F496013

General Info

Members Datasets Scaffolds Average Seq Length
1899 929 3798 297

Family's Representative Sequence

Representative Sequence 3300041411|Ga0439466_0034534|Ga0439466_0034534_355_1428
Length 357
Sequence MAEDSLGCTQVKPHADRGSQRVIAAHMNLAQGHTRGFERQAFGPPVLEKESMSNWLVDKLIPSIMRSEVKKSSVPEGLWHKCPSCDAVLYRPELEKTLDVCPKCNHHMRIGARARIDIFLDAEGRAELGADLEPVDRLKFRDGKKYKDRLTAAQKQTGEKDALISMSGTLLGMPVVVSAFEFSFMGGSMGAIVGERFVRAANYALENRCPMICFAASGGARMQEALISLMQMAKTSAVLARLREEGLPFISVLTDPVYGGVSASLAMLGDVIVAEPKALIGFAGPRVIEQTVREKLPEGFQRSEFLLEHGAIDMIIARQELRPRLGNLLAQLMGLPTPEFVAAPIVPIVIPPVPANL

Samples

Sample ID Description Type Environment
1 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
114 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
115 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
116 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
132 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
151 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
158 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
167 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
169 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
170 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
173 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
174 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
175 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
244 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
245 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
250 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
258 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
259 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
260 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
261 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
262 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
263 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
264 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
265 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
266 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
270 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
271 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
272 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
273 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
274 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
275 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
276 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
277 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
278 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
279 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
280 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
281 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
282 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
283 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
284 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
285 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
286 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
287 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
288 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
289 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
290 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
291 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
292 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
293 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
294 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
295 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
296 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
297 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
298 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
299 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
300 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
301 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
302 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
304 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
305 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
306 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
307 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
308 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
309 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
310 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
311 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
312 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
313 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
314 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
315 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
316 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
317 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
318 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
319 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
320 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
321 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
322 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
323 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
324 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
325 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
326 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
327 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
328 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
329 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
330 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
331 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
332 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
333 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
334 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
335 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
336 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
337 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
338 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
339 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
340 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
341 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
342 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
343 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
344 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
345 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
346 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
347 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
348 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
349 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
350 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
351 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
352 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
353 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
354 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
355 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
356 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
357 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
358 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
359 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
360 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
361 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
362 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
363 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
364 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
365 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
366 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
367 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
368 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
369 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
370 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
371 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
372 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
373 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
374 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
375 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
376 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
377 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
378 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
379 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
380 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
381 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
382 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
383 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
384 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
385 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
386 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
387 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
388 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
389 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
390 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
391 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
392 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
393 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
394 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
395 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
396 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
397 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
398 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
399 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
400 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
401 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
402 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
403 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
404 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
405 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
406 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
407 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
408 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
409 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
410 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
411 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
412 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
413 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
414 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
415 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
416 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
417 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
418 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
419 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
420 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
421 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
422 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
423 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
424 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
425 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
426 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
427 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
428 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
429 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
430 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
431 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
432 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
433 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
434 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
435 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
436 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
437 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
438 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
439 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
440 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
441 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
442 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
443 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
444 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
445 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
446 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
447 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
448 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
449 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
450 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
451 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
452 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
453 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
454 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
455 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
456 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
457 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
458 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
459 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
460 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
461 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
462 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
463 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
464 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
465 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
478 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
480 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
481 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
482 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
483 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
484 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
485 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
486 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
487 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
488 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
489 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
490 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
491 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
492 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
493 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
494 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
497 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
498 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
499 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
500 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
501 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
502 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
503 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
504 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
505 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
506 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
507 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
508 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
509 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
510 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
511 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
512 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
513 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
514 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
515 2506520008 Serratia plymuthica AS12 Isolate Unclassified
516 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
517 2511231004 Pseudomonas sp. GM102 Isolate Nodule
518 2511231006 Pseudomonas sp. GM17 Isolate Nodule
519 2511231007 Pseudomonas sp. GM18 Isolate Nodule
520 2511231008 Pseudomonas sp. GM21 Isolate Nodule
521 2511231010 Pseudomonas sp. GM25 Isolate Nodule
522 2511231011 Pseudomonas sp. GM30 Isolate Nodule
523 2511231012 Pseudomonas sp. GM33 Isolate Nodule
524 2511231014 Pseudomonas sp. GM48 Isolate Nodule
525 2511231015 Pseudomonas sp. GM49 Isolate Nodule
526 2511231016 Pseudomonas sp. GM50 Isolate Nodule
527 2511231017 Pseudomonas sp. GM55 Isolate Nodule
528 2511231018 Pseudomonas sp. GM60 Isolate Nodule
529 2511231019 Pseudomonas sp. GM67 Isolate Nodule
530 2511231020 Pseudomonas sp. GM74 Isolate Nodule
531 2511231021 Pseudomonas sp. GM78 Isolate Nodule
532 2511231022 Pseudomonas sp. GM79 Isolate Nodule
533 2511231023 Pseudomonas sp. GM80 Isolate Nodule
534 2511231024 Pseudomonas sp. GM84 Isolate Nodule
535 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
536 2511231031 Pseudomonas sp. GM16 Isolate Nodule
537 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
538 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
539 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
540 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
541 2547132181 Kosakonia sacchari SP1 Isolate Stem
542 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
543 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
544 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
545 2561511199 Enterobacter sp. R4-368 Isolate Nodule
546 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
547 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
548 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
549 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
550 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
551 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
552 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
553 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
554 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
555 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
556 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
557 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
558 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
559 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
560 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
561 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
562 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
563 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
564 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
565 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
566 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
567 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
568 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
569 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
570 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
571 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
572 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
573 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
574 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
575 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
576 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
577 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
578 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
579 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
580 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
581 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
582 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
583 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
584 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
585 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
586 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
587 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
588 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
589 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
590 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
591 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
592 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
593 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
594 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
595 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
596 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
597 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
598 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
599 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
600 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
601 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
602 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
603 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
604 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
605 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
606 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
607 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
608 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
609 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
610 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
611 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
612 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
613 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
614 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
615 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
616 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
617 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
618 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
619 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
620 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
621 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
622 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
623 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
624 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
625 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
626 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
627 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
628 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
629 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
630 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
631 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
632 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
633 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
634 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
635 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
636 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
637 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
638 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
639 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
640 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
641 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
642 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
643 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
644 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
645 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
646 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
647 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
648 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
649 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
650 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
651 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
652 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
653 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
654 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
655 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
656 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
657 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
658 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
659 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
660 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
661 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
662 2636415599 Klebsiella variicola DX120E Isolate Unclassified
663 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
664 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
665 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
666 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
667 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
668 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
669 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
670 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
671 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
672 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
673 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
674 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
675 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
676 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
677 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
678 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
679 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
680 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
681 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
682 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
683 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
684 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
685 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
686 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
687 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
688 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
689 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
690 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
691 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
692 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
693 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
694 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
695 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
696 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
697 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
698 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
699 2734482264 Dyella sp. AD052 Isolate Unclassified
700 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
701 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
702 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
703 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
704 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
705 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
706 2738543009 Luteibacter sp. OK325 Isolate Unclassified
707 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
708 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
709 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
710 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
711 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
712 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
713 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
714 2751185917 Enterobacter sp. HK169 Isolate Unclassified
715 2765235841 Pseudomonas putida AA7 Isolate Unclassified
716 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
717 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
718 2773857670 Pseudomonas sp. 478 Isolate Unclassified
719 2773857673 Pseudomonas sp. 443 Isolate Unclassified
720 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
721 2775507074 Klebsiella sp. D5A Isolate Unclassified
722 2784132063 Pseudomonas sp. 424 Isolate Unclassified
723 2784132072 Pseudomonas sp. 460 Isolate Unclassified
724 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
725 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
726 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
727 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
728 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
729 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
730 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
731 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
732 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
733 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
734 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
735 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
736 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
737 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
738 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
739 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
740 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
741 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
742 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
743 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
744 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
745 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
746 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
747 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
748 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
749 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
750 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
751 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
752 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
753 2821118458 Enterobacter asburiae 609 Isolate Unclassified
754 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
755 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
756 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
757 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
758 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
759 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
760 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
761 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
762 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
763 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
764 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
765 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
766 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
767 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
768 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
769 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
770 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
771 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
772 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
773 2847085930 Erwinia persicina B64 Isolate Bulb
774 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
775 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
776 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
777 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
778 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
779 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
780 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
781 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
782 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
783 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
784 2865014394 Pantoea sp. R-71966 Isolate Unclassified
785 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
786 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
787 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
788 2876601092 Pantoea endophytica 596 Isolate Unclassified
789 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
790 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
791 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
792 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
793 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
794 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
795 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
796 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
797 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
798 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
799 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
800 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
801 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
802 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
803 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
804 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
805 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
806 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
807 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
808 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
809 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
810 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
811 2919150387 Rahnella aceris 1817 Isolate Unclassified
812 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
813 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
814 2919404418 Luteibacter sp. 3190 Isolate Unclassified
815 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
816 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
817 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
818 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
819 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
820 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
821 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
822 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
823 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
824 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
825 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
826 2927143783 Rahnella sp. 2050 Isolate Unclassified
827 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
828 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
829 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
830 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
831 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
832 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
833 2932406140 Serratia sp. 2723 Isolate Rhizosphere
834 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
835 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
836 2937539931 Pantoea sp. LS15 Isolate Unclassified
837 2937967321 Serratia sp. YC16 Isolate Unclassified
838 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
839 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
840 2939577877 Serratia sp. 509 Isolate Rhizosphere
841 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
842 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
843 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
844 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
845 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
846 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
847 2941471342 Luteibacter sp. 621 Isolate Unclassified
848 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
849 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
850 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
851 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
852 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
853 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
854 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
855 2952252522 Salinicola sp. DM10 Isolate Unclassified
856 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
857 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
858 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
859 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
860 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
861 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
862 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
863 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
864 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
865 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
866 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
867 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
868 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
869 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
870 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
871 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
872 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
873 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
874 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
875 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
876 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
877 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
878 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
879 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
880 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
881 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
882 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
883 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
884 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
885 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
886 640753048 Serratia proteamaculans 568 Isolate Endosphere
887 8004592986 Serratia sp. S119 Isolate Unclassified
888 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
889 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
890 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
891 8018221730 Enterobacter sp. CM29 Isolate Unclassified
892 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
893 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
894 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
895 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
896 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
897 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
898 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
899 8052494512 Pseudomonas putida LD6 Isolate Unclassified
900 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
901 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
902 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
903 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
904 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
905 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
906 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
907 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
908 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
909 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
910 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
911 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
912 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
913 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
914 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
915 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
916 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
917 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
918 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
919 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
920 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
921 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
922 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
923 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
924 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
925 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
926 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
927 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
928 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
929 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.3
Metatranscriptomes 0.74
Isolates 21.96

