | 3300037418 | Ga0395900_0030673 | Ga0395900_0030673_1780_2607 | 264 |
| 295 | 3300037466 | Ga0395898_0025102 | Ga0395898_0025102_4592_5422 | 264 |
| 296 | 3300037466 | Ga0395898_0039335 | Ga0395898_0039335_1344_2171 | 264 |
| 297 | 3300037471 | Ga0395905_0107527 | Ga0395905_0107527_1252_2082 | 264 |
| 298 | 3300038443 | Ga0395901_0004298 | Ga0395901_0004298_957_1784 | 264 |
| 299 | 3300046526 | Ga0495666_0045895 | Ga0495666_0045895_1028_1822 | 264 |
| 300 | iso_pu_bacteria | 2643221556 | 2643802497 | 264 |
| 301 | iso_pu_bacteria | 2643221684 | 2644475920 | 264 |
| 302 | 3300005288 | Ga0065714_10152351 | Ga0065714_101523512 | 265 |
| 303 | 3300005333 | Ga0070677_10039250 | Ga0070677_100392503 | 265 |
| 304 | 3300005347 | Ga0070668_100015026 | Ga0070668_1000150264 | 265 |
| 305 | 3300005354 | Ga0070675_100040003 | Ga0070675_1000400035 | 265 |
| 306 | 3300005364 | Ga0070673_100339346 | Ga0070673_1003393461 | 265 |
| 307 | 3300005367 | Ga0070667_100029930 | Ga0070667_1000299305 | 265 |
| 308 | 3300005436 | Ga0070713_100314160 | Ga0070713_1003141601 | 265 |
| 309 | 3300005445 | Ga0070708_100011316 | Ga0070708_1000113162 | 265 |
| 310 | 3300005468 | Ga0070707_100005638 | Ga0070707_1000056383 | 265 |
| 311 | 3300005471 | Ga0070698_100096540 | Ga0070698_1000965403 | 265 |
| 312 | 3300005518 | Ga0070699_100034500 | Ga0070699_1000345003 | 265 |
| 313 | 3300005543 | Ga0070672_100025104 | Ga0070672_1000251044 | 265 |
| 314 | 3300005548 | Ga0070665_100053124 | Ga0070665_1000531246 | 265 |
| 315 | 3300005616 | Ga0068852_100574103 | Ga0068852_1005741031 | 265 |
| 316 | 3300006028 | Ga0070717_10323784 | Ga0070717_103237841 | 265 |
| 317 | 3300006175 | Ga0070712_100012114 | Ga0070712_1000121144 | 265 |
| 318 | 3300006914 | Ga0075436_100068532 | Ga0075436_1000685322 | 265 |
| 319 | 3300013306 | Ga0163162_10011627 | Ga0163162_100116272 | 265 |
| 320 | 3300024227 | Ga0228598_1011274 | Ga0228598_10112742 | 265 |
| 321 | 3300025915 | Ga0207693_10032045 | Ga0207693_100320452 | 265 |
| 322 | 3300025915 | Ga0207693_10222535 | Ga0207693_102225351 | 265 |
| 323 | 3300025916 | Ga0207663_10556355 | Ga0207663_105563551 | 265 |
| 324 | 3300025922 | Ga0207646_10014392 | Ga0207646_100143929 | 265 |
| 325 | 3300025926 | Ga0207659_10017661 | Ga0207659_100176611 | 265 |
| 326 | 3300025940 | Ga0207691_10034563 | Ga0207691_100345635 | 265 |
| 327 | 3300025972 | Ga0207668_10062991 | Ga0207668_100629912 | 265 |
| 328 | 3300028379 | Ga0268266_10016915 | Ga0268266_100169159 | 265 |
| 329 | 3300028800 | Ga0265338_10469888 | Ga0265338_104698881 | 265 |
| 330 | 3300031090 | Ga0265760_10002646 | Ga0265760_100026463 | 265 |
| 331 | 3300031241 | Ga0265325_10103956 | Ga0265325_101039562 | 265 |
| 332 | 3300031249 | Ga0265339_10000165 | Ga0265339_100001653 | 265 |
| 333 | 3300031456 | Ga0307513_10011033 | Ga0307513_1001103310 | 265 |
| 334 | 3300031595 | Ga0265313_10000300 | Ga0265313_1000030048 | 265 |
| 335 | 3300044684 | Ga0466966_0053889 | Ga0466966_0053889_1252_2049 | 265 |
| 336 | 3300044694 | Ga0466963_0103318 | Ga0466963_0103318_1136_1933 | 265 |
| 337 | 3300044719 | Ga0466971_0110042 | Ga0466971_0110042_26_823 | 265 |
| 338 | 3300045049 | Ga0466959_0153079 | Ga0466959_0153079_239_1036 | 265 |
| 339 | 3300046452 | Ga0495617_043193 | Ga0495617_043193_153_968 | 265 |
| 340 | 3300046460 | Ga0495638_0001364 | Ga0495638_0001364_6941_7756 | 265 |
| 341 | 3300046474 | Ga0495605_0000704 | Ga0495605_0000704_14671_15486 | 265 |
| 342 | 3300046491 | Ga0495584_0063845 | Ga0495584_0063845_39_854 | 265 |
| 343 | 3300046492 | Ga0495585_0117879 | Ga0495585_0117879_25_840 | 265 |
| 344 | 3300046501 | Ga0495607_0005354 | Ga0495607_0005354_4463_5278 | 265 |
| 345 | 3300046506 | Ga0495583_0000330 | Ga0495583_0000330_18613_19428 | 265 |
| 346 | 3300046511 | Ga0495608_0074903 | Ga0495608_0074903_373_1170 | 265 |
| 347 | 3300046513 | Ga0495616_0003188 | Ga0495616_0003188_6902_7717 | 265 |
| 348 | 3300046523 | Ga0495644_0000544 | Ga0495644_0000544_9756_10571 | 265 |
| 349 | 3300046524 | Ga0495648_0000877 | Ga0495648_0000877_19893_20708 | 265 |
| 350 | 3300046538 | Ga0495609_0002139 | Ga0495609_0002139_10767_11582 | 265 |
| 351 | 3300046542 | Ga0495597_0000375 | Ga0495597_0000375_3632_4462 | 265 |
| 352 | 3300046558 | Ga0495633_0002799 | Ga0495633_0002799_7094_7909 | 265 |
| 353 | 3300046615 | Ga0495656_0002877 | Ga0495656_0002877_411_1226 | 265 |
| 354 | 3300046648 | Ga0495611_0001362 | Ga0495611_0001362_7138_7953 | 265 |
| 355 | 3300046660 | Ga0495625_0003687 | Ga0495625_0003687_14073_14888 | 265 |
| 356 | 3300046664 | Ga0495659_0000800 | Ga0495659_0000800_6530_7345 | 265 |
| 357 | 3300046665 | Ga0495661_0009170 | Ga0495661_0009170_2529_3344 | 265 |
| 358 | 3300046691 | Ga0495670_0001448 | Ga0495670_0001448_6711_7526 | 265 |
| 359 | 3300046692 | Ga0495671_0015456 | Ga0495671_0015456_3127_3942 | 265 |
| 360 | 3300047318 | Ga0495636_0000153 | Ga0495636_0000153_18913_19728 | 265 |
| 361 | 3300047320 | Ga0495672_0007385 | Ga0495672_0007385_3930_4745 | 265 |
| 362 | 3300047323 | Ga0495683_0001329 | Ga0495683_0001329_224_1039 | 265 |
| 363 | 3300047443 | Ga0495687_000498 | Ga0495687_000498_33377_34192 | 265 |
| 364 | 3300047445 | Ga0495677_0000593 | Ga0495677_0000593_224_1039 | 265 |
| 365 | 3300047447 | Ga0495685_000010 | Ga0495685_000010_203_1018 | 265 |
| 366 | 3300047469 | Ga0495673_0003866 | Ga0495673_0003866_4467_5282 | 265 |
| 367 | 3300047472 | Ga0495686_0059784 | Ga0495686_0059784_1260_2075 | 265 |
| 368 | 3300048908 | Ga0496105_0011105 | Ga0496105_0011105_5056_5853 | 265 |
| 369 | 3300048928 | Ga0496125_0004558 | Ga0496125_0004558_12019_12816 | 265 |
| 370 | 3300049459 | Ga0495678_000525 | Ga0495678_000525_24927_25742 | 265 |
| 371 | 3300049460 | Ga0495682_0008853 | Ga0495682_0008853_2298_3113 | 265 |
| 372 | 3300049568 | Ga0501031_0035858 | Ga0501031_0035858_1475_2284 | 265 |
| 373 | 3300049568 | Ga0501031_0243342 | Ga0501031_0243342_48_845 | 265 |
| 374 | 3300049569 | Ga0501032_0037351 | Ga0501032_0037351_1349_2146 | 265 |
| 375 | 3300049569 | Ga0501032_0091160 | Ga0501032_0091160_872_1681 | 265 |
| 376 | 3300049570 | Ga0501033_0226769 | Ga0501033_0226769_55_864 | 265 |
| 377 | 3300049571 | Ga0501034_0000070 | Ga0501034_0000070_133774_134571 | 265 |
| 378 | 3300049571 | Ga0501034_0013989 | Ga0501034_0013989_1762_2559 | 265 |
| 379 | 3300049571 | Ga0501034_0021659 | Ga0501034_0021659_2505_3314 | 265 |
| 380 | 3300049571 | Ga0501034_0064750 | Ga0501034_0064750_1144_1941 | 265 |
| 381 | 3300049572 | Ga0501036_0025154 | Ga0501036_0025154_1403_2200 | 265 |
| 382 | 3300049572 | Ga0501036_0389270 | Ga0501036_0389270_334_1143 | 265 |
| 383 | 3300049574 | Ga0501038_0040531 | Ga0501038_0040531_2268_3077 | 265 |
| 384 | 3300049574 | Ga0501038_0058873 | Ga0501038_0058873_1342_2139 | 265 |
| 385 | 3300049575 | Ga0501039_0260542 | Ga0501039_0260542_124_921 | 265 |
| 386 | 3300049581 | Ga0501047_0008244 | Ga0501047_0008244_5462_6259 | 265 |
| 387 | 3300049584 | Ga0501068_0241952 | Ga0501068_0241952_197_994 | 265 |
| 388 | 3300049586 | Ga0501070_0012418 | Ga0501070_0012418_1475_2284 | 265 |
| 389 | 3300049741 | Ga0501079_0099173 | Ga0501079_0099173_271_1068 | 265 |
| 390 | 3300049744 | Ga0501083_0047864 | Ga0501083_0047864_287_1084 | 265 |
| 391 | 3300049760 | Ga0501263_013173 | Ga0501263_013173_151_948 | 265 |
| 392 | 3300049822 | Ga0501035_0110593 | Ga0501035_0110593_1009_1818 | 265 |
| 393 | 3300049823 | Ga0501044_0079246 | Ga0501044_0079246_1799_2608 | 265 |
| 394 | 3300049823 | Ga0501044_0291819 | Ga0501044_0291819_407_1204 | 265 |
| 395 | 3300060353 | Ga0501082_0194886 | Ga0501082_0194886_854_1651 | 265 |
| 396 | iso_pu_bacteria | 2857576091 | 2857580740 | 265 |
| 397 | 3300000042 | ARSoilYngRDRAFT_c00576 | ARSoilYngRDRAFT_005762 | 266 |
| 398 | 3300000043 | ARcpr5yngRDRAFT_c001137 | ARcpr5yngRDRAFT_0011373 | 266 |
| 399 | 3300000044 | ARSoilOldRDRAFT_c000653 | ARSoilOldRDRAFT_0006534 | 266 |
| 400 | 3300000045 | ARCol0oldRDRAFT_c00755 | ARCol0oldRDRAFT_007552 | 266 |
| 401 | 3300000652 | ARCol0yngRDRAFT_1001991 | ARCol0yngRDRAFT_10019911 | 266 |
| 402 | 3300001430 | JGI24032J14994_100465 | JGI24032J14994_1004652 | 266 |
| 403 | 3300001979 | JGI24740J21852_10002833 | JGI24740J21852_100028338 | 266 |
| 404 | 3300001979 | JGI24740J21852_10044403 | JGI24740J21852_100444032 | 266 |
| 405 | 3300001989 | JGI24739J22299_10002387 | JGI24739J22299_100023872 | 266 |
| 406 | 3300001989 | JGI24739J22299_10007118 | JGI24739J22299_100071184 | 266 |
| 407 | 3300001991 | JGI24743J22301_10006200 | JGI24743J22301_100062002 | 266 |
| 408 | 3300002075 | JGI24738J21930_10000453 | JGI24738J21930_100004538 | 266 |
| 409 | 3300002076 | JGI24749J21850_1001528 | JGI24749J21850_10015282 | 266 |
| 410 | 3300002077 | JGI24744J21845_10003861 | JGI24744J21845_100038612 | 266 |
| 411 | 3300002126 | JGI24035J26624_1000356 | JGI24035J26624_10003565 | 266 |
| 412 | 3300002244 | JGI24742J22300_10000709 | JGI24742J22300_100007097 | 266 |
| 413 | 3300002705 | JGI25156J39149_1001517 | JGI25156J39149_10015178 | 266 |
| 414 | 3300002738 | JGI25154J39366_1000333 | JGI25154J39366_100033314 | 266 |
| 415 | 3300003187 | JGI25151J46595_10018445 | JGI25151J46595_100184453 | 266 |
| 416 | 3300003203 | JGI25406J46586_10005393 | JGI25406J46586_100053933 | 266 |
| 417 | 3300003215 | JGI25153J46596_10000151 | JGI25153J46596_1000015116 | 266 |
| 418 | 3300003215 | JGI25153J46596_10002286 | JGI25153J46596_100022864 | 266 |
| 419 | 3300003215 | JGI25153J46596_10055377 | JGI25153J46596_100553772 | 266 |
| 420 | 3300003320 | rootH2_10182889 | rootH2_101828892 | 266 |
| 421 | 3300003323 | rootH1_10000649 | rootH1_1000064914 | 266 |
| 422 | 3300003354 | JGI25160J50197_1000163 | JGI25160J50197_100016336 | 266 |
| 423 | 3300003659 | JGI25404J52841_10000106 | JGI25404J52841_100001063 | 266 |
| 424 | 3300003751 | Ga0055538_1001362 | Ga0055538_10013625 | 266 |
| 425 | 3300003751 | Ga0055538_1001370 | Ga0055538_10013702 | 266 |
| 426 | 3300003752 | Ga0055539_1000145 | Ga0055539_100014561 | 266 |
| 427 | 3300003756 | Ga0055533_1000866 | Ga0055533_10008662 | 266 |
| 428 | 3300003756 | Ga0055533_1005873 | Ga0055533_10058732 | 266 |
| 429 | 3300003756 | Ga0055533_1005885 | Ga0055533_10058852 | 266 |
| 430 | 3300003758 | Ga0055532_1000469 | Ga0055532_10004693 | 266 |
| 431 | 3300003759 | Ga0055525_1001053 | Ga0055525_10010533 | 266 |
| 432 | 3300003761 | Ga0055535_1000999 | Ga0055535_10009993 | 266 |
| 433 | 3300003762 | Ga0055542_1000385 | Ga0055542_100038537 | 266 |
| 434 | 3300003763 | Ga0055529_1000831 | Ga0055529_100083115 | 266 |
| 435 | 3300003771 | Ga0055526_1026726 | Ga0055526_10267262 | 266 |
| 436 | 3300003773 | Ga0055537_1000688 | Ga0055537_100068816 | 266 |
| 437 | 3300003775 | Ga0055524_1016351 | Ga0055524_10163513 | 266 |
| 438 | 3300003775 | Ga0055524_1025859 | Ga0055524_10258592 | 266 |
| 439 | 3300003781 | Ga0055536_1000638 | Ga0055536_100063815 | 266 |
| 440 | 3300003781 | Ga0055536_1002200 | Ga0055536_10022008 | 266 |
| 441 | 3300003784 | Ga0055534_1000488 | Ga0055534_100048810 | 266 |
| 442 | 3300003791 | Ga0055530_10001927 | Ga0055530_100019277 | 266 |
| 443 | 3300003792 | Ga0055540_1000149 | Ga0055540_10001499 | 266 |
| 444 | 3300003792 | Ga0055540_1000275 | Ga0055540_10002755 | 266 |
| 445 | 3300003792 | Ga0055540_1003439 | Ga0055540_10034394 | 266 |
| 446 | 3300003794 | Ga0055531_10000062 | Ga0055531_1000006277 | 266 |
| 447 | 3300003841 | Ga0055541_1004944 | Ga0055541_10049442 | 266 |
| 448 | 3300003841 | Ga0055541_1006873 | Ga0055541_10068732 | 266 |
| 449 | 3300003841 | Ga0055541_1006878 | Ga0055541_10068782 | 266 |
| 450 | 3300005262 | Ga0065165_1001672 | Ga0065165_10016725 | 266 |
| 451 | 3300005288 | Ga0065714_10002324 | Ga0065714_1000232420 | 266 |
| 452 | 3300005289 | Ga0065704_10124798 | Ga0065704_101247982 | 266 |
| 453 | 3300005293 | Ga0065715_10112482 | Ga0065715_101124822 | 266 |
| 454 | 3300005295 | Ga0065707_10092907 | Ga0065707_100929074 | 266 |
| 455 | 3300005295 | Ga0065707_10102207 | Ga0065707_101022072 | 266 |
| 456 | 3300005327 | Ga0070658_10015415 | Ga0070658_100154152 | 266 |
| 457 | 3300005327 | Ga0070658_10021036 | Ga0070658_100210366 | 266 |
| 458 | 3300005327 | Ga0070658_10035934 | Ga0070658_100359342 | 266 |
| 459 | 3300005327 | Ga0070658_10155946 | Ga0070658_101559462 | 266 |
| 460 | 3300005327 | Ga0070658_10197897 | Ga0070658_101978971 | 266 |
| 461 | 3300005328 | Ga0070676_10002407 | Ga0070676_1000240710 | 266 |
| 462 | 3300005329 | Ga0070683_100004780 | Ga0070683_1000047802 | 266 |
| 463 | 3300005329 | Ga0070683_100139715 | Ga0070683_1001397152 | 266 |
| 464 | 3300005330 | Ga0070690_100000577 | Ga0070690_10000057718 | 266 |
| 465 | 3300005330 | Ga0070690_100059684 | Ga0070690_1000596842 | 266 |
| 466 | 3300005331 | Ga0070670_100026119 | Ga0070670_1000261193 | 266 |
| 467 | 3300005331 | Ga0070670_100691356 | Ga0070670_1006913561 | 266 |
| 468 | 3300005333 | Ga0070677_10000943 | Ga0070677_100009433 | 266 |
| 469 | 3300005334 | Ga0068869_100040653 | Ga0068869_1000406532 | 266 |
| 470 | 3300005335 | Ga0070666_10030069 | Ga0070666_100300694 | 266 |
| 471 | 3300005335 | Ga0070666_10038679 | Ga0070666_100386792 | 266 |
| 472 | 3300005336 | Ga0070680_100008066 | Ga0070680_1000080665 | 266 |
| 473 | 3300005336 | Ga0070680_100028142 | Ga0070680_1000281423 | 266 |
| 474 | 3300005336 | Ga0070680_100032815 | Ga0070680_1000328153 | 266 |
| 475 | 3300005336 | Ga0070680_100407707 | Ga0070680_1004077072 | 266 |
| 476 | 3300005337 | Ga0070682_100002906 | Ga0070682_1000029062 | 266 |
| 477 | 3300005337 | Ga0070682_100026631 | Ga0070682_1000266314 | 266 |
| 478 | 3300005337 | Ga0070682_100333548 | Ga0070682_1003335482 | 266 |
| 479 | 3300005338 | Ga0068868_100000892 | Ga0068868_1000008929 | 266 |
| 480 | 3300005339 | Ga0070660_100003390 | Ga0070660_10000339010 | 266 |
| 481 | 3300005339 | Ga0070660_100052583 | Ga0070660_1000525834 | 266 |
| 482 | 3300005339 | Ga0070660_100192548 | Ga0070660_1001925482 | 266 |
| 483 | 3300005340 | Ga0070689_100002855 | Ga0070689_1000028559 | 266 |
| 484 | 3300005341 | Ga0070691_10001992 | Ga0070691_100019922 | 266 |
| 485 | 3300005341 | Ga0070691_10214045 | Ga0070691_102140451 | 266 |
| 486 | 3300005343 | Ga0070687_100000895 | Ga0070687_1000008953 | 266 |
| 487 | 3300005344 | Ga0070661_100000172 | Ga0070661_10000017212 | 266 |
| 488 | 3300005344 | Ga0070661_100000804 | Ga0070661_1000008049 | 266 |
| 489 | 3300005344 | Ga0070661_100143009 | Ga0070661_1001430092 | 266 |
| 490 | 3300005344 | Ga0070661_100220425 | Ga0070661_1002204252 | 266 |
| 491 | 3300005345 | Ga0070692_10000830 | Ga0070692_100008303 | 266 |
| 492 | 3300005345 | Ga0070692_10072062 | Ga0070692_100720622 | 266 |
| 493 | 3300005347 | Ga0070668_100005596 | Ga0070668_1000055962 | 266 |
| 494 | 3300005353 | Ga0070669_100010788 | Ga0070669_1000107882 | 266 |
| 495 | 3300005353 | Ga0070669_100044673 | Ga0070669_1000446732 | 266 |
| 496 | 3300005354 | Ga0070675_100007817 | Ga0070675_1000078172 | 266 |
| 497 | 3300005354 | Ga0070675_100199836 | Ga0070675_1001998362 | 266 |
| 498 | 3300005355 | Ga0070671_100000144 | Ga0070671_1000001442 | 266 |
| 499 | 3300005355 | Ga0070671_100046072 | Ga0070671_1000460722 | 266 |
| 500 | 3300005355 | Ga0070671_100047928 | Ga0070671_1000479282 | 266 |
| 501 | 3300005355 | Ga0070671_100050429 | Ga0070671_1000504291 | 266 |
| 502 | 3300005355 | Ga0070671_100512005 | Ga0070671_1005120051 | 266 |
| 503 | 3300005356 | Ga0070674_100003771 | Ga0070674_1000037713 | 266 |
| 504 | 3300005356 | Ga0070674_100267397 | Ga0070674_1002673972 | 266 |
| 505 | 3300005364 | Ga0070673_100007016 | Ga0070673_1000070164 | 266 |
| 506 | 3300005364 | Ga0070673_100251216 | Ga0070673_1002512162 | 266 |
| 507 | 3300005364 | Ga0070673_100394145 | Ga0070673_1003941452 | 266 |
| 508 | 3300005365 | Ga0070688_100009077 | Ga0070688_1000090777 | 266 |
| 509 | 3300005365 | Ga0070688_100011259 | Ga0070688_1000112594 | 266 |
| 510 | 3300005365 | Ga0070688_100019796 | Ga0070688_1000197962 | 266 |
| 511 | 3300005365 | Ga0070688_100045165 | Ga0070688_1000451654 | 266 |
| 512 | 3300005366 | Ga0070659_100005098 | Ga0070659_10000509810 | 266 |
| 513 | 3300005367 | Ga0070667_100003448 | Ga0070667_1000034482 | 266 |
| 514 | 3300005367 | Ga0070667_100022884 | Ga0070667_1000228844 | 266 |
| 515 | 3300005367 | Ga0070667_100089458 | Ga0070667_1000894582 | 266 |
| 516 | 3300005367 | Ga0070667_100385199 | Ga0070667_1003851992 | 266 |
| 517 | 3300005406 | Ga0070703_10005909 | Ga0070703_100059092 | 266 |
| 518 | 3300005435 | Ga0070714_100015402 | Ga0070714_1000154024 | 266 |
| 519 | 3300005435 | Ga0070714_100272549 | Ga0070714_1002725492 | 266 |
| 520 | 3300005436 | Ga0070713_100005437 | Ga0070713_1000054374 | 266 |
| 521 | 3300005436 | Ga0070713_100040256 | Ga0070713_1000402565 | 266 |
| 522 | 3300005436 | Ga0070713_100042493 | Ga0070713_1000424932 | 266 |
| 523 | 3300005437 | Ga0070710_10002210 | Ga0070710_100022104 | 266 |
| 524 | 3300005437 | Ga0070710_10172690 | Ga0070710_101726902 | 266 |
| 525 | 3300005438 | Ga0070701_10000951 | Ga0070701_1000095110 | 266 |
| 526 | 3300005439 | Ga0070711_100026734 | Ga0070711_1000267344 | 266 |
| 527 | 3300005439 | Ga0070711_100300686 | Ga0070711_1003006862 | 266 |
| 528 | 3300005439 | Ga0070711_100391823 | Ga0070711_1003918231 | 266 |
| 529 | 3300005440 | Ga0070705_100003034 | Ga0070705_1000030342 | 266 |
| 530 | 3300005440 | Ga0070705_100020776 | Ga0070705_1000207764 | 266 |
| 531 | 3300005440 | Ga0070705_100344093 | Ga0070705_1003440932 | 266 |
| 532 | 3300005441 | Ga0070700_100001925 | Ga0070700_1000019253 | 266 |
| 533 | 3300005444 | Ga0070694_100013679 | Ga0070694_1000136794 | 266 |
| 534 | 3300005444 | Ga0070694_100195845 | Ga0070694_1001958452 | 266 |
| 535 | 3300005445 | Ga0070708_100076491 | Ga0070708_1000764913 | 266 |
| 536 | 3300005445 | Ga0070708_100155288 | Ga0070708_1001552882 | 266 |
| 537 | 3300005445 | Ga0070708_100228982 | Ga0070708_1002289821 | 266 |
| 538 | 3300005455 | Ga0070663_100000048 | Ga0070663_10000004837 | 266 |
| 539 | 3300005455 | Ga0070663_100008331 | Ga0070663_1000083316 | 266 |
| 540 | 3300005455 | Ga0070663_100066970 | Ga0070663_1000669703 | 266 |
| 541 | 3300005455 | Ga0070663_100408049 | Ga0070663_1004080492 | 266 |
| 542 | 3300005456 | Ga0070678_100019470 | Ga0070678_1000194703 | 266 |
| 543 | 3300005456 | Ga0070678_100031617 | Ga0070678_1000316174 | 266 |
| 544 | 3300005456 | Ga0070678_100032939 | Ga0070678_1000329393 | 266 |
| 545 | 3300005456 | Ga0070678_100168451 | Ga0070678_1001684512 | 266 |
| 546 | 3300005457 | Ga0070662_100009476 | Ga0070662_1000094766 | 266 |
| 547 | 3300005457 | Ga0070662_100125525 | Ga0070662_1001255252 | 266 |
| 548 | 3300005457 | Ga0070662_100399074 | Ga0070662_1003990741 | 266 |
| 549 | 3300005458 | Ga0070681_10079817 | Ga0070681_100798172 | 266 |
| 550 | 3300005458 | Ga0070681_10113424 | Ga0070681_101134243 | 266 |
| 551 | 3300005458 | Ga0070681_10168760 | Ga0070681_101687602 | 266 |
| 552 | 3300005458 | Ga0070681_10343051 | Ga0070681_103430512 | 266 |
| 553 | 3300005458 | Ga0070681_10423468 | Ga0070681_104234681 | 266 |
| 554 | 3300005459 | Ga0068867_100011042 | Ga0068867_1000110422 | 266 |
| 555 | 3300005459 | Ga0068867_100062306 | Ga0068867_1000623062 | 266 |
| 556 | 3300005459 | Ga0068867_100093862 | Ga0068867_1000938623 | 266 |
| 557 | 3300005466 | Ga0070685_10040340 | Ga0070685_100403402 | 266 |
| 558 | 3300005467 | Ga0070706_100448950 | Ga0070706_1004489502 | 266 |
| 559 | 3300005471 | Ga0070698_100436242 | Ga0070698_1004362421 | 266 |
| 560 | 3300005530 | Ga0070679_100019238 | Ga0070679_1000192386 | 266 |
| 561 | 3300005530 | Ga0070679_100088242 | Ga0070679_1000882423 | 266 |
| 562 | 3300005530 | Ga0070679_100260969 | Ga0070679_1002609692 | 266 |
| 563 | 3300005530 | Ga0070679_100309016 | Ga0070679_1003090161 | 266 |
| 564 | 3300005530 | Ga0070679_100468364 | Ga0070679_1004683642 | 266 |
| 565 | 3300005530 | Ga0070679_100589015 | Ga0070679_1005890152 | 266 |
| 566 | 3300005535 | Ga0070684_100001753 | Ga0070684_10000175315 | 266 |
| 567 | 3300005535 | Ga0070684_100016515 | Ga0070684_1000165155 | 266 |
| 568 | 3300005535 | Ga0070684_100104379 | Ga0070684_1001043791 | 266 |
| 569 | 3300005539 | Ga0068853_100005853 | Ga0068853_1000058533 | 266 |
| 570 | 3300005543 | Ga0070672_100030562 | Ga0070672_1000305623 | 266 |
| 571 | 3300005544 | Ga0070686_100000086 | Ga0070686_10000008654 | 266 |
| 572 | 3300005544 | Ga0070686_100008070 | Ga0070686_1000080705 | 266 |
| 573 | 3300005545 | Ga0070695_100007717 | Ga0070695_1000077172 | 266 |
| 574 | 3300005545 | Ga0070695_100057276 | Ga0070695_1000572761 | 266 |
| 575 | 3300005546 | Ga0070696_100004489 | Ga0070696_1000044892 | 266 |
| 576 | 3300005546 | Ga0070696_100149595 | Ga0070696_1001495951 | 266 |
| 577 | 3300005547 | Ga0070693_100053012 | Ga0070693_1000530122 | 266 |
| 578 | 3300005548 | Ga0070665_100008890 | Ga0070665_10000889010 | 266 |
| 579 | 3300005549 | Ga0070704_100000280 | Ga0070704_1000002803 | 266 |
| 580 | 3300005549 | Ga0070704_100053958 | Ga0070704_1000539582 | 266 |
| 581 | 3300005549 | Ga0070704_100140072 | Ga0070704_1001400722 | 266 |
| 582 | 3300005563 | Ga0068855_100001526 | Ga0068855_10000152615 | 266 |
| 583 | 3300005563 | Ga0068855_100027435 | Ga0068855_1000274353 | 266 |
| 584 | 3300005563 | Ga0068855_100037526 | Ga0068855_1000375266 | 266 |
| 585 | 3300005563 | Ga0068855_100097674 | Ga0068855_1000976742 | 266 |
| 586 | 3300005563 | Ga0068855_100171536 | Ga0068855_1001715362 | 266 |
| 587 | 3300005564 | Ga0070664_100000119 | Ga0070664_10000011912 | 266 |
| 588 | 3300005564 | Ga0070664_100008530 | Ga0070664_1000085309 | 266 |
| 589 | 3300005564 | Ga0070664_100044515 | Ga0070664_1000445154 | 266 |
| 590 | 3300005577 | Ga0068857_100005404 | Ga0068857_10000540410 | 266 |
| 591 | 3300005577 | Ga0068857_100031359 | Ga0068857_1000313594 | 266 |
| 592 | 3300005577 | Ga0068857_100067804 | Ga0068857_1000678045 | 266 |
| 593 | 3300005577 | Ga0068857_100636776 | Ga0068857_1006367762 | 266 |
| 594 | 3300005578 | Ga0068854_100003207 | Ga0068854_1000032072 | 266 |
| 595 | 3300005578 | Ga0068854_100010312 | Ga0068854_1000103125 | 266 |
| 596 | 3300005614 | Ga0068856_100000308 | Ga0068856_10000030812 | 266 |
| 597 | 3300005614 | Ga0068856_100010687 | Ga0068856_1000106872 | 266 |
| 598 | 3300005614 | Ga0068856_100258975 | Ga0068856_1002589752 | 266 |
| 599 | 3300005615 | Ga0070702_100014862 | Ga0070702_1000148624 | 266 |
| 600 | 3300005615 | Ga0070702_100116622 | Ga0070702_1001166222 | 266 |
| 601 | 3300005615 | Ga0070702_100204860 | Ga0070702_1002048602 | 266 |
| 602 | 3300005616 | Ga0068852_100002326 | Ga0068852_1000023264 | 266 |
| 603 | 3300005616 | Ga0068852_100031324 | Ga0068852_1000313246 | 266 |
| 604 | 3300005617 | Ga0068859_100009076 | Ga0068859_10000907610 | 266 |
| 605 | 3300005617 | Ga0068859_100039394 | Ga0068859_1000393944 | 266 |
| 606 | 3300005617 | Ga0068859_100053408 | Ga0068859_1000534084 | 266 |
| 607 | 3300005618 | Ga0068864_100001754 | Ga0068864_10000175414 | 266 |
| 608 | 3300005618 | Ga0068864_100013586 | Ga0068864_1000135865 | 266 |
| 609 | 3300005618 | Ga0068864_100050852 | Ga0068864_1000508524 | 266 |
| 610 | 3300005718 | Ga0068866_10001865 | Ga0068866_100018659 | 266 |
| 611 | 3300005719 | Ga0068861_100033242 | Ga0068861_1000332424 | 266 |
| 612 | 3300005719 | Ga0068861_100247729 | Ga0068861_1002477292 | 266 |
| 613 | 3300005840 | Ga0068870_10000419 | Ga0068870_1000041917 | 266 |
| 614 | 3300005841 | Ga0068863_100000340 | Ga0068863_10000034046 | 266 |
| 615 | 3300005841 | Ga0068863_100026204 | Ga0068863_1000262043 | 266 |
| 616 | 3300005842 | Ga0068858_100009413 | Ga0068858_1000094132 | 266 |
| 617 | 3300005842 | Ga0068858_100029243 | Ga0068858_1000292437 | 266 |
| 618 | 3300005842 | Ga0068858_100099646 | Ga0068858_1000996463 | 266 |
| 619 | 3300005843 | Ga0068860_100052206 | Ga0068860_1000522062 | 266 |
| 620 | 3300005843 | Ga0068860_100071592 | Ga0068860_1000715922 | 266 |
| 621 | 3300005843 | Ga0068860_100073526 | Ga0068860_1000735264 | 266 |
| 622 | 3300005843 | Ga0068860_100781709 | Ga0068860_1007817091 | 266 |
| 623 | 3300005844 | Ga0068862_100006116 | Ga0068862_10000611610 | 266 |
| 624 | 3300005844 | Ga0068862_100767656 | Ga0068862_1007676562 | 266 |
| 625 | 3300005937 | Ga0081455_10000007 | Ga0081455_10000007187 | 266 |
| 626 | 3300005983 | Ga0081540_1000002 | Ga0081540_1000002178 | 266 |
| 627 | 3300005985 | Ga0081539_10000394 | Ga0081539_100003943 | 266 |
| 628 | 3300006028 | Ga0070717_10003040 | Ga0070717_100030402 | 266 |
| 629 | 3300006028 | Ga0070717_10121840 | Ga0070717_101218402 | 266 |
| 630 | 3300006028 | Ga0070717_10139779 | Ga0070717_101397792 | 266 |
| 631 | 3300006038 | Ga0075365_10003142 | Ga0075365_100031421 | 266 |
| 632 | 3300006038 | Ga0075365_10100662 | Ga0075365_101006622 | 266 |
| 633 | 3300006038 | Ga0075365_10178335 | Ga0075365_101783352 | 266 |
| 634 | 3300006038 | Ga0075365_10252205 | Ga0075365_102522052 | 266 |
| 635 | 3300006038 | Ga0075365_10467938 | Ga0075365_104679382 | 266 |
| 636 | 3300006042 | Ga0075368_10003305 | Ga0075368_100033053 | 266 |
| 637 | 3300006042 | Ga0075368_10030278 | Ga0075368_100302782 | 266 |
| 638 | 3300006048 | Ga0075363_100000734 | Ga0075363_1000007349 | 266 |
| 639 | 3300006048 | Ga0075363_100017534 | Ga0075363_1000175342 | 266 |
| 640 | 3300006048 | Ga0075363_100041451 | Ga0075363_1000414513 | 266 |
| 641 | 3300006048 | Ga0075363_100043053 | Ga0075363_1000430532 | 266 |
| 642 | 3300006051 | Ga0075364_10027040 | Ga0075364_100270405 | 266 |
| 643 | 3300006051 | Ga0075364_10102231 | Ga0075364_101022312 | 266 |
| 644 | 3300006058 | Ga0075432_10028982 | Ga0075432_100289822 | 266 |
| 645 | 3300006058 | Ga0075432_10032292 | Ga0075432_100322922 | 266 |
| 646 | 3300006163 | Ga0070715_10005346 | Ga0070715_100053462 | 266 |
| 647 | 3300006173 | Ga0070716_100001217 | Ga0070716_10000121710 | 266 |
| 648 | 3300006175 | Ga0070712_100005950 | Ga0070712_1000059502 | 266 |
| 649 | 3300006175 | Ga0070712_100175548 | Ga0070712_1001755482 | 266 |
| 650 | 3300006177 | Ga0075362_10000286 | Ga0075362_1000028612 | 266 |
| 651 | 3300006177 | Ga0075362_10080265 | Ga0075362_100802652 | 266 |
| 652 | 3300006177 | Ga0075362_10109557 | Ga0075362_101095572 | 266 |
| 653 | 3300006177 | Ga0075362_10168438 | Ga0075362_101684382 | 266 |
| 654 | 3300006178 | Ga0075367_10000730 | Ga0075367_1000073010 | 266 |
| 655 | 3300006178 | Ga0075367_10002322 | Ga0075367_100023228 | 266 |
| 656 | 3300006178 | Ga0075367_10003087 | Ga0075367_100030875 | 266 |
| 657 | 3300006178 | Ga0075367_10038840 | Ga0075367_100388403 | 266 |
| 658 | 3300006178 | Ga0075367_10137112 | Ga0075367_101371122 | 266 |
| 659 | 3300006178 | Ga0075367_10352577 | Ga0075367_103525771 | 266 |
| 660 | 3300006186 | Ga0075369_10079221 | Ga0075369_100792212 | 266 |
| 661 | 3300006186 | Ga0075369_10110757 | Ga0075369_101107571 | 266 |
| 662 | 3300006186 | Ga0075369_10153483 | Ga0075369_101534832 | 266 |
| 663 | 3300006195 | Ga0075366_10001531 | Ga0075366_100015318 | 266 |
| 664 | 3300006195 | Ga0075366_10005069 | Ga0075366_100050697 | 266 |
| 665 | 3300006195 | Ga0075366_10015235 | Ga0075366_100152354 | 266 |
| 666 | 3300006195 | Ga0075366_10027421 | Ga0075366_100274213 | 266 |
| 667 | 3300006195 | Ga0075366_10034195 | Ga0075366_100341953 | 266 |
| 668 | 3300006237 | Ga0097621_100000880 | Ga0097621_10000088020 | 266 |
| 669 | 3300006237 | Ga0097621_100010589 | Ga0097621_1000105895 | 266 |
| 670 | 3300006353 | Ga0075370_10001459 | Ga0075370_100014592 | 266 |
| 671 | 3300006353 | Ga0075370_10007230 | Ga0075370_100072306 | 266 |
| 672 | 3300006353 | Ga0075370_10065979 | Ga0075370_100659792 | 266 |
| 673 | 3300006353 | Ga0075370_10079544 | Ga0075370_100795442 | 266 |
| 674 | 3300006353 | Ga0075370_10149080 | Ga0075370_101490802 | 266 |
| 675 | 3300006358 | Ga0068871_100006040 | Ga0068871_1000060409 | 266 |
| 676 | 3300006358 | Ga0068871_100036409 | Ga0068871_1000364092 | 266 |
| 677 | 3300006844 | Ga0075428_100001723 | Ga0075428_10000172314 | 266 |
| 678 | 3300006844 | Ga0075428_100006547 | Ga0075428_1000065473 | 266 |
| 679 | 3300006846 | Ga0075430_100000201 | Ga0075430_10000020114 | 266 |
| 680 | 3300006847 | Ga0075431_100000260 | Ga0075431_10000026014 | 266 |
| 681 | 3300006847 | Ga0075431_100001007 | Ga0075431_1000010071 | 266 |
| 682 | 3300006852 | Ga0075433_10000007 | Ga0075433_1000000765 | 266 |
| 683 | 3300006852 | Ga0075433_10019271 | Ga0075433_100192713 | 266 |
| 684 | 3300006852 | Ga0075433_10297785 | Ga0075433_102977851 | 266 |
| 685 | 3300006871 | Ga0075434_100000091 | Ga0075434_10000009133 | 266 |
| 686 | 3300006871 | Ga0075434_100054318 | Ga0075434_1000543187 | 266 |
| 687 | 3300006871 | Ga0075434_100243466 | Ga0075434_1002434662 | 266 |
| 688 | 3300006871 | Ga0075434_100459202 | Ga0075434_1004592022 | 266 |
| 689 | 3300006880 | Ga0075429_100001265 | Ga0075429_10000126513 | 266 |
| 690 | 3300006881 | Ga0068865_100000615 | Ga0068865_1000006152 | 266 |
| 691 | 3300006881 | Ga0068865_100080765 | Ga0068865_1000807652 | 266 |
| 692 | 3300006881 | Ga0068865_100121213 | Ga0068865_1001212131 | 266 |
| 693 | 3300006914 | Ga0075436_100015888 | Ga0075436_1000158884 | 266 |
| 694 | 3300006914 | Ga0075436_100104260 | Ga0075436_1001042602 | 266 |
| 695 | 3300006931 | Ga0097620_100009075 | Ga0097620_1000090753 | 266 |
| 696 | 3300006931 | Ga0097620_100039391 | Ga0097620_1000393914 | 266 |
| 697 | 3300006931 | Ga0097620_100053406 | Ga0097620_1000534064 | 266 |
| 698 | 3300007076 | Ga0075435_100011790 | Ga0075435_1000117901 | 266 |
| 699 | 3300007265 | Ga0099794_10003104 | Ga0099794_100031042 | 266 |
| 700 | 3300007265 | Ga0099794_10056087 | Ga0099794_100560873 | 266 |
| 701 | 3300007788 | Ga0099795_10017367 | Ga0099795_100173673 | 266 |
| 702 | 3300009011 | Ga0105251_10003023 | Ga0105251_100030238 | 266 |
| 703 | 3300009011 | Ga0105251_10018333 | Ga0105251_100183332 | 266 |
| 704 | 3300009011 | Ga0105251_10147661 | Ga0105251_101476611 | 266 |
| 705 | 3300009036 | Ga0105244_10004322 | Ga0105244_100043224 | 266 |
| 706 | 3300009036 | Ga0105244_10013636 | Ga0105244_100136365 | 266 |
| 707 | 3300009036 | Ga0105244_10146237 | Ga0105244_101462372 | 266 |
| 708 | 3300009092 | Ga0105250_10001271 | Ga0105250_100012715 | 266 |
| 709 | 3300009093 | Ga0105240_10014700 | Ga0105240_100147009 | 266 |
| 710 | 3300009093 | Ga0105240_10025813 | Ga0105240_100258137 | 266 |
| 711 | 3300009093 | Ga0105240_10083154 | Ga0105240_100831545 | 266 |
| 712 | 3300009093 | Ga0105240_10090355 | Ga0105240_100903552 | 266 |
| 713 | 3300009093 | Ga0105240_10146942 | Ga0105240_101469423 | 266 |
| 714 | 3300009093 | Ga0105240_10347407 | Ga0105240_103474072 | 266 |
| 715 | 3300009094 | Ga0111539_10001412 | Ga0111539_1000141217 | 266 |
| 716 | 3300009094 | Ga0111539_10026413 | Ga0111539_100264135 | 266 |
| 717 | 3300009094 | Ga0111539_10195935 | Ga0111539_101959352 | 266 |
| 718 | 3300009094 | Ga0111539_10672746 | Ga0111539_106727462 | 266 |
| 719 | 3300009098 | Ga0105245_10027580 | Ga0105245_100275804 | 266 |
| 720 | 3300009098 | Ga0105245_10041176 | Ga0105245_100411764 | 266 |
| 721 | 3300009098 | Ga0105245_10097858 | Ga0105245_100978584 | 266 |
| 722 | 3300009098 | Ga0105245_10201283 | Ga0105245_102012832 | 266 |