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0.05
Endosphere 4.05
Nodule 1.84
Rhizoplane 7.16
Rhizosphere 74.83
Stem 0.05
Stem Tuber 0.32
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439466_0034534 3300041411 Bacteria 1714
2 SwRhRL2b_contig_1293351 2162886007 Bacteria 1020
3 SwRhRL2b_contig_3043338 2162886007 Bacteria 3452
4 JGI24741J21665_1000158 3300001915 Bacteria 19398
5 JGI24741J21665_1006265 3300001915 Bacteria 2405
6 JGI24741J21665_1010208 3300001915 Bacteria 1692
7 JGI24740J21852_10000049 3300001979 Bacteria 38240
8 JGI24739J22299_10000804 3300001989 Bacteria 11483
9 JGI24738J21930_10001700 3300002075 Bacteria 6019
10 JGI25162J39368_1006058 3300002737 Bacteria 2177
11 JGI25157J39369_1000298 3300002741 Bacteria 36141
12 rootH2_10071538 3300003320 Bacteria 1731
13 rootH1_10026054 3300003323 Bacteria 30471
14 Ga0006562J51391_1059289 3300003578 Bacteria 5290
15 Ga0006562J51391_1067747 3300003578 Bacteria 3240
16 Ga0055538_1000093 3300003751 Bacteria 75896
17 Ga0055539_1000138 3300003752 Bacteria 75896
18 Ga0055539_1002413 3300003752 Bacteria 2876
19 Ga0055533_1000142 3300003756 Bacteria 75896
20 Ga0055532_1000152 3300003758 Bacteria 61495
21 Ga0055525_1000342 3300003759 Bacteria 34036
22 Ga0055527_1000266 3300003760 Bacteria 31574
23 Ga0055535_1000606 3300003761 Bacteria 29564
24 Ga0055535_1000805 3300003761 Bacteria 22731
25 Ga0055535_1007291 3300003761 Bacteria 2130
26 Ga0055542_1000803 3300003762 Bacteria 23207
27 Ga0055529_1000709 3300003763 Bacteria 22272
28 Ga0055536_1001963 3300003781 Bacteria 11830
29 Ga0055536_1002321 3300003781 Bacteria 10765
30 Ga0055536_1004042 3300003781 Bacteria 7639
31 Ga0055530_10003078 3300003791 Bacteria 9915
32 Ga0055540_1002628 3300003792 Bacteria 9324
33 Ga0055531_10000517 3300003794 Bacteria 34871
34 Ga0055541_1000091 3300003841 Bacteria 75896
35 Ga0065165_1000113 3300005262 Bacteria 135963
36 Ga0065714_10065334 3300005288 Bacteria 10809
37 Ga0065704_10001088 3300005289 Bacteria 13402
38 Ga0065704_10003695 3300005289 Bacteria 3867
39 Ga0065704_10017716 3300005289 Bacteria 2262
40 Ga0065704_10072724 3300005289 Bacteria 8093
41 Ga0065704_10109043 3300005289 Bacteria 2013
42 Ga0065712_10070206 3300005290 Bacteria 6226
43 Ga0065707_10108505 3300005295 Bacteria 2508
44 Ga0070658_10000868 3300005327 Bacteria 25839
45 Ga0070658_10017382 3300005327 Bacteria 5755
46 Ga0070690_100010523 3300005330 Bacteria 5387
47 Ga0070690_100027356 3300005330 Bacteria 3525
48 Ga0070690_100122135 3300005330 Bacteria 1749
49 Ga0070670_100005617 3300005331 Bacteria 10584
50 Ga0070670_100029308 3300005331 Bacteria 4737
51 Ga0070670_100234669 3300005331 Bacteria 1597
52 Ga0070677_10036026 3300005333 Bacteria 1921
53 Ga0070677_10040457 3300005333 Bacteria 1834
54 Ga0068869_100004095 3300005334 Bacteria 9027
55 Ga0068869_100072327 3300005334 Bacteria 2555
56 Ga0070666_10000007 3300005335 Bacteria 293732
57 Ga0070666_10000444 3300005335 Bacteria 25283
58 Ga0070666_10027083 3300005335 Bacteria 3751
59 Ga0070680_100000343 3300005336 Bacteria 31285
60 Ga0070680_100037245 3300005336 Bacteria 3930
61 Ga0070680_100223442 3300005336 Bacteria 1590
62 Ga0070682_100007669 3300005337 Bacteria 6080
63 Ga0070682_100026930 3300005337 Bacteria 3446
64 Ga0070682_100060755 3300005337 Bacteria 2390
65 Ga0070682_100395971 3300005337 Bacteria 1043
66 Ga0068868_100053801 3300005338 Bacteria 3172
67 Ga0068868_100162531 3300005338 Bacteria 1845
68 Ga0068868_100223465 3300005338 Bacteria 1577
69 Ga0070660_100043062 3300005339 Bacteria 3448
70 Ga0070689_100002094 3300005340 Bacteria 12961
71 Ga0070689_100008406 3300005340 Bacteria 7270
72 Ga0070691_10001257 3300005341 Bacteria 10703
73 Ga0070691_10082888 3300005341 Bacteria 1572
74 Ga0070691_10148897 3300005341 Bacteria 1198
75 Ga0070687_100002366 3300005343 Bacteria 7032
76 Ga0070687_100047574 3300005343 Bacteria 2201
77 Ga0070687_100129424 3300005343 Bacteria 1455
78 Ga0070661_100000757 3300005344 Bacteria 23255
79 Ga0070661_100000961 3300005344 Bacteria 20513
80 Ga0070661_100027551 3300005344 Bacteria 4093
81 Ga0070692_10000083 3300005345 Bacteria 19974
82 Ga0070692_10047225 3300005345 Bacteria 2228
83 Ga0070668_100006043 3300005347 Bacteria 8978
84 Ga0070668_100042258 3300005347 Bacteria 3494
85 Ga0070669_100000904 3300005353 Bacteria 21597
86 Ga0070669_100024486 3300005353 Bacteria 4327
87 Ga0070669_100029850 3300005353 Bacteria 3933
88 Ga0070669_100144693 3300005353 Bacteria 1836
89 Ga0070675_100001548 3300005354 Bacteria 17017
90 Ga0070675_100064282 3300005354 Bacteria 3034
91 Ga0070675_100086732 3300005354 Bacteria 2616
92 Ga0070671_100075147 3300005355 Bacteria 2822
93 Ga0070674_100330205 3300005356 Bacteria 1225
94 Ga0070673_100016400 3300005364 Bacteria 5237
95 Ga0070688_100002539 3300005365 Bacteria 9241
96 Ga0070659_100003826 3300005366 Bacteria 10736
97 Ga0070659_100069288 3300005366 Bacteria 2799
98 Ga0070709_10013734 3300005434 Bacteria 4561
99 Ga0070714_100002422 3300005435 Bacteria 13743
100 Ga0070714_100020495 3300005435 Bacteria 5399
101 Ga0070713_100482727 3300005436 Bacteria 1167
102 Ga0070701_10004182 3300005438 Bacteria 5808
103 Ga0070701_10008464 3300005438 Bacteria 4452
104 Ga0070701_10016863 3300005438 Bacteria 3405
105 Ga0070701_10061065 3300005438 Bacteria 1987
106 Ga0070711_100112475 3300005439 Bacteria 2000
107 Ga0070711_100173829 3300005439 Bacteria 1644
108 Ga0070700_100050794 3300005441 Bacteria 2579
109 Ga0070700_100063045 3300005441 Bacteria 2344
110 Ga0070694_100029016 3300005444 Bacteria 3607
111 Ga0070694_100051756 3300005444 Bacteria 2774
112 Ga0070708_100264494 3300005445 Bacteria 1617
113 Ga0070663_100010299 3300005455 Bacteria 5826
114 Ga0070663_100037660 3300005455 Bacteria 3368
115 Ga0070663_100194549 3300005455 Bacteria 1580
116 Ga0070678_100067305 3300005456 Bacteria 2665
117 Ga0070678_100276515 3300005456 Bacteria 1418
118 Ga0070662_100002124 3300005457 Bacteria 12146
119 Ga0070662_100035570 3300005457 Bacteria 3519
120 Ga0070681_10002432 3300005458 Bacteria 17035
121 Ga0070681_10009557 3300005458 Bacteria 9542
122 Ga0070681_10031584 3300005458 Bacteria 5316
123 Ga0068867_100071160 3300005459 Bacteria 2601
124 Ga0068867_100087873 3300005459 Bacteria 2354
125 Ga0068867_100088040 3300005459 Bacteria 2353
126 Ga0070685_10156004 3300005466 Bacteria 1451
127 Ga0070706_100201738 3300005467 Bacteria 1858
128 Ga0070679_100000091 3300005530 Bacteria 68903
129 Ga0070679_100000372 3300005530 Bacteria 38070
130 Ga0070679_100061780 3300005530 Bacteria 3734
131 Ga0070679_100190196 3300005530 Bacteria 2022
132 Ga0070684_100002177 3300005535 Bacteria 14467
133 Ga0070684_100183733 3300005535 Bacteria 1901
134 Ga0070697_100462287 3300005536 Bacteria 1106
135 Ga0068853_100008118 3300005539 Bacteria 8426
136 Ga0070672_100028669 3300005543 Bacteria 4166
137 Ga0070672_100141552 3300005543 Bacteria 1984
138 Ga0070686_100001564 3300005544 Bacteria 12861
139 Ga0070686_100005969 3300005544 Bacteria 6755
140 Ga0070695_100068983 3300005545 Bacteria 2310
141 Ga0070696_100001089 3300005546 Bacteria 17556
142 Ga0070693_100017566 3300005547 Bacteria 3721
143 Ga0070665_100000374 3300005548 Bacteria 66650
144 Ga0070665_100000817 3300005548 Bacteria 40729
145 Ga0070665_100001536 3300005548 Bacteria 26669
146 Ga0070665_100047770 3300005548 Bacteria 4295
147 Ga0070665_100110420 3300005548 Bacteria 2753
148 Ga0070665_100158536 3300005548 Bacteria 2265
149 Ga0070704_100035195 3300005549 Bacteria 3403
150 Ga0068855_100010100 3300005563 Bacteria 11379
151 Ga0068855_100021239 3300005563 Bacteria 7783
152 Ga0068855_100158400 3300005563 Bacteria 2571
153 Ga0070664_100000485 3300005564 Bacteria 30116
154 Ga0070664_100010951 3300005564 Bacteria 7356
155 Ga0070664_100031375 3300005564 Bacteria 4439
156 Ga0070664_100260673 3300005564 Bacteria 1560
157 Ga0068857_100233172 3300005577 Bacteria 1684
158 Ga0068854_100001982 3300005578 Bacteria 12523
159 Ga0068854_100019287 3300005578 Bacteria 4594
160 Ga0068854_100052940 3300005578 Bacteria 2912
161 Ga0068854_100319167 3300005578 Bacteria 1262
162 Ga0068856_100002593 3300005614 Bacteria 18615
163 Ga0068856_100035944 3300005614 Bacteria 4857
164 Ga0068856_100530382 3300005614 Bacteria 1198
165 Ga0070702_100211906 3300005615 Bacteria 1290
166 Ga0068852_100003098 3300005616 Bacteria 11576
167 Ga0068852_100004962 3300005616 Bacteria 9456
168 Ga0068852_100067893 3300005616 Bacteria 3118
169 Ga0068859_100003963 3300005617 Bacteria 15103
170 Ga0068859_100020692 3300005617 Bacteria 6603
171 Ga0068859_100125190 3300005617 Bacteria 2639
172 Ga0068859_100156214 3300005617 Bacteria 2358
173 Ga0068859_100173535 3300005617 Bacteria 2238
174 Ga0068864_100005280 3300005618 Bacteria 10583
175 Ga0068864_100009820 3300005618 Bacteria 7892
176 Ga0068864_100028224 3300005618 Bacteria 4741
177 Ga0068866_10048434 3300005718 Bacteria 2149
178 Ga0068861_100008096 3300005719 Bacteria 7232
179 Ga0068861_100011725 3300005719 Bacteria 6101
180 Ga0068861_100078095 3300005719 Bacteria 2584
181 Ga0068851_10030188 3300005834 Bacteria 2687
182 Ga0068870_10048952 3300005840 Bacteria 2227
183 Ga0068870_10133658 3300005840 Bacteria 1444
184 Ga0068863_100009131 3300005841 Bacteria 9683
185 Ga0068863_100035159 3300005841 Bacteria 4773
186 Ga0068863_100037003 3300005841 Bacteria 4647
187 Ga0068863_100184196 3300005841 Bacteria 2005
188 Ga0068863_100251306 3300005841 Bacteria 1708
189 Ga0068858_100036443 3300005842 Bacteria 4561
190 Ga0068860_100001649 3300005843 Bacteria 23875
191 Ga0068860_100078858 3300005843 Bacteria 3132
192 Ga0068860_100083892 3300005843 Bacteria 3031
193 Ga0068862_100008766 3300005844 Bacteria 8377
194 Ga0068862_100012326 3300005844 Bacteria 7070
195 Ga0068862_100047522 3300005844 Bacteria 3663
196 Ga0081455_10020754 3300005937 Bacteria 6176
197 Ga0070717_10016171 3300006028 Bacteria 5780
198 Ga0070717_10218057 3300006028 Bacteria 1676
199 Ga0075364_10002873 3300006051 Bacteria 9705
200 Ga0075364_10023125 3300006051 Bacteria 3932
201 Ga0075432_10094399 3300006058 Bacteria 1098
202 Ga0070715_10031475 3300006163 Bacteria 2154
203 Ga0070716_100003847 3300006173 Bacteria 7125
204 Ga0070712_100245917 3300006175 Bacteria 1427
205 Ga0070712_100304405 3300006175 Bacteria 1291
206 Ga0075362_10015605 3300006177 Bacteria 3093
207 Ga0097621_100112989 3300006237 Bacteria 2297
208 Ga0068871_100013415 3300006358 Bacteria 6082
209 Ga0068871_100055139 3300006358 Bacteria 3226
210 Ga0068871_100071187 3300006358 Bacteria 2860
211 Ga0075428_100005937 3300006844 Bacteria 13570
212 Ga0075428_100021775 3300006844 Bacteria 7097
213 Ga0075428_100089647 3300006844 Bacteria 3354
214 Ga0075430_100025234 3300006846 Bacteria 5055
215 Ga0075430_100030214 3300006846 Bacteria 4600
216 Ga0075430_100085791 3300006846 Bacteria 2636
217 Ga0075430_100498729 3300006846 Bacteria 1005
218 Ga0075431_100008918 3300006847 Bacteria 10050
219 Ga0075431_100040488 3300006847 Bacteria 4803
220 Ga0075431_100127534 3300006847 Bacteria 2625
221 Ga0075431_100265589 3300006847 Bacteria 1741
222 Ga0075429_100022013 3300006880 Bacteria 5528
223 Ga0075429_100034608 3300006880 Bacteria 4390
224 Ga0075429_100053422 3300006880 Bacteria 3516
225 Ga0075429_100127844 3300006880 Bacteria 2222
226 Ga0075429_100243046 3300006880 Bacteria 1576
227 Ga0068865_100163229 3300006881 Bacteria 1701
228 Ga0068865_100291499 3300006881 Bacteria 1303
229 Ga0097620_100003963 3300006931 Bacteria 15103
230 Ga0097620_100020691 3300006931 Bacteria 6603
231 Ga0097620_100125189 3300006931 Bacteria 2639
232 Ga0097620_100156216 3300006931 Bacteria 2358
233 Ga0097620_100173525 3300006931 Bacteria 2238
234 Ga0079104_1000120 3300006946 Bacteria 111969
235 Ga0079104_1000135 3300006946 Bacteria 103632
236 Ga0079104_1000375 3300006946 Bacteria 52652
237 Ga0079104_1000920 3300006946 Bacteria 23632
238 Ga0079104_1002489 3300006946 Bacteria 9828
239 Ga0099826_10035691 3300006948 Bacteria 3531
240 Ga0099794_10007866 3300007265 Bacteria 4404
241 Ga0099794_10074679 3300007265 Bacteria 1665
242 Ga0099795_10000004 3300007788 Bacteria 108633
243 Ga0099795_10009077 3300007788 Bacteria 2870
244 Ga0105251_10000500 3300009011 Bacteria 37162
245 Ga0105251_10000971 3300009011 Bacteria 25452
246 Ga0105251_10001251 3300009011 Bacteria 22007
247 Ga0105251_10008997 3300009011 Bacteria 5954
248 Ga0105251_10018140 3300009011 Bacteria 3751
249 Ga0105251_10020565 3300009011 Bacteria 3465
250 Ga0105251_10121300 3300009011 Bacteria 1187
251 Ga0105244_10000224 3300009036 Bacteria 58869
252 Ga0105244_10000246 3300009036 Bacteria 55589
253 Ga0105244_10005965 3300009036 Bacteria 7985
254 Ga0105244_10009502 3300009036 Bacteria 5974
255 Ga0105244_10009873 3300009036 Bacteria 5826
256 Ga0105244_10028238 3300009036 Bacteria 3012
257 Ga0105244_10031514 3300009036 Bacteria 2813
258 Ga0105244_10033675 3300009036 Bacteria 2700
259 Ga0105250_10000024 3300009092 Bacteria 218115
260 Ga0105250_10001909 3300009092 Bacteria 10814
261 Ga0105250_10002486 3300009092 Bacteria 9247
262 Ga0105250_10003102 3300009092 Bacteria 7995
263 Ga0105250_10008560 3300009092 Bacteria 4338
264 Ga0105250_10040436 3300009092 Bacteria 1870
265 Ga0105240_10029428 3300009093 Bacteria 7155
266 Ga0105240_10058195 3300009093 Bacteria 4825
267 Ga0105240_10159492 3300009093 Bacteria 2681
268 Ga0105240_10170151 3300009093 Bacteria 2581
269 Ga0105240_10215765 3300009093 Bacteria 2239
270 Ga0111539_10013105 3300009094 Bacteria 10372
271 Ga0111539_10275565 3300009094 Bacteria 1958
272 Ga0105245_10036619 3300009098 Bacteria 4360
273 Ga0105245_10142930 3300009098 Bacteria 2255
274 Ga0105245_10148507 3300009098 Bacteria 2214
275 Ga0105245_10155204 3300009098 Bacteria 2168
276 Ga0105247_10007410 3300009101 Bacteria 6735
277 Ga0105243_10001321 3300009148 Bacteria 22100
278 Ga0105243_10002510 3300009148 Bacteria 15315
279 Ga0105243_10178641 3300009148 Bacteria 1844
280 Ga0105241_10460500 3300009174 Bacteria 1127
281 Ga0105241_10525067 3300009174 Bacteria 1059
282 Ga0105242_10012095 3300009176 Bacteria 6640
283 Ga0105242_10064552 3300009176 Bacteria 3019
284 Ga0105248_10033962 3300009177 Bacteria 5701
285 Ga0105248_10046079 3300009177 Bacteria 4887
286 Ga0105248_10545284 3300009177 Bacteria 1308
287 Ga0105237_10000335 3300009545 Bacteria 66335
288 Ga0105237_10006477 3300009545 Bacteria 12975
289 Ga0105238_10001931 3300009551 Bacteria 20819
290 Ga0105238_10002259 3300009551 Bacteria 19408
291 Ga0105238_10085859 3300009551 Bacteria 3135
292 Ga0105238_10241394 3300009551 Bacteria 1784
293 Ga0105249_10024343 3300009553 Bacteria 5441
294 Ga0105249_10392022 3300009553 Bacteria 1417
295 Ga0105030_102265 3300009987 Bacteria 1684
296 Ga0099796_10000006 3300010159 Bacteria 66689
297 Ga0099796_10014045 3300010159 Bacteria 2302
298 Ga0105239_10013236 3300010375 Bacteria 9169
299 Ga0105239_10067141 3300010375 Bacteria 3939
300 Ga0105246_10005977 3300011119 Bacteria 7432
301 Ga0105246_10069796 3300011119 Bacteria 2469
302 Ga0105246_10153728 3300011119 Bacteria 1745
303 Ga0157345_1000334 3300012498 Bacteria 5606
304 Ga0157373_10021414 3300013100 Bacteria 4697
305 Ga0157373_10070915 3300013100 Bacteria 2462
306 Ga0157373_10072867 3300013100 Bacteria 2424
307 Ga0157373_10078059 3300013100 Bacteria 2335
308 Ga0157371_10000406 3300013102 Bacteria 53786
309 Ga0157371_10004097 3300013102 Bacteria 12880
310 Ga0157371_10006011 3300013102 Bacteria 10112
311 Ga0157371_10012661 3300013102 Bacteria 6435
312 Ga0157371_10079558 3300013102 Bacteria 2322
313 Ga0157370_10001889 3300013104 Bacteria 25787
314 Ga0157370_10002468 3300013104 Bacteria 22309
315 Ga0157370_10004655 3300013104 Bacteria 15667
316 Ga0157370_10012990 3300013104 Bacteria 8605
317 Ga0157370_10031845 3300013104 Bacteria 5155
318 Ga0157370_10044001 3300013104 Bacteria 4296
319 Ga0157370_10086697 3300013104 Bacteria 2941
320 Ga0157369_10000107 3300013105 Bacteria 117307
321 Ga0157369_10001202 3300013105 Bacteria 32234
322 Ga0157369_10007741 3300013105 Bacteria 12359
323 Ga0157369_10007861 3300013105 Bacteria 12263
324 Ga0157369_10057845 3300013105 Bacteria 4182
325 Ga0157374_10000600 3300013296 Bacteria 31879
326 Ga0157374_10266450 3300013296 Bacteria 1689
327 Ga0157378_10385231 3300013297 Bacteria 1378
328 Ga0163162_10001668 3300013306 Bacteria 20833
329 Ga0163162_10021683 3300013306 Bacteria 6327
330 Ga0163162_10133574 3300013306 Bacteria 2592
331 Ga0157372_10000715 3300013307 Bacteria 36428
332 Ga0157372_10003727 3300013307 Bacteria 16365
333 Ga0157372_10004291 3300013307 Bacteria 15241
334 Ga0157372_10010698 3300013307 Bacteria 9764
335 Ga0157372_10032929 3300013307 Bacteria 5688
336 Ga0157372_10066732 3300013307 Bacteria 4042
337 Ga0157372_10088454 3300013307 Bacteria 3517
338 Ga0157375_10007002 3300013308 Bacteria 9846
339 Ga0157375_10060961 3300013308 Bacteria 3744
340 Ga0157375_10360902 3300013308 Bacteria 1619
341 Ga0157375_10607457 3300013308 Bacteria 1252
342 Ga0163163_10000168 3300014325 Bacteria 68808
343 Ga0163163_10000848 3300014325 Bacteria 26014
344 Ga0163163_10022217 3300014325 Bacteria 6002
345 Ga0163163_10118014 3300014325 Bacteria 2685
346 Ga0157380_10000204 3300014326 Bacteria 34955
347 Ga0157380_10000702 3300014326 Bacteria 20873
348 Ga0157380_10004085 3300014326 Bacteria 10080
349 Ga0157380_10011556 3300014326 Bacteria 6380
350 Ga0157380_10120408 3300014326 Bacteria 2222
351 Ga0157380_10211056 3300014326 Bacteria 1730
352 Ga0182008_10002836 3300014497 Bacteria 10718
353 Ga0182008_10006502 3300014497 Bacteria 6526
354 Ga0182008_10057780 3300014497 Bacteria 1915
355 Ga0182008_10059674 3300014497 Bacteria 1882
356 Ga0157379_10000153 3300014968 Bacteria 51100
357 Ga0157379_10321153 3300014968 Bacteria 1414
358 Ga0157376_10166433 3300014969 Bacteria 2003
359 Ga0157376_10367091 3300014969 Bacteria 1382
360 Ga0182006_1000027 3300015261 Bacteria 252946
361 Ga0182006_1006580 3300015261 Bacteria 5384
362 Ga0182006_1029155 3300015261 Bacteria 2238
363 Ga0182006_1030073 3300015261 Bacteria 2198
364 Ga0182007_10030939 3300015262 Bacteria 1826
365 Ga0163161_10085264 3300017792 Bacteria 2330
366 Ga0163161_10167816 3300017792 Bacteria 1677
367 Ga0163161_10225715 3300017792 Bacteria 1452
368 Ga0163161_10540087 3300017792 Bacteria 954
369 Ga0206356_10269087 3300020070 Bacteria 4369
370 Ga0206354_10944045 3300020081 Bacteria 3035
371 Ga0206353_10734867 3300020082 Bacteria 5930
372 Ga0206353_10961766 3300020082 Bacteria 11309
373 Ga0154015_1412532 3300020610 Bacteria 1600
374 Ga0213871_10020754 3300021441 Bacteria 1631
375 Ga0209760_100079 3300025207 Bacteria 77345
376 Ga0209760_100211 3300025207 Bacteria 26630
377 Ga0209784_100128 3300025224 Bacteria 76497
378 Ga0209566_100157 3300025225 Bacteria 76430
379 Ga0209674_100180 3300025226 Bacteria 76497
380 Ga0209674_100523 3300025226 Bacteria 15570
381 Ga0209674_103020 3300025226 Bacteria 3247
382 Ga0209672_100018 3300025228 Bacteria 432924
383 Ga0209147_100183 3300025229 Bacteria 75926
384 Ga0209563_100144 3300025230 Bacteria 76497
385 Ga0209563_100231 3300025230 Bacteria 27006
386 Ga0207427_100001 3300025231 Bacteria 1410763
387 Ga0207427_100048 3300025231 Bacteria 238464
388 Ga0209437_100003 3300025233 Bacteria 1517827
389 Ga0209437_100094 3300025233 Bacteria 238465
390 Ga0209437_101381 3300025233 Bacteria 6152
391 Ga0209258_100024 3300025242 Bacteria 542096
392 Ga0209258_100310 3300025242 Bacteria 76430
393 Ga0209646_1000355 3300025246 Bacteria 32593
394 Ga0209026_1000056 3300025250 Bacteria 236450
395 Ga0209677_100127 3300025253 Bacteria 76548
396 Ga0209677_101128 3300025253 Bacteria 12514
397 Ga0209148_1000009 3300025254 Bacteria 1395625
398 Ga0209759_1000166 3300025256 Bacteria 113080
399 Ga0209129_1006397 3300025258 Bacteria 3819
400 Ga0209233_1000007 3300025261 Bacteria 1411234
401 Ga0209233_1000106 3300025261 Bacteria 268795
402 Ga0209455_1000029 3300025272 Bacteria 542096
403 Ga0209675_1011730 3300025291 Bacteria 2884
404 Ga0209676_1000055 3300025292 Bacteria 361565
405 Ga0209676_1000115 3300025292 Bacteria 205183
406 Ga0209676_1000556 3300025292 Bacteria 56739
407 Ga0209676_1000950 3300025292 Bacteria 35488
408 Ga0209676_1000959 3300025292 Bacteria 34915
409 Ga0209676_1004177 3300025292 Bacteria 8207
410 Ga0209758_1034692 3300025297 Bacteria 2002
411 Ga0209050_1000606 3300025298 Bacteria 57003
412 Ga0209050_1000941 3300025298 Bacteria 37976
413 Ga0209050_1000970 3300025298 Bacteria 36710
414 Ga0209050_1016874 3300025298 Bacteria 2952
415 Ga0207426_1046525 3300025302 Bacteria 1313
416 Ga0209051_1000054 3300025303 Bacteria 280804
417 Ga0209051_1000083 3300025303 Bacteria 192732
418 Ga0209051_1000429 3300025303 Bacteria 57551
419 Ga0209257_1000090 3300025304 Bacteria 274746
420 Ga0209257_1000175 3300025304 Bacteria 165070
421 Ga0209257_1018791 3300025304 Bacteria 2638
422 Ga0209257_1030643 3300025304 Bacteria 1733
423 Ga0207656_10001116 3300025321 Bacteria 8827
424 Ga0207656_10002494 3300025321 Bacteria 6219
425 Ga0207656_10070981 3300025321 Bacteria 1547
426 Ga0207696_1000019 3300025711 Bacteria 476309
427 Ga0207696_1000175 3300025711 Bacteria 102142
428 Ga0207696_1000275 3300025711 Bacteria 61367
429 Ga0207696_1000383 3300025711 Bacteria 42719
430 Ga0207696_1000426 3300025711 Bacteria 38552
431 Ga0207696_1001872 3300025711 Bacteria 10780
432 Ga0207696_1006240 3300025711 Bacteria 4827
433 Ga0207696_1007110 3300025711 Bacteria 4421
434 Ga0207696_1007189 3300025711 Bacteria 4384
435 Ga0207696_1007329 3300025711 Bacteria 4332
436 Ga0207696_1018686 3300025711 Bacteria 2271
437 Ga0207655_1000004 3300025728 Bacteria 1021221
438 Ga0207655_1000019 3300025728 Bacteria 536324
439 Ga0207655_1000062 3300025728 Bacteria 258054
440 Ga0207655_1000115 3300025728 Bacteria 162114
441 Ga0207655_1000434 3300025728 Bacteria 56142
442 Ga0207655_1001025 3300025728 Bacteria 28225
443 Ga0207655_1001255 3300025728 Bacteria 24204
444 Ga0207655_1001801 3300025728 Bacteria 18589
445 Ga0207655_1001882 3300025728 Bacteria 18026
446 Ga0207655_1005926 3300025728 Bacteria 8187
447 Ga0207655_1010454 3300025728 Bacteria 5626
448 Ga0207655_1014037 3300025728 Bacteria 4556
449 Ga0207655_1033064 3300025728 Bacteria 2351
450 Ga0207713_1000023 3300025735 Bacteria 346097
451 Ga0207713_1000207 3300025735 Bacteria 79895
452 Ga0207713_1000299 3300025735 Bacteria 56880
453 Ga0207713_1000681 3300025735 Bacteria 31842
454 Ga0207713_1003198 3300025735 Bacteria 11317
455 Ga0207713_1003297 3300025735 Bacteria 11099
456 Ga0207713_1004796 3300025735 Bacteria 8684
457 Ga0207713_1006447 3300025735 Bacteria 7146
458 Ga0207713_1009064 3300025735 Bacteria 5653
459 Ga0207713_1011536 3300025735 Bacteria 4793
460 Ga0207713_1014323 3300025735 Bacteria 4129
461 Ga0207713_1015587 3300025735 Bacteria 3893
462 Ga0207713_1016389 3300025735 Bacteria 3760
463 Ga0207713_1019734 3300025735 Bacteria 3287
464 Ga0207713_1052120 3300025735 Bacteria 1623
465 Ga0207682_10017898 3300025893 Bacteria 2766
466 Ga0207682_10085111 3300025893 Bacteria 1362
467 Ga0207710_10022650 3300025900 Bacteria 2697
468 Ga0207688_10018196 3300025901 Bacteria 3825
469 Ga0207680_10000002 3300025903 Bacteria 1018646
470 Ga0207680_10000258 3300025903 Bacteria 25434
471 Ga0207680_10017367 3300025903 Bacteria 3800
472 Ga0207647_10000548 3300025904 Bacteria 29903
473 Ga0207647_10041154 3300025904 Bacteria 2907
474 Ga0207685_10035372 3300025905 Bacteria 1822
475 Ga0207699_10056754 3300025906 Bacteria 2335
476 Ga0207643_10015501 3300025908 Bacteria 4149
477 Ga0207643_10078929 3300025908 Bacteria 1905
478 Ga0207643_10213513 3300025908 Bacteria 1178
479 Ga0207705_10000553 3300025909 Bacteria 31478
480 Ga0207705_10001408 3300025909 Bacteria 19149
481 Ga0207705_10001438 3300025909 Bacteria 18995
482 Ga0207705_10003691 3300025909 Bacteria 11648
483 Ga0207705_10368093 3300025909 Bacteria 1109
484 Ga0207705_10511402 3300025909 Bacteria 933
485 Ga0207654_10009586 3300025911 Bacteria 4922
486 Ga0207707_10000216 3300025912 Bacteria 61797
487 Ga0207707_10000535 3300025912 Bacteria 38781
488 Ga0207707_10001364 3300025912 Bacteria 22673
489 Ga0207707_10004165 3300025912 Bacteria 12811
490 Ga0207707_10005396 3300025912 Bacteria 11175
491 Ga0207707_10081172 3300025912 Bacteria 2831
492 Ga0207707_10477963 3300025912 Bacteria 1064
493 Ga0207695_10001358 3300025913 Bacteria 41520
494 Ga0207695_10015790 3300025913 Bacteria 8870
495 Ga0207695_10027644 3300025913 Bacteria 6312
496 Ga0207695_10240283 3300025913 Bacteria 1713
497 Ga0207671_10000018 3300025914 Bacteria 318130
498 Ga0207671_10003719 3300025914 Bacteria 15034
499 Ga0207660_10000037 3300025917 Bacteria 65071
500 Ga0207660_10001255 3300025917 Bacteria 17001
501 Ga0207660_10002057 3300025917 Bacteria 13362
502 Ga0207660_10025218 3300025917 Bacteria 4034
503 Ga0207660_10112702 3300025917 Bacteria 2049
504 Ga0207660_10223971 3300025917 Bacteria 1477
505 Ga0207662_10028790 3300025918 Bacteria 3214
506 Ga0207662_10036404 3300025918 Bacteria 2876
507 Ga0207662_10061192 3300025918 Bacteria 2260
508 Ga0207657_10000474 3300025919 Bacteria 42311
509 Ga0207657_10001326 3300025919 Bacteria 26300
510 Ga0207657_10049838 3300025919 Bacteria 3646
511 Ga0207649_10000008 3300025920 Bacteria 315683
512 Ga0207649_10001228 3300025920 Bacteria 15387
513 Ga0207649_10002222 3300025920 Bacteria 10968
514 Ga0207649_10006688 3300025920 Bacteria 6267
515 Ga0207649_10054940 3300025920 Bacteria 2481
516 Ga0207649_10143141 3300025920 Bacteria 1638
517 Ga0207652_10000164 3300025921 Bacteria 72008
518 Ga0207652_10000423 3300025921 Bacteria 43871
519 Ga0207652_10001445 3300025921 Bacteria 21033
520 Ga0207652_10001950 3300025921 Bacteria 17852
521 Ga0207652_10015597 3300025921 Bacteria 6183
522 Ga0207652_10134918 3300025921 Bacteria 2204
523 Ga0207681_10002297 3300025923 Bacteria 12156
524 Ga0207681_10040609 3300025923 Bacteria 3097
525 Ga0207681_10320815 3300025923 Bacteria 1232
526 Ga0207694_10000177 3300025924 Bacteria 65875
527 Ga0207694_10018186 3300025924 Bacteria 5314
528 Ga0207650_10002243 3300025925 Bacteria 13495
529 Ga0207650_10004740 3300025925 Bacteria 9292
530 Ga0207650_10147084 3300025925 Bacteria 1857
531 Ga0207650_10150038 3300025925 Bacteria 1839
532 Ga0207650_10167915 3300025925 Bacteria 1742
533 Ga0207659_10012384 3300025926 Bacteria 5424
534 Ga0207659_10047419 3300025926 Bacteria 3039
535 Ga0207659_10063730 3300025926 Bacteria 2666
536 Ga0207659_10129546 3300025926 Bacteria 1945
537 Ga0207687_10070807 3300025927 Bacteria 2490
538 Ga0207687_10226095 3300025927 Bacteria 1476
539 Ga0207687_10364567 3300025927 Bacteria 1180
540 Ga0207700_10010680 3300025928 Bacteria 5810
541 Ga0207700_10036810 3300025928 Bacteria 3538
542 Ga0207700_10056347 3300025928 Bacteria 2958
543 Ga0207664_10019567 3300025929 Bacteria 5006
544 Ga0207664_10022355 3300025929 Bacteria 4720
545 Ga0207690_10000334 3300025932 Bacteria 31412
546 Ga0207690_10000737 3300025932 Bacteria 21081
547 Ga0207690_10001231 3300025932 Bacteria 16169
548 Ga0207690_10258173 3300025932 Bacteria 1349
549 Ga0207706_10001633 3300025933 Bacteria 22226
550 Ga0207706_10012291 3300025933 Bacteria 7801
551 Ga0207706_10034821 3300025933 Bacteria 4480
552 Ga0207706_10122271 3300025933 Bacteria 2289
553 Ga0207706_10188335 3300025933 Bacteria 1811
554 Ga0207709_10000089 3300025935 Bacteria 149139
555 Ga0207709_10001814 3300025935 Bacteria 14255
556 Ga0207709_10129678 3300025935 Bacteria 1716
557 Ga0207709_10217788 3300025935 Bacteria 1375
558 Ga0207670_10001078 3300025936 Bacteria 14370
559 Ga0207670_10038130 3300025936 Bacteria 3136
560 Ga0207670_10079000 3300025936 Bacteria 2296
561 Ga0207670_10120227 3300025936 Bacteria 1908
562 Ga0207669_10101454 3300025937 Bacteria 1904
563 Ga0207704_10022452 3300025938 Bacteria 3381
564 Ga0207665_10010387 3300025939 Bacteria 6116
565 Ga0207665_10068109 3300025939 Bacteria 2425
566 Ga0207691_10007416 3300025940 Bacteria 10560
567 Ga0207691_10018791 3300025940 Bacteria 6546
568 Ga0207691_10129851 3300025940 Bacteria 2226
569 Ga0207691_10196050 3300025940 Bacteria 1759
570 Ga0207691_10206087 3300025940 Bacteria 1710
571 Ga0207711_10032996 3300025941 Bacteria 4379
572 Ga0207711_10047807 3300025941 Bacteria 3660
573 Ga0207711_10049020 3300025941 Bacteria 3615
574 Ga0207711_10137020 3300025941 Bacteria 2199
575 Ga0207711_10465228 3300025941 Bacteria 1178
576 Ga0207689_10005133 3300025942 Bacteria 11774
577 Ga0207689_10031466 3300025942 Bacteria 4417
578 Ga0207689_10084221 3300025942 Bacteria 2614
579 Ga0207661_10002528 3300025944 Bacteria 12590
580 Ga0207661_10326374 3300025944 Bacteria 1381
581 Ga0207679_10000008 3300025945 Bacteria 412057
582 Ga0207679_10001433 3300025945 Bacteria 14989
583 Ga0207679_10009007 3300025945 Bacteria 6379
584 Ga0207679_10094618 3300025945 Bacteria 2320
585 Ga0207679_10449521 3300025945 Bacteria 1142
586 Ga0207667_10000506 3300025949 Bacteria 51465
587 Ga0207667_10001190 3300025949 Bacteria 32639
588 Ga0207667_10004804 3300025949 Bacteria 16526
589 Ga0207667_10202020 3300025949 Bacteria 2039
590 Ga0207667_10406614 3300025949 Bacteria 1386
591 Ga0207651_10078940 3300025960 Bacteria 2363
592 Ga0207651_10146574 3300025960 Bacteria 1831
593 Ga0207651_10150588 3300025960 Bacteria 1810
594 Ga0207651_10184015 3300025960 Bacteria 1660
595 Ga0207712_10048104 3300025961 Bacteria 2965
596 Ga0207712_10260493 3300025961 Bacteria 1406
597 Ga0207668_10005842 3300025972 Bacteria 7247
598 Ga0207668_10050481 3300025972 Bacteria 2867
599 Ga0207668_10340823 3300025972 Bacteria 1250
600 Ga0207640_10043380 3300025981 Bacteria 2874
601 Ga0207640_10057477 3300025981 Bacteria 2559
602 Ga0207658_10200402 3300025986 Bacteria 1666
603 Ga0207658_10230232 3300025986 Bacteria 1564
604 Ga0207658_10252643 3300025986 Bacteria 1499
605 Ga0207677_10033701 3300026023 Bacteria 3307
606 Ga0207677_10038262 3300026023 Bacteria 3144
607 Ga0207703_10039843 3300026035 Bacteria 3757
608 Ga0207703_10070020 3300026035 Bacteria 2894
609 Ga0207639_10000194 3300026041 Bacteria 46634
610 Ga0207639_10000651 3300026041 Bacteria 23922
611 Ga0207639_10004992 3300026041 Bacteria 8936
612 Ga0207678_10000638 3300026067 Bacteria 32186
613 Ga0207678_10001101 3300026067 Bacteria 24769
614 Ga0207678_10010873 3300026067 Bacteria 8000
615 Ga0207678_10244740 3300026067 Bacteria 1536
616 Ga0207678_10378960 3300026067 Bacteria 1223
617 Ga0207708_10007427 3300026075 Bacteria 8100
618 Ga0207708_10074953 3300026075 Bacteria 2594
619 Ga0207708_10217382 3300026075 Bacteria 1530
620 Ga0207702_10006981 3300026078 Bacteria 9665
621 Ga0207702_10010603 3300026078 Bacteria 7701
622 Ga0207702_10018842 3300026078 Bacteria 5709
623 Ga0207702_10289001 3300026078 Bacteria 1553
624 Ga0207641_10004613 3300026088 Bacteria 11896
625 Ga0207641_10039243 3300026088 Bacteria 3959
626 Ga0207641_10046423 3300026088 Bacteria 3661
627 Ga0207641_10054676 3300026088 Bacteria 3388
628 Ga0207641_10127392 3300026088 Bacteria 2281
629 Ga0207648_10002079 3300026089 Bacteria 21809
630 Ga0207648_10025082 3300026089 Bacteria 5316
631 Ga0207648_10039695 3300026089 Bacteria 4138
632 Ga0207648_10204902 3300026089 Bacteria 1750
633 Ga0207676_10043184 3300026095 Bacteria 3469
634 Ga0207676_10063210 3300026095 Bacteria 2939
635 Ga0207676_10081019 3300026095 Bacteria 2636
636 Ga0207674_10002179 3300026116 Bacteria 24771
637 Ga0207674_10074629 3300026116 Bacteria 3403
638 Ga0207674_10175887 3300026116 Bacteria 2093
639 Ga0207675_100011633 3300026118 Bacteria 8229
640 Ga0207675_100021623 3300026118 Bacteria 5990
641 Ga0207675_100023062 3300026118 Bacteria 5788
642 Ga0207675_100124281 3300026118 Bacteria 2443
643 Ga0207675_100137849 3300026118 Bacteria 2316
644 Ga0207675_100200639 3300026118 Bacteria 1916
645 Ga0207683_10006412 3300026121 Bacteria 10076
646 Ga0207683_10087208 3300026121 Bacteria 2775
647 Ga0207683_10190713 3300026121 Bacteria 1861
648 Ga0207683_10280131 3300026121 Bacteria 1524
649 Ga0207698_10000920 3300026142 Bacteria 17121
650 Ga0207698_10001178 3300026142 Bacteria 15251
651 Ga0207698_10003673 3300026142 Bacteria 9269
652 Ga0209281_1000004 3300027111 Bacteria 1253949
653 Ga0209281_1000014 3300027111 Bacteria 643021
654 Ga0209281_1000018 3300027111 Bacteria 579091
655 Ga0209281_1000095 3300027111 Bacteria 238108
656 Ga0209281_1000391 3300027111 Bacteria 68959
657 Ga0209281_1000404 3300027111 Bacteria 65885
658 Ga0209389_1078671 3300027296 Bacteria 1633
659 Ga0209371_1000005 3300027312 Bacteria 1061740
660 Ga0209371_1000559 3300027312 Bacteria 34100
661 Ga0209371_1001783 3300027312 Bacteria 13490
662 Ga0209371_1003533 3300027312 Bacteria 7514
663 Ga0209371_1003732 3300027312 Bacteria 7136
664 Ga0209371_1010795 3300027312 Bacteria 2771
665 Ga0209969_1012383 3300027360 Bacteria 1230
666 Ga0209179_1000092 3300027512 Bacteria 13096
667 Ga0209179_1003038 3300027512 Bacteria 2361
668 Ga0209999_1017394 3300027543 Bacteria 1311
669 Ga0209282_1073187 3300027666 Bacteria 1857
670 Ga0209971_1000283 3300027682 Bacteria 14141
671 Ga0209966_1041067 3300027695 Bacteria 964
672 Ga0209974_10024050 3300027876 Bacteria 2016
673 Ga0207428_10015038 3300027907 Bacteria 6705
674 Ga0207428_10020953 3300027907 Bacteria 5542
675 Ga0207428_10033442 3300027907 Bacteria 4223
676 Ga0207428_10102538 3300027907 Bacteria 2210
677 Ga0268266_10000004 3300028379 Bacteria 1495817
678 Ga0268266_10000894 3300028379 Bacteria 38498
679 Ga0268266_10012944 3300028379 Bacteria 7194
680 Ga0268266_10037850 3300028379 Bacteria 4107
681 Ga0268266_10196192 3300028379 Bacteria 1846
682 Ga0268266_10255937 3300028379 Bacteria 1621
683 Ga0268265_10011415 3300028380 Bacteria 6007
684 Ga0268265_10014190 3300028380 Bacteria 5427
685 Ga0268265_10027739 3300028380 Bacteria 4045
686 Ga0268265_10028465 3300028380 Bacteria 4000
687 Ga0268265_10040833 3300028380 Bacteria 3428
688 Ga0268265_10451103 3300028380 Bacteria 1201
689 Ga0268265_10481270 3300028380 Bacteria 1166
690 Ga0268264_10027543 3300028381 Bacteria 4645
691 Ga0268264_10166497 3300028381 Bacteria 1990
692 Ga0268264_10285437 3300028381 Bacteria 1548
693 Ga0265334_10001122 3300028573 Bacteria 13075
694 Ga0265318_10001166 3300028577 Bacteria 16279
695 Ga0307517_10165832 3300028786 Bacteria 1468
696 Ga0307515_10022420 3300028794 Bacteria 11130
697 Ga0265338_10007165 3300028800 Bacteria 13963
698 Ga0265338_10052392 3300028800 Bacteria 3661
699 Ga0268256_1000006 3300030500 Bacteria 1063991
700 Ga0268256_1000683 3300030500 Bacteria 25530
701 Ga0268256_1000960 3300030500 Bacteria 19631
702 Ga0268256_1003107 3300030500 Bacteria 7756
703 Ga0268256_1011635 3300030500 Bacteria 2771
704 Ga0268256_1033619 3300030500 Bacteria 1209
705 Ga0316179_1113066 3300030734 Bacteria 2509
706 Ga0316178_1087112 3300030735 Bacteria 7323
707 Ga0316183_1044454 3300030742 Bacteria 2002
708 Ga0265763_1002977 3300030763 Bacteria 1322
709 Ga0265770_1000369 3300030878 Bacteria 6097
710 Ga0265760_10002759 3300031090 Bacteria 5138
711 Ga0265330_10002921 3300031235 Bacteria 9116
712 Ga0265332_10001420 3300031238 Bacteria 13467
713 Ga0265328_10042645 3300031239 Bacteria 1670
714 Ga0265320_10023023 3300031240 Bacteria 3323
715 Ga0265325_10009644 3300031241 Bacteria 5632
716 Ga0265329_10004113 3300031242 Bacteria 6161
717 Ga0265340_10005180 3300031247 Bacteria 7248
718 Ga0265331_10009198 3300031250 Bacteria 5568
719 Ga0265331_10013558 3300031250 Bacteria 4377
720 Ga0265327_10000014 3300031251 Bacteria 506288
721 Ga0265327_10001336 3300031251 Bacteria 31979
722 Ga0265327_10003077 3300031251 Bacteria 16467
723 Ga0265327_10025433 3300031251 Bacteria 3451
724 Ga0265316_10000792 3300031344 Bacteria 34876
725 Ga0265316_10002874 3300031344 Bacteria 17631
726 Ga0307513_10004368 3300031456 Bacteria 18888
727 Ga0307513_10006131 3300031456 Bacteria 15778
728 Ga0307513_10019623 3300031456 Bacteria 8042
729 Ga0307513_10085159 3300031456 Bacteria 3244
730 Ga0307513_10107892 3300031456 Bacteria 2787
731 Ga0307408_100000077 3300031548 Bacteria 110022
732 Ga0307408_100000411 3300031548 Bacteria 38447
733 Ga0307408_100011122 3300031548 Bacteria 5944
734 Ga0307408_100023679 3300031548 Bacteria 4186
735 Ga0307408_100029897 3300031548 Bacteria 3778
736 Ga0307408_100038986 3300031548 Bacteria 3355
737 Ga0307408_100113396 3300031548 Bacteria 2087
738 Ga0265313_10004882 3300031595 Bacteria 10056
739 Ga0265313_10072893 3300031595 Bacteria 1577
740 Ga0316575_10000552 3300031665 Bacteria 10946
741 Ga0316575_10008898 3300031665 Bacteria 3666
742 Ga0316575_10026536 3300031665 Bacteria 2251
743 Ga0316575_10029416 3300031665 Bacteria 2145
744 Ga0316575_10127780 3300031665 Bacteria 1042
745 Ga0316579_10000781 3300031691 Bacteria 10911
746 Ga0265314_10023013 3300031711 Bacteria 4761
747 Ga0316576_10043312 3300031727 Bacteria 3247
748 Ga0316576_10045016 3300031727 Bacteria 3189
749 Ga0316576_10063907 3300031727 Bacteria 2703
750 Ga0316576_10074584 3300031727 Bacteria 2509
751 Ga0316576_10149937 3300031727 Bacteria 1757
752 Ga0316578_10018465 3300031728 Bacteria 3822
753 Ga0316578_10029466 3300031728 Bacteria 3115
754 Ga0316578_10029662 3300031728 Bacteria 3105
755 Ga0316578_10084779 3300031728 Bacteria 1888
756 Ga0316578_10099491 3300031728 Bacteria 1742
757 Ga0307405_10003135 3300031731 Bacteria 7520
758 Ga0307405_10017965 3300031731 Bacteria 3893
759 Ga0307405_10065702 3300031731 Bacteria 2310
760 Ga0316577_10010475 3300031733 Bacteria 5007
761 Ga0316577_10011297 3300031733 Bacteria 4836
762 Ga0307413_10001598 3300031824 Bacteria 8745
763 Ga0307413_10004458 3300031824 Bacteria 6097
764 Ga0307413_10123809 3300031824 Bacteria 1756
765 Ga0307413_10355241 3300031824 Bacteria 1132
766 Ga0307410_10012094 3300031852 Bacteria 4970
767 Ga0307410_10245534 3300031852 Bacteria 1389
768 Ga0307410_10250298 3300031852 Bacteria 1377
769 Ga0307406_10019065 3300031901 Bacteria 4022
770 Ga0307406_10113897 3300031901 Bacteria 1867
771 Ga0307406_10182936 3300031901 Bacteria 1527
772 Ga0307407_10148287 3300031903 Bacteria 1521
773 Ga0307407_10167267 3300031903 Bacteria 1445
774 Ga0307412_10064739 3300031911 Bacteria 2471
775 Ga0307412_10232155 3300031911 Bacteria 1421
776 Ga0307409_100007399 3300031995 Bacteria 6566
777 Ga0307416_100001771 3300032002 Bacteria 11966
778 Ga0307416_100042601 3300032002 Bacteria 3545
779 Ga0307416_100076158 3300032002 Bacteria 2811
780 Ga0307416_100115811 3300032002 Bacteria 2374
781 Ga0307416_100467903 3300032002 Bacteria 1317
782 Ga0307414_10014501 3300032004 Bacteria 4728
783 Ga0307414_10167961 3300032004 Bacteria 1750
784 Ga0307414_10212399 3300032004 Bacteria 1582
785 Ga0307411_10001359 3300032005 Bacteria 9903
786 Ga0307411_10064378 3300032005 Bacteria 2455
787 Ga0307411_10114681 3300032005 Bacteria 1936
788 Ga0307415_100053847 3300032126 Bacteria 2744
789 Ga0316583_10000442 3300032133 Bacteria 12180
790 Ga0316585_10000027 3300032137 Bacteria 21775
791 Ga0316580_10007512 3300032139 Bacteria 3248
792 Ga0316580_10008044 3300032139 Bacteria 3154
793 Ga0316593_10000073 3300032168 Bacteria 12190
794 Ga0316593_10003440 3300032168 Bacteria 3928
795 Ga0316593_10008222 3300032168 Bacteria 2900
796 Ga0316593_10072220 3300032168 Bacteria 1195
797 Ga0307510_10001742 3300033180 Bacteria 24237
798 Ga0307510_10113435 3300033180 Bacteria 2444
799 Ga0307510_10221506 3300033180 Bacteria 1403
800 Ga0373923_0039004 3300035111 Bacteria 1949
801 Ga0373945_0056733 3300035116 Bacteria 1453
802 Ga0373957_0019132 3300035120 Bacteria 2406
803 Ga0373946_0043285 3300035171 Bacteria 1855
804 Ga0373955_0114736 3300035172 Bacteria 1560
805 Ga0373942_0093954 3300035207 Bacteria 908
806 Ga0316574_0001215 3300035398 Bacteria 11969
807 Ga0316574_0001978 3300035398 Bacteria 10063
808 Ga0316574_0004031 3300035398 Bacteria 7655
809 Ga0316574_0008617 3300035398 Bacteria 5670
810 Ga0316574_0016581 3300035398 Bacteria 4296
811 Ga0316574_0018396 3300035398 Bacteria 4105
812 Ga0316574_0028979 3300035398 Bacteria 3342
813 Ga0316574_0040134 3300035398 Bacteria 2880
814 Ga0316574_0190098 3300035398 Bacteria 1320
815 Ga0316574_0233700 3300035398 Bacteria 1176
816 Ga0316574_0270606 3300035398 Bacteria 1083
817 Ga0373931_0164347 3300035691 Bacteria 1303
818 Ga0373935_0242385 3300035692 Bacteria 1259
819 Ga0373927_0038213 3300035695 Bacteria 3117
820 Ga0373933_0022376 3300035724 Bacteria 3600
821 Ga0373947_0208876 3300035725 Bacteria 1280
822 Ga0316582_0001504 3300036647 Bacteria 10303
823 Ga0316582_0001671 3300036647 Bacteria 9941
824 Ga0316582_0014157 3300036647 Bacteria 4517
825 Ga0316582_0048003 3300036647 Bacteria 2698
826 Ga0316582_0083592 3300036647 Bacteria 2089
827 Ga0316582_0212859 3300036647 Bacteria 1321
828 Ga0316584_0002113 3300036712 Bacteria 12431
829 Ga0316584_0021722 3300036712 Bacteria 4669
830 Ga0316584_0035967 3300036712 Bacteria 3674
831 Ga0316584_0044524 3300036712 Bacteria 3309
832 Ga0316584_0046215 3300036712 Bacteria 3251
833 Ga0316584_0061284 3300036712 Bacteria 2817
834 Ga0316584_0075135 3300036712 Bacteria 2533
835 Ga0316584_0172799 3300036712 Bacteria 1602
836 Ga0395899_0000404 3300037312 Bacteria 50522
837 Ga0395899_0125215 3300037312 Bacteria 1838
838 Ga0395900_0000107 3300037418 Bacteria 149024
839 Ga0395900_0074336 3300037418 Bacteria 3494
840 Ga0395898_0000211 3300037466 Bacteria 149301
841 Ga0395898_0048094 3300037466 Bacteria 4184
842 Ga0316581_0000969 3300037588 Bacteria 6113
843 Ga0316581_0003338 3300037588 Bacteria 3985
844 Ga0395901_0079858 3300038443 Bacteria 3415
845 Ga0395901_0515479 3300038443 Bacteria 1215
846 Ga0237819_00787 3300038705 Bacteria 10146
847 Ga0400483_011244 3300039062 Bacteria 2678
848 Ga0400483_096306 3300039062 Bacteria 2719
849 Ga0400483_195378 3300039062 Bacteria 81541
850 Ga0400483_228399 3300039062 Bacteria 1558
851 Ga0400487_56255 3300039110 Bacteria 4084
852 Ga0436365_1567785 3300039437 Bacteria 2066
853 Ga0436365_1816396 3300039437 Bacteria 1842
854 Ga0436360_0504587 3300039438 Bacteria 11481
855 Ga0436361_0355976 3300039447 Bacteria 2771
856 Ga0436363_0879119 3300039450 Bacteria 8518
857 Ga0439436_0000026 3300041404 Bacteria 55607
858 Ga0439436_0000447 3300041404 Bacteria 10513
859 Ga0439438_000002 3300041405 Bacteria 618223
860 Ga0439438_003174 3300041405 Bacteria 6737
861 Ga0439438_003372 3300041405 Bacteria 6467
862 Ga0439438_004121 3300041405 Bacteria 5676
863 Ga0439438_007190 3300041405 Bacteria 3832
864 Ga0439438_022997 3300041405 Bacteria 1723
865 Ga0439447_001619 3300041407 Bacteria 8257
866 Ga0439447_002046 3300041407 Bacteria 7411
867 Ga0439447_008358 3300041407 Bacteria 3209
868 Ga0439447_039422 3300041407 Bacteria 1156
869 Ga0439461_0002255 3300041410 Bacteria 3064
870 Ga0439466_0002104 3300041411 Bacteria 7795
871 Ga0439466_0011580 3300041411 Bacteria 3261
872 Ga0439466_0016193 3300041411 Bacteria 2698
873 Ga0451791_0939169 3300041451 Bacteria 4353
874 Ga0451807_1085369 3300041486 Bacteria 2043
875 Ga0451833_0997501 3300041491 Bacteria 3095
876 Ga0451853_1515730 3300041512 Bacteria 3614
877 Ga0439441_031425 3300042001 Bacteria 1031
878 Ga0439448_0027489 3300042005 Bacteria 1793
879 Ga0439432_002151 3300042006 Bacteria 7433
880 Ga0439432_003611 3300042006 Bacteria 5723
881 Ga0439432_008528 3300042006 Bacteria 3596
882 Ga0439432_023722 3300042006 Bacteria 2019
883 Ga0439451_005685 3300042009 Bacteria 2550
884 Ga0439451_006810 3300042009 Bacteria 2338
885 Ga0439452_000015 3300042010 Bacteria 342948
886 Ga0439452_000193 3300042010 Bacteria 44853
887 Ga0439452_003709 3300042010 Bacteria 5280
888 Ga0439452_015227 3300042010 Bacteria 2116
889 Ga0439456_005372 3300042013 Bacteria 2598
890 Ga0439456_006439 3300042013 Bacteria 2398
891 Ga0450911_000989 3300042115 Bacteria 7366
892 Ga0450923_000761 3300042125 Bacteria 3853
893 Ga0450891_001834 3300042129 Bacteria 2185
894 Ga0450896_000803 3300042133 Bacteria 3554
895 Ga0450904_000021 3300042139 Bacteria 37453
896 Ga0450906_001253 3300042145 Bacteria 5602
897 Ga0450906_009578 3300042145 Bacteria 1845
898 Ga0450907_002943 3300042146 Bacteria 3131
899 Ga0450907_003833 3300042146 Bacteria 2632
900 Ga0450910_001012 3300042147 Bacteria 3423
901 Ga0439446_0001213 3300042156 Bacteria 5769
902 Ga0439446_0005836 3300042156 Bacteria 3184
903 Ga0439446_0019054 3300042156 Bacteria 1927
904 Ga0450908_003922 3300042184 Bacteria 2878
905 Ga0450908_004614 3300042184 Bacteria 2652
906 Ga0450908_006538 3300042184 Bacteria 2209
907 Ga0450908_008467 3300042184 Bacteria 1927
908 Ga0439459_0002761 3300042438 Bacteria 2735