| 723 | 3300009098 | Ga0105245_10350161 | Ga0105245_103501612 | 266 |
| 724 | 3300009101 | Ga0105247_10026019 | Ga0105247_100260194 | 266 |
| 725 | 3300009101 | Ga0105247_10113547 | Ga0105247_101135472 | 266 |
| 726 | 3300009101 | Ga0105247_10150151 | Ga0105247_101501512 | 266 |
| 727 | 3300009101 | Ga0105247_10330992 | Ga0105247_103309922 | 266 |
| 728 | 3300009147 | Ga0114129_10002772 | Ga0114129_1000277227 | 266 |
| 729 | 3300009147 | Ga0114129_10017987 | Ga0114129_100179879 | 266 |
| 730 | 3300009148 | Ga0105243_10007677 | Ga0105243_100076779 | 266 |
| 731 | 3300009148 | Ga0105243_10024994 | Ga0105243_100249944 | 266 |
| 732 | 3300009148 | Ga0105243_10030527 | Ga0105243_100305272 | 266 |
| 733 | 3300009148 | Ga0105243_10045128 | Ga0105243_100451286 | 266 |
| 734 | 3300009148 | Ga0105243_10429047 | Ga0105243_104290472 | 266 |
| 735 | 3300009174 | Ga0105241_10021798 | Ga0105241_100217986 | 266 |
| 736 | 3300009174 | Ga0105241_10023847 | Ga0105241_100238474 | 266 |
| 737 | 3300009174 | Ga0105241_10168092 | Ga0105241_101680922 | 266 |
| 738 | 3300009176 | Ga0105242_10004266 | Ga0105242_100042669 | 266 |
| 739 | 3300009176 | Ga0105242_10007702 | Ga0105242_100077029 | 266 |
| 740 | 3300009176 | Ga0105242_10211388 | Ga0105242_102113882 | 266 |
| 741 | 3300009177 | Ga0105248_10004655 | Ga0105248_100046553 | 266 |
| 742 | 3300009177 | Ga0105248_10057813 | Ga0105248_100578134 | 266 |
| 743 | 3300009177 | Ga0105248_10338938 | Ga0105248_103389381 | 266 |
| 744 | 3300009545 | Ga0105237_10042077 | Ga0105237_100420773 | 266 |
| 745 | 3300009545 | Ga0105237_10208558 | Ga0105237_102085582 | 266 |
| 746 | 3300009551 | Ga0105238_10110783 | Ga0105238_101107832 | 266 |
| 747 | 3300009551 | Ga0105238_10111936 | Ga0105238_101119363 | 266 |
| 748 | 3300009553 | Ga0105249_10010100 | Ga0105249_100101009 | 266 |
| 749 | 3300009553 | Ga0105249_10283720 | Ga0105249_102837202 | 266 |
| 750 | 3300009553 | Ga0105249_11020688 | Ga0105249_110206882 | 266 |
| 751 | 3300010375 | Ga0105239_10086648 | Ga0105239_100866483 | 266 |
| 752 | 3300010375 | Ga0105239_10118061 | Ga0105239_101180614 | 266 |
| 753 | 3300010375 | Ga0105239_10219286 | Ga0105239_102192862 | 266 |
| 754 | 3300010375 | Ga0105239_10253389 | Ga0105239_102533892 | 266 |
| 755 | 3300011119 | Ga0105246_10001908 | Ga0105246_100019088 | 266 |
| 756 | 3300011119 | Ga0105246_10183283 | Ga0105246_101832832 | 266 |
| 757 | 3300011119 | Ga0105246_10239225 | Ga0105246_102392252 | 266 |
| 758 | 3300013100 | Ga0157373_10001235 | Ga0157373_1000123518 | 266 |
| 759 | 3300013100 | Ga0157373_10004667 | Ga0157373_100046679 | 266 |
| 760 | 3300013102 | Ga0157371_10000419 | Ga0157371_1000041912 | 266 |
| 761 | 3300013102 | Ga0157371_10004765 | Ga0157371_100047655 | 266 |
| 762 | 3300013102 | Ga0157371_10105612 | Ga0157371_101056122 | 266 |
| 763 | 3300013102 | Ga0157371_10174573 | Ga0157371_101745732 | 266 |
| 764 | 3300013104 | Ga0157370_10000002 | Ga0157370_10000002160 | 266 |
| 765 | 3300013104 | Ga0157370_10061748 | Ga0157370_100617484 | 266 |
| 766 | 3300013104 | Ga0157370_10553966 | Ga0157370_105539662 | 266 |
| 767 | 3300013105 | Ga0157369_10001303 | Ga0157369_1000130328 | 266 |
| 768 | 3300013105 | Ga0157369_10042262 | Ga0157369_100422622 | 266 |
| 769 | 3300013105 | Ga0157369_10119185 | Ga0157369_101191853 | 266 |
| 770 | 3300013105 | Ga0157369_10522966 | Ga0157369_105229661 | 266 |
| 771 | 3300013296 | Ga0157374_10010364 | Ga0157374_100103649 | 266 |
| 772 | 3300013296 | Ga0157374_10029962 | Ga0157374_100299625 | 266 |
| 773 | 3300013297 | Ga0157378_10009964 | Ga0157378_100099649 | 266 |
| 774 | 3300013297 | Ga0157378_10035863 | Ga0157378_100358632 | 266 |
| 775 | 3300013297 | Ga0157378_10077532 | Ga0157378_100775322 | 266 |
| 776 | 3300013306 | Ga0163162_10017148 | Ga0163162_100171483 | 266 |
| 777 | 3300013306 | Ga0163162_10054423 | Ga0163162_100544233 | 266 |
| 778 | 3300013306 | Ga0163162_10061637 | Ga0163162_100616374 | 266 |
| 779 | 3300013306 | Ga0163162_10067500 | Ga0163162_100675002 | 266 |
| 780 | 3300013306 | Ga0163162_10167493 | Ga0163162_101674932 | 266 |
| 781 | 3300013307 | Ga0157372_10002873 | Ga0157372_1000287312 | 266 |
| 782 | 3300013307 | Ga0157372_10028009 | Ga0157372_100280093 | 266 |
| 783 | 3300013307 | Ga0157372_10088265 | Ga0157372_100882653 | 266 |
| 784 | 3300013307 | Ga0157372_10279203 | Ga0157372_102792032 | 266 |
| 785 | 3300013307 | Ga0157372_10801131 | Ga0157372_108011312 | 266 |
| 786 | 3300013308 | Ga0157375_10007981 | Ga0157375_100079814 | 266 |
| 787 | 3300013308 | Ga0157375_10059865 | Ga0157375_100598652 | 266 |
| 788 | 3300013308 | Ga0157375_10062691 | Ga0157375_100626914 | 266 |
| 789 | 3300013308 | Ga0157375_10219908 | Ga0157375_102199083 | 266 |
| 790 | 3300013308 | Ga0157375_10474743 | Ga0157375_104747432 | 266 |
| 791 | 3300014325 | Ga0163163_10006941 | Ga0163163_100069416 | 266 |
| 792 | 3300014325 | Ga0163163_10026981 | Ga0163163_100269814 | 266 |
| 793 | 3300014325 | Ga0163163_10071319 | Ga0163163_100713192 | 266 |
| 794 | 3300014326 | Ga0157380_10004902 | Ga0157380_1000490210 | 266 |
| 795 | 3300014326 | Ga0157380_10287406 | Ga0157380_102874062 | 266 |
| 796 | 3300014497 | Ga0182008_10017556 | Ga0182008_100175564 | 266 |
| 797 | 3300014497 | Ga0182008_10039281 | Ga0182008_100392812 | 266 |
| 798 | 3300014497 | Ga0182008_10050232 | Ga0182008_100502322 | 266 |
| 799 | 3300014497 | Ga0182008_10105766 | Ga0182008_101057662 | 266 |
| 800 | 3300014497 | Ga0182008_10107420 | Ga0182008_101074202 | 266 |
| 801 | 3300014745 | Ga0157377_10002529 | Ga0157377_100025293 | 266 |
| 802 | 3300014968 | Ga0157379_10000036 | Ga0157379_1000003669 | 266 |
| 803 | 3300014968 | Ga0157379_10024663 | Ga0157379_100246633 | 266 |
| 804 | 3300014968 | Ga0157379_10044610 | Ga0157379_100446104 | 266 |
| 805 | 3300014969 | Ga0157376_10027787 | Ga0157376_100277875 | 266 |
| 806 | 3300014969 | Ga0157376_10234851 | Ga0157376_102348512 | 266 |
| 807 | 3300015261 | Ga0182006_1002183 | Ga0182006_100218310 | 266 |
| 808 | 3300015261 | Ga0182006_1006307 | Ga0182006_10063073 | 266 |
| 809 | 3300015261 | Ga0182006_1012230 | Ga0182006_10122305 | 266 |
| 810 | 3300015262 | Ga0182007_10007789 | Ga0182007_100077894 | 266 |
| 811 | 3300015262 | Ga0182007_10011471 | Ga0182007_100114713 | 266 |
| 812 | 3300015265 | Ga0182005_1001297 | Ga0182005_10012977 | 266 |
| 813 | 3300015265 | Ga0182005_1006013 | Ga0182005_10060133 | 266 |
| 814 | 3300017792 | Ga0163161_10006198 | Ga0163161_100061989 | 266 |
| 815 | 3300020070 | Ga0206356_11256461 | Ga0206356_112564613 | 266 |
| 816 | 3300020070 | Ga0206356_11423983 | Ga0206356_114239831 | 266 |
| 817 | 3300020082 | Ga0206353_11376502 | Ga0206353_113765021 | 266 |
| 818 | 3300020610 | Ga0154015_1416319 | Ga0154015_14163194 | 266 |
| 819 | 3300021358 | Ga0213873_10026857 | Ga0213873_100268572 | 266 |
| 820 | 3300021361 | Ga0213872_10000482 | Ga0213872_1000048213 | 266 |
| 821 | 3300025224 | Ga0209784_100003 | Ga0209784_10000339 | 266 |
| 822 | 3300025224 | Ga0209784_100243 | Ga0209784_10024321 | 266 |
| 823 | 3300025224 | Ga0209784_100808 | Ga0209784_1008082 | 266 |
| 824 | 3300025225 | Ga0209566_100002 | Ga0209566_1000021083 | 266 |
| 825 | 3300025225 | Ga0209566_100742 | Ga0209566_1007428 | 266 |
| 826 | 3300025225 | Ga0209566_100934 | Ga0209566_1009342 | 266 |
| 827 | 3300025226 | Ga0209674_100010 | Ga0209674_10001055 | 266 |
| 828 | 3300025226 | Ga0209674_100081 | Ga0209674_100081139 | 266 |
| 829 | 3300025226 | Ga0209674_101205 | Ga0209674_1012058 | 266 |
| 830 | 3300025228 | Ga0209672_100624 | Ga0209672_1006243 | 266 |
| 831 | 3300025229 | Ga0209147_100414 | Ga0209147_10041414 | 266 |
| 832 | 3300025230 | Ga0209563_100004 | Ga0209563_100004495 | 266 |
| 833 | 3300025230 | Ga0209563_100026 | Ga0209563_100026254 | 266 |
| 834 | 3300025242 | Ga0209258_100618 | Ga0209258_10061814 | 266 |
| 835 | 3300025246 | Ga0209646_1000065 | Ga0209646_1000065177 | 266 |
| 836 | 3300025250 | Ga0209026_1010214 | Ga0209026_10102141 | 266 |
| 837 | 3300025253 | Ga0209677_100013 | Ga0209677_100013118 | 266 |
| 838 | 3300025253 | Ga0209677_101179 | Ga0209677_1011799 | 266 |
| 839 | 3300025254 | Ga0209148_1000113 | Ga0209148_100011348 | 266 |
| 840 | 3300025254 | Ga0209148_1006097 | Ga0209148_10060973 | 266 |
| 841 | 3300025256 | Ga0209759_1001010 | Ga0209759_100101013 | 266 |
| 842 | 3300025256 | Ga0209759_1001214 | Ga0209759_10012145 | 266 |
| 843 | 3300025256 | Ga0209759_1001322 | Ga0209759_10013222 | 266 |
| 844 | 3300025256 | Ga0209759_1003788 | Ga0209759_10037886 | 266 |
| 845 | 3300025263 | Ga0209565_1000176 | Ga0209565_100017610 | 266 |
| 846 | 3300025271 | Ga0207666_1000147 | Ga0207666_10001474 | 266 |
| 847 | 3300025271 | Ga0207666_1001482 | Ga0207666_10014823 | 266 |
| 848 | 3300025272 | Ga0209455_1000501 | Ga0209455_100050114 | 266 |
| 849 | 3300025273 | Ga0209673_1014335 | Ga0209673_10143352 | 266 |
| 850 | 3300025284 | Ga0209130_1001660 | Ga0209130_10016603 | 266 |
| 851 | 3300025290 | Ga0207673_1000767 | Ga0207673_10007674 | 266 |
| 852 | 3300025291 | Ga0209675_1000218 | Ga0209675_100021828 | 266 |
| 853 | 3300025292 | Ga0209676_1000627 | Ga0209676_10006275 | 266 |
| 854 | 3300025292 | Ga0209676_1001369 | Ga0209676_100136915 | 266 |
| 855 | 3300025294 | Ga0209025_1000028 | Ga0209025_1000028287 | 266 |
| 856 | 3300025294 | Ga0209025_1002169 | Ga0209025_10021696 | 266 |
| 857 | 3300025294 | Ga0209025_1029115 | Ga0209025_10291152 | 266 |
| 858 | 3300025294 | Ga0209025_1059610 | Ga0209025_10596101 | 266 |
| 859 | 3300025295 | Ga0209564_1000421 | Ga0209564_100042110 | 266 |
| 860 | 3300025297 | Ga0209758_1000063 | Ga0209758_1000063104 | 266 |
| 861 | 3300025297 | Ga0209758_1000120 | Ga0209758_1000120132 | 266 |
| 862 | 3300025297 | Ga0209758_1005062 | Ga0209758_10050628 | 266 |
| 863 | 3300025298 | Ga0209050_1000100 | Ga0209050_1000100187 | 266 |
| 864 | 3300025298 | Ga0209050_1000537 | Ga0209050_100053751 | 266 |
| 865 | 3300025299 | Ga0209256_1000263 | Ga0209256_100026315 | 266 |
| 866 | 3300025299 | Ga0209256_1002000 | Ga0209256_100200010 | 266 |
| 867 | 3300025299 | Ga0209256_1010514 | Ga0209256_10105144 | 266 |
| 868 | 3300025302 | Ga0207426_1000018 | Ga0207426_1000018502 | 266 |
| 869 | 3300025303 | Ga0209051_1000067 | Ga0209051_100006740 | 266 |
| 870 | 3300025303 | Ga0209051_1000302 | Ga0209051_10003027 | 266 |
| 871 | 3300025303 | Ga0209051_1000345 | Ga0209051_100034510 | 266 |
| 872 | 3300025304 | Ga0209257_1000095 | Ga0209257_1000095201 | 266 |
| 873 | 3300025304 | Ga0209257_1002834 | Ga0209257_100283410 | 266 |
| 874 | 3300025315 | Ga0207697_10002326 | Ga0207697_100023261 | 266 |
| 875 | 3300025315 | Ga0207697_10077030 | Ga0207697_100770302 | 266 |
| 876 | 3300025711 | Ga0207696_1002217 | Ga0207696_10022176 | 266 |
| 877 | 3300025728 | Ga0207655_1005104 | Ga0207655_10051045 | 266 |
| 878 | 3300025728 | Ga0207655_1008924 | Ga0207655_10089245 | 266 |
| 879 | 3300025728 | Ga0207655_1019123 | Ga0207655_10191235 | 266 |
| 880 | 3300025735 | Ga0207713_1002340 | Ga0207713_100234010 | 266 |
| 881 | 3300025885 | Ga0207653_10001409 | Ga0207653_100014094 | 266 |
| 882 | 3300025893 | Ga0207682_10001723 | Ga0207682_100017234 | 266 |
| 883 | 3300025898 | Ga0207692_10022169 | Ga0207692_100221691 | 266 |
| 884 | 3300025898 | Ga0207692_10120478 | Ga0207692_101204782 | 266 |
| 885 | 3300025898 | Ga0207692_10317278 | Ga0207692_103172781 | 266 |
| 886 | 3300025900 | Ga0207710_10005311 | Ga0207710_100053118 | 266 |
| 887 | 3300025900 | Ga0207710_10005447 | Ga0207710_100054478 | 266 |
| 888 | 3300025900 | Ga0207710_10060865 | Ga0207710_100608652 | 266 |
| 889 | 3300025901 | Ga0207688_10000167 | Ga0207688_100001679 | 266 |
| 890 | 3300025901 | Ga0207688_10097804 | Ga0207688_100978042 | 266 |
| 891 | 3300025901 | Ga0207688_10171623 | Ga0207688_101716232 | 266 |
| 892 | 3300025903 | Ga0207680_10023271 | Ga0207680_100232712 | 266 |
| 893 | 3300025903 | Ga0207680_10044018 | Ga0207680_100440183 | 266 |
| 894 | 3300025904 | Ga0207647_10002561 | Ga0207647_1000256117 | 266 |
| 895 | 3300025904 | Ga0207647_10057430 | Ga0207647_100574302 | 266 |
| 896 | 3300025905 | Ga0207685_10020155 | Ga0207685_100201552 | 266 |
| 897 | 3300025905 | Ga0207685_10136186 | Ga0207685_101361861 | 266 |
| 898 | 3300025906 | Ga0207699_10001489 | Ga0207699_1000148911 | 266 |
| 899 | 3300025906 | Ga0207699_10106411 | Ga0207699_101064112 | 266 |
| 900 | 3300025907 | Ga0207645_10005140 | Ga0207645_1000514010 | 266 |
| 901 | 3300025907 | Ga0207645_10125221 | Ga0207645_101252211 | 266 |
| 902 | 3300025907 | Ga0207645_10172079 | Ga0207645_101720792 | 266 |
| 903 | 3300025908 | Ga0207643_10004063 | Ga0207643_100040636 | 266 |
| 904 | 3300025909 | Ga0207705_10017729 | Ga0207705_100177294 | 266 |
| 905 | 3300025909 | Ga0207705_10081845 | Ga0207705_100818453 | 266 |
| 906 | 3300025910 | Ga0207684_10318850 | Ga0207684_103188502 | 266 |
| 907 | 3300025911 | Ga0207654_10026883 | Ga0207654_100268833 | 266 |
| 908 | 3300025912 | Ga0207707_10016807 | Ga0207707_100168076 | 266 |
| 909 | 3300025912 | Ga0207707_10040964 | Ga0207707_100409642 | 266 |
| 910 | 3300025912 | Ga0207707_10058268 | Ga0207707_100582683 | 266 |
| 911 | 3300025912 | Ga0207707_10378882 | Ga0207707_103788822 | 266 |
| 912 | 3300025913 | Ga0207695_10005378 | Ga0207695_100053783 | 266 |
| 913 | 3300025913 | Ga0207695_10045076 | Ga0207695_100450764 | 266 |
| 914 | 3300025913 | Ga0207695_10188244 | Ga0207695_101882443 | 266 |
| 915 | 3300025913 | Ga0207695_10242936 | Ga0207695_102429362 | 266 |
| 916 | 3300025914 | Ga0207671_10035659 | Ga0207671_100356595 | 266 |
| 917 | 3300025914 | Ga0207671_10588322 | Ga0207671_105883221 | 266 |
| 918 | 3300025915 | Ga0207693_10008449 | Ga0207693_1000844910 | 266 |
| 919 | 3300025915 | Ga0207693_10132042 | Ga0207693_101320423 | 266 |
| 920 | 3300025915 | Ga0207693_10181051 | Ga0207693_101810512 | 266 |
| 921 | 3300025916 | Ga0207663_10070179 | Ga0207663_100701792 | 266 |
| 922 | 3300025916 | Ga0207663_10144020 | Ga0207663_101440202 | 266 |
| 923 | 3300025917 | Ga0207660_10020078 | Ga0207660_100200784 | 266 |
| 924 | 3300025917 | Ga0207660_10029553 | Ga0207660_100295534 | 266 |
| 925 | 3300025917 | Ga0207660_10041239 | Ga0207660_100412394 | 266 |
| 926 | 3300025917 | Ga0207660_10199301 | Ga0207660_101993012 | 266 |
| 927 | 3300025918 | Ga0207662_10000195 | Ga0207662_1000019510 | 266 |
| 928 | 3300025918 | Ga0207662_10021822 | Ga0207662_100218221 | 266 |
| 929 | 3300025918 | Ga0207662_10198917 | Ga0207662_101989172 | 266 |
| 930 | 3300025919 | Ga0207657_10012031 | Ga0207657_100120319 | 266 |
| 931 | 3300025919 | Ga0207657_10141998 | Ga0207657_101419982 | 266 |
| 932 | 3300025919 | Ga0207657_10145041 | Ga0207657_101450411 | 266 |
| 933 | 3300025919 | Ga0207657_10251829 | Ga0207657_102518291 | 266 |
| 934 | 3300025919 | Ga0207657_10302416 | Ga0207657_103024161 | 266 |
| 935 | 3300025920 | Ga0207649_10000168 | Ga0207649_1000016812 | 266 |
| 936 | 3300025920 | Ga0207649_10000944 | Ga0207649_1000094419 | 266 |
| 937 | 3300025920 | Ga0207649_10026440 | Ga0207649_100264405 | 266 |
| 938 | 3300025920 | Ga0207649_10293310 | Ga0207649_102933102 | 266 |
| 939 | 3300025921 | Ga0207652_10027911 | Ga0207652_100279114 | 266 |
| 940 | 3300025921 | Ga0207652_10028891 | Ga0207652_100288914 | 266 |
| 941 | 3300025921 | Ga0207652_10074387 | Ga0207652_100743872 | 266 |
| 942 | 3300025923 | Ga0207681_10004024 | Ga0207681_100040249 | 266 |
| 943 | 3300025923 | Ga0207681_10033795 | Ga0207681_100337953 | 266 |
| 944 | 3300025924 | Ga0207694_10170107 | Ga0207694_101701072 | 266 |
| 945 | 3300025925 | Ga0207650_10011209 | Ga0207650_100112096 | 266 |