909 Ga0439464_0000028 3300042439 Bacteria 18437
910 Ga0450918_005543 3300042531 Bacteria 2265
911 Ga0450901_000068 3300042533 Bacteria 10539
912 Ga0451577_0013959 3300042876 Bacteria 7498
913 Ga0451577_0192142 3300042876 Bacteria 1842
914 Ga0451577_0208851 3300042876 Bacteria 1763
915 Ga0439440_0010459 3300042993 Bacteria 1940
916 Ga0466969_0015398 3300044656 Bacteria 4008
917 Ga0453683_0051155 3300044673 Bacteria 2588
918 Ga0466966_0014771 3300044684 Bacteria 5165
919 Ga0466961_0068102 3300044693 Bacteria 2260
920 Ga0466964_0040263 3300044706 Bacteria 1886
921 Ga0453684_0319401 3300044712 Bacteria 1759
922 Ga0453684_0450634 3300044712 Bacteria 1432
923 Ga0466971_0009827 3300044719 Bacteria 4177
924 Ga0466968_0003694 3300044735 Bacteria 5679
925 Ga0466970_0071846 3300044765 Bacteria 1861
926 Ga0466957_0046268 3300044842 Bacteria 2641
927 Ga0466957_0052198 3300044842 Bacteria 2489
928 Ga0466959_0000110 3300045049 Bacteria 52740
929 Ga0451576_0000034 3300045051 Bacteria 390778
930 Ga0451576_0062688 3300045051 Bacteria 3875
931 Ga0451576_0137921 3300045051 Bacteria 2544
932 Ga0451576_0293866 3300045051 Bacteria 1699
933 Ga0466958_0097864 3300045836 Bacteria 1821
934 Ga0495617_000583 3300046452 Bacteria 18579
935 Ga0495617_001724 3300046452 Bacteria 9363
936 Ga0495627_002133 3300046453 Bacteria 9968
937 Ga0495627_012638 3300046453 Bacteria 2990
938 Ga0495627_029960 3300046453 Bacteria 1727
939 Ga0495603_0007081 3300046455 Bacteria 6730
940 Ga0495590_0001676 3300046457 Bacteria 9432
941 Ga0495590_0003763 3300046457 Bacteria 6180
942 Ga0495591_000341 3300046458 Bacteria 41541
943 Ga0495591_002220 3300046458 Bacteria 11080
944 Ga0495591_002827 3300046458 Bacteria 9342
945 Ga0495591_003091 3300046458 Bacteria 8816
946 Ga0495591_006880 3300046458 Bacteria 4934
947 Ga0495591_010564 3300046458 Bacteria 3568
948 Ga0495591_015200 3300046458 Bacteria 2728
949 Ga0495638_0000873 3300046460 Bacteria 31227
950 Ga0495638_0001879 3300046460 Bacteria 18163
951 Ga0495638_0005848 3300046460 Bacteria 9043
952 Ga0495638_0020839 3300046460 Bacteria 4329
953 Ga0495638_0033336 3300046460 Bacteria 3294
954 Ga0495638_0061121 3300046460 Bacteria 2328
955 Ga0495653_0015001 3300046463 Bacteria 6320
956 Ga0495653_0101166 3300046463 Bacteria 2088
957 Ga0495650_0000047 3300046471 Bacteria 335136
958 Ga0495650_0000250 3300046471 Bacteria 105746
959 Ga0495650_0001128 3300046471 Bacteria 29020
960 Ga0495650_0001452 3300046471 Bacteria 22732
961 Ga0495650_0017006 3300046471 Bacteria 3658
962 Ga0495650_0048502 3300046471 Bacteria 1769
963 Ga0495605_0000373 3300046474 Bacteria 42328
964 Ga0495605_0000831 3300046474 Bacteria 21800
965 Ga0495605_0004590 3300046474 Bacteria 8085
966 Ga0495605_0010998 3300046474 Bacteria 5054
967 Ga0495605_0020248 3300046474 Bacteria 3537
968 Ga0495605_0060755 3300046474 Bacteria 1810
969 Ga0495639_0003160 3300046475 Bacteria 7157
970 Ga0495584_0002893 3300046491 Bacteria 9586
971 Ga0495584_0003978 3300046491 Bacteria 7971
972 Ga0495584_0012433 3300046491 Bacteria 4344
973 Ga0495584_0028139 3300046491 Bacteria 2847
974 Ga0495584_0141197 3300046491 Bacteria 1223
975 Ga0495585_0000019 3300046492 Bacteria 156966
976 Ga0495585_0005462 3300046492 Bacteria 8009
977 Ga0495585_0008389 3300046492 Bacteria 6265
978 Ga0495585_0010101 3300046492 Bacteria 5637
979 Ga0495585_0044297 3300046492 Bacteria 2486
980 Ga0495585_0045379 3300046492 Bacteria 2453
981 Ga0495585_0045774 3300046492 Bacteria 2441
982 Ga0495594_0000612 3300046499 Bacteria 18385
983 Ga0495594_0066620 3300046499 Bacteria 1998
984 Ga0495596_0002729 3300046500 Bacteria 9274
985 Ga0495596_0004687 3300046500 Bacteria 6616
986 Ga0495596_0019317 3300046500 Bacteria 2800
987 Ga0495596_0118138 3300046500 Bacteria 1030
988 Ga0495607_0000250 3300046501 Bacteria 57693
989 Ga0495607_0000538 3300046501 Bacteria 37198
990 Ga0495607_0000869 3300046501 Bacteria 28344
991 Ga0495607_0001054 3300046501 Bacteria 25166
992 Ga0495607_0001347 3300046501 Bacteria 21894
993 Ga0495607_0001549 3300046501 Bacteria 20131
994 Ga0495607_0005710 3300046501 Bacteria 8864
995 Ga0495607_0013072 3300046501 Bacteria 5456
996 Ga0495607_0016541 3300046501 Bacteria 4758
997 Ga0495607_0025549 3300046501 Bacteria 3672
998 Ga0495607_0026945 3300046501 Bacteria 3560
999 Ga0495607_0076715 3300046501 Bacteria 1847
1000 Ga0495607_0124245 3300046501 Bacteria 1351
1001 Ga0495583_0000521 3300046506 Bacteria 54646
1002 Ga0495583_0001354 3300046506 Bacteria 25389
1003 Ga0495583_0001828 3300046506 Bacteria 19872
1004 Ga0495583_0002363 3300046506 Bacteria 16292
1005 Ga0495583_0004447 3300046506 Bacteria 10026
1006 Ga0495606_0000255 3300046507 Bacteria 93984
1007 Ga0495606_0000665 3300046507 Bacteria 53891
1008 Ga0495606_0001039 3300046507 Bacteria 40170
1009 Ga0495606_0001255 3300046507 Bacteria 35408
1010 Ga0495606_0001384 3300046507 Bacteria 32777
1011 Ga0495606_0001423 3300046507 Bacteria 32125
1012 Ga0495606_0010914 3300046507 Bacteria 7475
1013 Ga0495606_0017563 3300046507 Bacteria 5402
1014 Ga0495610_0005830 3300046512 Bacteria 8655
1015 Ga0495610_0006853 3300046512 Bacteria 7724
1016 Ga0495610_0012420 3300046512 Bacteria 5129
1017 Ga0495610_0012850 3300046512 Bacteria 5008
1018 Ga0495610_0021163 3300046512 Bacteria 3583
1019 Ga0495610_0028061 3300046512 Bacteria 2982
1020 Ga0495610_0065014 3300046512 Bacteria 1722
1021 Ga0495610_0073017 3300046512 Bacteria 1595
1022 Ga0495616_0000047 3300046513 Bacteria 110592
1023 Ga0495616_0015572 3300046513 Bacteria 4226
1024 Ga0495616_0021705 3300046513 Bacteria 3472
1025 Ga0495616_0029933 3300046513 Bacteria 2867
1026 Ga0495616_0059387 3300046513 Bacteria 1881
1027 Ga0495616_0103027 3300046513 Bacteria 1336
1028 Ga0495620_0000413 3300046515 Bacteria 28516
1029 Ga0495620_0004548 3300046515 Bacteria 7808
1030 Ga0495620_0005447 3300046515 Bacteria 7097
1031 Ga0495620_0008101 3300046515 Bacteria 5656
1032 Ga0495620_0009649 3300046515 Bacteria 5123
1033 Ga0495620_0011860 3300046515 Bacteria 4530
1034 Ga0495620_0012826 3300046515 Bacteria 4310
1035 Ga0495620_0042921 3300046515 Bacteria 1972
1036 Ga0495620_0056293 3300046515 Bacteria 1655
1037 Ga0495630_0132113 3300046517 Bacteria 1896
1038 Ga0495631_0001326 3300046518 Bacteria 15169
1039 Ga0495631_0002466 3300046518 Bacteria 10426
1040 Ga0495631_0003442 3300046518 Bacteria 8667
1041 Ga0495631_0086210 3300046518 Bacteria 1352
1042 Ga0495631_0149972 3300046518 Bacteria 1000
1043 Ga0495632_0000080 3300046519 Bacteria 99523
1044 Ga0495632_0001147 3300046519 Bacteria 22609
1045 Ga0495632_0002357 3300046519 Bacteria 14464
1046 Ga0495632_0002444 3300046519 Bacteria 14138
1047 Ga0495632_0004992 3300046519 Bacteria 8892
1048 Ga0495632_0010987 3300046519 Bacteria 5310
1049 Ga0495632_0109542 3300046519 Bacteria 1297
1050 Ga0495632_0146866 3300046519 Bacteria 1091
1051 Ga0495637_0001830 3300046520 Bacteria 12172
1052 Ga0495637_0002110 3300046520 Bacteria 11184
1053 Ga0495637_0002741 3300046520 Bacteria 9595
1054 Ga0495637_0004862 3300046520 Bacteria 6910
1055 Ga0495637_0005624 3300046520 Bacteria 6364
1056 Ga0495637_0014903 3300046520 Bacteria 3660
1057 Ga0495637_0020114 3300046520 Bacteria 3075
1058 Ga0495637_0036621 3300046520 Bacteria 2135
1059 Ga0495637_0109737 3300046520 Bacteria 1070
1060 Ga0495643_0000717 3300046522 Bacteria 37887
1061 Ga0495643_0009384 3300046522 Bacteria 6083
1062 Ga0495643_0011560 3300046522 Bacteria 5369
1063 Ga0495643_0039912 3300046522 Bacteria 2565
1064 Ga0495644_0002686 3300046523 Bacteria 7075
1065 Ga0495648_0000424 3300046524 Bacteria 46425
1066 Ga0495648_0004682 3300046524 Bacteria 11605
1067 Ga0495648_0014046 3300046524 Bacteria 5888
1068 Ga0495648_0017048 3300046524 Bacteria 5211
1069 Ga0495648_0022776 3300046524 Bacteria 4303
1070 Ga0495648_0028289 3300046524 Bacteria 3736
1071 Ga0495648_0036009 3300046524 Bacteria 3200
1072 Ga0495648_0053069 3300046524 Bacteria 2458
1073 Ga0495648_0146670 3300046524 Bacteria 1235
1074 Ga0495666_0017719 3300046526 Bacteria 3545
1075 Ga0495642_0001528 3300046528 Bacteria 10274
1076 Ga0495642_0005253 3300046528 Bacteria 4979
1077 Ga0495654_0000875 3300046530 Bacteria 22618
1078 Ga0495654_0002722 3300046530 Bacteria 11159
1079 Ga0495654_0003407 3300046530 Bacteria 9760
1080 Ga0495654_0117720 3300046530 Bacteria 1205
1081 Ga0495654_0134545 3300046530 Bacteria 1106
1082 Ga0495586_0005021 3300046535 Bacteria 7081
1083 Ga0495587_0059558 3300046536 Bacteria 2240
1084 Ga0495587_0101663 3300046536 Bacteria 1656
1085 Ga0495609_0000011 3300046538 Bacteria 334377
1086 Ga0495609_0000349 3300046538 Bacteria 40285
1087 Ga0495609_0000784 3300046538 Bacteria 23757
1088 Ga0495609_0003919 3300046538 Bacteria 8345
1089 Ga0495609_0010058 3300046538 Bacteria 4552
1090 Ga0495609_0014027 3300046538 Bacteria 3773
1091 Ga0495609_0047626 3300046538 Bacteria 1918
1092 Ga0495597_0000221 3300046542 Bacteria 52360
1093 Ga0495597_0002355 3300046542 Bacteria 12161
1094 Ga0495597_0002438 3300046542 Bacteria 11798
1095 Ga0495597_0102779 3300046542 Bacteria 1203
1096 Ga0495597_0136610 3300046542 Bacteria 1013
1097 Ga0495597_0152939 3300046542 Bacteria 945
1098 Ga0495622_0000853 3300046557 Bacteria 16756
1099 Ga0495622_0001397 3300046557 Bacteria 12265
1100 Ga0495622_0037039 3300046557 Bacteria 2272
1101 Ga0495622_0110250 3300046557 Bacteria 1260
1102 Ga0495633_0000287 3300046558 Bacteria 58020
1103 Ga0495633_0000438 3300046558 Bacteria 43059
1104 Ga0495656_0040293 3300046615 Bacteria 1946
1105 Ga0495668_0008912 3300046616 Bacteria 6205
1106 Ga0495668_0022194 3300046616 Bacteria 3629
1107 Ga0495668_0145650 3300046616 Bacteria 1296
1108 Ga0495634_0005385 3300046642 Bacteria 9859
1109 Ga0495611_0000001 3300046648 Bacteria 2628469
1110 Ga0495611_0000955 3300046648 Bacteria 15433
1111 Ga0495611_0001725 3300046648 Bacteria 10580
1112 Ga0495611_0001973 3300046648 Bacteria 9731
1113 Ga0495611_0002094 3300046648 Bacteria 9372
1114 Ga0495625_0000001 3300046660 Bacteria 1641829
1115 Ga0495625_0000187 3300046660 Bacteria 97797
1116 Ga0495625_0007564 3300046660 Bacteria 9432
1117 Ga0495625_0007957 3300046660 Bacteria 9109
1118 Ga0495625_0008531 3300046660 Bacteria 8730
1119 Ga0495625_0018950 3300046660 Bacteria 5355
1120 Ga0495625_0026761 3300046660 Bacteria 4351
1121 Ga0495625_0222071 3300046660 Bacteria 1237
1122 Ga0495659_0001232 3300046664 Bacteria 8857
1123 Ga0495661_0000051 3300046665 Bacteria 140353
1124 Ga0495661_0000477 3300046665 Bacteria 42410
1125 Ga0495661_0000596 3300046665 Bacteria 37123
1126 Ga0495661_0001003 3300046665 Bacteria 25378
1127 Ga0495661_0001772 3300046665 Bacteria 17368
1128 Ga0495661_0029543 3300046665 Bacteria 3496
1129 Ga0495661_0038148 3300046665 Bacteria 2995
1130 Ga0495588_0107533 3300046674 Bacteria 1468
1131 Ga0495623_0007248 3300046679 Bacteria 7197
1132 Ga0495646_0019993 3300046680 Bacteria 4233
1133 Ga0495658_0222963 3300046683 Bacteria 1181
1134 Ga0495669_0034276 3300046684 Bacteria 2237
1135 Ga0495670_0002102 3300046691 Bacteria 9827
1136 Ga0495670_0002797 3300046691 Bacteria 8632
1137 Ga0495670_0011627 3300046691 Bacteria 4331
1138 Ga0495670_0019046 3300046691 Bacteria 3382
1139 Ga0495670_0019878 3300046691 Bacteria 3309
1140 Ga0495671_0000552 3300046692 Bacteria 28021
1141 Ga0495671_0001180 3300046692 Bacteria 17885
1142 Ga0495671_0007665 3300046692 Bacteria 6129
1143 Ga0495671_0016360 3300046692 Bacteria 3961
1144 Ga0495671_0022227 3300046692 Bacteria 3324
1145 Ga0495671_0027804 3300046692 Bacteria 2917
1146 Ga0495671_0158987 3300046692 Bacteria 1099
1147 Ga0495649_0000165 3300046694 Bacteria 57643
1148 Ga0495649_0006953 3300046694 Bacteria 6989
1149 Ga0495649_0008252 3300046694 Bacteria 6275
1150 Ga0495649_0008478 3300046694 Bacteria 6182
1151 Ga0495649_0016610 3300046694 Bacteria 4170
1152 Ga0495649_0024380 3300046694 Bacteria 3373
1153 Ga0495649_0046070 3300046694 Bacteria 2375
1154 Ga0495649_0055392 3300046694 Bacteria 2142
1155 Ga0495589_0000272 3300046794 Bacteria 42126
1156 Ga0495589_0002065 3300046794 Bacteria 11371
1157 Ga0495589_0002775 3300046794 Bacteria 9691
1158 Ga0495589_0004145 3300046794 Bacteria 7755
1159 Ga0495589_0009775 3300046794 Bacteria 4980
1160 Ga0495600_0296731 3300046809 Bacteria 1020
1161 Ga0495660_0000746 3300046810 Bacteria 24565
1162 Ga0495660_0000888 3300046810 Bacteria 22116
1163 Ga0495660_0001273 3300046810 Bacteria 17539
1164 Ga0495660_0001683 3300046810 Bacteria 14811
1165 Ga0495660_0007204 3300046810 Bacteria 6548
1166 Ga0495660_0013190 3300046810 Bacteria 4788
1167 Ga0495660_0014399 3300046810 Bacteria 4577
1168 Ga0495660_0033838 3300046810 Bacteria 2862
1169 Ga0495660_0129028 3300046810 Bacteria 1270
1170 Ga0495660_0172199 3300046810 Bacteria 1053
1171 Ga0495660_0186559 3300046810 Bacteria 999
1172 Ga0495604_0008431 3300047317 Bacteria 8139
1173 Ga0495636_0016827 3300047318 Bacteria 2924
1174 Ga0495636_0163909 3300047318 Bacteria 1002
1175 Ga0495674_0348451 3300047319 Bacteria 1203
1176 Ga0495672_0000009 3300047320 Bacteria 557755
1177 Ga0495672_0007676 3300047320 Bacteria 8085
1178 Ga0495672_0008500 3300047320 Bacteria 7560
1179 Ga0495672_0009606 3300047320 Bacteria 6984
1180 Ga0495672_0015130 3300047320 Bacteria 5250
1181 Ga0495672_0020631 3300047320 Bacteria 4312
1182 Ga0495672_0035405 3300047320 Bacteria 3074
1183 Ga0495672_0141233 3300047320 Bacteria 1258
1184 Ga0495672_0227721 3300047320 Bacteria 916
1185 Ga0495676_0000508 3300047321 Bacteria 31862
1186 Ga0495676_0002177 3300047321 Bacteria 17357
1187 Ga0495680_0014817 3300047322 Bacteria 6740
1188 Ga0495680_0127637 3300047322 Bacteria 1871
1189 Ga0495683_0000053 3300047323 Bacteria 121769
1190 Ga0495683_0000129 3300047323 Bacteria 75590
1191 Ga0495683_0002438 3300047323 Bacteria 11243
1192 Ga0495683_0003047 3300047323 Bacteria 9849
1193 Ga0495683_0003636 3300047323 Bacteria 8943
1194 Ga0495687_004396 3300047443 Bacteria 9556
1195 Ga0495687_010164 3300047443 Bacteria 5181
1196 Ga0495675_0012350 3300047444 Bacteria 5375
1197 Ga0495679_000001 3300047446 Bacteria 1607568
1198 Ga0495679_000075 3300047446 Bacteria 95844
1199 Ga0495679_000381 3300047446 Bacteria 34012
1200 Ga0495673_0000001 3300047469 Bacteria 1630730
1201 Ga0495673_0000071 3300047469 Bacteria 217117
1202 Ga0495673_0000099 3300047469 Bacteria 179978
1203 Ga0495673_0001468 3300047469 Bacteria 18689
1204 Ga0495673_0003834 3300047469 Bacteria 9708
1205 Ga0495673_0004508 3300047469 Bacteria 8694
1206 Ga0495673_0005014 3300047469 Bacteria 8123
1207 Ga0495673_0005967 3300047469 Bacteria 7250
1208 Ga0495673_0014795 3300047469 Bacteria 4045
1209 Ga0495673_0022827 3300047469 Bacteria 3058
1210 Ga0495673_0068555 3300047469 Bacteria 1498
1211 Ga0495673_0116260 3300047469 Bacteria 1063
1212 Ga0495681_0002160 3300047470 Bacteria 14254
1213 Ga0495681_0017030 3300047470 Bacteria 4049
1214 Ga0495681_0026095 3300047470 Bacteria 3049
1215 Ga0495681_0026592 3300047470 Bacteria 3007
1216 Ga0495681_0103111 3300047470 Bacteria 1244
1217 Ga0495684_0015811 3300047471 Bacteria 5808
1218 Ga0495686_0000255 3300047472 Bacteria 95600
1219 Ga0495686_0003112 3300047472 Bacteria 14658
1220 Ga0495686_0013966 3300047472 Bacteria 5552
1221 Ga0495686_0128482 3300047472 Bacteria 1504
1222 Ga0495686_0246428 3300047472 Bacteria 1005
1223 Ga0495593_0029323 3300047673 Bacteria 3017
1224 Ga0495626_0000250 3300048091 Bacteria 62295
1225 Ga0495626_0003380 3300048091 Bacteria 10269
1226 Ga0495626_0005631 3300048091 Bacteria 7260
1227 Ga0495626_0031579 3300048091 Bacteria 2547
1228 Ga0495626_0065118 3300048091 Bacteria 1650
1229 Ga0495626_0079876 3300048091 Bacteria 1454
1230 Ga0496100_0097587 3300048903 Bacteria 2018
1231 Ga0496100_0269206 3300048903 Bacteria 1266
1232 Ga0496101_0042073 3300048904 Bacteria 3261
1233 Ga0496102_0006510 3300048905 Bacteria 9963
1234 Ga0496102_0052861 3300048905 Bacteria 3702
1235 Ga0496103_0007448 3300048906 Bacteria 6523
1236 Ga0496103_0196798 3300048906 Bacteria 1296
1237 Ga0496105_0000498 3300048908 Bacteria 25929
1238 Ga0496105_0136287 3300048908 Bacteria 2022
1239 Ga0496106_0000153 3300048909 Bacteria 51161
1240 Ga0496106_0019257 3300048909 Bacteria 5062
1241 Ga0496108_0058937 3300048911 Bacteria 3229
1242 Ga0496109_0054813 3300048912 Bacteria 3636
1243 Ga0496115_0438437 3300048918 Bacteria 1056
1244 Ga0496116_0000005 3300048919 Bacteria 827804
1245 Ga0496116_0000420 3300048919 Bacteria 59988
1246 Ga0496116_0000426 3300048919 Bacteria 59252
1247 Ga0496116_0017981 3300048919 Bacteria 5465
1248 Ga0496116_0052335 3300048919 Bacteria 2706
1249 Ga0496117_0001337 3300048920 Bacteria 36234
1250 Ga0496117_0014648 3300048920 Bacteria 6742
1251 Ga0496117_0038224 3300048920 Bacteria 3563
1252 Ga0496118_0000749 3300048921 Bacteria 52548
1253 Ga0496118_0003213 3300048921 Bacteria 20858
1254 Ga0496118_0003350 3300048921 Bacteria 20288
1255 Ga0496118_0004127 3300048921 Bacteria 17575
1256 Ga0496118_0006111 3300048921 Bacteria 13384
1257 Ga0496118_0039751 3300048921 Bacteria 3750
1258 Ga0496118_0045640 3300048921 Bacteria 3417
1259 Ga0496118_0204389 3300048921 Bacteria 1166
1260 Ga0496119_0000943 3300048922 Bacteria 37460
1261 Ga0496119_0010600 3300048922 Bacteria 7731
1262 Ga0496119_0027685 3300048922 Bacteria 3889
1263 Ga0496119_0036096 3300048922 Bacteria 3230
1264 Ga0496119_0049647 3300048922 Bacteria 2592
1265 Ga0496120_0000081 3300048923 Bacteria 158294
1266 Ga0496120_0002521 3300048923 Bacteria 18302
1267 Ga0496120_0002840 3300048923 Bacteria 16687
1268 Ga0496121_0000126 3300048924 Bacteria 168873
1269 Ga0496121_0000210 3300048924 Bacteria 128287
1270 Ga0496121_0002035 3300048924 Bacteria 31995
1271 Ga0496121_0003354 3300048924 Bacteria 22975
1272 Ga0496121_0003580 3300048924 Bacteria 21935
1273 Ga0496121_0006074 3300048924 Bacteria 15198
1274 Ga0496121_0007739 3300048924 Bacteria 12880
1275 Ga0496121_0021277 3300048924 Bacteria 6362
1276 Ga0496121_0042326 3300048924 Bacteria 3964
1277 Ga0496121_0056799 3300048924 Bacteria 3248
1278 Ga0496121_0207584 3300048924 Bacteria 1390
1279 Ga0496122_0000003 3300048925 Bacteria 645810
1280 Ga0496122_0004101 3300048925 Bacteria 18456
1281 Ga0496122_0010966 3300048925 Bacteria 9262
1282 Ga0496122_0015351 3300048925 Bacteria 7326
1283 Ga0496122_0019389 3300048925 Bacteria 6216
1284 Ga0496122_0026085 3300048925 Bacteria 5054
1285 Ga0496122_0026167 3300048925 Bacteria 5041
1286 Ga0496122_0043240 3300048925 Bacteria 3532
1287 Ga0496122_0148532 3300048925 Bacteria 1451
1288 Ga0496122_0163767 3300048925 Bacteria 1352
1289 Ga0496123_0000012 3300048926 Bacteria 458760
1290 Ga0496123_0001037 3300048926 Bacteria 42105
1291 Ga0496123_0002927 3300048926 Bacteria 19981
1292 Ga0496123_0003252 3300048926 Bacteria 18456
1293 Ga0496123_0006129 3300048926 Bacteria 11789
1294 Ga0496123_0008715 3300048926 Bacteria 9259
1295 Ga0496123_0047090 3300048926 Bacteria 2917
1296 Ga0496124_0000382 3300048927 Bacteria 80986
1297 Ga0496124_0001085 3300048927 Bacteria 42903
1298 Ga0496124_0007002 3300048927 Bacteria 12084
1299 Ga0496124_0011459 3300048927 Bacteria 8863
1300 Ga0496124_0034709 3300048927 Bacteria 4421
1301 Ga0496124_0044392 3300048927 Bacteria 3814
1302 Ga0496124_0061908 3300048927 Bacteria 3134
1303 Ga0496124_0111270 3300048927 Bacteria 2203
1304 Ga0496124_0153205 3300048927 Bacteria 1805
1305 Ga0496125_0003846 3300048928 Bacteria 17813
1306 Ga0496125_0005039 3300048928 Bacteria 14904
1307 Ga0496125_0111055 3300048928 Bacteria 1985
1308 Ga0496125_0135733 3300048928 Bacteria 1721
1309 Ga0496126_0013672 3300048929 Bacteria 8240
1310 Ga0496126_0025112 3300048929 Bacteria 5740
1311 Ga0496126_0210905 3300048929 Bacteria 1635
1312 Ga0496126_0256171 3300048929 Bacteria 1457
1313 Ga0495678_000207 3300049459 Bacteria 68441
1314 Ga0495678_000362 3300049459 Bacteria 46331
1315 Ga0495678_000688 3300049459 Bacteria 31040
1316 Ga0495678_003571 3300049459 Bacteria 9521
1317 Ga0495678_009139 3300049459 Bacteria 4936
1318 Ga0495682_0000268 3300049460 Bacteria 41058
1319 Ga0495682_0001604 3300049460 Bacteria 11665
1320 Ga0495682_0002356 3300049460 Bacteria 8981
1321 Ga0495682_0007117 3300049460 Bacteria 4472
1322 Ga0501031_0018035 3300049568 Bacteria 4591
1323 Ga0501031_0025351 3300049568 Bacteria 3868
1324 Ga0501031_0031753 3300049568 Bacteria 3445
1325 Ga0501032_0002909 3300049569 Bacteria 13306
1326 Ga0501032_0035250 3300049569 Bacteria 3422
1327 Ga0501032_0077868 3300049569 Bacteria 2207
1328 Ga0501032_0198587 3300049569 Bacteria 1309
1329 Ga0501033_0087350 3300049570 Bacteria 2282
1330 Ga0501034_0002351 3300049571 Bacteria 23045
1331 Ga0501034_0021040 3300049571 Bacteria 6657
1332 Ga0501034_0081004 3300049571 Bacteria 3249
1333 Ga0501034_0242331 3300049571 Bacteria 1749
1334 Ga0501036_0006637 3300049572 Bacteria 9404
1335 Ga0501036_0007248 3300049572 Bacteria 9030
1336 Ga0501036_0023358 3300049572 Bacteria 5208
1337 Ga0501037_0000336 3300049573 Bacteria 39761
1338 Ga0501037_0000890 3300049573 Bacteria 22295
1339 Ga0501037_0009363 3300049573 Bacteria 7190
1340 Ga0501037_0026716 3300049573 Bacteria 4266
1341 Ga0501037_0067848 3300049573 Bacteria 2597
1342 Ga0501037_0100311 3300049573 Bacteria 2090
1343 Ga0501038_0000613 3300049574 Bacteria 31786
1344 Ga0501038_0000890 3300049574 Bacteria 26458
1345 Ga0501038_0004044 3300049574 Bacteria 13629
1346 Ga0501038_0026144 3300049574 Bacteria 5200
1347 Ga0501038_0038270 3300049574 Bacteria 4201
1348 Ga0501038_0097095 3300049574 Bacteria 2458
1349 Ga0501039_0001459 3300049575 Bacteria 17382
1350 Ga0501039_0009292 3300049575 Bacteria 7487
1351 Ga0501039_0087227 3300049575 Bacteria 2431
1352 Ga0501040_0008402 3300049576 Bacteria 6708
1353 Ga0501040_0009285 3300049576 Bacteria 6406
1354 Ga0501040_0048208 3300049576 Bacteria 2911
1355 Ga0501040_0252368 3300049576 Bacteria 1258
1356 Ga0501041_0022214 3300049577 Bacteria 3798
1357 Ga0501041_0066644 3300049577 Bacteria 2206
1358 Ga0501042_0006811 3300049578 Bacteria 7451
1359 Ga0501042_0012620 3300049578 Bacteria 5730
1360 Ga0501042_0022927 3300049578 Bacteria 4362
1361 Ga0501042_0068854 3300049578 Bacteria 2531
1362 Ga0501042_0076687 3300049578 Bacteria 2393
1363 Ga0501042_0132794 3300049578 Bacteria 1794
1364 Ga0501043_0001577 3300049579 Bacteria 19829
1365 Ga0501043_0005458 3300049579 Bacteria 10279
1366 Ga0501043_0027068 3300049579 Bacteria 4501
1367 Ga0501046_0002547 3300049580 Bacteria 17048
1368 Ga0501046_0015065 3300049580 Bacteria 6502
1369 Ga0501046_0041807 3300049580 Bacteria 3656
1370 Ga0501046_0226372 3300049580 Bacteria 1383
1371 Ga0501047_0013033 3300049581 Bacteria 7875
1372 Ga0501047_0079878 3300049581 Bacteria 3144
1373 Ga0501047_0092112 3300049581 Bacteria 2909
1374 Ga0501048_0001575 3300049582 Bacteria 17326
1375 Ga0501048_0049744 3300049582 Bacteria 2987
1376 Ga0501048_0435151 3300049582 Bacteria 939
1377 Ga0501068_0000860 3300049584 Bacteria 15814
1378 Ga0501069_0019390 3300049585 Bacteria 3678
1379 Ga0501069_0030778 3300049585 Bacteria 2949
1380 Ga0501069_0033248 3300049585 Bacteria 2840
1381 Ga0501070_0000970 3300049586 Bacteria 25738
1382 Ga0501070_0005927 3300049586 Bacteria 10421
1383 Ga0501070_0007212 3300049586 Bacteria 9435
1384 Ga0501070_0026151 3300049586 Bacteria 4898
1385 Ga0501070_0057879 3300049586 Bacteria 3213
1386 Ga0501070_0059757 3300049586 Bacteria 3160
1387 Ga0501070_0306057 3300049586 Bacteria 1294
1388 Ga0501070_0512149 3300049586 Bacteria 963
1389 Ga0501071_0006866 3300049587 Bacteria 7419
1390 Ga0501071_0008275 3300049587 Bacteria 6868
1391 Ga0501071_0028510 3300049587 Bacteria 3936
1392 Ga0501071_0046888 3300049587 Bacteria 3104
1393 Ga0501071_0199893 3300049587 Bacteria 1501
1394 Ga0501072_0001665 3300049588 Bacteria 16559
1395 Ga0501072_0050306 3300049588 Bacteria 3281
1396 Ga0501072_0081218 3300049588 Bacteria 2569
1397 Ga0501072_0222534 3300049588 Bacteria 1504
1398 Ga0501073_0001296 3300049589 Bacteria 18376
1399 Ga0501073_0005417 3300049589 Bacteria 9556
1400 Ga0501074_0003467 3300049590 Bacteria 11194
1401 Ga0501074_0004606 3300049590 Bacteria 9872
1402 Ga0501074_0046643 3300049590 Bacteria 3133
1403 Ga0501074_0051278 3300049590 Bacteria 2978
1404 Ga0501075_0005794 3300049591 Bacteria 8453
1405 Ga0501076_0004278 3300049592 Bacteria 10114
1406 Ga0501076_0017297 3300049592 Bacteria 5477
1407 Ga0501076_0080183 3300049592 Bacteria 2619
1408 Ga0501076_0087147 3300049592 Bacteria 2510
1409 Ga0501076_0096624 3300049592 Bacteria 2380
1410 Ga0501076_0184567 3300049592 Bacteria 1701
1411 Ga0501076_0263768 3300049592 Bacteria 1410
1412 Ga0501077_0004143 3300049593 Bacteria 8765
1413 Ga0501077_0005084 3300049593 Bacteria 7983
1414 Ga0501077_0015808 3300049593 Bacteria 4753
1415 Ga0501077_0018766 3300049593 Bacteria 4376
1416 Ga0501079_0005616 3300049741 Bacteria 9360
1417 Ga0501079_0038157 3300049741 Bacteria 3705
1418 Ga0501079_0066439 3300049741 Bacteria 2782
1419 Ga0501079_0102905 3300049741 Bacteria 2215
1420 Ga0501080_0009700 3300049742 Bacteria 8791
1421 Ga0501080_0037690 3300049742 Bacteria 4514
1422 Ga0501080_0051433 3300049742 Bacteria 3833
1423 Ga0501081_0000359 3300049743 Bacteria 24723
1424 Ga0501081_0006393 3300049743 Bacteria 7645
1425 Ga0501081_0018913 3300049743 Bacteria 4578
1426 Ga0501081_0021470 3300049743 Bacteria 4309
1427 Ga0501083_0069785 3300049744 Bacteria 2338
1428 Ga0501035_0002833 3300049822 Bacteria 16759
1429 Ga0501035_0017003 3300049822 Bacteria 6703
1430 Ga0501035_0025839 3300049822 Bacteria 5381
1431 Ga0501035_0030682 3300049822 Bacteria 4900
1432 Ga0501035_0047129 3300049822 Bacteria 3871
1433 Ga0501035_0049018 3300049822 Bacteria 3786
1434 Ga0501035_0100512 3300049822 Bacteria 2539
1435 Ga0501044_0000233 3300049823 Bacteria 69824
1436 Ga0501044_0007876 3300049823 Bacteria 11711
1437 Ga0501044_0027700 3300049823 Bacteria 5982
1438 Ga0501044_0178374 3300049823 Bacteria 2092
1439 Ga0501044_0398670 3300049823 Bacteria 1289
1440 Ga0501045_0015215 3300049824 Bacteria 5460
1441 Ga0501045_0216215 3300049824 Bacteria 1427
1442 Ga0501226_000016 3300049853 Bacteria 154924
1443 nmdc:mga05p37_11639_c1 3300050507 Bacteria 10485
1444 nmdc:mga05p37_50302_c1 3300050507 Bacteria 5125
1445 nmdc:mga05p37_683579_c1 3300050507 Bacteria 1143
1446 nmdc:mga05p37_704269_c1 3300050507 Bacteria 1121
1447 nmdc:mga09592_121791_c1 3300050508 Bacteria 2241
1448 nmdc:mga09592_1590_c1 3300050508 Bacteria 18289
1449 nmdc:mga09592_28889_c1 3300050508 Bacteria 4611
1450 nmdc:mga09592_42861_c1 3300050508 Bacteria 3807
1451 nmdc:mga0qj67_256366_c1 3300050509 Bacteria 1419
1452 nmdc:mga0qj67_27615_c1 3300050509 Bacteria 4401
1453 nmdc:mga0qj67_35491_c1 3300050509 Bacteria 3899
1454 nmdc:mga06r32_12939_c1 3300050510 Bacteria 7544
1455 nmdc:mga06r32_21093_c1 3300050510 Bacteria 6011
1456 nmdc:mga06r32_2483_c1 3300050510 Bacteria 16504
1457 nmdc:mga06r32_29_c1 3300050510 Bacteria 85620
1458 nmdc:mga06r32_52865_c1 3300050510 Bacteria 3891
1459 nmdc:mga06r32_73794_c1 3300050510 Bacteria 3306
1460 nmdc:mga08y16_17178_c1 3300050511 Bacteria 7616
1461 nmdc:mga08y16_223682_c1 3300050511 Bacteria 1948
1462 nmdc:mga08y16_228495_c1 3300050511 Bacteria 1925
1463 nmdc:mga08y16_34011_c1 3300050511 Bacteria 5354
1464 nmdc:mga08y16_56030_c1 3300050511 Bacteria 4120
1465 nmdc:mga0n895_387277_c1 3300050512 Bacteria 1414
1466 nmdc:mga08x19_27949_c1 3300050514 Bacteria 3530
1467 Ga0500643_000002 3300053087 Bacteria 1277657
1468 Ga0500646_0009536 3300053090 Bacteria 2485
1469 Ga0500651_0010486 3300053093 Bacteria 5557
1470 Ga0500641_0004188 3300053096 Bacteria 5090
1471 Ga0500555_001433 3300053103 Bacteria 7310
1472 Ga0500573_0188865 3300053140 Bacteria 1102
1473 Ga0500645_013165 3300053730 Bacteria 2660
1474 Ga0501084_0007065 3300054114 Bacteria 9251
1475 Ga0501084_0021309 3300054114 Bacteria 5402
1476 Ga0501082_0078438 3300060353 Bacteria 2849
1477 Ga0501082_0148097 3300060353 Bacteria 2038
1478 Ga0501082_0323856 3300060353 Bacteria 1343
1479 Ga0501082_0368765 3300060353 Bacteria 1252
1480 Ga0530510_0000025 3300061734 Bacteria 67946
1481 Ga0530510_0198611 3300061734 Bacteria 1489
1482 Ga0530510_0216908 3300061734 Bacteria 1422
1483 2506584749 2506520008 Bacteria 5443009
1484 2508853399 2508501071 Bacteria 5454741
1485 2511257597 2511231004 Bacteria 6669789
1486 2511263655 2511231006 Bacteria 6794709
1487 2511270258 2511231007 Bacteria 6306603
1488 2511276448 2511231008 Bacteria 6624100
1489 2511291008 2511231010 Bacteria 6373152
1490 2511294262 2511231011 Bacteria 6149768
1491 2511302443 2511231012 Bacteria 6738011
1492 2511314040 2511231014 Bacteria 6462302
1493 2511320000 2511231015 Bacteria 6598026
1494 2511324788 2511231016 Bacteria 6704427
1495 2511330333 2511231017 Bacteria 6503007
1496 2511338012 2511231018 Bacteria 6436256
1497 2511342823 2511231019 Bacteria 6520662
1498 2511348792 2511231020 Bacteria 6115223
1499 2511354868 2511231021 Bacteria 7302637
1500 2511365893 2511231022 Bacteria 6719296
1501 2511369961 2511231023 Bacteria 6808468
1502 2511373241 2511231024 Bacteria 5835885
1503 2511380098 2511231025 Bacteria 5324661
1504 2511413258 2511231031 Bacteria 6558529
1505 2511434916 2511231035 Bacteria 5341610
1506 2511823903 2511231156 Bacteria 6845832
1507 2512326837 2512047018 Bacteria 6663241
1508 2538425420 2537561728 Bacteria 5149301
1509 2547697344 2547132181 Bacteria 4945084
1510 2548647709 2547132416 Bacteria 4633861
1511 2555259895 2554235234 Bacteria 5762085
1512 2555669063 2554235341 Bacteria 6867980
1513 2562463631 2561511199 Bacteria 5155034
1514 2583791469 2582580891 Bacteria 6800976
1515 2585827701 2585427591 Bacteria 5482980
1516 2585834813 2585427592 Bacteria 5370892
1517 2595445752 2593339238 Bacteria 4182970
1518 2595449395 2593339239 Bacteria 4124669
1519 2597857203 2597489887 Bacteria 6666321
1520 2597864875 2597489888 Bacteria 6179543
1521 2597870751 2597489889 Bacteria 6297495
1522 2599328646 2599185155 Bacteria 5827168
1523 2599358045 2599185160 Bacteria 6844013
1524 2599361803 2599185161 Bacteria 6960462
1525 2599368124 2599185162 Bacteria 6957254
1526 2599374913 2599185163 Bacteria 6995158
1527 2599383210 2599185164 Bacteria 6841688
1528 2599389407 2599185165 Bacteria 6843250
1529 2599393771 2599185166 Bacteria 6959206
1530 2599398057 2599185167 Bacteria 6353609
1531 2599405538 2599185168 Bacteria 6997636
1532 2599452514 2599185179 Bacteria 6611171
1533 2599464860 2599185181 Bacteria 6844519
1534 2599468412 2599185182 Bacteria 6883168
1535 2599484225 2599185185 Bacteria 6652270
1536 2599493884 2599185186 Bacteria 6831633
1537 2599503152 2599185188 Bacteria 6164180
1538 2599507060 2599185189 Bacteria 5862825
1539 2599516188 2599185190 Bacteria 6285678
1540 2599518382 2599185191 Bacteria 6297582
1541 2599614830 2599185212 Bacteria 6765997
1542 2599769713 2599185248 Bacteria 6696816
1543 2599801875 2599185257 Bacteria 6492581
1544 2599878216 2599185288 Bacteria 6666191
1545 2599889033 2599185289 Bacteria 6778765
1546 2599895514 2599185290 Bacteria 6289611
1547 2599901605 2599185291 Bacteria 6775623
1548 2599933658 2599185300 Bacteria 6062622
1549 2599942829 2599185302 Bacteria 5954930
1550 2599947409 2599185303 Bacteria 6512725
1551 2599953578 2599185304 Bacteria 5951361
1552 2599959264 2599185305 Bacteria 6748700
1553 2599964532 2599185306 Bacteria 6637356
1554 2599972107 2599185307 Bacteria 6194719
1555 2599975595 2599185308 Bacteria 6621546
1556 2599982163 2599185309 Bacteria 5969593
1557 2599988966 2599185310 Bacteria 6014457
1558 2599994711 2599185311 Bacteria 6354990
1559 2599999571 2599185312 Bacteria 5912071
1560 2600007312 2599185313 Bacteria 6658188
1561 2600009768 2599185314 Bacteria 6621749
1562 2600020513 2599185315 Bacteria 6771107
1563 2600025236 2599185316 Bacteria 6320029
1564 2600029745 2599185317 Bacteria 6435722
1565 2600037815 2599185318 Bacteria 6961590
1566 2600042008 2599185319 Bacteria 6637840
1567 2600046915 2599185320 Bacteria 5963263
1568 2600055026 2599185321 Bacteria 6764560
1569 2600057774 2599185322 Bacteria 6763055
1570 2600064789 2599185323 Bacteria 6688755
1571 2600071676 2599185324 Bacteria 6590677
1572 2600076039 2599185325 Bacteria 6324919
1573 2600217591 2599185356 Bacteria 6843884
1574 2600359340 2600254930 Bacteria 6431253
1575 2600365442 2600254931 Bacteria 6734225
1576 2600445635 2600254954 Bacteria 5100516
1577 2601524225 2600255254 Bacteria 5281859
1578 2601529379 2600255255 Bacteria 5282785
1579 2601540068 2600255257 Bacteria 5597196
1580 2601616213 2600255280 Bacteria 5292309
1581 2601620935 2600255281 Bacteria 5288753
1582 2601628789 2600255283 Bacteria 6061572
1583 2601644281 2600255287 Bacteria 5210468
1584 2601649332 2600255288 Bacteria 5282738
1585 2601654259 2600255289 Bacteria 5281907
1586 2601659681 2600255290 Bacteria 5282218
1587 2601664103 2600255291 Bacteria 5217298
1588 2601689848 2600255296 Bacteria 5784754
1589 2601697063 2600255298 Bacteria 5215185
1590 2601702109 2600255299 Bacteria 5218662
1591 2601707003 2600255300 Bacteria 5287774
1592 2601712045 2600255301 Bacteria 5280532
1593 2601717520 2600255302 Bacteria 5288235
1594 2601722211 2600255303 Bacteria 5219315
1595 2601727448 2600255304 Bacteria 5283973
1596 2601732487 2600255305 Bacteria 5282329
1597 2601736998 2600255306 Bacteria 5281613
1598 2601741280 2600255307 Bacteria 5439064
1599 2601752466 2600255309 Bacteria 5431045
1600 2601758691 2600255310 Bacteria 5600903
1601 2601764805 2600255311 Bacteria 5598766
1602 2601777759 2600255313 Bacteria 6842543
1603 2601795825 2600255318 Bacteria 6383414
1604 2602010051 2600255389 Bacteria 5275336
1605 2602019307 2600255392 Bacteria 5437392
1606 2603636847 2602042046 Bacteria 5483348
1607 2603645400 2602042047 Bacteria 4697674
1608 2603662266 2602042052 Bacteria 5215873
1609 2603667162 2602042053 Bacteria 5214361
1610 2603699374 2602042066 Bacteria 4423871
1611 2603705403 2602042067 Bacteria 4863713
1612 2603839872 2602042103 Bacteria 5284714
1613 2603844949 2602042104 Bacteria 5281639
1614 2603850047 2602042105 Bacteria 5282303
1615 2603855090 2602042106 Bacteria 5282744
1616 2603867905 2602042109 Bacteria 5152801
1617 2603872670 2602042110 Bacteria 5283285
1618 2603877973 2602042111 Bacteria 5212080
1619 2606049873 2603880178 Bacteria 5283018
1620 2606071534 2603880184 Bacteria 5217896
1621 2606075328 2603880185 Bacteria 6379190
1622 2606128191 2603880199 Bacteria 6377649
1623 2606147534 2603880202 Bacteria 5284684
1624 2606177762 2603880211 Bacteria 5284226
1625 2608381633 2606217733 Bacteria 6360972
1626 2609909621 2609459761 Bacteria 5513740
1627 2621298532 2619619299 Bacteria 6649820
1628 2624479762 2623620443 Bacteria 6427864
1629 2624491417 2623620446 Bacteria 6500345
1630 2637224047 2636415599 Bacteria 5718434
1631 2643842568 2643221565 Bacteria 6216018
1632 2643871578 2643221571 Bacteria 6228673
1633 2643884595 2643221574 Bacteria 2789653
1634 2643952955 2643221589 Bacteria 6250934
1635 2644022717 2643221602 Bacteria 6249926
1636 2644188890 2643221633 Bacteria 6733554
1637 2644284957 2643221650 Bacteria 7029547
1638 2644351436 2643221663 Bacteria 3425771
1639 2644549017 2643221699 Bacteria 5731501
1640 2644553250 2643221699 Bacteria 5731501
1641 2644621633 2643221713 Bacteria 6554480
1642 2650895788 2648501693 Bacteria 5069560
1643 2652548559 2651869719 Bacteria 6047974
1644 2656276958 2654587920 Bacteria 5475511
1645 2671093484 2667528170 Bacteria 6786960
1646 2671098442 2667528171 Bacteria 6900659
1647 2671101086 2667528172 Bacteria 5170840
1648 2671107136 2667528173 Bacteria 5375747
1649 2671128314 2667528176 Bacteria 6724917
1650 2671584508 2671180115 Bacteria 5353919
1651 2671768824 2671180172 Bacteria 6495783
1652 2676405455 2675903046 Bacteria 5451247
1653 2677899632 2675903420 Bacteria 6247433
1654 2678264255 2675903515 Bacteria 6580491
1655 2681996188 2681812866 Bacteria 4552357
1656 2682006476 2681812869 Bacteria 5014465
1657 2686354200 2684622997 Bacteria 4624240
1658 2687578747 2687453129 Bacteria 4387428
1659 2689446132 2687453601 Bacteria 5546041
1660 2707098858 2706794495 Bacteria 4536932
1661 2712468851 2711768156 Bacteria 4471618
1662 2715752533 2713897148 Bacteria 5883533
1663 2715758928 2713897149 Bacteria 6506249
1664 2718633434 2718217725 Bacteria 5758958
1665 2721027940 2718218334 Bacteria 4765486
1666 2723249632 2721755607 Bacteria 5841722
1667 2729148192 2728369097 Bacteria 4333476
1668 2735836488 2734482264 Unclassified 5014763
1669 2738674558 2738541265 Bacteria 6594665
1670 2738752951 2738541282 Bacteria 6593925
1671 2738809710 2738541294 Bacteria 6925949
1672 2738861992 2738541303 Bacteria 6591772
1673 2738897070 2738541309 Bacteria 6926455
1674 2739199792 2738543004 Bacteria 6381073
1675 2739227413 2738543009 Bacteria 4944499
1676 2739259433 2738543015 Bacteria 6750701
1677 2739264367 2738543016 Bacteria 5657564
1678 2739284986 2738543020 Bacteria 5718238
1679 2739290300 2738543021 Bacteria 5718241
1680 2739315789 2738543025 Bacteria 6600348
1681 2743736619 2740892503 Bacteria 6855563
1682 2745004710 2744054620 Bacteria 6551379
1683 2753856950 2751185917 Bacteria 4551186
1684 2765585220 2765235841 Bacteria 6137024
1685 2765590055 2765235842 Bacteria 4799256
1686 2772440047 2772190666 Bacteria 5117644
1687 2774120998 2773857670 Bacteria 6407454
1688 2774137343 2773857673 Bacteria 6513460
1689 2775541273 2775506706 Bacteria 4873073
1690 2777020980 2775507074 Bacteria 5532402
1691 2784263653 2784132063 Bacteria 6262788
1692 2784314070 2784132072 Bacteria 6596533
1693 2791922321 2791354903 Bacteria 4937680
1694 2792311987 2791355010 Bacteria 4864581
1695 2793404707 2791355275 Bacteria 4429597
1696 2794596658 2791355520 Bacteria 5948615
1697 2807179676 2806310673 Bacteria 4801221
1698 2807407436 2806310737 Bacteria 5751088
1699 2807455764 2806310745 Bacteria 5742165
1700 2807455775 2806310745 Bacteria 5742165
1701 2808857651 2808606361 Bacteria 6136259
1702 2808904411 2808606373 Bacteria 4423627
1703 2808924733 2808606376 Bacteria 6248667
1704 2808927746 2808606377 Bacteria 6646337
1705 2808937821 2808606378 Bacteria 6177535
1706 2808939157 2808606379 Bacteria 5022697
1707 2808946835 2808606380 Bacteria 6248705
1708 2808949714 2808606381 Bacteria 6646461
1709 2808960249 2808606382 Bacteria 6841132
1710 2808966135 2808606383 Bacteria 6138645
1711 2808977164 2808606385 Bacteria 6711065
1712 2808992319 2808606388 Bacteria 6706662
1713 2809000975 2808606389 Bacteria 6138126
1714 2809125231 2808606414 Bacteria 4917181
1715 2809216713 2808606445 Bacteria 6057339
1716 2812365694 2811994881 Bacteria 6298475
1717 2813727857 2811995292 Bacteria 5303342
1718 2814695400 2814123068 Bacteria 5687681
1719 2817492320 2816332298 Bacteria 6852809
1720 2819563880 2818991440 Bacteria 4774720
1721 2819656463 2818991456 Bacteria 6123676
1722 2819703522 2818991464 Bacteria 6907494
1723 2821121074 2821118458 Bacteria 4714306
1724 2823375708 2823373977 Bacteria 4779415
1725 2823424115 2823421272 Bacteria 5372474
1726 2825656805 2825651385 Bacteria 6715909
1727 2826583643 2826581358 Bacteria 5963467
1728 2834033736 2834028612 Bacteria 6354979
1729 2842809437 2842805378 Bacteria 5385175
1730 2842818139 2842815866 Bacteria 5947510
1731 2842831129 2842826826 Bacteria 5974129
1732 2842832365 2842832357 Bacteria 5959113
1733 2842842388 2842837860 Bacteria 6066181
1734 2842848654 2842843487 Bacteria 6004777
1735 2842849226 2842849001 Bacteria 5924277
1736 2842854798 2842854478 Bacteria 6143501
1737 2842915603 2842914999 Bacteria 4419378
1738 2842919568 2842918807 Bacteria 4289178
1739 2844428399 2844425489 Bacteria 4854065
1740 2844529159 2844528606 Bacteria 4733806
1741 2844669501 2844665904 Bacteria 6817974
1742 2846540673 2846540461 Bacteria 5471451
1743 2847086590 2847085930 Bacteria 5070450
1744 2847798937 2847797336 Bacteria 5176640
1745 2852107054 2852103415 Bacteria 5193810
1746 2852613482 2852612431 Bacteria 6885235
1747 2852658271 2852657418 Bacteria 6472974
1748 2852668782 2852667396 Bacteria 6885555
1749 2854606083 2854601825 Bacteria 4797592
1750 2855197391 2855195626 Bacteria 4927512
1751 2858468363 2858466076 Bacteria 4722413
1752 2860339622 2860339153 Bacteria 6846989
1753 2860871385 2860867994 Bacteria 5645326
1754 2865016591 2865014394 Bacteria 4764573
1755 2869555482 2869551831 Bacteria 5474685
1756 2871275976 2871272651 Bacteria 5042015
1757 2871285832 2871282230 Bacteria 4917173
1758 2876603243 2876601092 Bacteria 5114497
1759 2878031774 2878029506 Bacteria 6418441
1760 2880234275 2880230671 Bacteria 6140320
1761 2881612562 2881609920 Bacteria 4405319
1762 2884087839 2884086401 Bacteria 5005459
1763 2887632269 2887630918 Bacteria 3239855
1764 2888370139 2888366609 Bacteria 5155009
1765 2891672373 2891670763 Bacteria 4967099
1766 2895516091 2895511927 Bacteria 6802080
1767 2900053002 2900051742 Bacteria 4985156
1768 2904464516 2904463128 Bacteria 4775606
1769 2904476060 2904474040 Bacteria 5504324
1770 2904515361 2904513164 Bacteria 5476410
1771 2904523609 2904518522 Bacteria 6068986
1772 2904554295 2904550169 Bacteria 6221258
1773 2908450760 2908446538 Bacteria 6829095
1774 2908672462 2908669403 Bacteria 5740494
1775 2912967484 2912963787 Bacteria 5646108
1776 2913040732 2913036834 Bacteria 6704877
1777 2916180199 2916178963 Bacteria 5265078
1778 2917072860 2917070673 Bacteria 6868303
1779 2919068248 2919063839 Bacteria 6302690
1780 2919111007 2919108558 Bacteria 5897419
1781 2919152229 2919150387 Bacteria 5500879
1782 2919157317 2919155634 Bacteria 4860545
1783 2919386740 2919385768 Bacteria 5897293
1784 2919405911 2919404418 Bacteria 4232372
1785 2919456715 2919456309 Bacteria 6586567
1786 2919482150 2919481497 Bacteria 6907839
1787 2919491521 2919487758 Bacteria 5929766
1788 2919503826 2919501602 Bacteria 5286340
1789 2919692392 2919688452 Bacteria 4595932
1790 2919701024 2919697872 Bacteria 6553725
1791 2923155636 2923153595 Bacteria 6870622
1792 2923525661 2923519811 Bacteria 6298479
1793 2923587715 2923586266 Bacteria 6565975
1794 2923635923 2923634449 Bacteria 4753480
1795 2926065602 2926063275 Bacteria 5285848
1796 2927144898 2927143783 Bacteria 5504251
1797 2927837579 2927833300 Bacteria 4923934
1798 2929148228 2929144301 Bacteria 6622272
1799 2929193405 2929189879 Bacteria 5930554
1800 2931374359 2931369376 Bacteria 6847892
1801 2931394715 2931390751 Bacteria 6273349
1802 2931400494 2931396565 Bacteria 7251677
1803 2932410093 2932406140 Bacteria 5134491
1804 2935359288 2935353572 Unclassified 6955622
1805 2935625736 2935625433 Bacteria 5042964
1806 2937542412 2937539931 Bacteria 4639830
1807 2937968671 2937967321 Bacteria 5094075
1808 2939570070 2939568625 Bacteria 4542555
1809 2939575390 2939573065 Bacteria 4926053
1810 2939581433 2939577877 Bacteria 5132791
1811 2939604837 2939602548 Bacteria 4950493
1812 2939608652 2939607340 Bacteria 4719256
1813 2939618515 2939617950 Bacteria 4820956
1814 2939639264 2939636861 Bacteria 6297853
1815 2939642911 2939642701 Bacteria 4475280
1816 2939652992 2939651529 Bacteria 5895393
1817 2941474613 2941471342 Bacteria 5018624
1818 2945876809 2945874760 Bacteria 5527237
1819 2945932574 2945928738 Bacteria 6053221
1820 2945952193 2945951305 Bacteria 4918162
1821 2945962481 2945961074 Bacteria 7342064
1822 2946008817 2946006987 Bacteria 6705746
1823 2946031879 2946027586 Bacteria 6049274
1824 2947238707 2947233263 Bacteria 6439278
1825 2952253277 2952252522 Bacteria 4171745
1826 2953997967 2953994433 Bacteria 4303959
1827 2969081081 2969079654 Bacteria 5439582
1828 2969306568 2969304461 Bacteria 6601805
1829 2971822455 2971820967 Bacteria 5823634
1830 2974291745 2974289157 Bacteria 6080362
1831 2974311057 2974310843 Bacteria 4947816
1832 2974439310 2974435778 Bacteria 4876478
1833 2978978667 2978975091 Bacteria 4704313
1834 2984290384 2984286254 Bacteria 6702062
1835 2984497566 2984494565 Bacteria 5000175
1836 2984563539 2984559226 Bacteria 5683096
1837 2984596273 2984595703 Bacteria 5682994
1838 2988729875 2988728565 Bacteria 6124362
1839 2990261514 2990261002 Bacteria 4919493
1840 2998141954 2998139840 Bacteria 6073514
1841 3007253506 3007252601 Bacteria 4559114
1842 3007317721 3007315729 Bacteria 5076637
1843 3007401219 3007395558 Bacteria 6755444
1844 3007421605 3007419365 Bacteria 7026924
1845 3007513375 3007511990 Bacteria 6481491
1846 3007618399 3007614139 Bacteria 6053559
1847 3007619868 3007619802 Bacteria 6411688
1848 3007723774 3007718800 Bacteria 5971527