| 946 | 3300025925 | Ga0207650_10241511 | Ga0207650_102415112 | 266 |
| 947 | 3300025926 | Ga0207659_10001128 | Ga0207659_1000112814 | 266 |
| 948 | 3300025926 | Ga0207659_10105888 | Ga0207659_101058882 | 266 |
| 949 | 3300025927 | Ga0207687_10016099 | Ga0207687_100160994 | 266 |
| 950 | 3300025928 | Ga0207700_10005022 | Ga0207700_100050226 | 266 |
| 951 | 3300025928 | Ga0207700_10038774 | Ga0207700_100387744 | 266 |
| 952 | 3300025928 | Ga0207700_10038856 | Ga0207700_100388563 | 266 |
| 953 | 3300025928 | Ga0207700_10530417 | Ga0207700_105304172 | 266 |
| 954 | 3300025929 | Ga0207664_10037901 | Ga0207664_100379012 | 266 |
| 955 | 3300025929 | Ga0207664_10310225 | Ga0207664_103102252 | 266 |
| 956 | 3300025931 | Ga0207644_10016379 | Ga0207644_100163794 | 266 |
| 957 | 3300025931 | Ga0207644_10029859 | Ga0207644_100298595 | 266 |
| 958 | 3300025931 | Ga0207644_10048690 | Ga0207644_100486902 | 266 |
| 959 | 3300025931 | Ga0207644_10534818 | Ga0207644_105348182 | 266 |
| 960 | 3300025932 | Ga0207690_10010455 | Ga0207690_100104555 | 266 |
| 961 | 3300025932 | Ga0207690_10307559 | Ga0207690_103075591 | 266 |
| 962 | 3300025933 | Ga0207706_10010273 | Ga0207706_100102739 | 266 |
| 963 | 3300025933 | Ga0207706_10019439 | Ga0207706_100194397 | 266 |
| 964 | 3300025933 | Ga0207706_10053277 | Ga0207706_100532774 | 266 |
| 965 | 3300025933 | Ga0207706_10160825 | Ga0207706_101608252 | 266 |
| 966 | 3300025933 | Ga0207706_10409685 | Ga0207706_104096852 | 266 |
| 967 | 3300025934 | Ga0207686_10002278 | Ga0207686_100022787 | 266 |
| 968 | 3300025934 | Ga0207686_10009205 | Ga0207686_100092055 | 266 |
| 969 | 3300025934 | Ga0207686_10196287 | Ga0207686_101962872 | 266 |
| 970 | 3300025935 | Ga0207709_10002480 | Ga0207709_100024803 | 266 |
| 971 | 3300025935 | Ga0207709_10103755 | Ga0207709_101037552 | 266 |
| 972 | 3300025936 | Ga0207670_10000792 | Ga0207670_100007924 | 266 |
| 973 | 3300025937 | Ga0207669_10001389 | Ga0207669_100013894 | 266 |
| 974 | 3300025937 | Ga0207669_10165189 | Ga0207669_101651892 | 266 |
| 975 | 3300025938 | Ga0207704_10478771 | Ga0207704_104787711 | 266 |
| 976 | 3300025939 | Ga0207665_10034351 | Ga0207665_100343514 | 266 |
| 977 | 3300025940 | Ga0207691_10009001 | Ga0207691_100090013 | 266 |
| 978 | 3300025941 | Ga0207711_10009422 | Ga0207711_100094228 | 266 |
| 979 | 3300025941 | Ga0207711_10011627 | Ga0207711_100116272 | 266 |
| 980 | 3300025941 | Ga0207711_10539283 | Ga0207711_105392832 | 266 |
| 981 | 3300025942 | Ga0207689_10000008 | Ga0207689_10000008118 | 266 |
| 982 | 3300025944 | Ga0207661_10002577 | Ga0207661_1000257713 | 266 |
| 983 | 3300025944 | Ga0207661_10254323 | Ga0207661_102543232 | 266 |
| 984 | 3300025945 | Ga0207679_10000085 | Ga0207679_1000008537 | 266 |
| 985 | 3300025945 | Ga0207679_10004919 | Ga0207679_100049199 | 266 |
| 986 | 3300025945 | Ga0207679_10149819 | Ga0207679_101498192 | 266 |
| 987 | 3300025945 | Ga0207679_10158555 | Ga0207679_101585552 | 266 |
| 988 | 3300025949 | Ga0207667_10008690 | Ga0207667_100086908 | 266 |
| 989 | 3300025949 | Ga0207667_10017077 | Ga0207667_100170779 | 266 |
| 990 | 3300025949 | Ga0207667_10029863 | Ga0207667_100298634 | 266 |
| 991 | 3300025949 | Ga0207667_10080722 | Ga0207667_100807221 | 266 |
| 992 | 3300025960 | Ga0207651_10000292 | Ga0207651_1000029213 | 266 |
| 993 | 3300025960 | Ga0207651_10035767 | Ga0207651_100357672 | 266 |
| 994 | 3300025960 | Ga0207651_10230681 | Ga0207651_102306812 | 266 |
| 995 | 3300025961 | Ga0207712_10253608 | Ga0207712_102536082 | 266 |
| 996 | 3300025961 | Ga0207712_10265581 | Ga0207712_102655812 | 266 |
| 997 | 3300025972 | Ga0207668_10001329 | Ga0207668_1000132910 | 266 |
| 998 | 3300025972 | Ga0207668_10175610 | Ga0207668_101756102 | 266 |
| 999 | 3300025972 | Ga0207668_10288539 | Ga0207668_102885392 | 266 |
| 1000 | 3300025981 | Ga0207640_10000946 | Ga0207640_1000094612 | 266 |
| 1001 | 3300025981 | Ga0207640_10001339 | Ga0207640_1000133913 | 266 |
| 1002 | 3300025986 | Ga0207658_10008697 | Ga0207658_100086977 | 266 |
| 1003 | 3300025986 | Ga0207658_10014450 | Ga0207658_100144503 | 266 |
| 1004 | 3300025986 | Ga0207658_10026305 | Ga0207658_100263054 | 266 |
| 1005 | 3300025986 | Ga0207658_10028752 | Ga0207658_100287523 | 266 |
| 1006 | 3300025986 | Ga0207658_10089957 | Ga0207658_100899572 | 266 |
| 1007 | 3300026023 | Ga0207677_10023807 | Ga0207677_100238074 | 266 |
| 1008 | 3300026023 | Ga0207677_10030325 | Ga0207677_100303253 | 266 |
| 1009 | 3300026035 | Ga0207703_10006686 | Ga0207703_100066864 | 266 |
| 1010 | 3300026035 | Ga0207703_10048343 | Ga0207703_100483432 | 266 |
| 1011 | 3300026041 | Ga0207639_10061983 | Ga0207639_100619833 | 266 |
| 1012 | 3300026041 | Ga0207639_10198554 | Ga0207639_101985542 | 266 |
| 1013 | 3300026041 | Ga0207639_10310928 | Ga0207639_103109283 | 266 |
| 1014 | 3300026067 | Ga0207678_10000202 | Ga0207678_1000020236 | 266 |
| 1015 | 3300026067 | Ga0207678_10009486 | Ga0207678_100094863 | 266 |
| 1016 | 3300026067 | Ga0207678_10092108 | Ga0207678_100921083 | 266 |
| 1017 | 3300026067 | Ga0207678_10564253 | Ga0207678_105642531 | 266 |
| 1018 | 3300026075 | Ga0207708_10006642 | Ga0207708_100066429 | 266 |
| 1019 | 3300026075 | Ga0207708_10289801 | Ga0207708_102898011 | 266 |
| 1020 | 3300026075 | Ga0207708_10473437 | Ga0207708_104734371 | 266 |
| 1021 | 3300026078 | Ga0207702_10000294 | Ga0207702_1000029446 | 266 |
| 1022 | 3300026078 | Ga0207702_10025513 | Ga0207702_100255135 | 266 |
| 1023 | 3300026078 | Ga0207702_10073289 | Ga0207702_100732896 | 266 |
| 1024 | 3300026088 | Ga0207641_10004156 | Ga0207641_100041562 | 266 |
| 1025 | 3300026088 | Ga0207641_10029014 | Ga0207641_100290142 | 266 |
| 1026 | 3300026088 | Ga0207641_10279426 | Ga0207641_102794262 | 266 |
| 1027 | 3300026089 | Ga0207648_10009518 | Ga0207648_100095189 | 266 |
| 1028 | 3300026089 | Ga0207648_10040099 | Ga0207648_100400992 | 266 |
| 1029 | 3300026089 | Ga0207648_10060737 | Ga0207648_100607373 | 266 |
| 1030 | 3300026095 | Ga0207676_10000182 | Ga0207676_1000018216 | 266 |
| 1031 | 3300026095 | Ga0207676_10008809 | Ga0207676_100088092 | 266 |
| 1032 | 3300026095 | Ga0207676_10018336 | Ga0207676_100183364 | 266 |
| 1033 | 3300026095 | Ga0207676_10075023 | Ga0207676_100750232 | 266 |
| 1034 | 3300026116 | Ga0207674_10012281 | Ga0207674_100122813 | 266 |
| 1035 | 3300026116 | Ga0207674_10034038 | Ga0207674_100340384 | 266 |
| 1036 | 3300026116 | Ga0207674_10058447 | Ga0207674_100584474 | 266 |
| 1037 | 3300026116 | Ga0207674_10148377 | Ga0207674_101483772 | 266 |
| 1038 | 3300026116 | Ga0207674_10605528 | Ga0207674_106055282 | 266 |
| 1039 | 3300026118 | Ga0207675_100009202 | Ga0207675_1000092024 | 266 |
| 1040 | 3300026118 | Ga0207675_100223631 | Ga0207675_1002236312 | 266 |
| 1041 | 3300026118 | Ga0207675_100611305 | Ga0207675_1006113052 | 266 |
| 1042 | 3300026121 | Ga0207683_10008676 | Ga0207683_100086767 | 266 |
| 1043 | 3300026121 | Ga0207683_10008899 | Ga0207683_100088993 | 266 |
| 1044 | 3300026121 | Ga0207683_10152765 | Ga0207683_101527652 | 266 |
| 1045 | 3300026121 | Ga0207683_10268527 | Ga0207683_102685272 | 266 |
| 1046 | 3300026121 | Ga0207683_10394119 | Ga0207683_103941192 | 266 |
| 1047 | 3300026142 | Ga0207698_10011050 | Ga0207698_100110505 | 266 |
| 1048 | 3300026142 | Ga0207698_10014161 | Ga0207698_100141614 | 266 |
| 1049 | 3300026142 | Ga0207698_10029219 | Ga0207698_100292194 | 266 |
| 1050 | 3300026142 | Ga0207698_10364095 | Ga0207698_103640952 | 266 |
| 1051 | 3300027462 | Ga0210000_1000579 | Ga0210000_10005791 | 266 |
| 1052 | 3300027512 | Ga0209179_1008622 | Ga0209179_10086221 | 266 |
| 1053 | 3300027512 | Ga0209179_1019414 | Ga0209179_10194142 | 266 |
| 1054 | 3300027543 | Ga0209999_1000289 | Ga0209999_10002896 | 266 |
| 1055 | 3300027665 | Ga0209983_1007917 | Ga0209983_10079172 | 266 |
| 1056 | 3300027666 | Ga0209282_1000105 | Ga0209282_10001057 | 266 |
| 1057 | 3300027671 | Ga0209588_1020430 | Ga0209588_10204302 | 266 |
| 1058 | 3300027682 | Ga0209971_1007306 | Ga0209971_10073062 | 266 |
| 1059 | 3300027695 | Ga0209966_1001543 | Ga0209966_10015433 | 266 |
| 1060 | 3300027717 | Ga0209998_10001521 | Ga0209998_100015216 | 266 |
| 1061 | 3300027717 | Ga0209998_10002524 | Ga0209998_100025244 | 266 |
| 1062 | 3300027866 | Ga0209813_10015681 | Ga0209813_100156812 | 266 |
| 1063 | 3300027876 | Ga0209974_10001584 | Ga0209974_100015842 | 266 |
| 1064 | 3300027876 | Ga0209974_10014301 | Ga0209974_100143012 | 266 |
| 1065 | 3300027907 | Ga0207428_10000115 | Ga0207428_1000011517 | 266 |
| 1066 | 3300027907 | Ga0207428_10001793 | Ga0207428_1000179318 | 266 |
| 1067 | 3300027907 | Ga0207428_10013664 | Ga0207428_100136644 | 266 |
| 1068 | 3300028379 | Ga0268266_10048810 | Ga0268266_100488102 | 266 |
| 1069 | 3300028379 | Ga0268266_10358671 | Ga0268266_103586712 | 266 |
| 1070 | 3300028379 | Ga0268266_10641677 | Ga0268266_106416771 | 266 |
| 1071 | 3300028380 | Ga0268265_10006061 | Ga0268265_100060612 | 266 |
| 1072 | 3300028381 | Ga0268264_10015470 | Ga0268264_100154704 | 266 |
| 1073 | 3300028381 | Ga0268264_10073561 | Ga0268264_100735613 | 266 |
| 1074 | 3300028381 | Ga0268264_10262149 | Ga0268264_102621492 | 266 |
| 1075 | 3300028381 | Ga0268264_10310622 | Ga0268264_103106222 | 266 |
| 1076 | 3300028556 | Ga0265337_1000403 | Ga0265337_10004032 | 266 |
| 1077 | 3300028573 | Ga0265334_10057842 | Ga0265334_100578422 | 266 |
| 1078 | 3300028794 | Ga0307515_10008051 | Ga0307515_100080519 | 266 |
| 1079 | 3300028794 | Ga0307515_10298673 | Ga0307515_102986731 | 266 |
| 1080 | 3300028800 | Ga0265338_10011769 | Ga0265338_100117692 | 266 |
| 1081 | 3300028800 | Ga0265338_10122133 | Ga0265338_101221334 | 266 |
| 1082 | 3300028800 | Ga0265338_10267035 | Ga0265338_102670352 | 266 |
| 1083 | 3300030521 | Ga0307511_10000019 | Ga0307511_100000199 | 266 |
| 1084 | 3300030522 | Ga0307512_10151369 | Ga0307512_101513692 | 266 |
| 1085 | 3300030522 | Ga0307512_10193253 | Ga0307512_101932532 | 266 |
| 1086 | 3300030731 | Ga0316177_1138189 | Ga0316177_11381893 | 266 |
| 1087 | 3300030733 | Ga0314311_1143830 | Ga0314311_11438302 | 266 |
| 1088 | 3300030735 | Ga0316178_1024177 | Ga0316178_10241774 | 266 |
| 1089 | 3300030744 | Ga0316181_1116699 | Ga0316181_111669912 | 266 |
| 1090 | 3300030745 | Ga0316182_1438880 | Ga0316182_14388802 | 266 |
| 1091 | 3300031235 | Ga0265330_10006763 | Ga0265330_100067635 | 266 |
| 1092 | 3300031235 | Ga0265330_10018509 | Ga0265330_100185094 | 266 |
| 1093 | 3300031235 | Ga0265330_10142406 | Ga0265330_101424062 | 266 |
| 1094 | 3300031238 | Ga0265332_10002834 | Ga0265332_100028342 | 266 |
| 1095 | 3300031241 | Ga0265325_10000026 | Ga0265325_100000264 | 266 |
| 1096 | 3300031241 | Ga0265325_10000258 | Ga0265325_1000025814 | 266 |
| 1097 | 3300031241 | Ga0265325_10008677 | Ga0265325_100086776 | 266 |
| 1098 | 3300031241 | Ga0265325_10008781 | Ga0265325_100087814 | 266 |
| 1099 | 3300031241 | Ga0265325_10016270 | Ga0265325_100162702 | 266 |
| 1100 | 3300031247 | Ga0265340_10104016 | Ga0265340_101040162 | 266 |
| 1101 | 3300031249 | Ga0265339_10003955 | Ga0265339_100039557 | 266 |
| 1102 | 3300031250 | Ga0265331_10006990 | Ga0265331_100069905 | 266 |
| 1103 | 3300031250 | Ga0265331_10040370 | Ga0265331_100403702 | 266 |
| 1104 | 3300031250 | Ga0265331_10137524 | Ga0265331_101375241 | 266 |
| 1105 | 3300031251 | Ga0265327_10073180 | Ga0265327_100731802 | 266 |
| 1106 | 3300031344 | Ga0265316_10065041 | Ga0265316_100650414 | 266 |
| 1107 | 3300031344 | Ga0265316_10082669 | Ga0265316_100826693 | 266 |
| 1108 | 3300031344 | Ga0265316_10108823 | Ga0265316_101088232 | 266 |
| 1109 | 3300031344 | Ga0265316_10290501 | Ga0265316_102905012 | 266 |
| 1110 | 3300031456 | Ga0307513_10007727 | Ga0307513_1000772711 | 266 |
| 1111 | 3300031456 | Ga0307513_10046515 | Ga0307513_100465153 | 266 |
| 1112 | 3300031456 | Ga0307513_10077565 | Ga0307513_100775652 | 266 |
| 1113 | 3300031456 | Ga0307513_10275792 | Ga0307513_102757922 | 266 |
| 1114 | 3300031507 | Ga0307509_10057042 | Ga0307509_100570425 | 266 |
| 1115 | 3300031507 | Ga0307509_10171889 | Ga0307509_101718892 | 266 |
| 1116 | 3300031548 | Ga0307408_100009496 | Ga0307408_1000094968 | 266 |
| 1117 | 3300031548 | Ga0307408_100048329 | Ga0307408_1000483291 | 266 |
| 1118 | 3300031548 | Ga0307408_100196147 | Ga0307408_1001961472 | 266 |
| 1119 | 3300031548 | Ga0307408_100244608 | Ga0307408_1002446082 | 266 |
| 1120 | 3300031595 | Ga0265313_10000072 | Ga0265313_1000007270 | 266 |
| 1121 | 3300031595 | Ga0265313_10013430 | Ga0265313_100134302 | 266 |
| 1122 | 3300031595 | Ga0265313_10024597 | Ga0265313_100245973 | 266 |
| 1123 | 3300031616 | Ga0307508_10000248 | Ga0307508_1000024845 | 266 |
| 1124 | 3300031616 | Ga0307508_10058543 | Ga0307508_100585433 | 266 |
| 1125 | 3300031649 | Ga0307514_10000890 | Ga0307514_1000089012 | 266 |
| 1126 | 3300031649 | Ga0307514_10020138 | Ga0307514_100201385 | 266 |
| 1127 | 3300031711 | Ga0265314_10002865 | Ga0265314_1000286512 | 266 |
| 1128 | 3300031711 | Ga0265314_10002886 | Ga0265314_100028866 | 266 |
| 1129 | 3300031711 | Ga0265314_10039095 | Ga0265314_100390953 | 266 |
| 1130 | 3300031712 | Ga0265342_10000082 | Ga0265342_1000008219 | 266 |
| 1131 | 3300031712 | Ga0265342_10000291 | Ga0265342_1000029134 | 266 |
| 1132 | 3300031712 | Ga0265342_10063168 | Ga0265342_100631682 | 266 |
| 1133 | 3300031727 | Ga0316576_10021360 | Ga0316576_100213601 | 266 |
| 1134 | 3300031728 | Ga0316578_10070369 | Ga0316578_100703692 | 266 |
| 1135 | 3300031731 | Ga0307405_10156598 | Ga0307405_101565982 | 266 |
| 1136 | 3300031731 | Ga0307405_10252338 | Ga0307405_102523382 | 266 |
| 1137 | 3300031731 | Ga0307405_10602380 | Ga0307405_106023801 | 266 |
| 1138 | 3300031852 | Ga0307410_10197495 | Ga0307410_101974952 | 266 |
| 1139 | 3300031901 | Ga0307406_10001484 | Ga0307406_100014848 | 266 |
| 1140 | 3300031901 | Ga0307406_10049376 | Ga0307406_100493762 | 266 |
| 1141 | 3300031911 | Ga0307412_10311318 | Ga0307412_103113181 | 266 |
| 1142 | 3300031911 | Ga0307412_10780538 | Ga0307412_107805381 | 266 |
| 1143 | 3300032002 | Ga0307416_100182306 | Ga0307416_1001823062 | 266 |
| 1144 | 3300032002 | Ga0307416_100741787 | Ga0307416_1007417871 | 266 |
| 1145 | 3300033179 | Ga0307507_10023773 | Ga0307507_100237733 | 266 |
| 1146 | 3300033179 | Ga0307507_10115233 | Ga0307507_101152332 | 266 |
| 1147 | 3300033179 | Ga0307507_10151277 | Ga0307507_101512772 | 266 |
| 1148 | 3300034816 | Ga0373930_0001137 | Ga0373930_0001137_327_1127 | 266 |
| 1149 | 3300034816 | Ga0373930_0017644 | Ga0373930_0017644_457_1257 | 266 |
| 1150 | 3300034817 | Ga0373948_0000530 | Ga0373948_0000530_2749_3549 | 266 |
| 1151 | 3300034818 | Ga0373950_0001280 | Ga0373950_0001280_2396_3196 | 266 |
| 1152 | 3300034819 | Ga0373958_0000935 | Ga0373958_0000935_2610_3410 | 266 |
| 1153 | 3300034820 | Ga0373959_0002074 | Ga0373959_0002074_696_1496 | 266 |
| 1154 | 3300034820 | Ga0373959_0002994 | Ga0373959_0002994_1435_2235 | 266 |
| 1155 | 3300034820 | Ga0373959_0033674 | Ga0373959_0033674_96_896 | 266 |
| 1156 | 3300034957 | Ga0373938_0000237 | Ga0373938_0000237_6611_7411 | 266 |
| 1157 | 3300034957 | Ga0373938_0001173 | Ga0373938_0001173_825_1625 | 266 |
| 1158 | 3300034957 | Ga0373938_0001763 | Ga0373938_0001763_745_1545 | 266 |
| 1159 | 3300035083 | Ga0373926_0013479 | Ga0373926_0013479_1715_2515 | 266 |
| 1160 | 3300035084 | Ga0373928_0000547 | Ga0373928_0000547_1799_2599 | 266 |
| 1161 | 3300035084 | Ga0373928_0006668 | Ga0373928_0006668_509_1309 | 266 |
| 1162 | 3300035085 | Ga0373929_0000699 | Ga0373929_0000699_3936_4736 | 266 |
| 1163 | 3300035085 | Ga0373929_0008455 | Ga0373929_0008455_129_929 | 266 |
| 1164 | 3300035086 | Ga0373934_0005867 | Ga0373934_0005867_3337_4137 | 266 |
| 1165 | 3300035088 | Ga0373940_0001972 | Ga0373940_0001972_2037_2837 | 266 |
| 1166 | 3300035088 | Ga0373940_0100003 | Ga0373940_0100003_22_822 | 266 |
| 1167 | 3300035090 | Ga0373949_0002043 | Ga0373949_0002043_2971_3771 | 266 |
| 1168 | 3300035090 | Ga0373949_0003337 | Ga0373949_0003337_1804_2604 | 266 |
| 1169 | 3300035091 | Ga0373951_0003295 | Ga0373951_0003295_1563_2363 | 266 |
| 1170 | 3300035091 | Ga0373951_0007696 | Ga0373951_0007696_672_1472 | 266 |
| 1171 | 3300035092 | Ga0373952_0000858 | Ga0373952_0000858_3023_3823 | 266 |
| 1172 | 3300035092 | Ga0373952_0008149 | Ga0373952_0008149_183_983 | 266 |
| 1173 | 3300035111 | Ga0373923_0001865 | Ga0373923_0001865_1640_2440 | 266 |
| 1174 | 3300035111 | Ga0373923_0002073 | Ga0373923_0002073_4655_5455 | 266 |
| 1175 | 3300035112 | Ga0373932_0003430 | Ga0373932_0003430_2784_3584 | 266 |
| 1176 | 3300035113 | Ga0373936_0043737 | Ga0373936_0043737_459_1259 | 266 |
| 1177 | 3300035113 | Ga0373936_0046394 | Ga0373936_0046394_88_888 | 266 |
| 1178 | 3300035113 | Ga0373936_0048530 | Ga0373936_0048530_416_1216 | 266 |
| 1179 | 3300035113 | Ga0373936_0071413 | Ga0373936_0071413_289_1089 | 266 |
| 1180 | 3300035114 | Ga0373939_0002937 | Ga0373939_0002937_1576_2376 | 266 |
| 1181 | 3300035114 | Ga0373939_0006052 | Ga0373939_0006052_1769_2569 | 266 |
| 1182 | 3300035115 | Ga0373941_0015410 | Ga0373941_0015410_661_1461 | 266 |
| 1183 | 3300035116 | Ga0373945_0009515 | Ga0373945_0009515_995_1795 | 266 |
| 1184 | 3300035116 | Ga0373945_0022704 | Ga0373945_0022704_1285_2085 | 266 |
| 1185 | 3300035116 | Ga0373945_0127372 | Ga0373945_0127372_67_867 | 266 |
| 1186 | 3300035117 | Ga0373953_0000963 | Ga0373953_0000963_3074_3874 | 266 |
| 1187 | 3300035117 | Ga0373953_0025962 | Ga0373953_0025962_111_911 | 266 |
| 1188 | 3300035118 | Ga0373954_0001647 | Ga0373954_0001647_6168_6968 | 266 |
| 1189 | 3300035118 | Ga0373954_0006896 | Ga0373954_0006896_2308_3108 | 266 |
| 1190 | 3300035118 | Ga0373954_0015121 | Ga0373954_0015121_565_1365 | 266 |
| 1191 | 3300035118 | Ga0373954_0029687 | Ga0373954_0029687_1186_1986 | 266 |
| 1192 | 3300035118 | Ga0373954_0058374 | Ga0373954_0058374_87_887 | 266 |
| 1193 | 3300035118 | Ga0373954_0207291 | Ga0373954_0207291_44_844 | 266 |
| 1194 | 3300035119 | Ga0373956_0000080 | Ga0373956_0000080_29459_30259 | 266 |
| 1195 | 3300035119 | Ga0373956_0010369 | Ga0373956_0010369_1646_2446 | 266 |
| 1196 | 3300035119 | Ga0373956_0019862 | Ga0373956_0019862_494_1294 | 266 |
| 1197 | 3300035119 | Ga0373956_0033838 | Ga0373956_0033838_142_942 | 266 |
| 1198 | 3300035119 | Ga0373956_0048845 | Ga0373956_0048845_55_855 | 266 |
| 1199 | 3300035119 | Ga0373956_0084062 | Ga0373956_0084062_186_986 | 266 |
| 1200 | 3300035120 | Ga0373957_0013058 | Ga0373957_0013058_1858_2658 | 266 |
| 1201 | 3300035120 | Ga0373957_0024477 | Ga0373957_0024477_538_1338 | 266 |
| 1202 | 3300035121 | Ga0373960_0003754 | Ga0373960_0003754_2613_3413 | 266 |
| 1203 | 3300035121 | Ga0373960_0006948 | Ga0373960_0006948_1228_2028 | 266 |
| 1204 | 3300035170 | Ga0373943_0032108 | Ga0373943_0032108_123_923 | 266 |
| 1205 | 3300035171 | Ga0373946_0007183 | Ga0373946_0007183_1456_2256 | 266 |
| 1206 | 3300035171 | Ga0373946_0012822 | Ga0373946_0012822_1624_2424 | 266 |
| 1207 | 3300035171 | Ga0373946_0066484 | Ga0373946_0066484_456_1256 | 266 |
| 1208 | 3300035171 | Ga0373946_0190897 | Ga0373946_0190897_112_912 | 266 |
| 1209 | 3300035172 | Ga0373955_0006219 | Ga0373955_0006219_3735_4535 | 266 |
| 1210 | 3300035172 | Ga0373955_0009768 | Ga0373955_0009768_3550_4350 | 266 |
| 1211 | 3300035172 | Ga0373955_0043040 | Ga0373955_0043040_1375_2175 | 266 |
| 1212 | 3300035172 | Ga0373955_0060816 | Ga0373955_0060816_558_1358 | 266 |
| 1213 | 3300035172 | Ga0373955_0088264 | Ga0373955_0088264_196_996 | 266 |
| 1214 | 3300035172 | Ga0373955_0165691 | Ga0373955_0165691_68_868 | 266 |
| 1215 | 3300035207 | Ga0373942_0004844 | Ga0373942_0004844_1080_1880 | 266 |
| 1216 | 3300035207 | Ga0373942_0011363 | Ga0373942_0011363_903_1703 | 266 |
| 1217 | 3300035241 | Ga0373961_0006553 | Ga0373961_0006553_1099_1899 | 266 |
| 1218 | 3300035241 | Ga0373961_0012233 | Ga0373961_0012233_716_1516 | 266 |
| 1219 | 3300035241 | Ga0373961_0015940 | Ga0373961_0015940_101_901 | 266 |
| 1220 | 3300035241 | Ga0373961_0018134 | Ga0373961_0018134_347_1147 | 266 |
| 1221 | 3300035241 | Ga0373961_0055458 | Ga0373961_0055458_327_1127 | 266 |
| 1222 | 3300035242 | Ga0373962_0005838 | Ga0373962_0005838_198_998 | 266 |
| 1223 | 3300035242 | Ga0373962_0012645 | Ga0373962_0012645_218_1018 | 266 |
| 1224 | 3300035410 | Ga0373924_0007061 | Ga0373924_0007061_2662_3462 | 266 |
| 1225 | 3300035410 | Ga0373924_0029209 | Ga0373924_0029209_1181_1981 | 266 |
| 1226 | 3300035410 | Ga0373924_0032775 | Ga0373924_0032775_294_1094 | 266 |
| 1227 | 3300035410 | Ga0373924_0103106 | Ga0373924_0103106_384_1184 | 266 |
| 1228 | 3300035410 | Ga0373924_0126870 | Ga0373924_0126870_19_819 | 266 |
| 1229 | 3300035691 | Ga0373931_0004454 | Ga0373931_0004454_4911_5711 | 266 |
| 1230 | 3300035691 | Ga0373931_0041907 | Ga0373931_0041907_929_1729 | 266 |
| 1231 | 3300035691 | Ga0373931_0154193 | Ga0373931_0154193_250_1050 | 266 |
| 1232 | 3300035692 | Ga0373935_0000086 | Ga0373935_0000086_37988_38788 | 266 |
| 1233 | 3300035692 | Ga0373935_0001093 | Ga0373935_0001093_11453_12253 | 266 |
| 1234 | 3300035692 | Ga0373935_0074146 | Ga0373935_0074146_363_1163 | 266 |
| 1235 | 3300035692 | Ga0373935_0107985 | Ga0373935_0107985_947_1747 | 266 |
| 1236 | 3300035692 | Ga0373935_0330396 | Ga0373935_0330396_198_998 | 266 |
| 1237 | 3300035695 | Ga0373927_0002359 | Ga0373927_0002359_7769_8569 | 266 |
| 1238 | 3300035695 | Ga0373927_0015519 | Ga0373927_0015519_3742_4542 | 266 |
| 1239 | 3300035695 | Ga0373927_0034659 | Ga0373927_0034659_1905_2705 | 266 |
| 1240 | 3300035695 | Ga0373927_0048502 | Ga0373927_0048502_237_1037 | 266 |
| 1241 | 3300035724 | Ga0373933_0000373 | Ga0373933_0000373_10081_10881 | 266 |
| 1242 | 3300035724 | Ga0373933_0000862 | Ga0373933_0000862_6102_6902 | 266 |
| 1243 | 3300035724 | Ga0373933_0037862 | Ga0373933_0037862_1859_2659 | 266 |
| 1244 | 3300035724 | Ga0373933_0052171 | Ga0373933_0052171_1218_2018 | 266 |
| 1245 | 3300035724 | Ga0373933_0092684 | Ga0373933_0092684_998_1798 | 266 |
| 1246 | 3300035724 | Ga0373933_0100035 | Ga0373933_0100035_552_1352 | 266 |
| 1247 | 3300035724 | Ga0373933_0155419 | Ga0373933_0155419_305_1105 | 266 |
| 1248 | 3300035725 | Ga0373947_0000096 | Ga0373947_0000096_18493_19293 | 266 |
| 1249 | 3300035725 | Ga0373947_0000288 | Ga0373947_0000288_26603_27403 | 266 |
| 1250 | 3300035725 | Ga0373947_0020805 | Ga0373947_0020805_2229_3029 | 266 |
| 1251 | 3300035725 | Ga0373947_0042688 | Ga0373947_0042688_454_1254 | 266 |
| 1252 | 3300035725 | Ga0373947_0094304 | Ga0373947_0094304_151_951 | 266 |
| 1253 | 3300036401 | Ga0373937_0000198 | Ga0373937_0000198_41762_42562 | 266 |
| 1254 | 3300036401 | Ga0373937_0000996 | Ga0373937_0000996_21327_22127 | 266 |
| 1255 | 3300036401 | Ga0373937_0001196 | Ga0373937_0001196_16572_17372 | 266 |
| 1256 | 3300036401 | Ga0373937_0004708 | Ga0373937_0004708_10292_11092 | 266 |
| 1257 | 3300036401 | Ga0373937_0012002 | Ga0373937_0012002_2875_3675 | 266 |
| 1258 | 3300036401 | Ga0373937_0016752 | Ga0373937_0016752_3259_4059 | 266 |
| 1259 | 3300036401 | Ga0373937_0062971 | Ga0373937_0062971_834_1634 | 266 |
| 1260 | 3300036712 | Ga0316584_0039976 | Ga0316584_0039976_396_1196 | 266 |
| 1261 | 3300037068 | Ga0373925_0000071 | Ga0373925_0000071_33064_33864 | 266 |
| 1262 | 3300037068 | Ga0373925_0025094 | Ga0373925_0025094_2142_2942 | 266 |
| 1263 | 3300037068 | Ga0373925_0039484 | Ga0373925_0039484_2357_3157 | 266 |
| 1264 | 3300037068 | Ga0373925_0078281 | Ga0373925_0078281_443_1243 | 266 |
| 1265 | 3300037068 | Ga0373925_0128987 | Ga0373925_0128987_681_1481 | 266 |
| 1266 | 3300037068 | Ga0373925_0151336 | Ga0373925_0151336_970_1770 | 266 |
| 1267 | 3300037068 | Ga0373925_0195558 | Ga0373925_0195558_649_1449 | 266 |
| 1268 | 3300037418 | Ga0395900_0005355 | Ga0395900_0005355_3423_4256 | 266 |
| 1269 | 3300037418 | Ga0395900_0009172 | Ga0395900_0009172_2045_2845 | 266 |
| 1270 | 3300037418 | Ga0395900_0023179 | Ga0395900_0023179_3593_4393 | 266 |
| 1271 | 3300037418 | Ga0395900_0030518 | Ga0395900_0030518_3902_4702 | 266 |
| 1272 | 3300037418 | Ga0395900_0385494 | Ga0395900_0385494_364_1164 | 266 |
| 1273 | 3300037466 | Ga0395898_0098632 | Ga0395898_0098632_1988_2788 | 266 |
| 1274 | 3300037466 | Ga0395898_0110477 | Ga0395898_0110477_130_930 | 266 |
| 1275 | 3300037471 | Ga0395905_0007343 | Ga0395905_0007343_1284_2102 | 266 |
| 1276 | 3300037471 | Ga0395905_0019208 | Ga0395905_0019208_1637_2437 | 266 |
| 1277 | 3300037853 | Ga0436364_0143743 | Ga0436364_0143743_836_1636 | 266 |
| 1278 | 3300038443 | Ga0395901_0111770 | Ga0395901_0111770_1770_2570 | 266 |
| 1279 | 3300038443 | Ga0395901_0169640 | Ga0395901_0169640_296_1096 | 266 |
| 1280 | 3300038996 | Ga0242420_001963 | Ga0242420_001963_2047_2847 | 266 |
| 1281 | 3300039437 | Ga0436365_1178757 | Ga0436365_1178757_13_813 | 266 |
| 1282 | 3300039437 | Ga0436365_1584283 | Ga0436365_1584283_10666_11466 | 266 |
| 1283 | 3300039438 | Ga0436360_1218633 | Ga0436360_1218633_436_1236 | 266 |
| 1284 | 3300039447 | Ga0436361_0066245 | Ga0436361_0066245_30936_31814 | 266 |
| 1285 | 3300039453 | Ga0436362_0484821 | Ga0436362_0484821_100_900 | 266 |
| 1286 | 3300041404 | Ga0439436_0000775 | Ga0439436_0000775_5949_6749 | 266 |
| 1287 | 3300041404 | Ga0439436_0043605 | Ga0439436_0043605_39_839 | 266 |
| 1288 | 3300041405 | Ga0439438_000172 | Ga0439438_000172_11089_11907 | 266 |
| 1289 | 3300041406 | Ga0439439_0006506 | Ga0439439_0006506_1098_1898 | 266 |
| 1290 | 3300041407 | Ga0439447_036061 | Ga0439447_036061_114_914 | 266 |
| 1291 | 3300041407 | Ga0439447_043930 | Ga0439447_043930_243_1061 | 266 |
| 1292 | 3300041411 | Ga0439466_0000919 | Ga0439466_0000919_7016_7816 | 266 |
| 1293 | 3300041411 | Ga0439466_0052802 | Ga0439466_0052802_208_1008 | 266 |
| 1294 | 3300041413 | Ga0439465_0001472 | Ga0439465_0001472_3497_4297 | 266 |
| 1295 | 3300041997 | Ga0439431_0000651 | Ga0439431_0000651_3448_4248 | 266 |
| 1296 | 3300042002 | Ga0439442_005663 | Ga0439442_005663_398_1198 | 266 |
| 1297 | 3300042004 | Ga0439445_0000311 | Ga0439445_0000311_1598_2398 | 266 |
| 1298 | 3300042006 | Ga0439432_000634 | Ga0439432_000634_784_1584 | 266 |
| 1299 | 3300042006 | Ga0439432_000839 | Ga0439432_000839_8187_8987 | 266 |
| 1300 | 3300042006 | Ga0439432_048569 | Ga0439432_048569_214_1014 | 266 |
| 1301 | 3300042007 | Ga0439449_0001169 | Ga0439449_0001169_5274_6074 | 266 |
| 1302 | 3300042007 | Ga0439449_0071617 | Ga0439449_0071617_167_967 | 266 |
| 1303 | 3300042010 | Ga0439452_007246 | Ga0439452_007246_2184_2984 | 266 |
| 1304 | 3300042010 | Ga0439452_014273 | Ga0439452_014273_1374_2174 | 266 |
| 1305 | 3300042014 | Ga0439457_006925 | Ga0439457_006925_288_1088 | 266 |
| 1306 | 3300042015 | Ga0439462_0000245 | Ga0439462_0000245_1588_2388 | 266 |
| 1307 | 3300042016 | Ga0439463_009804 | Ga0439463_009804_1428_2246 | 266 |
| 1308 | 3300042145 | Ga0450906_008920 | Ga0450906_008920_699_1499 | 266 |
| 1309 | 3300042156 | Ga0439446_0000836 | Ga0439446_0000836_588_1388 | 266 |
| 1310 | 3300042435 | Ga0439434_0008498 | Ga0439434_0008498_1111_1911 | 266 |
| 1311 | 3300042435 | Ga0439434_0102640 | Ga0439434_0102640_106_906 | 266 |
| 1312 | 3300042530 | Ga0450916_020341 | Ga0450916_020341_42_842 | 266 |
| 1313 | 3300042532 | Ga0450893_0012840 | Ga0450893_0012840_526_1326 | 266 |
| 1314 | 3300044694 | Ga0466963_0169674 | Ga0466963_0169674_370_1170 | 266 |
| 1315 | 3300044712 | Ga0453684_0389327 | Ga0453684_0389327_456_1256 | 266 |
| 1316 | 3300044842 | Ga0466957_0151547 | Ga0466957_0151547_613_1413 | 266 |
| 1317 | 3300044842 | Ga0466957_0198811 | Ga0466957_0198811_178_1008 | 266 |
| 1318 | 3300045049 | Ga0466959_0181286 | Ga0466959_0181286_532_1332 | 266 |
| 1319 | 3300045836 | Ga0466958_0019850 | Ga0466958_0019850_2654_3490 | 266 |
| 1320 | 3300045976 | Ga0466967_0002811 | Ga0466967_0002811_5621_6421 | 266 |
| 1321 | 3300045976 | Ga0466967_0677743 | Ga0466967_0677743_39_839 | 266 |
| 1322 | 3300046452 | Ga0495617_025618 | Ga0495617_025618_1165_1965 | 266 |
| 1323 | 3300046453 | Ga0495627_005899 | Ga0495627_005899_161_1027 | 266 |
| 1324 | 3300046454 | Ga0495592_0000117 | Ga0495592_0000117_37606_38406 | 266 |
| 1325 | 3300046454 | Ga0495592_0023908 | Ga0495592_0023908_2828_3628 | 266 |
| 1326 | 3300046454 | Ga0495592_0031275 | Ga0495592_0031275_754_1563 | 266 |
| 1327 | 3300046454 | Ga0495592_0074670 | Ga0495592_0074670_1187_1987 | 266 |
| 1328 | 3300046454 | Ga0495592_0089572 | Ga0495592_0089572_172_972 | 266 |
| 1329 | 3300046454 | Ga0495592_0184893 | Ga0495592_0184893_507_1307 | 266 |
| 1330 | 3300046454 | Ga0495592_0243356 | Ga0495592_0243356_284_1084 | 266 |
| 1331 | 3300046454 | Ga0495592_0291141 | Ga0495592_0291141_141_941 | 266 |
| 1332 | 3300046455 | Ga0495603_0008338 | Ga0495603_0008338_1696_2496 | 266 |
| 1333 | 3300046455 | Ga0495603_0028846 | Ga0495603_0028846_1890_2690 | 266 |
| 1334 | 3300046455 | Ga0495603_0237029 | Ga0495603_0237029_200_1000 | 266 |
| 1335 | 3300046458 | Ga0495591_000635 | Ga0495591_000635_1781_2590 | 266 |
| 1336 | 3300046459 | Ga0495629_0000183 | Ga0495629_0000183_24996_25796 | 266 |
| 1337 | 3300046459 | Ga0495629_0008700 | Ga0495629_0008700_3883_4683 | 266 |
| 1338 | 3300046459 | Ga0495629_0010435 | Ga0495629_0010435_3723_4532 | 266 |
| 1339 | 3300046459 | Ga0495629_0022122 | Ga0495629_0022122_1225_2025 | 266 |
| 1340 | 3300046460 | Ga0495638_0019805 | Ga0495638_0019805_908_1708 | 266 |
| 1341 | 3300046460 | Ga0495638_0044966 | Ga0495638_0044966_1944_2753 | 266 |
| 1342 | 3300046461 | Ga0495641_0014858 | Ga0495641_0014858_3111_3911 | 266 |
| 1343 | 3300046461 | Ga0495641_0024360 | Ga0495641_0024360_577_1377 | 266 |
| 1344 | 3300046461 | Ga0495641_0048412 | Ga0495641_0048412_717_1517 | 266 |
| 1345 | 3300046461 | Ga0495641_0062845 | Ga0495641_0062845_268_1068 | 266 |
| 1346 | 3300046462 | Ga0495651_0000370 | Ga0495651_0000370_6535_7335 | 266 |
| 1347 | 3300046462 | Ga0495651_0000814 | Ga0495651_0000814_21846_22646 | 266 |
| 1348 | 3300046462 | Ga0495651_0002238 | Ga0495651_0002238_6999_7808 | 266 |
| 1349 | 3300046462 | Ga0495651_0006676 | Ga0495651_0006676_4371_5171 | 266 |
| 1350 | 3300046462 | Ga0495651_0007700 | Ga0495651_0007700_1406_2206 | 266 |
| 1351 | 3300046462 | Ga0495651_0009079 | Ga0495651_0009079_2381_3181 | 266 |
| 1352 | 3300046462 | Ga0495651_0018701 | Ga0495651_0018701_3517_4317 | 266 |
| 1353 | 3300046462 | Ga0495651_0080495 | Ga0495651_0080495_1426_2226 | 266 |
| 1354 | 3300046462 | Ga0495651_0132388 | Ga0495651_0132388_31_831 | 266 |
| 1355 | 3300046463 | Ga0495653_0000047 | Ga0495653_0000047_67013_67813 | 266 |
| 1356 | 3300046463 | Ga0495653_0005190 | Ga0495653_0005190_821_1630 | 266 |
| 1357 | 3300046463 | Ga0495653_0007193 | Ga0495653_0007193_6114_6932 | 266 |
| 1358 | 3300046463 | Ga0495653_0010604 | Ga0495653_0010604_756_1592 | 266 |
| 1359 | 3300046463 | Ga0495653_0096770 | Ga0495653_0096770_506_1306 | 266 |
| 1360 | 3300046471 | Ga0495650_0001103 | Ga0495650_0001103_20674_21492 | 266 |
| 1361 | 3300046471 | Ga0495650_0001463 | Ga0495650_0001463_20232_21032 | 266 |
| 1362 | 3300046471 | Ga0495650_0094670 | Ga0495650_0094670_64_864 | 266 |
| 1363 | 3300046472 | Ga0495580_0007138 | Ga0495580_0007138_2418_3227 | 266 |