1849 3007803567 3007803356 Bacteria 5931491
1850 3007860664 3007855910 Bacteria 5637581
1851 3007862819 3007861166 Bacteria 6045338
1852 3007868313 3007866637 Bacteria 5899198
1853 3007876340 3007872151 Bacteria 5268868
1854 637319412 637000220 Bacteria 7074893
1855 640487732 640427133 Bacteria 4567418
1856 640938878 640753048 Bacteria 5495657
1857 8004596202 8004592986 Bacteria 5122074
1858 8015397842 8015394850 Bacteria 5064660
1859 8015689893 8015687852 Bacteria 6613826
1860 8016735036 8016733728 Bacteria 5274317
1861 8018223619 8018221730 Bacteria 4616064
1862 8018409207 8018405270 Bacteria 4978981
1863 8019501481 8019499862 Bacteria 5169538
1864 8019505147 8019504834 Bacteria 4819156
1865 8019775270 8019769354 Bacteria 6924660
1866 8019778312 8019775933 Bacteria 6858656
1867 8029998744 8029995093 Bacteria 5990776
1868 8034965870 8034962539 Bacteria 4884839
1869 8052496157 8052494512 Bacteria 5765634
1870 8054288543 8054285046 Bacteria 6919322
1871 8054349179 8054347763 Bacteria 5901107
1872 8054359886 8054357960 Bacteria 2867777
1873 8054507254 8054503363 Bacteria 6101651
1874 8054846663 8054844752 Bacteria 4450330
1875 8054852004 8054849141 Bacteria 5232694
1876 8054932865 8054929484 Bacteria 5599761
1877 8055092195 8055087960 Bacteria 4784273
1878 8055095521 8055092621 Bacteria 4873875
1879 8055100231 8055097453 Bacteria 4865496
1880 8055696887 8055693939 Bacteria 4772047
1881 8055772998 8055770955 Bacteria 6827675
1882 8055822159 8055817908 Bacteria 6609162
1883 8055879640 8055878733 Bacteria 5907058
1884 8056117871 8056115690 Bacteria 5527654
1885 8056124420 8056120720 Bacteria 5758328
1886 8056127924 8056125926 Bacteria 6228218
1887 8056135644 8056131705 Bacteria 6107031
1888 8056139077 8056137416 Bacteria 6147080
1889 8056147116 8056143049 Bacteria 6307666
1890 8056152945 8056148874 Bacteria 6479865
1891 8056155976 8056155041 Bacteria 6486948
1892 8056161843 8056161164 Bacteria 6106669
1893 8056169047 8056166840 Bacteria 5820959
1894 8056175195 8056172158 Bacteria 6133900
1895 8056183519 8056177738 Bacteria 6748268
1896 8056573002 8056569372 Bacteria 5997322
1897 8057161537 8057160832 Bacteria 3268302
1898 8057306736 8057304971 Bacteria 4649742
1899 8057799429 8057798959 Bacteria 6713499
1900 Ga0439466_0034534
1901 SwRhRL2b_contig_1293351
1902 SwRhRL2b_contig_3043338
1903 JGI24741J21665_1000158
1904 JGI24741J21665_1006265
1905 JGI24741J21665_1010208
1906 JGI24740J21852_10000049
1907 JGI24739J22299_10000804
1908 JGI24738J21930_10001700
1909 JGI25162J39368_1006058
1910 JGI25157J39369_1000298
1911 rootH2_10071538
1912 rootH1_10026054
1913 Ga0006562J51391_1059289
1914 Ga0006562J51391_1067747
1915 Ga0055538_1000093
1916 Ga0055539_1000138
1917 Ga0055539_1002413
1918 Ga0055533_1000142
1919 Ga0055532_1000152
1920 Ga0055525_1000342
1921 Ga0055527_1000266
1922 Ga0055535_1000606
1923 Ga0055535_1000805
1924 Ga0055535_1007291
1925 Ga0055542_1000803
1926 Ga0055529_1000709
1927 Ga0055536_1001963
1928 Ga0055536_1002321
1929 Ga0055536_1004042
1930 Ga0055530_10003078
1931 Ga0055540_1002628
1932 Ga0055531_10000517
1933 Ga0055541_1000091
1934 Ga0065165_1000113
1935 Ga0065714_10065334
1936 Ga0065704_10001088
1937 Ga0065704_10003695
1938 Ga0065704_10017716
1939 Ga0065704_10072724
1940 Ga0065704_10109043
1941 Ga0065712_10070206
1942 Ga0065707_10108505
1943 Ga0070658_10000868
1944 Ga0070658_10017382
1945 Ga0070690_100010523
1946 Ga0070690_100027356
1947 Ga0070690_100122135
1948 Ga0070670_100005617
1949 Ga0070670_100029308
1950 Ga0070670_100234669
1951 Ga0070677_10036026
1952 Ga0070677_10040457
1953 Ga0068869_100004095
1954 Ga0068869_100072327
1955 Ga0070666_10000007
1956 Ga0070666_10000444
1957 Ga0070666_10027083
1958 Ga0070680_100000343
1959 Ga0070680_100037245
1960 Ga0070680_100223442
1961 Ga0070682_100007669
1962 Ga0070682_100026930
1963 Ga0070682_100060755
1964 Ga0070682_100395971
1965 Ga0068868_100053801
1966 Ga0068868_100162531
1967 Ga0068868_100223465
1968 Ga0070660_100043062
1969 Ga0070689_100002094
1970 Ga0070689_100008406
1971 Ga0070691_10001257
1972 Ga0070691_10082888
1973 Ga0070691_10148897
1974 Ga0070687_100002366
1975 Ga0070687_100047574
1976 Ga0070687_100129424
1977 Ga0070661_100000757
1978 Ga0070661_100000961
1979 Ga0070661_100027551
1980 Ga0070692_10000083
1981 Ga0070692_10047225
1982 Ga0070668_100006043
1983 Ga0070668_100042258
1984 Ga0070669_100000904
1985 Ga0070669_100024486
1986 Ga0070669_100029850
1987 Ga0070669_100144693
1988 Ga0070675_100001548
1989 Ga0070675_100064282
1990 Ga0070675_100086732
1991 Ga0070671_100075147
1992 Ga0070674_100330205
1993 Ga0070673_100016400
1994 Ga0070688_100002539
1995 Ga0070659_100003826
1996 Ga0070659_100069288
1997 Ga0070709_10013734
1998 Ga0070714_100002422
1999 Ga0070714_100020495
2000 Ga0070713_100482727
2001 Ga0070701_10004182
2002 Ga0070701_10008464
2003 Ga0070701_10016863
2004 Ga0070701_10061065
2005 Ga0070711_100112475
2006 Ga0070711_100173829
2007 Ga0070700_100050794
2008 Ga0070700_100063045
2009 Ga0070694_100029016
2010 Ga0070694_100051756
2011 Ga0070708_100264494
2012 Ga0070663_100010299
2013 Ga0070663_100037660
2014 Ga0070663_100194549
2015 Ga0070678_100067305
2016 Ga0070678_100276515
2017 Ga0070662_100002124
2018 Ga0070662_100035570
2019 Ga0070681_10002432
2020 Ga0070681_10009557
2021 Ga0070681_10031584
2022 Ga0068867_100071160
2023 Ga0068867_100087873
2024 Ga0068867_100088040
2025 Ga0070685_10156004
2026 Ga0070706_100201738
2027 Ga0070679_100000091
2028 Ga0070679_100000372
2029 Ga0070679_100061780
2030 Ga0070679_100190196
2031 Ga0070684_100002177
2032 Ga0070684_100183733
2033 Ga0070697_100462287
2034 Ga0068853_100008118
2035 Ga0070672_100028669
2036 Ga0070672_100141552
2037 Ga0070686_100001564
2038 Ga0070686_100005969
2039 Ga0070695_100068983
2040 Ga0070696_100001089
2041 Ga0070693_100017566
2042 Ga0070665_100000374
2043 Ga0070665_100000817
2044 Ga0070665_100001536
2045 Ga0070665_100047770
2046 Ga0070665_100110420
2047 Ga0070665_100158536
2048 Ga0070704_100035195
2049 Ga0068855_100010100
2050 Ga0068855_100021239
2051 Ga0068855_100158400
2052 Ga0070664_100000485
2053 Ga0070664_100010951
2054 Ga0070664_100031375
2055 Ga0070664_100260673
2056 Ga0068857_100233172
2057 Ga0068854_100001982
2058 Ga0068854_100019287
2059 Ga0068854_100052940
2060 Ga0068854_100319167
2061 Ga0068856_100002593
2062 Ga0068856_100035944
2063 Ga0068856_100530382
2064 Ga0070702_100211906
2065 Ga0068852_100003098
2066 Ga0068852_100004962
2067 Ga0068852_100067893
2068 Ga0068859_100003963
2069 Ga0068859_100020692
2070 Ga0068859_100125190
2071 Ga0068859_100156214
2072 Ga0068859_100173535
2073 Ga0068864_100005280
2074 Ga0068864_100009820
2075 Ga0068864_100028224
2076 Ga0068866_10048434
2077 Ga0068861_100008096
2078 Ga0068861_100011725
2079 Ga0068861_100078095
2080 Ga0068851_10030188
2081 Ga0068870_10048952
2082 Ga0068870_10133658
2083 Ga0068863_100009131
2084 Ga0068863_100035159
2085 Ga0068863_100037003
2086 Ga0068863_100184196
2087 Ga0068863_100251306
2088 Ga0068858_100036443
2089 Ga0068860_100001649
2090 Ga0068860_100078858
2091 Ga0068860_100083892
2092 Ga0068862_100008766
2093 Ga0068862_100012326
2094 Ga0068862_100047522
2095 Ga0081455_10020754
2096 Ga0070717_10016171
2097 Ga0070717_10218057
2098 Ga0075364_10002873
2099 Ga0075364_10023125
2100 Ga0075432_10094399
2101 Ga0070715_10031475
2102 Ga0070716_100003847
2103 Ga0070712_100245917
2104 Ga0070712_100304405
2105 Ga0075362_10015605
2106 Ga0097621_100112989
2107 Ga0068871_100013415
2108 Ga0068871_100055139
2109 Ga0068871_100071187
2110 Ga0075428_100005937
2111 Ga0075428_100021775
2112 Ga0075428_100089647
2113 Ga0075430_100025234
2114 Ga0075430_100030214
2115 Ga0075430_100085791
2116 Ga0075430_100498729
2117 Ga0075431_100008918
2118 Ga0075431_100040488
2119 Ga0075431_100127534
2120 Ga0075431_100265589
2121 Ga0075429_100022013
2122 Ga0075429_100034608
2123 Ga0075429_100053422
2124 Ga0075429_100127844
2125 Ga0075429_100243046
2126 Ga0068865_100163229
2127 Ga0068865_100291499
2128 Ga0097620_100003963
2129 Ga0097620_100020691
2130 Ga0097620_100125189
2131 Ga0097620_100156216
2132 Ga0097620_100173525
2133 Ga0079104_1000120
2134 Ga0079104_1000135
2135 Ga0079104_1000375
2136 Ga0079104_1000920
2137 Ga0079104_1002489
2138 Ga0099826_10035691
2139 Ga0099794_10007866
2140 Ga0099794_10074679
2141 Ga0099795_10000004
2142 Ga0099795_10009077
2143 Ga0105251_10000500
2144 Ga0105251_10000971
2145 Ga0105251_10001251
2146 Ga0105251_10008997
2147 Ga0105251_10018140
2148 Ga0105251_10020565
2149 Ga0105251_10121300
2150 Ga0105244_10000224
2151 Ga0105244_10000246
2152 Ga0105244_10005965
2153 Ga0105244_10009502
2154 Ga0105244_10009873
2155 Ga0105244_10028238
2156 Ga0105244_10031514
2157 Ga0105244_10033675
2158 Ga0105250_10000024
2159 Ga0105250_10001909
2160 Ga0105250_10002486
2161 Ga0105250_10003102
2162 Ga0105250_10008560
2163 Ga0105250_10040436
2164 Ga0105240_10029428
2165 Ga0105240_10058195
2166 Ga0105240_10159492
2167 Ga0105240_10170151
2168 Ga0105240_10215765
2169 Ga0111539_10013105
2170 Ga0111539_10275565
2171 Ga0105245_10036619
2172 Ga0105245_10142930
2173 Ga0105245_10148507
2174 Ga0105245_10155204
2175 Ga0105247_10007410
2176 Ga0105243_10001321
2177 Ga0105243_10002510
2178 Ga0105243_10178641
2179 Ga0105241_10460500
2180 Ga0105241_10525067
2181 Ga0105242_10012095
2182 Ga0105242_10064552
2183 Ga0105248_10033962
2184 Ga0105248_10046079
2185 Ga0105248_10545284
2186 Ga0105237_10000335
2187 Ga0105237_10006477
2188 Ga0105238_10001931
2189 Ga0105238_10002259
2190 Ga0105238_10085859
2191 Ga0105238_10241394
2192 Ga0105249_10024343
2193 Ga0105249_10392022
2194 Ga0105030_102265
2195 Ga0099796_10000006
2196 Ga0099796_10014045
2197 Ga0105239_10013236
2198 Ga0105239_10067141
2199 Ga0105246_10005977
2200 Ga0105246_10069796
2201 Ga0105246_10153728
2202 Ga0157345_1000334
2203 Ga0157373_10021414
2204 Ga0157373_10070915
2205 Ga0157373_10072867
2206 Ga0157373_10078059
2207 Ga0157371_10000406
2208 Ga0157371_10004097
2209 Ga0157371_10006011
2210 Ga0157371_10012661
2211 Ga0157371_10079558
2212 Ga0157370_10001889
2213 Ga0157370_10002468
2214 Ga0157370_10004655
2215 Ga0157370_10012990
2216 Ga0157370_10031845
2217 Ga0157370_10044001
2218 Ga0157370_10086697
2219 Ga0157369_10000107
2220 Ga0157369_10001202
2221 Ga0157369_10007741
2222 Ga0157369_10007861
2223 Ga0157369_10057845
2224 Ga0157374_10000600
2225 Ga0157374_10266450
2226 Ga0157378_10385231
2227 Ga0163162_10001668
2228 Ga0163162_10021683
2229 Ga0163162_10133574
2230 Ga0157372_10000715
2231 Ga0157372_10003727
2232 Ga0157372_10004291
2233 Ga0157372_10010698
2234 Ga0157372_10032929
2235 Ga0157372_10066732
2236 Ga0157372_10088454
2237 Ga0157375_10007002
2238 Ga0157375_10060961
2239 Ga0157375_10360902
2240 Ga0157375_10607457
2241 Ga0163163_10000168
2242 Ga0163163_10000848
2243 Ga0163163_10022217
2244 Ga0163163_10118014
2245 Ga0157380_10000204
2246 Ga0157380_10000702
2247 Ga0157380_10004085
2248 Ga0157380_10011556
2249 Ga0157380_10120408
2250 Ga0157380_10211056
2251 Ga0182008_10002836
2252 Ga0182008_10006502
2253 Ga0182008_10057780
2254 Ga0182008_10059674
2255 Ga0157379_10000153
2256 Ga0157379_10321153
2257 Ga0157376_10166433
2258 Ga0157376_10367091
2259 Ga0182006_1000027
2260 Ga0182006_1006580
2261 Ga0182006_1029155
2262 Ga0182006_1030073
2263 Ga0182007_10030939
2264 Ga0163161_10085264
2265 Ga0163161_10167816
2266 Ga0163161_10225715
2267 Ga0163161_10540087
2268 Ga0206356_10269087
2269 Ga0206354_10944045
2270 Ga0206353_10734867
2271 Ga0206353_10961766
2272 Ga0154015_1412532
2273 Ga0213871_10020754
2274 Ga0209760_100079
2275 Ga0209760_100211
2276 Ga0209784_100128
2277 Ga0209566_100157
2278 Ga0209674_100180
2279 Ga0209674_100523
2280 Ga0209674_103020
2281 Ga0209672_100018
2282 Ga0209147_100183
2283 Ga0209563_100144
2284 Ga0209563_100231
2285 Ga0207427_100001
2286 Ga0207427_100048
2287 Ga0209437_100003
2288 Ga0209437_100094
2289 Ga0209437_101381
2290 Ga0209258_100024
2291 Ga0209258_100310
2292 Ga0209646_1000355
2293 Ga0209026_1000056
2294 Ga0209677_100127
2295 Ga0209677_101128
2296 Ga0209148_1000009
2297 Ga0209759_1000166
2298 Ga0209129_1006397
2299 Ga0209233_1000007
2300 Ga0209233_1000106
2301 Ga0209455_1000029
2302 Ga0209675_1011730
2303 Ga0209676_1000055
2304 Ga0209676_1000115
2305 Ga0209676_1000556
2306 Ga0209676_1000950
2307 Ga0209676_1000959
2308 Ga0209676_1004177
2309 Ga0209758_1034692
2310 Ga0209050_1000606
2311 Ga0209050_1000941
2312 Ga0209050_1000970
2313 Ga0209050_1016874
2314 Ga0207426_1046525
2315 Ga0209051_1000054
2316 Ga0209051_1000083
2317 Ga0209051_1000429
2318 Ga0209257_1000090
2319 Ga0209257_1000175
2320 Ga0209257_1018791
2321 Ga0209257_1030643
2322 Ga0207656_10001116
2323 Ga0207656_10002494
2324 Ga0207656_10070981
2325 Ga0207696_1000019
2326 Ga0207696_1000175
2327 Ga0207696_1000275
2328 Ga0207696_1000383
2329 Ga0207696_1000426
2330 Ga0207696_1001872
2331 Ga0207696_1006240
2332 Ga0207696_1007110
2333 Ga0207696_1007189
2334 Ga0207696_1007329
2335 Ga0207696_1018686
2336 Ga0207655_1000004
2337 Ga0207655_1000019
2338 Ga0207655_1000062
2339 Ga0207655_1000115
2340 Ga0207655_1000434
2341 Ga0207655_1001025
2342 Ga0207655_1001255
2343 Ga0207655_1001801
2344 Ga0207655_1001882
2345 Ga0207655_1005926
2346 Ga0207655_1010454
2347 Ga0207655_1014037
2348 Ga0207655_1033064
2349 Ga0207713_1000023
2350 Ga0207713_1000207
2351 Ga0207713_1000299
2352 Ga0207713_1000681
2353 Ga0207713_1003198
2354 Ga0207713_1003297
2355 Ga0207713_1004796
2356 Ga0207713_1006447
2357 Ga0207713_1009064
2358 Ga0207713_1011536
2359 Ga0207713_1014323
2360 Ga0207713_1015587
2361 Ga0207713_1016389
2362 Ga0207713_1019734
2363 Ga0207713_1052120
2364 Ga0207682_10017898
2365 Ga0207682_10085111
2366 Ga0207710_10022650
2367 Ga0207688_10018196
2368 Ga0207680_10000002
2369 Ga0207680_10000258
2370 Ga0207680_10017367
2371 Ga0207647_10000548
2372 Ga0207647_10041154
2373 Ga0207685_10035372
2374 Ga0207699_10056754
2375 Ga0207643_10015501
2376 Ga0207643_10078929
2377 Ga0207643_10213513
2378 Ga0207705_10000553
2379 Ga0207705_10001408
2380 Ga0207705_10001438
2381 Ga0207705_10003691
2382 Ga0207705_10368093
2383 Ga0207705_10511402
2384 Ga0207654_10009586
2385 Ga0207707_10000216
2386 Ga0207707_10000535
2387 Ga0207707_10001364
2388 Ga0207707_10004165
2389 Ga0207707_10005396
2390 Ga0207707_10081172
2391 Ga0207707_10477963
2392 Ga0207695_10001358
2393 Ga0207695_10015790
2394 Ga0207695_10027644
2395 Ga0207695_10240283
2396 Ga0207671_10000018
2397 Ga0207671_10003719
2398 Ga0207660_10000037
2399 Ga0207660_10001255
2400 Ga0207660_10002057
2401 Ga0207660_10025218
2402 Ga0207660_10112702
2403 Ga0207660_10223971
2404 Ga0207662_10028790
2405 Ga0207662_10036404
2406 Ga0207662_10061192
2407 Ga0207657_10000474
2408 Ga0207657_10001326
2409 Ga0207657_10049838
2410 Ga0207649_10000008
2411 Ga0207649_10001228
2412 Ga0207649_10002222
2413 Ga0207649_10006688
2414 Ga0207649_10054940
2415 Ga0207649_10143141
2416 Ga0207652_10000164
2417 Ga0207652_10000423
2418 Ga0207652_10001445
2419 Ga0207652_10001950
2420 Ga0207652_10015597
2421 Ga0207652_10134918
2422 Ga0207681_10002297
2423 Ga0207681_10040609
2424 Ga0207681_10320815
2425 Ga0207694_10000177
2426 Ga0207694_10018186
2427 Ga0207650_10002243
2428 Ga0207650_10004740
2429 Ga0207650_10147084
2430 Ga0207650_10150038
2431 Ga0207650_10167915
2432 Ga0207659_10012384
2433 Ga0207659_10047419
2434 Ga0207659_10063730
2435 Ga0207659_10129546
2436 Ga0207687_10070807
2437 Ga0207687_10226095
2438 Ga0207687_10364567
2439 Ga0207700_10010680
2440 Ga0207700_10036810
2441 Ga0207700_10056347
2442 Ga0207664_10019567
2443 Ga0207664_10022355
2444 Ga0207690_10000334
2445 Ga0207690_10000737
2446 Ga0207690_10001231
2447 Ga0207690_10258173
2448 Ga0207706_10001633
2449 Ga0207706_10012291
2450 Ga0207706_10034821
2451 Ga0207706_10122271
2452 Ga0207706_10188335
2453 Ga0207709_10000089
2454 Ga0207709_10001814
2455 Ga0207709_10129678
2456 Ga0207709_10217788
2457 Ga0207670_10001078
2458 Ga0207670_10038130
2459 Ga0207670_10079000
2460 Ga0207670_10120227
2461 Ga0207669_10101454
2462 Ga0207704_10022452
2463 Ga0207665_10010387
2464 Ga0207665_10068109
2465 Ga0207691_10007416
2466 Ga0207691_10018791
2467 Ga0207691_10129851
2468 Ga0207691_10196050
2469 Ga0207691_10206087
2470 Ga0207711_10032996
2471 Ga0207711_10047807
2472 Ga0207711_10049020
2473 Ga0207711_10137020
2474 Ga0207711_10465228
2475 Ga0207689_10005133
2476 Ga0207689_10031466
2477 Ga0207689_10084221
2478 Ga0207661_10002528
2479 Ga0207661_10326374
2480 Ga0207679_10000008
2481 Ga0207679_10001433
2482 Ga0207679_10009007
2483 Ga0207679_10094618
2484 Ga0207679_10449521
2485 Ga0207667_10000506
2486 Ga0207667_10001190
2487 Ga0207667_10004804
2488 Ga0207667_10202020
2489 Ga0207667_10406614
2490 Ga0207651_10078940
2491 Ga0207651_10146574
2492 Ga0207651_10150588
2493 Ga0207651_10184015
2494 Ga0207712_10048104
2495 Ga0207712_10260493
2496 Ga0207668_10005842
2497 Ga0207668_10050481
2498 Ga0207668_10340823
2499 Ga0207640_10043380
2500 Ga0207640_10057477
2501 Ga0207658_10200402
2502 Ga0207658_10230232
2503 Ga0207658_10252643
2504 Ga0207677_10033701
2505 Ga0207677_10038262
2506 Ga0207703_10039843
2507 Ga0207703_10070020
2508 Ga0207639_10000194
2509 Ga0207639_10000651
2510 Ga0207639_10004992
2511 Ga0207678_10000638
2512 Ga0207678_10001101
2513 Ga0207678_10010873
2514 Ga0207678_10244740
2515 Ga0207678_10378960
2516 Ga0207708_10007427
2517 Ga0207708_10074953
2518 Ga0207708_10217382
2519 Ga0207702_10006981
2520 Ga0207702_10010603
2521 Ga0207702_10018842
2522 Ga0207702_10289001
2523 Ga0207641_10004613
2524 Ga0207641_10039243
2525 Ga0207641_10046423
2526 Ga0207641_10054676
2527 Ga0207641_10127392
2528 Ga0207648_10002079
2529 Ga0207648_10025082
2530 Ga0207648_10039695
2531 Ga0207648_10204902
2532 Ga0207676_10043184
2533 Ga0207676_10063210
2534 Ga0207676_10081019
2535 Ga0207674_10002179
2536 Ga0207674_10074629
2537 Ga0207674_10175887
2538 Ga0207675_100011633
2539 Ga0207675_100021623
2540 Ga0207675_100023062
2541 Ga0207675_100124281
2542 Ga0207675_100137849
2543 Ga0207675_100200639
2544 Ga0207683_10006412
2545 Ga0207683_10087208
2546 Ga0207683_10190713
2547 Ga0207683_10280131
2548 Ga0207698_10000920
2549 Ga0207698_10001178
2550 Ga0207698_10003673
2551 Ga0209281_1000004
2552 Ga0209281_1000014
2553 Ga0209281_1000018
2554 Ga0209281_1000095
2555 Ga0209281_1000391
2556 Ga0209281_1000404
2557 Ga0209389_1078671
2558 Ga0209371_1000005
2559 Ga0209371_1000559
2560 Ga0209371_1001783
2561 Ga0209371_1003533
2562 Ga0209371_1003732
2563 Ga0209371_1010795
2564 Ga0209969_1012383
2565 Ga0209179_1000092
2566 Ga0209179_1003038
2567 Ga0209999_1017394
2568 Ga0209282_1073187
2569 Ga0209971_1000283
2570 Ga0209966_1041067
2571 Ga0209974_10024050
2572 Ga0207428_10015038
2573 Ga0207428_10020953
2574 Ga0207428_10033442
2575 Ga0207428_10102538
2576 Ga0268266_10000004
2577 Ga0268266_10000894
2578 Ga0268266_10012944
2579 Ga0268266_10037850
2580 Ga0268266_10196192
2581 Ga0268266_10255937
2582 Ga0268265_10011415
2583 Ga0268265_10014190
2584 Ga0268265_10027739
2585 Ga0268265_10028465
2586 Ga0268265_10040833
2587 Ga0268265_10451103
2588 Ga0268265_10481270
2589 Ga0268264_10027543
2590 Ga0268264_10166497
2591 Ga0268264_10285437
2592 Ga0265334_10001122
2593 Ga0265318_10001166
2594 Ga0307517_10165832
2595 Ga0307515_10022420
2596 Ga0265338_10007165
2597 Ga0265338_10052392
2598 Ga0268256_1000006
2599 Ga0268256_1000683
2600 Ga0268256_1000960
2601 Ga0268256_1003107
2602 Ga0268256_1011635
2603 Ga0268256_1033619
2604 Ga0316179_1113066
2605 Ga0316178_1087112
2606 Ga0316183_1044454
2607 Ga0265763_1002977
2608 Ga0265770_1000369
2609 Ga0265760_10002759
2610 Ga0265330_10002921
2611 Ga0265332_10001420
2612 Ga0265328_10042645
2613 Ga0265320_10023023
2614 Ga0265325_10009644
2615 Ga0265329_10004113
2616 Ga0265340_10005180
2617 Ga0265331_10009198
2618 Ga0265331_10013558
2619 Ga0265327_10000014
2620 Ga0265327_10001336
2621 Ga0265327_10003077
2622 Ga0265327_10025433
2623 Ga0265316_10000792
2624 Ga0265316_10002874
2625 Ga0307513_10004368
2626 Ga0307513_10006131
2627 Ga0307513_10019623
2628 Ga0307513_10085159
2629 Ga0307513_10107892
2630 Ga0307408_100000077
2631 Ga0307408_100000411
2632 Ga0307408_100011122
2633 Ga0307408_100023679
2634 Ga0307408_100029897
2635 Ga0307408_100038986
2636 Ga0307408_100113396
2637 Ga0265313_10004882
2638 Ga0265313_10072893
2639 Ga0316575_10000552
2640 Ga0316575_10008898
2641 Ga0316575_10026536
2642 Ga0316575_10029416
2643 Ga0316575_10127780
2644 Ga0316579_10000781
2645 Ga0265314_10023013
2646 Ga0316576_10043312
2647 Ga0316576_10045016
2648 Ga0316576_10063907
2649 Ga0316576_10074584
2650 Ga0316576_10149937
2651 Ga0316578_10018465
2652 Ga0316578_10029466
2653 Ga0316578_10029662
2654 Ga0316578_10084779
2655 Ga0316578_10099491
2656 Ga0307405_10003135
2657 Ga0307405_10017965
2658 Ga0307405_10065702
2659 Ga0316577_10010475
2660 Ga0316577_10011297
2661 Ga0307413_10001598
2662 Ga0307413_10004458
2663 Ga0307413_10123809
2664 Ga0307413_10355241
2665 Ga0307410_10012094
2666 Ga0307410_10245534
2667 Ga0307410_10250298
2668 Ga0307406_10019065
2669 Ga0307406_10113897
2670 Ga0307406_10182936
2671 Ga0307407_10148287
2672 Ga0307407_10167267
2673 Ga0307412_10064739
2674 Ga0307412_10232155
2675 Ga0307409_100007399
2676 Ga0307416_100001771
2677 Ga0307416_100042601
2678 Ga0307416_100076158
2679 Ga0307416_100115811
2680 Ga0307416_100467903
2681 Ga0307414_10014501
2682 Ga0307414_10167961
2683 Ga0307414_10212399
2684 Ga0307411_10001359
2685 Ga0307411_10064378
2686 Ga0307411_10114681
2687 Ga0307415_100053847
2688 Ga0316583_10000442
2689 Ga0316585_10000027
2690 Ga0316580_10007512
2691 Ga0316580_10008044
2692 Ga0316593_10000073
2693 Ga0316593_10003440
2694 Ga0316593_10008222
2695 Ga0316593_10072220
2696 Ga0307510_10001742
2697 Ga0307510_10113435
2698 Ga0307510_10221506
2699 Ga0373923_0039004
2700 Ga0373945_0056733
2701 Ga0373957_0019132
2702 Ga0373946_0043285
2703 Ga0373955_0114736
2704 Ga0373942_0093954
2705 Ga0316574_0001215
2706 Ga0316574_0001978
2707 Ga0316574_0004031
2708 Ga0316574_0008617
2709 Ga0316574_0016581
2710 Ga0316574_0018396
2711 Ga0316574_0028979
2712 Ga0316574_0040134
2713 Ga0316574_0190098
2714 Ga0316574_0233700
2715 Ga0316574_0270606
2716 Ga0373931_0164347
2717 Ga0373935_0242385
2718 Ga0373927_0038213
2719 Ga0373933_0022376