| 1364 | 3300046472 | Ga0495580_0025075 | Ga0495580_0025075_352_1152 | 266 |
| 1365 | 3300046472 | Ga0495580_0070025 | Ga0495580_0070025_1597_2397 | 266 |
| 1366 | 3300046472 | Ga0495580_0154976 | Ga0495580_0154976_237_1046 | 266 |
| 1367 | 3300046473 | Ga0495582_0001121 | Ga0495582_0001121_7467_8267 | 266 |
| 1368 | 3300046473 | Ga0495582_0024945 | Ga0495582_0024945_652_1461 | 266 |
| 1369 | 3300046475 | Ga0495639_0050356 | Ga0495639_0050356_905_1705 | 266 |
| 1370 | 3300046476 | Ga0495662_0005350 | Ga0495662_0005350_2397_3197 | 266 |
| 1371 | 3300046476 | Ga0495662_0010112 | Ga0495662_0010112_3686_4495 | 266 |
| 1372 | 3300046476 | Ga0495662_0030200 | Ga0495662_0030200_754_1554 | 266 |
| 1373 | 3300046476 | Ga0495662_0044862 | Ga0495662_0044862_309_1109 | 266 |
| 1374 | 3300046476 | Ga0495662_0151810 | Ga0495662_0151810_91_891 | 266 |
| 1375 | 3300046477 | Ga0495664_0000024 | Ga0495664_0000024_37860_38660 | 266 |
| 1376 | 3300046477 | Ga0495664_0005136 | Ga0495664_0005136_2659_3468 | 266 |
| 1377 | 3300046477 | Ga0495664_0057217 | Ga0495664_0057217_46_846 | 266 |
| 1378 | 3300046491 | Ga0495584_0010326 | Ga0495584_0010326_879_1679 | 266 |
| 1379 | 3300046492 | Ga0495585_0003428 | Ga0495585_0003428_3461_4261 | 266 |
| 1380 | 3300046499 | Ga0495594_0005327 | Ga0495594_0005327_5597_6397 | 266 |
| 1381 | 3300046500 | Ga0495596_0000234 | Ga0495596_0000234_9078_9890 | 266 |
| 1382 | 3300046500 | Ga0495596_0000399 | Ga0495596_0000399_6226_7044 | 266 |
| 1383 | 3300046500 | Ga0495596_0000473 | Ga0495596_0000473_17643_18452 | 266 |
| 1384 | 3300046501 | Ga0495607_0003341 | Ga0495607_0003341_10203_11003 | 266 |
| 1385 | 3300046501 | Ga0495607_0005459 | Ga0495607_0005459_4604_5416 | 266 |
| 1386 | 3300046501 | Ga0495607_0009340 | Ga0495607_0009340_3107_3907 | 266 |
| 1387 | 3300046507 | Ga0495606_0000028 | Ga0495606_0000028_146810_147628 | 266 |
| 1388 | 3300046511 | Ga0495608_0000004 | Ga0495608_0000004_104366_105166 | 266 |
| 1389 | 3300046511 | Ga0495608_0002221 | Ga0495608_0002221_2289_3089 | 266 |
| 1390 | 3300046511 | Ga0495608_0005426 | Ga0495608_0005426_1083_1892 | 266 |
| 1391 | 3300046511 | Ga0495608_0015766 | Ga0495608_0015766_4055_4855 | 266 |
| 1392 | 3300046511 | Ga0495608_0270471 | Ga0495608_0270471_154_954 | 266 |
| 1393 | 3300046512 | Ga0495610_0001083 | Ga0495610_0001083_19343_20155 | 266 |
| 1394 | 3300046512 | Ga0495610_0011354 | Ga0495610_0011354_2440_3240 | 266 |
| 1395 | 3300046513 | Ga0495616_0005373 | Ga0495616_0005373_3089_3925 | 266 |
| 1396 | 3300046513 | Ga0495616_0008254 | Ga0495616_0008254_4620_5432 | 266 |
| 1397 | 3300046513 | Ga0495616_0010366 | Ga0495616_0010366_2831_3631 | 266 |
| 1398 | 3300046514 | Ga0495618_0000036 | Ga0495618_0000036_55176_55976 | 266 |
| 1399 | 3300046514 | Ga0495618_0010775 | Ga0495618_0010775_1993_2802 | 266 |
| 1400 | 3300046514 | Ga0495618_0013409 | Ga0495618_0013409_90_890 | 266 |
| 1401 | 3300046514 | Ga0495618_0022634 | Ga0495618_0022634_2267_3067 | 266 |
| 1402 | 3300046514 | Ga0495618_0058548 | Ga0495618_0058548_1614_2414 | 266 |
| 1403 | 3300046516 | Ga0495628_0000006 | Ga0495628_0000006_45567_46367 | 266 |
| 1404 | 3300046516 | Ga0495628_0000950 | Ga0495628_0000950_10719_11519 | 266 |
| 1405 | 3300046516 | Ga0495628_0011003 | Ga0495628_0011003_6151_6951 | 266 |
| 1406 | 3300046516 | Ga0495628_0037732 | Ga0495628_0037732_1030_1863 | 266 |
| 1407 | 3300046516 | Ga0495628_0063284 | Ga0495628_0063284_483_1283 | 266 |
| 1408 | 3300046516 | Ga0495628_0084826 | Ga0495628_0084826_216_1016 | 266 |
| 1409 | 3300046516 | Ga0495628_0113498 | Ga0495628_0113498_693_1502 | 266 |
| 1410 | 3300046517 | Ga0495630_0000647 | Ga0495630_0000647_21722_22522 | 266 |
| 1411 | 3300046517 | Ga0495630_0000958 | Ga0495630_0000958_12032_12841 | 266 |
| 1412 | 3300046517 | Ga0495630_0037719 | Ga0495630_0037719_61_861 | 266 |
| 1413 | 3300046518 | Ga0495631_0000135 | Ga0495631_0000135_42427_43227 | 266 |
| 1414 | 3300046518 | Ga0495631_0088284 | Ga0495631_0088284_191_991 | 266 |
| 1415 | 3300046520 | Ga0495637_0067592 | Ga0495637_0067592_523_1323 | 266 |
| 1416 | 3300046523 | Ga0495644_0000234 | Ga0495644_0000234_1064_1864 | 266 |
| 1417 | 3300046524 | Ga0495648_0000454 | Ga0495648_0000454_34025_34834 | 266 |
| 1418 | 3300046524 | Ga0495648_0003768 | Ga0495648_0003768_10958_11767 | 266 |
| 1419 | 3300046526 | Ga0495666_0001961 | Ga0495666_0001961_926_1735 | 266 |
| 1420 | 3300046526 | Ga0495666_0069489 | Ga0495666_0069489_699_1499 | 266 |
| 1421 | 3300046529 | Ga0495652_0000038 | Ga0495652_0000038_40578_41378 | 266 |
| 1422 | 3300046529 | Ga0495652_0002257 | Ga0495652_0002257_11920_12720 | 266 |
| 1423 | 3300046529 | Ga0495652_0005721 | Ga0495652_0005721_9665_10465 | 266 |
| 1424 | 3300046529 | Ga0495652_0051353 | Ga0495652_0051353_1410_2210 | 266 |
| 1425 | 3300046529 | Ga0495652_0067574 | Ga0495652_0067574_1803_2612 | 266 |
| 1426 | 3300046529 | Ga0495652_0150503 | Ga0495652_0150503_51_851 | 266 |
| 1427 | 3300046530 | Ga0495654_0000458 | Ga0495654_0000458_20674_21492 | 266 |
| 1428 | 3300046531 | Ga0495665_0000503 | Ga0495665_0000503_2495_3304 | 266 |
| 1429 | 3300046531 | Ga0495665_0171539 | Ga0495665_0171539_223_1023 | 266 |
| 1430 | 3300046531 | Ga0495665_0263839 | Ga0495665_0263839_11_844 | 266 |
| 1431 | 3300046533 | Ga0495640_0000001 | Ga0495640_0000001_52753_53553 | 266 |
| 1432 | 3300046533 | Ga0495640_0009446 | Ga0495640_0009446_1115_1915 | 266 |
| 1433 | 3300046533 | Ga0495640_0011562 | Ga0495640_0011562_5397_6206 | 266 |
| 1434 | 3300046533 | Ga0495640_0018366 | Ga0495640_0018366_2750_3550 | 266 |
| 1435 | 3300046533 | Ga0495640_0030156 | Ga0495640_0030156_1680_2480 | 266 |
| 1436 | 3300046533 | Ga0495640_0065064 | Ga0495640_0065064_1641_2441 | 266 |
| 1437 | 3300046533 | Ga0495640_0118754 | Ga0495640_0118754_307_1107 | 266 |
| 1438 | 3300046535 | Ga0495586_0011977 | Ga0495586_0011977_3566_4375 | 266 |
| 1439 | 3300046535 | Ga0495586_0078426 | Ga0495586_0078426_296_1096 | 266 |
| 1440 | 3300046535 | Ga0495586_0116328 | Ga0495586_0116328_56_856 | 266 |
| 1441 | 3300046536 | Ga0495587_0000004 | Ga0495587_0000004_107831_108631 | 266 |
| 1442 | 3300046536 | Ga0495587_0002205 | Ga0495587_0002205_9964_10773 | 266 |
| 1443 | 3300046536 | Ga0495587_0002956 | Ga0495587_0002956_2767_3567 | 266 |
| 1444 | 3300046536 | Ga0495587_0016926 | Ga0495587_0016926_2489_3289 | 266 |
| 1445 | 3300046536 | Ga0495587_0044529 | Ga0495587_0044529_919_1719 | 266 |
| 1446 | 3300046536 | Ga0495587_0101778 | Ga0495587_0101778_122_922 | 266 |
| 1447 | 3300046536 | Ga0495587_0227286 | Ga0495587_0227286_124_924 | 266 |
| 1448 | 3300046536 | Ga0495587_0237797 | Ga0495587_0237797_175_975 | 266 |
| 1449 | 3300046538 | Ga0495609_0003061 | Ga0495609_0003061_4380_5192 | 266 |
| 1450 | 3300046538 | Ga0495609_0068622 | Ga0495609_0068622_76_876 | 266 |
| 1451 | 3300046539 | Ga0495621_0043543 | Ga0495621_0043543_32_856 | 266 |
| 1452 | 3300046539 | Ga0495621_0051238 | Ga0495621_0051238_106_906 | 266 |
| 1453 | 3300046543 | Ga0495645_0000001 | Ga0495645_0000001_249950_250750 | 266 |
| 1454 | 3300046543 | Ga0495645_0000432 | Ga0495645_0000432_24464_25264 | 266 |
| 1455 | 3300046543 | Ga0495645_0001487 | Ga0495645_0001487_6961_7761 | 266 |
| 1456 | 3300046543 | Ga0495645_0024643 | Ga0495645_0024643_753_1562 | 266 |
| 1457 | 3300046543 | Ga0495645_0105019 | Ga0495645_0105019_935_1735 | 266 |
| 1458 | 3300046543 | Ga0495645_0239708 | Ga0495645_0239708_260_1060 | 266 |
| 1459 | 3300046557 | Ga0495622_0024244 | Ga0495622_0024244_599_1399 | 266 |
| 1460 | 3300046557 | Ga0495622_0027655 | Ga0495622_0027655_208_1008 | 266 |
| 1461 | 3300046557 | Ga0495622_0076085 | Ga0495622_0076085_726_1526 | 266 |
| 1462 | 3300046558 | Ga0495633_0005806 | Ga0495633_0005806_317_1117 | 266 |
| 1463 | 3300046559 | Ga0495667_0000093 | Ga0495667_0000093_31696_32496 | 266 |
| 1464 | 3300046559 | Ga0495667_0001799 | Ga0495667_0001799_1584_2384 | 266 |
| 1465 | 3300046559 | Ga0495667_0008800 | Ga0495667_0008800_4063_4863 | 266 |
| 1466 | 3300046559 | Ga0495667_0026230 | Ga0495667_0026230_70_870 | 266 |
| 1467 | 3300046559 | Ga0495667_0029736 | Ga0495667_0029736_2243_3043 | 266 |
| 1468 | 3300046559 | Ga0495667_0067176 | Ga0495667_0067176_306_1115 | 266 |
| 1469 | 3300046559 | Ga0495667_0130871 | Ga0495667_0130871_86_886 | 266 |
| 1470 | 3300046559 | Ga0495667_0256305 | Ga0495667_0256305_286_1086 | 266 |
| 1471 | 3300046615 | Ga0495656_0000174 | Ga0495656_0000174_2781_3581 | 266 |
| 1472 | 3300046616 | Ga0495668_0001029 | Ga0495668_0001029_20667_21485 | 266 |
| 1473 | 3300046616 | Ga0495668_0007077 | Ga0495668_0007077_6279_7097 | 266 |
| 1474 | 3300046642 | Ga0495634_0000133 | Ga0495634_0000133_37596_38396 | 266 |
| 1475 | 3300046642 | Ga0495634_0016098 | Ga0495634_0016098_3723_4532 | 266 |
| 1476 | 3300046642 | Ga0495634_0033066 | Ga0495634_0033066_1181_1981 | 266 |
| 1477 | 3300046642 | Ga0495634_0114725 | Ga0495634_0114725_439_1239 | 266 |
| 1478 | 3300046642 | Ga0495634_0206571 | Ga0495634_0206571_48_848 | 266 |
| 1479 | 3300046648 | Ga0495611_0023408 | Ga0495611_0023408_1014_1814 | 266 |
| 1480 | 3300046660 | Ga0495625_0150502 | Ga0495625_0150502_290_1090 | 266 |
| 1481 | 3300046663 | Ga0495635_0000003 | Ga0495635_0000003_249581_250381 | 266 |
| 1482 | 3300046663 | Ga0495635_0000646 | Ga0495635_0000646_5525_6334 | 266 |
| 1483 | 3300046663 | Ga0495635_0006494 | Ga0495635_0006494_5964_6764 | 266 |
| 1484 | 3300046663 | Ga0495635_0034212 | Ga0495635_0034212_2060_2860 | 266 |
| 1485 | 3300046663 | Ga0495635_0073971 | Ga0495635_0073971_599_1399 | 266 |
| 1486 | 3300046663 | Ga0495635_0105275 | Ga0495635_0105275_158_958 | 266 |
| 1487 | 3300046663 | Ga0495635_0119512 | Ga0495635_0119512_259_1059 | 266 |
| 1488 | 3300046664 | Ga0495659_0000220 | Ga0495659_0000220_3831_4631 | 266 |
| 1489 | 3300046665 | Ga0495661_0000013 | Ga0495661_0000013_105218_106036 | 266 |
| 1490 | 3300046665 | Ga0495661_0000842 | Ga0495661_0000842_15158_15967 | 266 |
| 1491 | 3300046665 | Ga0495661_0012410 | Ga0495661_0012410_513_1325 | 266 |
| 1492 | 3300046674 | Ga0495588_0037137 | Ga0495588_0037137_867_1667 | 266 |
| 1493 | 3300046675 | Ga0495657_0000143 | Ga0495657_0000143_37563_38363 | 266 |
| 1494 | 3300046675 | Ga0495657_0013257 | Ga0495657_0013257_1280_2080 | 266 |
| 1495 | 3300046675 | Ga0495657_0021999 | Ga0495657_0021999_3001_3801 | 266 |
| 1496 | 3300046675 | Ga0495657_0047823 | Ga0495657_0047823_734_1534 | 266 |
| 1497 | 3300046675 | Ga0495657_0172690 | Ga0495657_0172690_473_1282 | 266 |
| 1498 | 3300046678 | Ga0495599_0000012 | Ga0495599_0000012_47845_48645 | 266 |
| 1499 | 3300046678 | Ga0495599_0004908 | Ga0495599_0004908_4620_5420 | 266 |
| 1500 | 3300046678 | Ga0495599_0018735 | Ga0495599_0018735_3060_3869 | 266 |
| 1501 | 3300046678 | Ga0495599_0027283 | Ga0495599_0027283_2620_3420 | 266 |
| 1502 | 3300046678 | Ga0495599_0075037 | Ga0495599_0075037_1196_1996 | 266 |
| 1503 | 3300046678 | Ga0495599_0109570 | Ga0495599_0109570_158_958 | 266 |
| 1504 | 3300046679 | Ga0495623_0000015 | Ga0495623_0000015_84908_85708 | 266 |
| 1505 | 3300046679 | Ga0495623_0001145 | Ga0495623_0001145_4480_5298 | 266 |
| 1506 | 3300046679 | Ga0495623_0004582 | Ga0495623_0004582_7633_8433 | 266 |
| 1507 | 3300046679 | Ga0495623_0007637 | Ga0495623_0007637_2864_3673 | 266 |
| 1508 | 3300046679 | Ga0495623_0058539 | Ga0495623_0058539_1323_2123 | 266 |
| 1509 | 3300046680 | Ga0495646_0000005 | Ga0495646_0000005_162121_162921 | 266 |
| 1510 | 3300046680 | Ga0495646_0002872 | Ga0495646_0002872_1619_2428 | 266 |
| 1511 | 3300046680 | Ga0495646_0006953 | Ga0495646_0006953_4229_5029 | 266 |
| 1512 | 3300046680 | Ga0495646_0024002 | Ga0495646_0024002_928_1728 | 266 |
| 1513 | 3300046680 | Ga0495646_0051560 | Ga0495646_0051560_1386_2222 | 266 |
| 1514 | 3300046680 | Ga0495646_0299562 | Ga0495646_0299562_31_831 | 266 |
| 1515 | 3300046681 | Ga0495647_0013152 | Ga0495647_0013152_1024_1824 | 266 |
| 1516 | 3300046683 | Ga0495658_0000357 | Ga0495658_0000357_8700_9500 | 266 |
| 1517 | 3300046683 | Ga0495658_0009686 | Ga0495658_0009686_1641_2441 | 266 |
| 1518 | 3300046683 | Ga0495658_0064782 | Ga0495658_0064782_1038_1838 | 266 |
| 1519 | 3300046683 | Ga0495658_0069789 | Ga0495658_0069789_1076_1876 | 266 |
| 1520 | 3300046683 | Ga0495658_0275730 | Ga0495658_0275730_175_975 | 266 |
| 1521 | 3300046689 | Ga0495613_0002012 | Ga0495613_0002012_13622_14431 | 266 |
| 1522 | 3300046689 | Ga0495613_0009346 | Ga0495613_0009346_3528_4328 | 266 |
| 1523 | 3300046689 | Ga0495613_0143411 | Ga0495613_0143411_224_1024 | 266 |
| 1524 | 3300046689 | Ga0495613_0160507 | Ga0495613_0160507_547_1347 | 266 |
| 1525 | 3300046690 | Ga0495624_0003776 | Ga0495624_0003776_4366_5175 | 266 |
| 1526 | 3300046690 | Ga0495624_0031164 | Ga0495624_0031164_1144_1944 | 266 |
| 1527 | 3300046691 | Ga0495670_0000414 | Ga0495670_0000414_4841_5641 | 266 |
| 1528 | 3300046692 | Ga0495671_0001254 | Ga0495671_0001254_4641_5453 | 266 |
| 1529 | 3300046692 | Ga0495671_0040031 | Ga0495671_0040031_981_1781 | 266 |
| 1530 | 3300046692 | Ga0495671_0169826 | Ga0495671_0169826_121_930 | 266 |
| 1531 | 3300046694 | Ga0495649_0008623 | Ga0495649_0008623_760_1572 | 266 |
| 1532 | 3300046694 | Ga0495649_0044452 | Ga0495649_0044452_1103_1912 | 266 |
| 1533 | 3300046794 | Ga0495589_0035216 | Ga0495589_0035216_1009_1818 | 266 |
| 1534 | 3300046794 | Ga0495589_0125734 | Ga0495589_0125734_25_837 | 266 |
| 1535 | 3300046794 | Ga0495589_0151085 | Ga0495589_0151085_262_1062 | 266 |
| 1536 | 3300046809 | Ga0495600_0000051 | Ga0495600_0000051_40741_41541 | 266 |
| 1537 | 3300046809 | Ga0495600_0003472 | Ga0495600_0003472_5255_6064 | 266 |
| 1538 | 3300046809 | Ga0495600_0007486 | Ga0495600_0007486_2662_3462 | 266 |
| 1539 | 3300046809 | Ga0495600_0022417 | Ga0495600_0022417_515_1315 | 266 |
| 1540 | 3300046809 | Ga0495600_0037657 | Ga0495600_0037657_1896_2696 | 266 |
| 1541 | 3300046809 | Ga0495600_0190871 | Ga0495600_0190871_214_1014 | 266 |
| 1542 | 3300047315 | Ga0495581_0001486 | Ga0495581_0001486_1162_1971 | 266 |
| 1543 | 3300047315 | Ga0495581_0010000 | Ga0495581_0010000_3861_4661 | 266 |
| 1544 | 3300047315 | Ga0495581_0012865 | Ga0495581_0012865_3968_4768 | 266 |
| 1545 | 3300047315 | Ga0495581_0015516 | Ga0495581_0015516_1664_2464 | 266 |
| 1546 | 3300047317 | Ga0495604_0000002 | Ga0495604_0000002_280268_281068 | 266 |
| 1547 | 3300047317 | Ga0495604_0017648 | Ga0495604_0017648_3911_4711 | 266 |
| 1548 | 3300047317 | Ga0495604_0048780 | Ga0495604_0048780_2227_3036 | 266 |
| 1549 | 3300047317 | Ga0495604_0115217 | Ga0495604_0115217_108_908 | 266 |
| 1550 | 3300047317 | Ga0495604_0137824 | Ga0495604_0137824_904_1704 | 266 |
| 1551 | 3300047317 | Ga0495604_0212198 | Ga0495604_0212198_205_1038 | 266 |
| 1552 | 3300047319 | Ga0495674_0000004 | Ga0495674_0000004_279817_280617 | 266 |
| 1553 | 3300047319 | Ga0495674_0024907 | Ga0495674_0024907_763_1563 | 266 |
| 1554 | 3300047319 | Ga0495674_0025291 | Ga0495674_0025291_2791_3591 | 266 |
| 1555 | 3300047319 | Ga0495674_0048298 | Ga0495674_0048298_2758_3558 | 266 |
| 1556 | 3300047319 | Ga0495674_0051878 | Ga0495674_0051878_2112_2921 | 266 |
| 1557 | 3300047319 | Ga0495674_0069597 | Ga0495674_0069597_249_1049 | 266 |
| 1558 | 3300047319 | Ga0495674_0155587 | Ga0495674_0155587_1016_1816 | 266 |
| 1559 | 3300047320 | Ga0495672_0013407 | Ga0495672_0013407_151_963 | 266 |
| 1560 | 3300047321 | Ga0495676_0008678 | Ga0495676_0008678_5158_5967 | 266 |
| 1561 | 3300047321 | Ga0495676_0036656 | Ga0495676_0036656_719_1519 | 266 |
| 1562 | 3300047322 | Ga0495680_0000142 | Ga0495680_0000142_68267_69067 | 266 |
| 1563 | 3300047322 | Ga0495680_0001462 | Ga0495680_0001462_3167_3967 | 266 |
| 1564 | 3300047322 | Ga0495680_0005045 | Ga0495680_0005045_11114_11914 | 266 |
| 1565 | 3300047322 | Ga0495680_0011214 | Ga0495680_0011214_4151_4960 | 266 |
| 1566 | 3300047322 | Ga0495680_0012241 | Ga0495680_0012241_3155_3955 | 266 |
| 1567 | 3300047322 | Ga0495680_0017639 | Ga0495680_0017639_3129_3929 | 266 |
| 1568 | 3300047322 | Ga0495680_0027679 | Ga0495680_0027679_3558_4394 | 266 |
| 1569 | 3300047322 | Ga0495680_0054253 | Ga0495680_0054253_1795_2595 | 266 |
| 1570 | 3300047322 | Ga0495680_0054369 | Ga0495680_0054369_1822_2622 | 266 |
| 1571 | 3300047322 | Ga0495680_0081387 | Ga0495680_0081387_583_1401 | 266 |
| 1572 | 3300047323 | Ga0495683_0000086 | Ga0495683_0000086_80624_81442 | 266 |
| 1573 | 3300047323 | Ga0495683_0000919 | Ga0495683_0000919_15243_16052 | 266 |
| 1574 | 3300047444 | Ga0495675_0000824 | Ga0495675_0000824_14408_15208 | 266 |
| 1575 | 3300047444 | Ga0495675_0004498 | Ga0495675_0004498_3527_4345 | 266 |
| 1576 | 3300047444 | Ga0495675_0005626 | Ga0495675_0005626_3723_4532 | 266 |
| 1577 | 3300047444 | Ga0495675_0057907 | Ga0495675_0057907_216_1016 | 266 |
| 1578 | 3300047444 | Ga0495675_0087847 | Ga0495675_0087847_837_1670 | 266 |
| 1579 | 3300047444 | Ga0495675_0099781 | Ga0495675_0099781_808_1608 | 266 |
| 1580 | 3300047446 | Ga0495679_000078 | Ga0495679_000078_35423_36232 | 266 |
| 1581 | 3300047447 | Ga0495685_006895 | Ga0495685_006895_1152_1964 | 266 |
| 1582 | 3300047469 | Ga0495673_0004187 | Ga0495673_0004187_6014_6823 | 266 |
| 1583 | 3300047469 | Ga0495673_0007764 | Ga0495673_0007764_1597_2415 | 266 |
| 1584 | 3300047469 | Ga0495673_0105981 | Ga0495673_0105981_49_861 | 266 |
| 1585 | 3300047471 | Ga0495684_0000004 | Ga0495684_0000004_260693_261493 | 266 |
| 1586 | 3300047471 | Ga0495684_0001528 | Ga0495684_0001528_1787_2587 | 266 |
| 1587 | 3300047471 | Ga0495684_0033070 | Ga0495684_0033070_2650_3468 | 266 |
| 1588 | 3300047471 | Ga0495684_0100776 | Ga0495684_0100776_1109_1918 | 266 |
| 1589 | 3300047471 | Ga0495684_0110807 | Ga0495684_0110807_444_1244 | 266 |
| 1590 | 3300047471 | Ga0495684_0199991 | Ga0495684_0199991_298_1098 | 266 |
| 1591 | 3300047673 | Ga0495593_0004166 | Ga0495593_0004166_581_1390 | 266 |
| 1592 | 3300047673 | Ga0495593_0156173 | Ga0495593_0156173_283_1083 | 266 |
| 1593 | 3300048088 | Ga0495602_0000001 | Ga0495602_0000001_249623_250423 | 266 |
| 1594 | 3300048088 | Ga0495602_0004084 | Ga0495602_0004084_6218_7018 | 266 |
| 1595 | 3300048088 | Ga0495602_0038074 | Ga0495602_0038074_2513_3313 | 266 |
| 1596 | 3300048088 | Ga0495602_0067303 | Ga0495602_0067303_1102_1902 | 266 |
| 1597 | 3300048089 | Ga0495614_0001174 | Ga0495614_0001174_4177_4986 | 266 |
| 1598 | 3300048089 | Ga0495614_0106141 | Ga0495614_0106141_241_1041 | 266 |
| 1599 | 3300048091 | Ga0495626_0001516 | Ga0495626_0001516_13107_13943 | 266 |
| 1600 | 3300048903 | Ga0496100_0000066 | Ga0496100_0000066_44325_45128 | 266 |
| 1601 | 3300048903 | Ga0496100_0002624 | Ga0496100_0002624_1985_2785 | 266 |
| 1602 | 3300048903 | Ga0496100_0032409 | Ga0496100_0032409_2348_3148 | 266 |
| 1603 | 3300048903 | Ga0496100_0040924 | Ga0496100_0040924_1041_1841 | 266 |
| 1604 | 3300048903 | Ga0496100_0088506 | Ga0496100_0088506_1081_1881 | 266 |
| 1605 | 3300048903 | Ga0496100_0096905 | Ga0496100_0096905_745_1545 | 266 |
| 1606 | 3300048904 | Ga0496101_0000154 | Ga0496101_0000154_44298_45101 | 266 |
| 1607 | 3300048904 | Ga0496101_0003320 | Ga0496101_0003320_7362_8162 | 266 |
| 1608 | 3300048904 | Ga0496101_0015113 | Ga0496101_0015113_4033_4833 | 266 |
| 1609 | 3300048904 | Ga0496101_0020381 | Ga0496101_0020381_1622_2422 | 266 |
| 1610 | 3300048904 | Ga0496101_0048987 | Ga0496101_0048987_1389_2189 | 266 |
| 1611 | 3300048904 | Ga0496101_0412861 | Ga0496101_0412861_250_1050 | 266 |
| 1612 | 3300048905 | Ga0496102_0000191 | Ga0496102_0000191_44302_45105 | 266 |
| 1613 | 3300048905 | Ga0496102_0006722 | Ga0496102_0006722_1992_2801 | 266 |
| 1614 | 3300048905 | Ga0496102_0024677 | Ga0496102_0024677_2448_3248 | 266 |
| 1615 | 3300048905 | Ga0496102_0025462 | Ga0496102_0025462_2887_3687 | 266 |
| 1616 | 3300048905 | Ga0496102_0062282 | Ga0496102_0062282_2337_3137 | 266 |
| 1617 | 3300048905 | Ga0496102_0107194 | Ga0496102_0107194_1405_2205 | 266 |
| 1618 | 3300048905 | Ga0496102_0130447 | Ga0496102_0130447_1425_2243 | 266 |
| 1619 | 3300048905 | Ga0496102_0166352 | Ga0496102_0166352_600_1400 | 266 |
| 1620 | 3300048905 | Ga0496102_0283874 | Ga0496102_0283874_642_1442 | 266 |
| 1621 | 3300048906 | Ga0496103_0000232 | Ga0496103_0000232_15350_16153 | 266 |
| 1622 | 3300048906 | Ga0496103_0002570 | Ga0496103_0002570_2527_3336 | 266 |
| 1623 | 3300048906 | Ga0496103_0010404 | Ga0496103_0010404_1478_2278 | 266 |
| 1624 | 3300048906 | Ga0496103_0022797 | Ga0496103_0022797_691_1491 | 266 |
| 1625 | 3300048906 | Ga0496103_0123516 | Ga0496103_0123516_610_1410 | 266 |
| 1626 | 3300048907 | Ga0496104_0001363 | Ga0496104_0001363_9699_10499 | 266 |
| 1627 | 3300048907 | Ga0496104_0005323 | Ga0496104_0005323_8988_9791 | 266 |
| 1628 | 3300048907 | Ga0496104_0030000 | Ga0496104_0030000_2398_3198 | 266 |
| 1629 | 3300048907 | Ga0496104_0094144 | Ga0496104_0094144_492_1292 | 266 |
| 1630 | 3300048907 | Ga0496104_0196088 | Ga0496104_0196088_95_895 | 266 |
| 1631 | 3300048907 | Ga0496104_0453131 | Ga0496104_0453131_142_945 | 266 |
| 1632 | 3300048908 | Ga0496105_0002131 | Ga0496105_0002131_12254_13054 | 266 |
| 1633 | 3300048908 | Ga0496105_0020728 | Ga0496105_0020728_2215_3015 | 266 |
| 1634 | 3300048908 | Ga0496105_0038168 | Ga0496105_0038168_68_871 | 266 |
| 1635 | 3300048908 | Ga0496105_0045672 | Ga0496105_0045672_1517_2317 | 266 |
| 1636 | 3300048908 | Ga0496105_0101863 | Ga0496105_0101863_1127_1927 | 266 |
| 1637 | 3300048908 | Ga0496105_0166138 | Ga0496105_0166138_523_1323 | 266 |
| 1638 | 3300048908 | Ga0496105_0194665 | Ga0496105_0194665_228_1028 | 266 |
| 1639 | 3300048908 | Ga0496105_0437968 | Ga0496105_0437968_210_1010 | 266 |
| 1640 | 3300048909 | Ga0496106_0002204 | Ga0496106_0002204_10614_11414 | 266 |
| 1641 | 3300048909 | Ga0496106_0004015 | Ga0496106_0004015_5287_6087 | 266 |
| 1642 | 3300048909 | Ga0496106_0046148 | Ga0496106_0046148_901_1701 | 266 |
| 1643 | 3300048909 | Ga0496106_0173777 | Ga0496106_0173777_358_1158 | 266 |
| 1644 | 3300048909 | Ga0496106_0188967 | Ga0496106_0188967_606_1406 | 266 |
| 1645 | 3300048909 | Ga0496106_0283491 | Ga0496106_0283491_428_1228 | 266 |
| 1646 | 3300048910 | Ga0496107_0001189 | Ga0496107_0001189_3176_3976 | 266 |
| 1647 | 3300048910 | Ga0496107_0005878 | Ga0496107_0005878_3425_4225 | 266 |
| 1648 | 3300048910 | Ga0496107_0023259 | Ga0496107_0023259_549_1349 | 266 |
| 1649 | 3300048910 | Ga0496107_0048646 | Ga0496107_0048646_2191_2991 | 266 |
| 1650 | 3300048910 | Ga0496107_0060851 | Ga0496107_0060851_1913_2713 | 266 |
| 1651 | 3300048910 | Ga0496107_0461999 | Ga0496107_0461999_34_834 | 266 |
| 1652 | 3300048911 | Ga0496108_0002494 | Ga0496108_0002494_6992_7792 | 266 |
| 1653 | 3300048911 | Ga0496108_0010537 | Ga0496108_0010537_2167_2967 | 266 |
| 1654 | 3300048911 | Ga0496108_0037485 | Ga0496108_0037485_1072_1872 | 266 |
| 1655 | 3300048911 | Ga0496108_0070746 | Ga0496108_0070746_1936_2736 | 266 |
| 1656 | 3300048911 | Ga0496108_0095796 | Ga0496108_0095796_154_954 | 266 |
| 1657 | 3300048911 | Ga0496108_0184186 | Ga0496108_0184186_572_1372 | 266 |
| 1658 | 3300048911 | Ga0496108_0533793 | Ga0496108_0533793_171_971 | 266 |
| 1659 | 3300048912 | Ga0496109_0000567 | Ga0496109_0000567_1089_1889 | 266 |
| 1660 | 3300048912 | Ga0496109_0000700 | Ga0496109_0000700_24348_25148 | 266 |
| 1661 | 3300048912 | Ga0496109_0013437 | Ga0496109_0013437_5252_6052 | 266 |
| 1662 | 3300048912 | Ga0496109_0085694 | Ga0496109_0085694_23_823 | 266 |
| 1663 | 3300048913 | Ga0496110_0036662 | Ga0496110_0036662_1517_2317 | 266 |
| 1664 | 3300048913 | Ga0496110_0071860 | Ga0496110_0071860_1632_2432 | 266 |
| 1665 | 3300048913 | Ga0496110_0115960 | Ga0496110_0115960_250_1050 | 266 |
| 1666 | 3300048913 | Ga0496110_0404582 | Ga0496110_0404582_293_1093 | 266 |
| 1667 | 3300048913 | Ga0496110_0635255 | Ga0496110_0635255_82_882 | 266 |
| 1668 | 3300048914 | Ga0496111_0002128 | Ga0496111_0002128_3491_4291 | 266 |
| 1669 | 3300048914 | Ga0496111_0030278 | Ga0496111_0030278_396_1196 | 266 |
| 1670 | 3300048914 | Ga0496111_0127915 | Ga0496111_0127915_545_1345 | 266 |
| 1671 | 3300048914 | Ga0496111_0262018 | Ga0496111_0262018_451_1251 | 266 |
| 1672 | 3300048914 | Ga0496111_0281064 | Ga0496111_0281064_303_1103 | 266 |
| 1673 | 3300048915 | Ga0496112_0006626 | Ga0496112_0006626_4891_5691 | 266 |
| 1674 | 3300048915 | Ga0496112_0054561 | Ga0496112_0054561_1068_1868 | 266 |
| 1675 | 3300048915 | Ga0496112_0067828 | Ga0496112_0067828_663_1463 | 266 |
| 1676 | 3300048915 | Ga0496112_0131301 | Ga0496112_0131301_1351_2151 | 266 |
| 1677 | 3300048915 | Ga0496112_0238354 | Ga0496112_0238354_124_924 | 266 |
| 1678 | 3300048915 | Ga0496112_0446415 | Ga0496112_0446415_329_1129 | 266 |
| 1679 | 3300048916 | Ga0496113_0001279 | Ga0496113_0001279_10219_11019 | 266 |
| 1680 | 3300048916 | Ga0496113_0020581 | Ga0496113_0020581_1236_2036 | 266 |
| 1681 | 3300048916 | Ga0496113_0057616 | Ga0496113_0057616_718_1518 | 266 |
| 1682 | 3300048916 | Ga0496113_0064863 | Ga0496113_0064863_1903_2703 | 266 |
| 1683 | 3300048916 | Ga0496113_0136323 | Ga0496113_0136323_313_1113 | 266 |
| 1684 | 3300048916 | Ga0496113_0190821 | Ga0496113_0190821_419_1219 | 266 |
| 1685 | 3300048917 | Ga0496114_0018338 | Ga0496114_0018338_1899_2699 | 266 |
| 1686 | 3300048917 | Ga0496114_0029525 | Ga0496114_0029525_1275_2075 | 266 |
| 1687 | 3300048917 | Ga0496114_0033161 | Ga0496114_0033161_2380_3180 | 266 |
| 1688 | 3300048917 | Ga0496114_0274562 | Ga0496114_0274562_534_1334 | 266 |
| 1689 | 3300048918 | Ga0496115_0001922 | Ga0496115_0001922_12548_13348 | 266 |
| 1690 | 3300048918 | Ga0496115_0010508 | Ga0496115_0010508_4178_4978 | 266 |
| 1691 | 3300048918 | Ga0496115_0017144 | Ga0496115_0017144_262_1062 | 266 |
| 1692 | 3300048918 | Ga0496115_0024926 | Ga0496115_0024926_3062_3862 | 266 |
| 1693 | 3300048918 | Ga0496115_0040708 | Ga0496115_0040708_2323_3123 | 266 |
| 1694 | 3300048918 | Ga0496115_0046991 | Ga0496115_0046991_1177_1977 | 266 |
| 1695 | 3300048918 | Ga0496115_0168289 | Ga0496115_0168289_668_1468 | 266 |
| 1696 | 3300048918 | Ga0496115_0247411 | Ga0496115_0247411_176_976 | 266 |
| 1697 | 3300048919 | Ga0496116_0008329 | Ga0496116_0008329_4728_5540 | 266 |
| 1698 | 3300048919 | Ga0496116_0010352 | Ga0496116_0010352_5476_6276 | 266 |
| 1699 | 3300048919 | Ga0496116_0096558 | Ga0496116_0096558_282_1082 | 266 |
| 1700 | 3300048919 | Ga0496116_0229102 | Ga0496116_0229102_89_922 | 266 |
| 1701 | 3300048920 | Ga0496117_0000956 | Ga0496117_0000956_38454_39257 | 266 |
| 1702 | 3300048920 | Ga0496117_0008683 | Ga0496117_0008683_2635_3435 | 266 |
| 1703 | 3300048920 | Ga0496117_0009904 | Ga0496117_0009904_5937_6737 | 266 |
| 1704 | 3300048920 | Ga0496117_0011583 | Ga0496117_0011583_6699_7508 | 266 |
| 1705 | 3300048920 | Ga0496117_0093919 | Ga0496117_0093919_470_1303 | 266 |
| 1706 | 3300048921 | Ga0496118_0000494 | Ga0496118_0000494_44309_45112 | 266 |
| 1707 | 3300048921 | Ga0496118_0000757 | Ga0496118_0000757_36737_37546 | 266 |
| 1708 | 3300048921 | Ga0496118_0002208 | Ga0496118_0002208_17395_18195 | 266 |
| 1709 | 3300048921 | Ga0496118_0025727 | Ga0496118_0025727_1081_1881 | 266 |
| 1710 | 3300048922 | Ga0496119_0008642 | Ga0496119_0008642_5959_6762 | 266 |
| 1711 | 3300048924 | Ga0496121_0000099 | Ga0496121_0000099_64147_64947 | 266 |
| 1712 | 3300048924 | Ga0496121_0009644 | Ga0496121_0009644_3370_4182 | 266 |
| 1713 | 3300048924 | Ga0496121_0053371 | Ga0496121_0053371_1587_2387 | 266 |
| 1714 | 3300048924 | Ga0496121_0133576 | Ga0496121_0133576_374_1174 | 266 |
| 1715 | 3300048924 | Ga0496121_0361856 | Ga0496121_0361856_132_932 | 266 |
| 1716 | 3300048925 | Ga0496122_0002394 | Ga0496122_0002394_21251_22063 | 266 |
| 1717 | 3300048925 | Ga0496122_0012696 | Ga0496122_0012696_3880_4746 | 266 |
| 1718 | 3300048925 | Ga0496122_0042043 | Ga0496122_0042043_2082_2882 | 266 |
| 1719 | 3300048926 | Ga0496123_0002192 | Ga0496123_0002192_19399_20211 | 266 |
| 1720 | 3300048926 | Ga0496123_0046425 | Ga0496123_0046425_1014_1880 | 266 |
| 1721 | 3300048926 | Ga0496123_0124933 | Ga0496123_0124933_151_951 | 266 |
| 1722 | 3300048927 | Ga0496124_0000962 | Ga0496124_0000962_17655_18455 | 266 |
| 1723 | 3300048927 | Ga0496124_0029765 | Ga0496124_0029765_822_1625 | 266 |
| 1724 | 3300048927 | Ga0496124_0037548 | Ga0496124_0037548_2479_3345 | 266 |
| 1725 | 3300048927 | Ga0496124_0189006 | Ga0496124_0189006_744_1568 | 266 |
| 1726 | 3300048928 | Ga0496125_0001570 | Ga0496125_0001570_26643_27476 | 266 |
| 1727 | 3300048928 | Ga0496125_0040720 | Ga0496125_0040720_1166_1978 | 266 |
| 1728 | 3300048928 | Ga0496125_0097126 | Ga0496125_0097126_715_1515 | 266 |
| 1729 | 3300048929 | Ga0496126_0002134 | Ga0496126_0002134_4294_5112 | 266 |
| 1730 | 3300049568 | Ga0501031_0013932 | Ga0501031_0013932_3776_4576 | 266 |
| 1731 | 3300049569 | Ga0501032_0043686 | Ga0501032_0043686_1381_2181 | 266 |
| 1732 | 3300049569 | Ga0501032_0341256 | Ga0501032_0341256_146_946 | 266 |
| 1733 | 3300049570 | Ga0501033_0012682 | Ga0501033_0012682_1173_1973 | 266 |
| 1734 | 3300049571 | Ga0501034_0183838 | Ga0501034_0183838_41_841 | 266 |
| 1735 | 3300049571 | Ga0501034_0713752 | Ga0501034_0713752_67_867 | 266 |
| 1736 | 3300049572 | Ga0501036_0020490 | Ga0501036_0020490_3749_4549 | 266 |
| 1737 | 3300049573 | Ga0501037_0014650 | Ga0501037_0014650_1194_1994 | 266 |
| 1738 | 3300049574 | Ga0501038_0007499 | Ga0501038_0007499_843_1643 | 266 |
| 1739 | 3300049574 | Ga0501038_0148203 | Ga0501038_0148203_773_1573 | 266 |
| 1740 | 3300049575 | Ga0501039_0062918 | Ga0501039_0062918_905_1705 | 266 |
| 1741 | 3300049575 | Ga0501039_0078186 | Ga0501039_0078186_496_1296 | 266 |
| 1742 | 3300049579 | Ga0501043_0000024 | Ga0501043_0000024_20538_21371 | 266 |
| 1743 | 3300049579 | Ga0501043_0001631 | Ga0501043_0001631_13698_14498 | 266 |
| 1744 | 3300049579 | Ga0501043_0033568 | Ga0501043_0033568_564_1364 | 266 |
| 1745 | 3300049579 | Ga0501043_0398936 | Ga0501043_0398936_183_983 | 266 |
| 1746 | 3300049580 | Ga0501046_0000173 | Ga0501046_0000173_20538_21371 | 266 |
| 1747 | 3300049580 | Ga0501046_0001796 | Ga0501046_0001796_5017_5817 | 266 |
| 1748 | 3300049580 | Ga0501046_0004601 | Ga0501046_0004601_11094_11894 | 266 |
| 1749 | 3300049581 | Ga0501047_0000051 | Ga0501047_0000051_132911_133744 | 266 |
| 1750 | 3300049581 | Ga0501047_0000305 | Ga0501047_0000305_37545_38345 | 266 |
| 1751 | 3300049582 | Ga0501048_0000650 | Ga0501048_0000650_3386_4219 | 266 |
| 1752 | 3300049582 | Ga0501048_0001348 | Ga0501048_0001348_12981_13781 | 266 |
| 1753 | 3300049582 | Ga0501048_0010540 | Ga0501048_0010540_5122_5922 | 266 |
| 1754 | 3300049583 | Ga0501067_0014773 | Ga0501067_0014773_1155_1955 | 266 |
| 1755 | 3300049584 | Ga0501068_0023440 | Ga0501068_0023440_1004_1804 | 266 |
| 1756 | 3300049585 | Ga0501069_0002445 | Ga0501069_0002445_910_1710 | 266 |
| 1757 | 3300049586 | Ga0501070_0051186 | Ga0501070_0051186_1077_1877 | 266 |
| 1758 | 3300049586 | Ga0501070_0088095 | Ga0501070_0088095_1192_1992 | 266 |
| 1759 | 3300049586 | Ga0501070_0108004 | Ga0501070_0108004_1121_1921 | 266 |
| 1760 | 3300049587 | Ga0501071_0216162 | Ga0501071_0216162_403_1203 | 266 |
| 1761 | 3300049587 | Ga0501071_0230687 | Ga0501071_0230687_277_1077 | 266 |
| 1762 | 3300049588 | Ga0501072_0252576 | Ga0501072_0252576_238_1038 | 266 |