2720 Ga0373947_0208876
2721 Ga0316582_0001504
2722 Ga0316582_0001671
2723 Ga0316582_0014157
2724 Ga0316582_0048003
2725 Ga0316582_0083592
2726 Ga0316582_0212859
2727 Ga0316584_0002113
2728 Ga0316584_0021722
2729 Ga0316584_0035967
2730 Ga0316584_0044524
2731 Ga0316584_0046215
2732 Ga0316584_0061284
2733 Ga0316584_0075135
2734 Ga0316584_0172799
2735 Ga0395899_0000404
2736 Ga0395899_0125215
2737 Ga0395900_0000107
2738 Ga0395900_0074336
2739 Ga0395898_0000211
2740 Ga0395898_0048094
2741 Ga0316581_0000969
2742 Ga0316581_0003338
2743 Ga0395901_0079858
2744 Ga0395901_0515479
2745 Ga0237819_00787
2746 Ga0400483_011244
2747 Ga0400483_096306
2748 Ga0400483_195378
2749 Ga0400483_228399
2750 Ga0400487_56255
2751 Ga0436365_1567785
2752 Ga0436365_1816396
2753 Ga0436360_0504587
2754 Ga0436361_0355976
2755 Ga0436363_0879119
2756 Ga0439436_0000026
2757 Ga0439436_0000447
2758 Ga0439438_000002
2759 Ga0439438_003174
2760 Ga0439438_003372
2761 Ga0439438_004121
2762 Ga0439438_007190
2763 Ga0439438_022997
2764 Ga0439447_001619
2765 Ga0439447_002046
2766 Ga0439447_008358
2767 Ga0439447_039422
2768 Ga0439461_0002255
2769 Ga0439466_0002104
2770 Ga0439466_0011580
2771 Ga0439466_0016193
2772 Ga0451791_0939169
2773 Ga0451807_1085369
2774 Ga0451833_0997501
2775 Ga0451853_1515730
2776 Ga0439441_031425
2777 Ga0439448_0027489
2778 Ga0439432_002151
2779 Ga0439432_003611
2780 Ga0439432_008528
2781 Ga0439432_023722
2782 Ga0439451_005685
2783 Ga0439451_006810
2784 Ga0439452_000015
2785 Ga0439452_000193
2786 Ga0439452_003709
2787 Ga0439452_015227
2788 Ga0439456_005372
2789 Ga0439456_006439
2790 Ga0450911_000989
2791 Ga0450923_000761
2792 Ga0450891_001834
2793 Ga0450896_000803
2794 Ga0450904_000021
2795 Ga0450906_001253
2796 Ga0450906_009578
2797 Ga0450907_002943
2798 Ga0450907_003833
2799 Ga0450910_001012
2800 Ga0439446_0001213
2801 Ga0439446_0005836
2802 Ga0439446_0019054
2803 Ga0450908_003922
2804 Ga0450908_004614
2805 Ga0450908_006538
2806 Ga0450908_008467
2807 Ga0439459_0002761
2808 Ga0439464_0000028
2809 Ga0450918_005543
2810 Ga0450901_000068
2811 Ga0451577_0013959
2812 Ga0451577_0192142
2813 Ga0451577_0208851
2814 Ga0439440_0010459
2815 Ga0466969_0015398
2816 Ga0453683_0051155
2817 Ga0466966_0014771
2818 Ga0466961_0068102
2819 Ga0466964_0040263
2820 Ga0453684_0319401
2821 Ga0453684_0450634
2822 Ga0466971_0009827
2823 Ga0466968_0003694
2824 Ga0466970_0071846
2825 Ga0466957_0046268
2826 Ga0466957_0052198
2827 Ga0466959_0000110
2828 Ga0451576_0000034
2829 Ga0451576_0062688
2830 Ga0451576_0137921
2831 Ga0451576_0293866
2832 Ga0466958_0097864
2833 Ga0495617_000583
2834 Ga0495617_001724
2835 Ga0495627_002133
2836 Ga0495627_012638
2837 Ga0495627_029960
2838 Ga0495603_0007081
2839 Ga0495590_0001676
2840 Ga0495590_0003763
2841 Ga0495591_000341
2842 Ga0495591_002220
2843 Ga0495591_002827
2844 Ga0495591_003091
2845 Ga0495591_006880
2846 Ga0495591_010564
2847 Ga0495591_015200
2848 Ga0495638_0000873
2849 Ga0495638_0001879
2850 Ga0495638_0005848
2851 Ga0495638_0020839
2852 Ga0495638_0033336
2853 Ga0495638_0061121
2854 Ga0495653_0015001
2855 Ga0495653_0101166
2856 Ga0495650_0000047
2857 Ga0495650_0000250
2858 Ga0495650_0001128
2859 Ga0495650_0001452
2860 Ga0495650_0017006
2861 Ga0495650_0048502
2862 Ga0495605_0000373
2863 Ga0495605_0000831
2864 Ga0495605_0004590
2865 Ga0495605_0010998
2866 Ga0495605_0020248
2867 Ga0495605_0060755
2868 Ga0495639_0003160
2869 Ga0495584_0002893
2870 Ga0495584_0003978
2871 Ga0495584_0012433
2872 Ga0495584_0028139
2873 Ga0495584_0141197
2874 Ga0495585_0000019
2875 Ga0495585_0005462
2876 Ga0495585_0008389
2877 Ga0495585_0010101
2878 Ga0495585_0044297
2879 Ga0495585_0045379
2880 Ga0495585_0045774
2881 Ga0495594_0000612
2882 Ga0495594_0066620
2883 Ga0495596_0002729
2884 Ga0495596_0004687
2885 Ga0495596_0019317
2886 Ga0495596_0118138
2887 Ga0495607_0000250
2888 Ga0495607_0000538
2889 Ga0495607_0000869
2890 Ga0495607_0001054
2891 Ga0495607_0001347
2892 Ga0495607_0001549
2893 Ga0495607_0005710
2894 Ga0495607_0013072
2895 Ga0495607_0016541
2896 Ga0495607_0025549
2897 Ga0495607_0026945
2898 Ga0495607_0076715
2899 Ga0495607_0124245
2900 Ga0495583_0000521
2901 Ga0495583_0001354
2902 Ga0495583_0001828
2903 Ga0495583_0002363
2904 Ga0495583_0004447
2905 Ga0495606_0000255
2906 Ga0495606_0000665
2907 Ga0495606_0001039
2908 Ga0495606_0001255
2909 Ga0495606_0001384
2910 Ga0495606_0001423
2911 Ga0495606_0010914
2912 Ga0495606_0017563
2913 Ga0495610_0005830
2914 Ga0495610_0006853
2915 Ga0495610_0012420
2916 Ga0495610_0012850
2917 Ga0495610_0021163
2918 Ga0495610_0028061
2919 Ga0495610_0065014
2920 Ga0495610_0073017
2921 Ga0495616_0000047
2922 Ga0495616_0015572
2923 Ga0495616_0021705
2924 Ga0495616_0029933
2925 Ga0495616_0059387
2926 Ga0495616_0103027
2927 Ga0495620_0000413
2928 Ga0495620_0004548
2929 Ga0495620_0005447
2930 Ga0495620_0008101
2931 Ga0495620_0009649
2932 Ga0495620_0011860
2933 Ga0495620_0012826
2934 Ga0495620_0042921
2935 Ga0495620_0056293
2936 Ga0495630_0132113
2937 Ga0495631_0001326
2938 Ga0495631_0002466
2939 Ga0495631_0003442
2940 Ga0495631_0086210
2941 Ga0495631_0149972
2942 Ga0495632_0000080
2943 Ga0495632_0001147
2944 Ga0495632_0002357
2945 Ga0495632_0002444
2946 Ga0495632_0004992
2947 Ga0495632_0010987
2948 Ga0495632_0109542
2949 Ga0495632_0146866
2950 Ga0495637_0001830
2951 Ga0495637_0002110
2952 Ga0495637_0002741
2953 Ga0495637_0004862
2954 Ga0495637_0005624
2955 Ga0495637_0014903
2956 Ga0495637_0020114
2957 Ga0495637_0036621
2958 Ga0495637_0109737
2959 Ga0495643_0000717
2960 Ga0495643_0009384
2961 Ga0495643_0011560
2962 Ga0495643_0039912
2963 Ga0495644_0002686
2964 Ga0495648_0000424
2965 Ga0495648_0004682
2966 Ga0495648_0014046
2967 Ga0495648_0017048
2968 Ga0495648_0022776
2969 Ga0495648_0028289
2970 Ga0495648_0036009
2971 Ga0495648_0053069
2972 Ga0495648_0146670
2973 Ga0495666_0017719
2974 Ga0495642_0001528
2975 Ga0495642_0005253
2976 Ga0495654_0000875
2977 Ga0495654_0002722
2978 Ga0495654_0003407
2979 Ga0495654_0117720
2980 Ga0495654_0134545
2981 Ga0495586_0005021
2982 Ga0495587_0059558
2983 Ga0495587_0101663
2984 Ga0495609_0000011
2985 Ga0495609_0000349
2986 Ga0495609_0000784
2987 Ga0495609_0003919
2988 Ga0495609_0010058
2989 Ga0495609_0014027
2990 Ga0495609_0047626
2991 Ga0495597_0000221
2992 Ga0495597_0002355
2993 Ga0495597_0002438
2994 Ga0495597_0102779
2995 Ga0495597_0136610
2996 Ga0495597_0152939
2997 Ga0495622_0000853
2998 Ga0495622_0001397
2999 Ga0495622_0037039
3000 Ga0495622_0110250
3001 Ga0495633_0000287
3002 Ga0495633_0000438
3003 Ga0495656_0040293
3004 Ga0495668_0008912
3005 Ga0495668_0022194
3006 Ga0495668_0145650
3007 Ga0495634_0005385
3008 Ga0495611_0000001
3009 Ga0495611_0000955
3010 Ga0495611_0001725
3011 Ga0495611_0001973
3012 Ga0495611_0002094
3013 Ga0495625_0000001
3014 Ga0495625_0000187
3015 Ga0495625_0007564
3016 Ga0495625_0007957
3017 Ga0495625_0008531
3018 Ga0495625_0018950
3019 Ga0495625_0026761
3020 Ga0495625_0222071
3021 Ga0495659_0001232
3022 Ga0495661_0000051
3023 Ga0495661_0000477
3024 Ga0495661_0000596
3025 Ga0495661_0001003
3026 Ga0495661_0001772
3027 Ga0495661_0029543
3028 Ga0495661_0038148
3029 Ga0495588_0107533
3030 Ga0495623_0007248
3031 Ga0495646_0019993
3032 Ga0495658_0222963
3033 Ga0495669_0034276
3034 Ga0495670_0002102
3035 Ga0495670_0002797
3036 Ga0495670_0011627
3037 Ga0495670_0019046
3038 Ga0495670_0019878
3039 Ga0495671_0000552
3040 Ga0495671_0001180
3041 Ga0495671_0007665
3042 Ga0495671_0016360
3043 Ga0495671_0022227
3044 Ga0495671_0027804
3045 Ga0495671_0158987
3046 Ga0495649_0000165
3047 Ga0495649_0006953
3048 Ga0495649_0008252
3049 Ga0495649_0008478
3050 Ga0495649_0016610
3051 Ga0495649_0024380
3052 Ga0495649_0046070
3053 Ga0495649_0055392
3054 Ga0495589_0000272
3055 Ga0495589_0002065
3056 Ga0495589_0002775
3057 Ga0495589_0004145
3058 Ga0495589_0009775
3059 Ga0495600_0296731
3060 Ga0495660_0000746
3061 Ga0495660_0000888
3062 Ga0495660_0001273
3063 Ga0495660_0001683
3064 Ga0495660_0007204
3065 Ga0495660_0013190
3066 Ga0495660_0014399
3067 Ga0495660_0033838
3068 Ga0495660_0129028
3069 Ga0495660_0172199
3070 Ga0495660_0186559
3071 Ga0495604_0008431
3072 Ga0495636_0016827
3073 Ga0495636_0163909
3074 Ga0495674_0348451
3075 Ga0495672_0000009
3076 Ga0495672_0007676
3077 Ga0495672_0008500
3078 Ga0495672_0009606
3079 Ga0495672_0015130
3080 Ga0495672_0020631
3081 Ga0495672_0035405
3082 Ga0495672_0141233
3083 Ga0495672_0227721
3084 Ga0495676_0000508
3085 Ga0495676_0002177
3086 Ga0495680_0014817
3087 Ga0495680_0127637
3088 Ga0495683_0000053
3089 Ga0495683_0000129
3090 Ga0495683_0002438
3091 Ga0495683_0003047
3092 Ga0495683_0003636
3093 Ga0495687_004396
3094 Ga0495687_010164
3095 Ga0495675_0012350
3096 Ga0495679_000001
3097 Ga0495679_000075
3098 Ga0495679_000381
3099 Ga0495673_0000001
3100 Ga0495673_0000071
3101 Ga0495673_0000099
3102 Ga0495673_0001468
3103 Ga0495673_0003834
3104 Ga0495673_0004508
3105 Ga0495673_0005014
3106 Ga0495673_0005967
3107 Ga0495673_0014795
3108 Ga0495673_0022827
3109 Ga0495673_0068555
3110 Ga0495673_0116260
3111 Ga0495681_0002160
3112 Ga0495681_0017030
3113 Ga0495681_0026095
3114 Ga0495681_0026592
3115 Ga0495681_0103111
3116 Ga0495684_0015811
3117 Ga0495686_0000255
3118 Ga0495686_0003112
3119 Ga0495686_0013966
3120 Ga0495686_0128482
3121 Ga0495686_0246428
3122 Ga0495593_0029323
3123 Ga0495626_0000250
3124 Ga0495626_0003380
3125 Ga0495626_0005631
3126 Ga0495626_0031579
3127 Ga0495626_0065118
3128 Ga0495626_0079876
3129 Ga0496100_0097587
3130 Ga0496100_0269206
3131 Ga0496101_0042073
3132 Ga0496102_0006510
3133 Ga0496102_0052861
3134 Ga0496103_0007448
3135 Ga0496103_0196798
3136 Ga0496105_0000498
3137 Ga0496105_0136287
3138 Ga0496106_0000153
3139 Ga0496106_0019257
3140 Ga0496108_0058937
3141 Ga0496109_0054813
3142 Ga0496115_0438437
3143 Ga0496116_0000005
3144 Ga0496116_0000420
3145 Ga0496116_0000426
3146 Ga0496116_0017981
3147 Ga0496116_0052335
3148 Ga0496117_0001337
3149 Ga0496117_0014648
3150 Ga0496117_0038224
3151 Ga0496118_0000749
3152 Ga0496118_0003213
3153 Ga0496118_0003350
3154 Ga0496118_0004127
3155 Ga0496118_0006111
3156 Ga0496118_0039751
3157 Ga0496118_0045640
3158 Ga0496118_0204389
3159 Ga0496119_0000943
3160 Ga0496119_0010600
3161 Ga0496119_0027685
3162 Ga0496119_0036096
3163 Ga0496119_0049647
3164 Ga0496120_0000081
3165 Ga0496120_0002521
3166 Ga0496120_0002840
3167 Ga0496121_0000126
3168 Ga0496121_0000210
3169 Ga0496121_0002035
3170 Ga0496121_0003354
3171 Ga0496121_0003580
3172 Ga0496121_0006074
3173 Ga0496121_0007739
3174 Ga0496121_0021277
3175 Ga0496121_0042326
3176 Ga0496121_0056799
3177 Ga0496121_0207584
3178 Ga0496122_0000003
3179 Ga0496122_0004101
3180 Ga0496122_0010966
3181 Ga0496122_0015351
3182 Ga0496122_0019389
3183 Ga0496122_0026085
3184 Ga0496122_0026167
3185 Ga0496122_0043240
3186 Ga0496122_0148532
3187 Ga0496122_0163767
3188 Ga0496123_0000012
3189 Ga0496123_0001037
3190 Ga0496123_0002927
3191 Ga0496123_0003252
3192 Ga0496123_0006129
3193 Ga0496123_0008715
3194 Ga0496123_0047090
3195 Ga0496124_0000382
3196 Ga0496124_0001085
3197 Ga0496124_0007002
3198 Ga0496124_0011459
3199 Ga0496124_0034709
3200 Ga0496124_0044392
3201 Ga0496124_0061908
3202 Ga0496124_0111270
3203 Ga0496124_0153205
3204 Ga0496125_0003846
3205 Ga0496125_0005039
3206 Ga0496125_0111055
3207 Ga0496125_0135733
3208 Ga0496126_0013672
3209 Ga0496126_0025112
3210 Ga0496126_0210905
3211 Ga0496126_0256171
3212 Ga0495678_000207
3213 Ga0495678_000362
3214 Ga0495678_000688
3215 Ga0495678_003571
3216 Ga0495678_009139
3217 Ga0495682_0000268
3218 Ga0495682_0001604
3219 Ga0495682_0002356
3220 Ga0495682_0007117
3221 Ga0501031_0018035
3222 Ga0501031_0025351
3223 Ga0501031_0031753
3224 Ga0501032_0002909
3225 Ga0501032_0035250
3226 Ga0501032_0077868
3227 Ga0501032_0198587
3228 Ga0501033_0087350
3229 Ga0501034_0002351
3230 Ga0501034_0021040
3231 Ga0501034_0081004
3232 Ga0501034_0242331
3233 Ga0501036_0006637
3234 Ga0501036_0007248
3235 Ga0501036_0023358
3236 Ga0501037_0000336
3237 Ga0501037_0000890
3238 Ga0501037_0009363
3239 Ga0501037_0026716
3240 Ga0501037_0067848
3241 Ga0501037_0100311
3242 Ga0501038_0000613
3243 Ga0501038_0000890
3244 Ga0501038_0004044
3245 Ga0501038_0026144
3246 Ga0501038_0038270
3247 Ga0501038_0097095
3248 Ga0501039_0001459
3249 Ga0501039_0009292
3250 Ga0501039_0087227
3251 Ga0501040_0008402
3252 Ga0501040_0009285
3253 Ga0501040_0048208
3254 Ga0501040_0252368
3255 Ga0501041_0022214
3256 Ga0501041_0066644
3257 Ga0501042_0006811
3258 Ga0501042_0012620
3259 Ga0501042_0022927
3260 Ga0501042_0068854
3261 Ga0501042_0076687
3262 Ga0501042_0132794
3263 Ga0501043_0001577
3264 Ga0501043_0005458
3265 Ga0501043_0027068
3266 Ga0501046_0002547
3267 Ga0501046_0015065
3268 Ga0501046_0041807
3269 Ga0501046_0226372
3270 Ga0501047_0013033
3271 Ga0501047_0079878
3272 Ga0501047_0092112
3273 Ga0501048_0001575
3274 Ga0501048_0049744
3275 Ga0501048_0435151
3276 Ga0501068_0000860
3277 Ga0501069_0019390
3278 Ga0501069_0030778
3279 Ga0501069_0033248
3280 Ga0501070_0000970
3281 Ga0501070_0005927
3282 Ga0501070_0007212
3283 Ga0501070_0026151
3284 Ga0501070_0057879
3285 Ga0501070_0059757
3286 Ga0501070_0306057
3287 Ga0501070_0512149
3288 Ga0501071_0006866
3289 Ga0501071_0008275
3290 Ga0501071_0028510
3291 Ga0501071_0046888
3292 Ga0501071_0199893
3293 Ga0501072_0001665
3294 Ga0501072_0050306
3295 Ga0501072_0081218
3296 Ga0501072_0222534
3297 Ga0501073_0001296
3298 Ga0501073_0005417
3299 Ga0501074_0003467
3300 Ga0501074_0004606
3301 Ga0501074_0046643
3302 Ga0501074_0051278
3303 Ga0501075_0005794
3304 Ga0501076_0004278
3305 Ga0501076_0017297
3306 Ga0501076_0080183
3307 Ga0501076_0087147
3308 Ga0501076_0096624
3309 Ga0501076_0184567
3310 Ga0501076_0263768
3311 Ga0501077_0004143
3312 Ga0501077_0005084
3313 Ga0501077_0015808
3314 Ga0501077_0018766
3315 Ga0501079_0005616
3316 Ga0501079_0038157
3317 Ga0501079_0066439
3318 Ga0501079_0102905
3319 Ga0501080_0009700
3320 Ga0501080_0037690
3321 Ga0501080_0051433
3322 Ga0501081_0000359
3323 Ga0501081_0006393
3324 Ga0501081_0018913
3325 Ga0501081_0021470
3326 Ga0501083_0069785
3327 Ga0501035_0002833
3328 Ga0501035_0017003
3329 Ga0501035_0025839
3330 Ga0501035_0030682
3331 Ga0501035_0047129
3332 Ga0501035_0049018
3333 Ga0501035_0100512
3334 Ga0501044_0000233
3335 Ga0501044_0007876
3336 Ga0501044_0027700
3337 Ga0501044_0178374
3338 Ga0501044_0398670
3339 Ga0501045_0015215
3340 Ga0501045_0216215
3341 Ga0501226_000016
3342 nmdc:mga05p37_11639_c1
3343 nmdc:mga05p37_50302_c1
3344 nmdc:mga05p37_683579_c1
3345 nmdc:mga05p37_704269_c1
3346 nmdc:mga09592_121791_c1
3347 nmdc:mga09592_1590_c1
3348 nmdc:mga09592_28889_c1
3349 nmdc:mga09592_42861_c1
3350 nmdc:mga0qj67_256366_c1
3351 nmdc:mga0qj67_27615_c1
3352 nmdc:mga0qj67_35491_c1
3353 nmdc:mga06r32_12939_c1
3354 nmdc:mga06r32_21093_c1
3355 nmdc:mga06r32_2483_c1
3356 nmdc:mga06r32_29_c1
3357 nmdc:mga06r32_52865_c1
3358 nmdc:mga06r32_73794_c1
3359 nmdc:mga08y16_17178_c1
3360 nmdc:mga08y16_223682_c1
3361 nmdc:mga08y16_228495_c1
3362 nmdc:mga08y16_34011_c1
3363 nmdc:mga08y16_56030_c1
3364 nmdc:mga0n895_387277_c1
3365 nmdc:mga08x19_27949_c1
3366 Ga0500643_000002
3367 Ga0500646_0009536
3368 Ga0500651_0010486
3369 Ga0500641_0004188
3370 Ga0500555_001433
3371 Ga0500573_0188865
3372 Ga0500645_013165
3373 Ga0501084_0007065
3374 Ga0501084_0021309
3375 Ga0501082_0078438
3376 Ga0501082_0148097
3377 Ga0501082_0323856
3378 Ga0501082_0368765
3379 Ga0530510_0000025
3380 Ga0530510_0198611
3381 Ga0530510_0216908
3382 2506584749
3383 2508853399
3384 2511257597
3385 2511263655
3386 2511270258
3387 2511276448
3388 2511291008
3389 2511294262
3390 2511302443
3391 2511314040
3392 2511320000
3393 2511324788
3394 2511330333
3395 2511338012
3396 2511342823
3397 2511348792
3398 2511354868
3399 2511365893
3400 2511369961
3401 2511373241
3402 2511380098
3403 2511413258
3404 2511434916
3405 2511823903
3406 2512326837
3407 2538425420
3408 2547697344
3409 2548647709
3410 2555259895
3411 2555669063
3412 2562463631
3413 2583791469
3414 2585827701
3415 2585834813
3416 2595445752
3417 2595449395
3418 2597857203
3419 2597864875
3420 2597870751
3421 2599328646
3422 2599358045
3423 2599361803
3424 2599368124
3425 2599374913
3426 2599383210
3427 2599389407
3428 2599393771
3429 2599398057
3430 2599405538
3431 2599452514
3432 2599464860
3433 2599468412
3434 2599484225
3435 2599493884
3436 2599503152
3437 2599507060
3438 2599516188
3439 2599518382
3440 2599614830
3441 2599769713
3442 2599801875
3443 2599878216
3444 2599889033
3445 2599895514
3446 2599901605
3447 2599933658
3448 2599942829
3449 2599947409
3450 2599953578
3451 2599959264
3452 2599964532
3453 2599972107
3454 2599975595
3455 2599982163
3456 2599988966
3457 2599994711
3458 2599999571
3459 2600007312
3460 2600009768
3461 2600020513
3462 2600025236
3463 2600029745
3464 2600037815
3465 2600042008
3466 2600046915
3467 2600055026
3468 2600057774
3469 2600064789
3470 2600071676
3471 2600076039
3472 2600217591
3473 2600359340
3474 2600365442
3475 2600445635
3476 2601524225
3477 2601529379
3478 2601540068
3479 2601616213
3480 2601620935
3481 2601628789
3482 2601644281
3483 2601649332
3484 2601654259
3485 2601659681
3486 2601664103
3487 2601689848
3488 2601697063
3489 2601702109
3490 2601707003
3491 2601712045
3492 2601717520
3493 2601722211
3494 2601727448
3495 2601732487
3496 2601736998
3497 2601741280
3498 2601752466
3499 2601758691
3500 2601764805
3501 2601777759
3502 2601795825
3503 2602010051
3504 2602019307
3505 2603636847
3506 2603645400
3507 2603662266
3508 2603667162
3509 2603699374
3510 2603705403
3511 2603839872
3512 2603844949
3513 2603850047
3514 2603855090
3515 2603867905
3516 2603872670
3517 2603877973
3518 2606049873
3519 2606071534
3520 2606075328
3521 2606128191
3522 2606147534
3523 2606177762
3524 2608381633
3525 2609909621
3526 2621298532
3527 2624479762
3528 2624491417
3529 2637224047
3530 2643842568
3531 2643871578
3532 2643884595
3533 2643952955
3534 2644022717
3535 2644188890
3536 2644284957
3537 2644351436
3538 2644549017
3539 2644553250
3540 2644621633
3541 2650895788
3542 2652548559
3543 2656276958
3544 2671093484
3545 2671098442
3546 2671101086
3547 2671107136
3548 2671128314
3549 2671584508
3550 2671768824
3551 2676405455
3552 2677899632
3553 2678264255
3554 2681996188
3555 2682006476
3556 2686354200
3557 2687578747
3558 2689446132
3559 2707098858
3560 2712468851
3561 2715752533
3562 2715758928
3563 2718633434
3564 2721027940
3565 2723249632
3566 2729148192
3567 2735836488
3568 2738674558
3569 2738752951
3570 2738809710
3571 2738861992
3572 2738897070
3573 2739199792
3574 2739227413
3575 2739259433
3576 2739264367
3577 2739284986
3578 2739290300
3579 2739315789
3580 2743736619
3581 2745004710
3582 2753856950
3583 2765585220
3584 2765590055
3585 2772440047
3586 2774120998
3587 2774137343
3588 2775541273
3589 2777020980
3590 2784263653
3591 2784314070
3592 2791922321
3593 2792311987
3594 2793404707
3595 2794596658
3596 2807179676
3597 2807407436
3598 2807455764
3599 2807455775
3600 2808857651
3601 2808904411
3602 2808924733
3603 2808927746
3604 2808937821
3605 2808939157
3606 2808946835
3607 2808949714
3608 2808960249
3609 2808966135
3610 2808977164
3611 2808992319
3612 2809000975
3613 2809125231
3614 2809216713
3615 2812365694
3616 2813727857
3617 2814695400
3618 2817492320
3619 2819563880
3620 2819656463
3621 2819703522
3622 2821121074
3623 2823375708
3624 2823424115
3625 2825656805
3626 2826583643
3627 2834033736
3628 2842809437
3629 2842818139
3630 2842831129
3631 2842832365
3632 2842842388
3633 2842848654
3634 2842849226
3635 2842854798
3636 2842915603
3637 2842919568
3638 2844428399
3639 2844529159
3640 2844669501
3641 2846540673
3642 2847086590
3643 2847798937
3644 2852107054
3645 2852613482
3646 2852658271
3647 2852668782
3648 2854606083
3649 2855197391
3650 2858468363
3651 2860339622
3652 2860871385
3653 2865016591
3654 2869555482
3655 2871275976
3656 2871285832
3657 2876603243
3658 2878031774
3659 2880234275
3660 2881612562
3661 2884087839
3662 2887632269
3663 2888370139
3664 2891672373
3665 2895516091
3666 2900053002
3667 2904464516
3668 2904476060
3669 2904515361
3670 2904523609
3671 2904554295
3672 2908450760
3673 2908672462
3674 2912967484
3675 2913040732
3676 2916180199
3677 2917072860
3678 2919068248
3679 2919111007
3680 2919152229
3681 2919157317
3682 2919386740
3683 2919405911
3684 2919456715
3685 2919482150
3686 2919491521
3687 2919503826
3688 2919692392
3689 2919701024
3690 2923155636
3691 2923525661
3692 2923587715
3693 2923635923
3694 2926065602
3695 2927144898
3696 2927837579
3697 2929148228
3698 2929193405
3699 2931374359
3700 2931394715
3701 2931400494
3702 2932410093
3703 2935359288
3704 2935625736
3705 2937542412
3706 2937968671
3707 2939570070
3708 2939575390
3709 2939581433
3710 2939604837
3711 2939608652
3712 2939618515
3713 2939639264
3714 2939642911
3715 2939652992
3716 2941474613
3717 2945876809
3718 2945932574
3719 2945952193
3720 2945962481
3721 2946008817
3722 2946031879
3723 2947238707
3724 2952253277
3725 2953997967
3726 2969081081
3727 2969306568
3728 2971822455
3729 2974291745
3730 2974311057
3731 2974439310
3732 2978978667
3733 2984290384
3734 2984497566
3735 2984563539
3736 2984596273
3737 2988729875
3738 2990261514
3739 2998141954
3740 3007253506
3741 3007317721
3742 3007401219
3743 3007421605
3744 3007513375
3745 3007618399
3746 3007619868
3747 3007723774
3748 3007803567
3749 3007860664
3750 3007862819
3751 3007868313
3752 3007876340
3753 637319412
3754 640487732
3755 640938878
3756 8004596202
3757 8015397842
3758 8015689893
3759 8016735036
3760 8018223619
3761 8018409207
3762 8019501481
3763 8019505147
3764 8019775270
3765 8019778312
3766 8029998744
3767 8034965870
3768 8052496157
3769 8054288543
3770 8054349179
3771 8054359886
3772 8054507254
3773 8054846663
3774 8054852004
3775 8054932865
3776 8055092195
3777 8055095521
3778 8055100231
3779 8055696887
3780 8055772998
3781 8055822159
3782 8055879640
3783 8056117871
3784 8056124420
3785 8056127924
3786 8056135644
3787 8056139077
3788 8056147116
3789 8056152945
3790 8056155976
3791 8056161843
3792 8056169047
3793 8056175195
3794 8056183519
3795 8056573002
3796 8057161537
3797 8057306736
3798 8057799429

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17848

zf-ACC

Acetyl-CoA carboxylase zinc finger domain

79

104

1

PF01039

Carboxyl_trans

Carboxyl transferase domain

136

305

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9y-assembly1.cif.gz_B-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9677 28 287
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9661 28 280
2f9y-assembly1.cif.gz_B-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9531 28 287
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.944 28 280
5kdr-assembly1.cif.gz_B-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.943 28 285
ID Description Score Start End Superfamily
2f9yB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9677 28 287 3.90.226.10
2f9yB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9531 28 287 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9519 27 285 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9448 27 285 3.90.226.10
5kdrB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.943 28 285 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A377CC89-F1-model_v4 AcetylCoA carboxylase (EC 6.4.1.2) 0.9796 57 155 GO:0003989
GO:0006633
GO:0009329
GO:2001295
AF-A0A258C0Q4-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.9726 65 291 GO:0003989
GO:0006633
GO:0009329
GO:0016740
GO:2001295
AF-A0A090QYR6-F1-model_v4 Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2) 0.9724 57 164 GO:0003989
GO:0006633
GO:0009329
GO:0016740
GO:2001295
AF-A0A350D4F3-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.9694 27 285 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016740
GO:0046872
GO:2001295
AF-A0A840UZB0-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) 0.9689 38 281 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295

Map