| 1763 | 3300049588 | Ga0501072_0348423 | Ga0501072_0348423_354_1154 | 266 |
| 1764 | 3300049589 | Ga0501073_0013348 | Ga0501073_0013348_3778_4578 | 266 |
| 1765 | 3300049589 | Ga0501073_0210504 | Ga0501073_0210504_463_1263 | 266 |
| 1766 | 3300049590 | Ga0501074_0002924 | Ga0501074_0002924_9904_10704 | 266 |
| 1767 | 3300049592 | Ga0501076_0271310 | Ga0501076_0271310_520_1320 | 266 |
| 1768 | 3300049592 | Ga0501076_0313775 | Ga0501076_0313775_366_1166 | 266 |
| 1769 | 3300049679 | Ga0501249_000841 | Ga0501249_000841_2155_2955 | 266 |
| 1770 | 3300049705 | Ga0501225_0003044 | Ga0501225_0003044_4014_4814 | 266 |
| 1771 | 3300049741 | Ga0501079_0071245 | Ga0501079_0071245_146_946 | 266 |
| 1772 | 3300049742 | Ga0501080_0013878 | Ga0501080_0013878_4149_4949 | 266 |
| 1773 | 3300049743 | Ga0501081_0273888 | Ga0501081_0273888_179_979 | 266 |
| 1774 | 3300049744 | Ga0501083_0010486 | Ga0501083_0010486_729_1529 | 266 |
| 1775 | 3300049744 | Ga0501083_0095086 | Ga0501083_0095086_378_1181 | 266 |
| 1776 | 3300049744 | Ga0501083_0111142 | Ga0501083_0111142_574_1374 | 266 |
| 1777 | 3300049759 | Ga0501262_000282 | Ga0501262_000282_2295_3095 | 266 |
| 1778 | 3300049822 | Ga0501035_0003206 | Ga0501035_0003206_7675_8475 | 266 |
| 1779 | 3300049822 | Ga0501035_0037571 | Ga0501035_0037571_3216_4016 | 266 |
| 1780 | 3300049823 | Ga0501044_0000212 | Ga0501044_0000212_60773_61573 | 266 |
| 1781 | 3300049823 | Ga0501044_0019211 | Ga0501044_0019211_1179_1979 | 266 |
| 1782 | 3300049823 | Ga0501044_0032009 | Ga0501044_0032009_2900_3700 | 266 |
| 1783 | 3300049823 | Ga0501044_0136126 | Ga0501044_0136126_1472_2305 | 266 |
| 1784 | 3300049823 | Ga0501044_0310482 | Ga0501044_0310482_165_965 | 266 |
| 1785 | 3300049824 | Ga0501045_0016684 | Ga0501045_0016684_2550_3350 | 266 |
| 1786 | 3300049824 | Ga0501045_0151396 | Ga0501045_0151396_766_1566 | 266 |
| 1787 | 3300050489 | nmdc:mga03683_131_c2 | nmdc:mga03683_131_c2_5581_6381 | 266 |
| 1788 | 3300050489 | nmdc:mga03683_4120_c1 | nmdc:mga03683_4120_c1_342_1145 | 266 |
| 1789 | 3300050490 | nmdc:mga03n38_13453_c1 | nmdc:mga03n38_13453_c1_1022_1822 | 266 |
| 1790 | 3300050490 | nmdc:mga03n38_65253_c1 | nmdc:mga03n38_65253_c1_328_1128 | 266 |
| 1791 | 3300050491 | nmdc:mga00v17_26732_c1 | nmdc:mga00v17_26732_c1_589_1389 | 266 |
| 1792 | 3300050491 | nmdc:mga00v17_27410_c1 | nmdc:mga00v17_27410_c1_263_1063 | 266 |
| 1793 | 3300050492 | nmdc:mga0yw44_12622_c1 | nmdc:mga0yw44_12622_c1_718_1518 | 266 |
| 1794 | 3300050492 | nmdc:mga0yw44_99924_c1 | nmdc:mga0yw44_99924_c1_1029_1829 | 266 |
| 1795 | 3300050493 | nmdc:mga0k408_2988_c1 | nmdc:mga0k408_2988_c1_2546_3346 | 266 |
| 1796 | 3300050493 | nmdc:mga0k408_34076_c1 | nmdc:mga0k408_34076_c1_1436_2236 | 266 |
| 1797 | 3300050493 | nmdc:mga0k408_35047_c1 | nmdc:mga0k408_35047_c1_1309_2109 | 266 |
| 1798 | 3300050493 | nmdc:mga0k408_4288_c1 | nmdc:mga0k408_4288_c1_5287_6087 | 266 |
| 1799 | 3300050493 | nmdc:mga0k408_49574_c1 | nmdc:mga0k408_49574_c1_98_901 | 266 |
| 1800 | 3300050494 | nmdc:mga06z11_31128_c1 | nmdc:mga06z11_31128_c1_1115_1915 | 266 |
| 1801 | 3300050494 | nmdc:mga06z11_34851_c1 | nmdc:mga06z11_34851_c1_679_1479 | 266 |
| 1802 | 3300050494 | nmdc:mga06z11_37546_c1 | nmdc:mga06z11_37546_c1_517_1317 | 266 |
| 1803 | 3300050494 | nmdc:mga06z11_6364_c1 | nmdc:mga06z11_6364_c1_157_957 | 266 |
| 1804 | 3300050494 | nmdc:mga06z11_87116_c2 | nmdc:mga06z11_87116_c2_22_822 | 266 |
| 1805 | 3300050495 | nmdc:mga04h51_22504_c1 | nmdc:mga04h51_22504_c1_423_1223 | 266 |
| 1806 | 3300050495 | nmdc:mga04h51_23730_c1 | nmdc:mga04h51_23730_c1_436_1239 | 266 |
| 1807 | 3300050495 | nmdc:mga04h51_38256_c1 | nmdc:mga04h51_38256_c1_156_956 | 266 |
| 1808 | 3300050496 | nmdc:mga07m45_1095_c1 | nmdc:mga07m45_1095_c1_4381_5181 | 266 |
| 1809 | 3300050496 | nmdc:mga07m45_18576_c1 | nmdc:mga07m45_18576_c1_764_1567 | 266 |
| 1810 | 3300050496 | nmdc:mga07m45_5940_c1 | nmdc:mga07m45_5940_c1_267_1067 | 266 |
| 1811 | 3300050496 | nmdc:mga07m45_61998_c1 | nmdc:mga07m45_61998_c1_1139_1939 | 266 |
| 1812 | 3300050507 | nmdc:mga05p37_5774_c1 | nmdc:mga05p37_5774_c1_1214_2014 | 266 |
| 1813 | 3300050507 | nmdc:mga05p37_828_c1 | nmdc:mga05p37_828_c1_12778_13578 | 266 |
| 1814 | 3300050508 | nmdc:mga09592_21763_c1 | nmdc:mga09592_21763_c1_926_1726 | 266 |
| 1815 | 3300050508 | nmdc:mga09592_21943_c1 | nmdc:mga09592_21943_c1_4095_4901 | 266 |
| 1816 | 3300050509 | nmdc:mga0qj67_165_c1 | nmdc:mga0qj67_165_c1_12939_13739 | 266 |
| 1817 | 3300050510 | nmdc:mga06r32_513_c1 | nmdc:mga06r32_513_c1_12866_13666 | 266 |
| 1818 | 3300050510 | nmdc:mga06r32_7918_c1 | nmdc:mga06r32_7918_c1_1012_1818 | 266 |
| 1819 | 3300050511 | nmdc:mga08y16_4405_c1 | nmdc:mga08y16_4405_c1_12778_13578 | 266 |
| 1820 | 3300050511 | nmdc:mga08y16_77507_c1 | nmdc:mga08y16_77507_c1_2411_3211 | 266 |
| 1821 | 3300050512 | nmdc:mga0n895_10588_c2 | nmdc:mga0n895_10588_c2_3968_4768 | 266 |
| 1822 | 3300050512 | nmdc:mga0n895_1284_c1 | nmdc:mga0n895_1284_c1_14033_14833 | 266 |
| 1823 | 3300050512 | nmdc:mga0n895_160658_c1 | nmdc:mga0n895_160658_c1_286_1086 | 266 |
| 1824 | 3300050512 | nmdc:mga0n895_32422_c1 | nmdc:mga0n895_32422_c1_697_1497 | 266 |
| 1825 | 3300050512 | nmdc:mga0n895_53866_c1 | nmdc:mga0n895_53866_c1_42_842 | 266 |
| 1826 | 3300050512 | nmdc:mga0n895_91521_c1 | nmdc:mga0n895_91521_c1_44_844 | 266 |
| 1827 | 3300050513 | nmdc:mga0rr50_31356_c1 | nmdc:mga0rr50_31356_c1_2039_2839 | 266 |
| 1828 | 3300050513 | nmdc:mga0rr50_330469_c1 | nmdc:mga0rr50_330469_c1_338_1138 | 266 |
| 1829 | 3300050513 | nmdc:mga0rr50_8687_c1 | nmdc:mga0rr50_8687_c1_3080_3880 | 266 |
| 1830 | 3300050514 | nmdc:mga08x19_53960_c1 | nmdc:mga08x19_53960_c1_1352_2152 | 266 |
| 1831 | 3300050515 | nmdc:mga0a205_1140_c1 | nmdc:mga0a205_1140_c1_9423_10223 | 266 |
| 1832 | 3300050515 | nmdc:mga0a205_12519_c1 | nmdc:mga0a205_12519_c1_5784_6584 | 266 |
| 1833 | 3300050515 | nmdc:mga0a205_432198_c1 | nmdc:mga0a205_432198_c1_77_877 | 266 |
| 1834 | 3300050516 | nmdc:mga0sz30_1590_c1 | nmdc:mga0sz30_1590_c1_3453_4253 | 266 |
| 1835 | 3300050516 | nmdc:mga0sz30_36051_c1 | nmdc:mga0sz30_36051_c1_760_1560 | 266 |
| 1836 | 3300053077 | Ga0495601_0000026 | Ga0495601_0000026_37652_38452 | 266 |
| 1837 | 3300053077 | Ga0495601_0000075 | Ga0495601_0000075_25110_25910 | 266 |
| 1838 | 3300053077 | Ga0495601_0003475 | Ga0495601_0003475_1977_2777 | 266 |
| 1839 | 3300053077 | Ga0495601_0007907 | Ga0495601_0007907_2400_3200 | 266 |
| 1840 | 3300053077 | Ga0495601_0008795 | Ga0495601_0008795_4059_4859 | 266 |
| 1841 | 3300053077 | Ga0495601_0013952 | Ga0495601_0013952_3168_3968 | 266 |
| 1842 | 3300053077 | Ga0495601_0019791 | Ga0495601_0019791_3100_3900 | 266 |
| 1843 | 3300053077 | Ga0495601_0098383 | Ga0495601_0098383_366_1166 | 266 |
| 1844 | 3300053078 | Ga0495612_0000005 | Ga0495612_0000005_25904_26704 | 266 |
| 1845 | 3300053078 | Ga0495612_0005901 | Ga0495612_0005901_2502_3302 | 266 |
| 1846 | 3300053078 | Ga0495612_0011526 | Ga0495612_0011526_143_943 | 266 |
| 1847 | 3300053078 | Ga0495612_0018362 | Ga0495612_0018362_694_1494 | 266 |
| 1848 | 3300053079 | Ga0500610_0000112 | Ga0500610_0000112_4083_4925 | 266 |
| 1849 | 3300053084 | Ga0495595_0000058 | Ga0495595_0000058_20115_20915 | 266 |
| 1850 | 3300053084 | Ga0495595_0000311 | Ga0495595_0000311_13017_13817 | 266 |
| 1851 | 3300053084 | Ga0495595_0000650 | Ga0495595_0000650_12383_13183 | 266 |
| 1852 | 3300053084 | Ga0495595_0002803 | Ga0495595_0002803_2599_3399 | 266 |
| 1853 | 3300053084 | Ga0495595_0009800 | Ga0495595_0009800_133_933 | 266 |
| 1854 | 3300053084 | Ga0495595_0018149 | Ga0495595_0018149_1670_2470 | 266 |
| 1855 | 3300053085 | Ga0495619_0000003 | Ga0495619_0000003_254745_255545 | 266 |
| 1856 | 3300053085 | Ga0495619_0000301 | Ga0495619_0000301_24226_25026 | 266 |
| 1857 | 3300053085 | Ga0495619_0000315 | Ga0495619_0000315_27832_28632 | 266 |
| 1858 | 3300053085 | Ga0495619_0000645 | Ga0495619_0000645_12841_13641 | 266 |
| 1859 | 3300053085 | Ga0495619_0004564 | Ga0495619_0004564_239_1039 | 266 |
| 1860 | 3300053085 | Ga0495619_0008284 | Ga0495619_0008284_1634_2434 | 266 |
| 1861 | 3300053085 | Ga0495619_0020045 | Ga0495619_0020045_2797_3597 | 266 |
| 1862 | 3300053085 | Ga0495619_0046550 | Ga0495619_0046550_236_1036 | 266 |
| 1863 | 3300053085 | Ga0495619_0093547 | Ga0495619_0093547_631_1431 | 266 |
| 1864 | 3300053085 | Ga0495619_0099418 | Ga0495619_0099418_1001_1801 | 266 |
| 1865 | 3300053085 | Ga0495619_0215579 | Ga0495619_0215579_217_1017 | 266 |
| 1866 | 3300053086 | Ga0500578_0010253 | Ga0500578_0010253_4390_5193 | 266 |
| 1867 | 3300053087 | Ga0500643_004510 | Ga0500643_004510_351_1151 | 266 |
| 1868 | 3300053088 | Ga0500644_0000805 | Ga0500644_0000805_7366_8166 | 266 |
| 1869 | 3300053091 | Ga0500647_0033508 | Ga0500647_0033508_1358_2158 | 266 |
| 1870 | 3300053093 | Ga0500651_0225020 | Ga0500651_0225020_218_1027 | 266 |
| 1871 | 3300053094 | Ga0500566_0002965 | Ga0500566_0002965_7605_8408 | 266 |
| 1872 | 3300053094 | Ga0500566_0031163 | Ga0500566_0031163_1915_2715 | 266 |
| 1873 | 3300053094 | Ga0500566_0099650 | Ga0500566_0099650_421_1224 | 266 |
| 1874 | 3300053094 | Ga0500566_0103179 | Ga0500566_0103179_463_1272 | 266 |
| 1875 | 3300053094 | Ga0500566_0143510 | Ga0500566_0143510_108_908 | 266 |
| 1876 | 3300053095 | Ga0500640_000109 | Ga0500640_000109_5558_6361 | 266 |
| 1877 | 3300053102 | Ga0500554_000127 | Ga0500554_000127_10460_11263 | 266 |
| 1878 | 3300053111 | Ga0500572_000364 | Ga0500572_000364_12743_13543 | 266 |
| 1879 | 3300053111 | Ga0500572_002316 | Ga0500572_002316_1108_1911 | 266 |
| 1880 | 3300053117 | Ga0500593_042853 | Ga0500593_042853_1125_1925 | 266 |
| 1881 | 3300053118 | Ga0500594_0007743 | Ga0500594_0007743_390_1193 | 266 |
| 1882 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_734758_735558 | 266 |
| 1883 | 3300053119 | Ga0500595_000654 | Ga0500595_000654_11422_12225 | 266 |
| 1884 | 3300053119 | Ga0500595_036417 | Ga0500595_036417_505_1305 | 266 |
| 1885 | 3300053120 | Ga0500597_014321 | Ga0500597_014321_1746_2549 | 266 |
| 1886 | 3300053121 | Ga0500607_000040 | Ga0500607_000040_28317_29150 | 266 |
| 1887 | 3300053123 | Ga0500614_000065 | Ga0500614_000065_14322_15125 | 266 |
| 1888 | 3300053125 | Ga0500618_001458 | Ga0500618_001458_6811_7629 | 266 |
| 1889 | 3300053130 | Ga0500642_0007198 | Ga0500642_0007198_2846_3646 | 266 |
| 1890 | 3300053133 | Ga0500655_013889 | Ga0500655_013889_373_1176 | 266 |
| 1891 | 3300053134 | Ga0500658_0000142 | Ga0500658_0000142_15570_16370 | 266 |
| 1892 | 3300053136 | Ga0500559_0004285 | Ga0500559_0004285_2654_3454 | 266 |
| 1893 | 3300053136 | Ga0500559_0004688 | Ga0500559_0004688_839_1642 | 266 |
| 1894 | 3300053136 | Ga0500559_0009713 | Ga0500559_0009713_159_959 | 266 |
| 1895 | 3300053139 | Ga0500568_0000983 | Ga0500568_0000983_7016_7816 | 266 |
| 1896 | 3300053139 | Ga0500568_0116516 | Ga0500568_0116516_158_958 | 266 |
| 1897 | 3300053148 | Ga0500590_000575 | Ga0500590_000575_6532_7332 | 266 |
| 1898 | 3300053148 | Ga0500590_078858 | Ga0500590_078858_415_1218 | 266 |
| 1899 | 3300053150 | Ga0500603_024525 | Ga0500603_024525_450_1253 | 266 |
| 1900 | 3300053151 | Ga0500604_0014219 | Ga0500604_0014219_228_1031 | 266 |
| 1901 | 3300053151 | Ga0500604_0019835 | Ga0500604_0019835_37_837 | 266 |
| 1902 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_786369_787169 | 266 |
| 1903 | 3300053153 | Ga0500616_0013278 | Ga0500616_0013278_593_1393 | 266 |
| 1904 | 3300053153 | Ga0500616_0033446 | Ga0500616_0033446_18_818 | 266 |
| 1905 | 3300053154 | Ga0500619_000062 | Ga0500619_000062_16474_17274 | 266 |
| 1906 | 3300053156 | Ga0500622_0014031 | Ga0500622_0014031_2534_3343 | 266 |
| 1907 | 3300053156 | Ga0500622_0117387 | Ga0500622_0117387_421_1221 | 266 |
| 1908 | 3300053159 | Ga0500630_045519 | Ga0500630_045519_1245_2048 | 266 |
| 1909 | 3300053161 | Ga0500634_0011715 | Ga0500634_0011715_3538_4338 | 266 |
| 1910 | 3300053162 | Ga0500638_101029 | Ga0500638_101029_247_1050 | 266 |
| 1911 | 3300053163 | Ga0500639_006776 | Ga0500639_006776_1368_2168 | 266 |
| 1912 | 3300053177 | Ga0500636_0012653 | Ga0500636_0012653_584_1384 | 266 |
| 1913 | 3300053177 | Ga0500636_0022288 | Ga0500636_0022288_1499_2308 | 266 |
| 1914 | 3300053177 | Ga0500636_0113664 | Ga0500636_0113664_145_945 | 266 |
| 1915 | 3300053178 | Ga0500637_0085771 | Ga0500637_0085771_87_890 | 266 |
| 1916 | 3300053730 | Ga0500645_000091 | Ga0500645_000091_64165_64977 | 266 |
| 1917 | 3300053730 | Ga0500645_001379 | Ga0500645_001379_5805_6608 | 266 |
| 1918 | 3300053733 | Ga0500552_015723 | Ga0500552_015723_100_900 | 266 |
| 1919 | 3300053735 | Ga0500596_012353 | Ga0500596_012353_239_1039 | 266 |
| 1920 | 3300060353 | Ga0501082_0170102 | Ga0501082_0170102_210_1010 | 266 |
| 1921 | iso_pu_bacteria | 2513237151 | 2513961995 | 266 |
| 1922 | iso_pu_bacteria | 2599185178 | 2599448609 | 266 |
| 1923 | iso_pu_bacteria | 2619619299 | 2621300641 | 266 |
| 1924 | iso_pu_bacteria | 2738541265 | 2738673305 | 266 |
| 1925 | iso_pu_bacteria | 2738541282 | 2738751698 | 266 |
| 1926 | iso_pu_bacteria | 2738541303 | 2738860739 | 266 |
| 1927 | iso_pu_bacteria | 2773857670 | 2774120211 | 266 |
| 1928 | iso_pu_bacteria | 2773857672 | 2774129891 | 266 |
| 1929 | iso_pu_bacteria | 2784132072 | 2784311858 | 266 |
| 1930 | iso_pu_bacteria | 2808606401 | 2809063841 | 266 |
| 1931 | iso_pu_bacteria | 2808606404 | 2809079809 | 266 |
| 1932 | iso_pu_bacteria | 2808606405 | 2809084174 | 266 |
| 1933 | iso_pu_bacteria | 2880518877 | 2880523473 | 266 |
| 1934 | iso_pu_bacteria | 2894023352 | 2894027592 | 266 |
| 1935 | iso_pu_bacteria | 2900577576 | 2900579879 | 266 |
| 1936 | iso_pu_bacteria | 2928058823 | 2928059737 | 266 |
| 1937 | iso_pu_bacteria | 2945934425 | 2945934678 | 266 |
| 1938 | iso_pu_bacteria | 2988728565 | 2988729132 | 266 |
| 1939 | iso_pu_bacteria | 2990088156 | 2990093288 | 266 |
| 1940 | iso_pu_bacteria | 8039098773 | 8039102178 | 266 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5jc8-assembly1.cif.gz_B | crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans | 0.9881 | 3 | 266 |
| 5jc8-assembly1.cif.gz_C | crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans | 0.9874 | 3 | 266 |
| 5jc8-assembly1.cif.gz_A | crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans | 0.9818 | 3 | 266 |
| 5jc8-assembly1.cif.gz_D | crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans | 0.9816 | 3 | 266 |
| 5jc8-assembly1.cif.gz_B | crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans | 0.9804 | 3 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5jc8D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9816 | 3 | 266 | 3.40.50.720 |
| 5jc8D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9743 | 3 | 266 | 3.40.50.720 |
| 4hsyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9568 | 5 | 262 | 3.40.50.720 |
| 5k9zA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9543 | 4 | 263 | 3.40.50.720 |
| af_P37440_1_255_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9537 | 3 | 262 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D6SHR2-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9844 | 29 | 266 |
GO:0016491
|
| AF-A0A0P9MHY1-F1-model_v4 | Membrane protein | 0.9832 | 135 | 266 |
GO:0016616
|
| AF-A0A4Q4CLH7-F1-model_v4 | SDR family oxidoreductase | 0.978 | 68 | 266 |
GO:0016491
|
| AF-A0A2D6SHR2-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9763 | 29 | 266 |
GO:0016491
|
| AF-A0A0P9MHY1-F1-model_v4 | Membrane protein | 0.9759 | 135 | 266 |
GO:0016616
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar