F496013
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1899 | 929 | 3798 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300041411|Ga0439466_0034534|Ga0439466_0034534_355_1428 |
| Length | 357 |
| Sequence | MAEDSLGCTQVKPHADRGSQRVIAAHMNLAQGHTRGFERQAFGPPVLEKESMSNWLVDKLIPSIMRSEVKKSSVPEGLWHKCPSCDAVLYRPELEKTLDVCPKCNHHMRIGARARIDIFLDAEGRAELGADLEPVDRLKFRDGKKYKDRLTAAQKQTGEKDALISMSGTLLGMPVVVSAFEFSFMGGSMGAIVGERFVRAANYALENRCPMICFAASGGARMQEALISLMQMAKTSAVLARLREEGLPFISVLTDPVYGGVSASLAMLGDVIVAEPKALIGFAGPRVIEQTVREKLPEGFQRSEFLLEHGAIDMIIARQELRPRLGNLLAQLMGLPTPEFVAAPIVPIVIPPVPANL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 108 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 109 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 114 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 115 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 116 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 117 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 132 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 158 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 169 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 244 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 245 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 250 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 254 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 258 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 259 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 260 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 261 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 262 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 263 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 264 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 265 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 266 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 270 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 272 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 273 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 274 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 275 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 276 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 277 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 278 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 279 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 280 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 281 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 282 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 283 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 284 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 285 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 286 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 287 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 288 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 289 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 290 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 291 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 292 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 293 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 294 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 295 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 296 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 297 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 298 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 299 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 300 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 301 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 302 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 304 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 305 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 306 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 307 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 308 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 309 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 311 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 312 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 313 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 314 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 315 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 316 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 317 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 318 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 319 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 320 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 321 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 322 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 323 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 324 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 325 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 326 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 327 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 328 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 329 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 330 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 331 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 332 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 333 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 334 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 335 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 336 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 337 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 338 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 339 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 340 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 341 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 342 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 343 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 344 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 345 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 346 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 347 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 348 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 349 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 350 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 351 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 352 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 353 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 354 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 355 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 356 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 357 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 358 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 359 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 360 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 361 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 362 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 363 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 364 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 365 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 366 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 367 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 368 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 369 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 370 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 371 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 372 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 373 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 444 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 445 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 446 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 447 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 448 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 449 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 450 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 451 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 452 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 453 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 454 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 455 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 456 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 457 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 458 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 459 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 460 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 461 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 462 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 463 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 498 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 506 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 507 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 508 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 509 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 510 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 511 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 512 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 515 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 516 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 517 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 518 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 519 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 520 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 521 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 522 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 523 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 524 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 525 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 526 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 527 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 528 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 529 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 530 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 531 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 532 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 533 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 534 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 535 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 536 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 537 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 538 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 539 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 540 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 541 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 542 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 543 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 544 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 545 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 546 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 547 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 548 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 549 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 550 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 551 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 552 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 553 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 554 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 555 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 556 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 557 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 558 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 559 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 560 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 561 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 562 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 563 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 564 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 565 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 566 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 567 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 568 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 569 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 570 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 571 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 572 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 573 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 574 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 575 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 576 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 577 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 578 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 579 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 580 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 581 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 582 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 583 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 584 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 585 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 586 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 587 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 588 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 589 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 590 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 591 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 592 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 593 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 594 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 595 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 596 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 597 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 598 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 599 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 600 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 601 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 602 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 603 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 604 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 605 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 606 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 607 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 608 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 609 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 610 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 611 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 612 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 613 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 614 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 615 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 616 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 617 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 618 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 619 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 620 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 621 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 622 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 623 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 624 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 625 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 626 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 627 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 628 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 629 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 630 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 631 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 632 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 633 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 634 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 635 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 636 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 637 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 638 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 639 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 640 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 641 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 642 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 643 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 644 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 645 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 646 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 647 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 648 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 649 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 650 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 651 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 652 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 653 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 654 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 655 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 656 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 657 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 658 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 659 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 660 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 661 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 662 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 663 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 664 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 665 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 666 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 667 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 668 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 669 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 670 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 671 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 672 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 673 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 674 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 675 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 676 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 677 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 678 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 679 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 680 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 681 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 682 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 683 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 684 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 685 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 686 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 687 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 688 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 689 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 690 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 691 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 692 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 693 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 694 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 695 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 696 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 697 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 698 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 699 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 700 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 701 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 702 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 703 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 704 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 705 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 706 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 707 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 708 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 709 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 710 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 711 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 712 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 713 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 714 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 715 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 716 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 717 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 718 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 719 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 720 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 721 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 722 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 723 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 724 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 725 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 726 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 727 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 728 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 729 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 730 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 731 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 732 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 733 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 734 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 735 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 736 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 737 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 738 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 739 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 740 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 741 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 742 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 743 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 744 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 745 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 746 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 747 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 748 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 749 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 750 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 751 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 752 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 753 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 754 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 755 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 756 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 757 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 758 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 759 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 760 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 761 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 762 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 763 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 764 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 765 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 766 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 767 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 768 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 769 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 770 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 771 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 772 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 773 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 774 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 775 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 776 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 777 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 778 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 779 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 780 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 781 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 782 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 783 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 784 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 785 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 786 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 787 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 788 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 789 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 790 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 791 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 792 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 793 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 794 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 795 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 796 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 797 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 798 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 799 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 800 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 801 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 802 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 803 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 804 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 805 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 806 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 807 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 808 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 809 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 810 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 811 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 812 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 813 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 814 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 815 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 816 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 817 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 818 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 819 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 820 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 821 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 822 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 823 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 824 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 825 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 826 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 827 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 828 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 829 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 830 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 831 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 832 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 833 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 834 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 835 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 836 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 837 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 838 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 839 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 840 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 841 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 842 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 843 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 844 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 845 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 846 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 847 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 848 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 849 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 850 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 851 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 852 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 853 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 854 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 855 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 856 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 857 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 858 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 859 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 860 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 861 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 862 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 863 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 864 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 865 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 866 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 867 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 868 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 869 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 870 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 871 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 872 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 873 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 874 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 875 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 876 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 877 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 878 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 879 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 880 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 881 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 882 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 883 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 884 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 885 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 886 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 887 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 888 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 889 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 890 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 891 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 892 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 893 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 894 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 895 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 896 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 897 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 898 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 899 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 900 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 901 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 902 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
| 903 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 904 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 905 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 906 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 907 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 908 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 909 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 910 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 911 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 912 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 913 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 914 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 915 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 916 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 917 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 918 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 919 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 920 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 921 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 922 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 923 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 924 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 925 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 926 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 927 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 928 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 929 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.3 |
| Metatranscriptomes | 0.74 |
| Isolates | 21.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.21 |
| Bulb | 0.05 |
| Endosphere | 4.05 |
| Nodule | 1.84 |
| Rhizoplane | 7.16 |
| Rhizosphere | 74.83 |
| Stem | 0.05 |
| Stem Tuber | 0.32 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439466_0034534 | 3300041411 | Bacteria | 1714 |
| 2 | SwRhRL2b_contig_1293351 | 2162886007 | Bacteria | 1020 |
| 3 | SwRhRL2b_contig_3043338 | 2162886007 | Bacteria | 3452 |
| 4 | JGI24741J21665_1000158 | 3300001915 | Bacteria | 19398 |
| 5 | JGI24741J21665_1006265 | 3300001915 | Bacteria | 2405 |
| 6 | JGI24741J21665_1010208 | 3300001915 | Bacteria | 1692 |
| 7 | JGI24740J21852_10000049 | 3300001979 | Bacteria | 38240 |
| 8 | JGI24739J22299_10000804 | 3300001989 | Bacteria | 11483 |
| 9 | JGI24738J21930_10001700 | 3300002075 | Bacteria | 6019 |
| 10 | JGI25162J39368_1006058 | 3300002737 | Bacteria | 2177 |
| 11 | JGI25157J39369_1000298 | 3300002741 | Bacteria | 36141 |
| 12 | rootH2_10071538 | 3300003320 | Bacteria | 1731 |
| 13 | rootH1_10026054 | 3300003323 | Bacteria | 30471 |
| 14 | Ga0006562J51391_1059289 | 3300003578 | Bacteria | 5290 |
| 15 | Ga0006562J51391_1067747 | 3300003578 | Bacteria | 3240 |
| 16 | Ga0055538_1000093 | 3300003751 | Bacteria | 75896 |
| 17 | Ga0055539_1000138 | 3300003752 | Bacteria | 75896 |
| 18 | Ga0055539_1002413 | 3300003752 | Bacteria | 2876 |
| 19 | Ga0055533_1000142 | 3300003756 | Bacteria | 75896 |
| 20 | Ga0055532_1000152 | 3300003758 | Bacteria | 61495 |
| 21 | Ga0055525_1000342 | 3300003759 | Bacteria | 34036 |
| 22 | Ga0055527_1000266 | 3300003760 | Bacteria | 31574 |
| 23 | Ga0055535_1000606 | 3300003761 | Bacteria | 29564 |
| 24 | Ga0055535_1000805 | 3300003761 | Bacteria | 22731 |
| 25 | Ga0055535_1007291 | 3300003761 | Bacteria | 2130 |
| 26 | Ga0055542_1000803 | 3300003762 | Bacteria | 23207 |
| 27 | Ga0055529_1000709 | 3300003763 | Bacteria | 22272 |
| 28 | Ga0055536_1001963 | 3300003781 | Bacteria | 11830 |
| 29 | Ga0055536_1002321 | 3300003781 | Bacteria | 10765 |
| 30 | Ga0055536_1004042 | 3300003781 | Bacteria | 7639 |
| 31 | Ga0055530_10003078 | 3300003791 | Bacteria | 9915 |
| 32 | Ga0055540_1002628 | 3300003792 | Bacteria | 9324 |
| 33 | Ga0055531_10000517 | 3300003794 | Bacteria | 34871 |
| 34 | Ga0055541_1000091 | 3300003841 | Bacteria | 75896 |
| 35 | Ga0065165_1000113 | 3300005262 | Bacteria | 135963 |
| 36 | Ga0065714_10065334 | 3300005288 | Bacteria | 10809 |
| 37 | Ga0065704_10001088 | 3300005289 | Bacteria | 13402 |
| 38 | Ga0065704_10003695 | 3300005289 | Bacteria | 3867 |
| 39 | Ga0065704_10017716 | 3300005289 | Bacteria | 2262 |
| 40 | Ga0065704_10072724 | 3300005289 | Bacteria | 8093 |
| 41 | Ga0065704_10109043 | 3300005289 | Bacteria | 2013 |
| 42 | Ga0065712_10070206 | 3300005290 | Bacteria | 6226 |
| 43 | Ga0065707_10108505 | 3300005295 | Bacteria | 2508 |
| 44 | Ga0070658_10000868 | 3300005327 | Bacteria | 25839 |
| 45 | Ga0070658_10017382 | 3300005327 | Bacteria | 5755 |
| 46 | Ga0070690_100010523 | 3300005330 | Bacteria | 5387 |
| 47 | Ga0070690_100027356 | 3300005330 | Bacteria | 3525 |
| 48 | Ga0070690_100122135 | 3300005330 | Bacteria | 1749 |
| 49 | Ga0070670_100005617 | 3300005331 | Bacteria | 10584 |
| 50 | Ga0070670_100029308 | 3300005331 | Bacteria | 4737 |
| 51 | Ga0070670_100234669 | 3300005331 | Bacteria | 1597 |
| 52 | Ga0070677_10036026 | 3300005333 | Bacteria | 1921 |
| 53 | Ga0070677_10040457 | 3300005333 | Bacteria | 1834 |
| 54 | Ga0068869_100004095 | 3300005334 | Bacteria | 9027 |
| 55 | Ga0068869_100072327 | 3300005334 | Bacteria | 2555 |
| 56 | Ga0070666_10000007 | 3300005335 | Bacteria | 293732 |
| 57 | Ga0070666_10000444 | 3300005335 | Bacteria | 25283 |
| 58 | Ga0070666_10027083 | 3300005335 | Bacteria | 3751 |
| 59 | Ga0070680_100000343 | 3300005336 | Bacteria | 31285 |
| 60 | Ga0070680_100037245 | 3300005336 | Bacteria | 3930 |
| 61 | Ga0070680_100223442 | 3300005336 | Bacteria | 1590 |
| 62 | Ga0070682_100007669 | 3300005337 | Bacteria | 6080 |
| 63 | Ga0070682_100026930 | 3300005337 | Bacteria | 3446 |
| 64 | Ga0070682_100060755 | 3300005337 | Bacteria | 2390 |
| 65 | Ga0070682_100395971 | 3300005337 | Bacteria | 1043 |
| 66 | Ga0068868_100053801 | 3300005338 | Bacteria | 3172 |
| 67 | Ga0068868_100162531 | 3300005338 | Bacteria | 1845 |
| 68 | Ga0068868_100223465 | 3300005338 | Bacteria | 1577 |
| 69 | Ga0070660_100043062 | 3300005339 | Bacteria | 3448 |
| 70 | Ga0070689_100002094 | 3300005340 | Bacteria | 12961 |
| 71 | Ga0070689_100008406 | 3300005340 | Bacteria | 7270 |
| 72 | Ga0070691_10001257 | 3300005341 | Bacteria | 10703 |
| 73 | Ga0070691_10082888 | 3300005341 | Bacteria | 1572 |
| 74 | Ga0070691_10148897 | 3300005341 | Bacteria | 1198 |
| 75 | Ga0070687_100002366 | 3300005343 | Bacteria | 7032 |
| 76 | Ga0070687_100047574 | 3300005343 | Bacteria | 2201 |
| 77 | Ga0070687_100129424 | 3300005343 | Bacteria | 1455 |
| 78 | Ga0070661_100000757 | 3300005344 | Bacteria | 23255 |
| 79 | Ga0070661_100000961 | 3300005344 | Bacteria | 20513 |
| 80 | Ga0070661_100027551 | 3300005344 | Bacteria | 4093 |
| 81 | Ga0070692_10000083 | 3300005345 | Bacteria | 19974 |
| 82 | Ga0070692_10047225 | 3300005345 | Bacteria | 2228 |
| 83 | Ga0070668_100006043 | 3300005347 | Bacteria | 8978 |
| 84 | Ga0070668_100042258 | 3300005347 | Bacteria | 3494 |
| 85 | Ga0070669_100000904 | 3300005353 | Bacteria | 21597 |
| 86 | Ga0070669_100024486 | 3300005353 | Bacteria | 4327 |
| 87 | Ga0070669_100029850 | 3300005353 | Bacteria | 3933 |
| 88 | Ga0070669_100144693 | 3300005353 | Bacteria | 1836 |
| 89 | Ga0070675_100001548 | 3300005354 | Bacteria | 17017 |
| 90 | Ga0070675_100064282 | 3300005354 | Bacteria | 3034 |
| 91 | Ga0070675_100086732 | 3300005354 | Bacteria | 2616 |
| 92 | Ga0070671_100075147 | 3300005355 | Bacteria | 2822 |
| 93 | Ga0070674_100330205 | 3300005356 | Bacteria | 1225 |
| 94 | Ga0070673_100016400 | 3300005364 | Bacteria | 5237 |
| 95 | Ga0070688_100002539 | 3300005365 | Bacteria | 9241 |
| 96 | Ga0070659_100003826 | 3300005366 | Bacteria | 10736 |
| 97 | Ga0070659_100069288 | 3300005366 | Bacteria | 2799 |
| 98 | Ga0070709_10013734 | 3300005434 | Bacteria | 4561 |
| 99 | Ga0070714_100002422 | 3300005435 | Bacteria | 13743 |
| 100 | Ga0070714_100020495 | 3300005435 | Bacteria | 5399 |
| 101 | Ga0070713_100482727 | 3300005436 | Bacteria | 1167 |
| 102 | Ga0070701_10004182 | 3300005438 | Bacteria | 5808 |
| 103 | Ga0070701_10008464 | 3300005438 | Bacteria | 4452 |
| 104 | Ga0070701_10016863 | 3300005438 | Bacteria | 3405 |
| 105 | Ga0070701_10061065 | 3300005438 | Bacteria | 1987 |
| 106 | Ga0070711_100112475 | 3300005439 | Bacteria | 2000 |
| 107 | Ga0070711_100173829 | 3300005439 | Bacteria | 1644 |
| 108 | Ga0070700_100050794 | 3300005441 | Bacteria | 2579 |
| 109 | Ga0070700_100063045 | 3300005441 | Bacteria | 2344 |
| 110 | Ga0070694_100029016 | 3300005444 | Bacteria | 3607 |
| 111 | Ga0070694_100051756 | 3300005444 | Bacteria | 2774 |
| 112 | Ga0070708_100264494 | 3300005445 | Bacteria | 1617 |
| 113 | Ga0070663_100010299 | 3300005455 | Bacteria | 5826 |
| 114 | Ga0070663_100037660 | 3300005455 | Bacteria | 3368 |
| 115 | Ga0070663_100194549 | 3300005455 | Bacteria | 1580 |
| 116 | Ga0070678_100067305 | 3300005456 | Bacteria | 2665 |
| 117 | Ga0070678_100276515 | 3300005456 | Bacteria | 1418 |
| 118 | Ga0070662_100002124 | 3300005457 | Bacteria | 12146 |
| 119 | Ga0070662_100035570 | 3300005457 | Bacteria | 3519 |
| 120 | Ga0070681_10002432 | 3300005458 | Bacteria | 17035 |
| 121 | Ga0070681_10009557 | 3300005458 | Bacteria | 9542 |
| 122 | Ga0070681_10031584 | 3300005458 | Bacteria | 5316 |
| 123 | Ga0068867_100071160 | 3300005459 | Bacteria | 2601 |
| 124 | Ga0068867_100087873 | 3300005459 | Bacteria | 2354 |
| 125 | Ga0068867_100088040 | 3300005459 | Bacteria | 2353 |
| 126 | Ga0070685_10156004 | 3300005466 | Bacteria | 1451 |
| 127 | Ga0070706_100201738 | 3300005467 | Bacteria | 1858 |
| 128 | Ga0070679_100000091 | 3300005530 | Bacteria | 68903 |
| 129 | Ga0070679_100000372 | 3300005530 | Bacteria | 38070 |
| 130 | Ga0070679_100061780 | 3300005530 | Bacteria | 3734 |
| 131 | Ga0070679_100190196 | 3300005530 | Bacteria | 2022 |
| 132 | Ga0070684_100002177 | 3300005535 | Bacteria | 14467 |
| 133 | Ga0070684_100183733 | 3300005535 | Bacteria | 1901 |
| 134 | Ga0070697_100462287 | 3300005536 | Bacteria | 1106 |
| 135 | Ga0068853_100008118 | 3300005539 | Bacteria | 8426 |
| 136 | Ga0070672_100028669 | 3300005543 | Bacteria | 4166 |
| 137 | Ga0070672_100141552 | 3300005543 | Bacteria | 1984 |
| 138 | Ga0070686_100001564 | 3300005544 | Bacteria | 12861 |
| 139 | Ga0070686_100005969 | 3300005544 | Bacteria | 6755 |
| 140 | Ga0070695_100068983 | 3300005545 | Bacteria | 2310 |
| 141 | Ga0070696_100001089 | 3300005546 | Bacteria | 17556 |
| 142 | Ga0070693_100017566 | 3300005547 | Bacteria | 3721 |
| 143 | Ga0070665_100000374 | 3300005548 | Bacteria | 66650 |
| 144 | Ga0070665_100000817 | 3300005548 | Bacteria | 40729 |
| 145 | Ga0070665_100001536 | 3300005548 | Bacteria | 26669 |
| 146 | Ga0070665_100047770 | 3300005548 | Bacteria | 4295 |
| 147 | Ga0070665_100110420 | 3300005548 | Bacteria | 2753 |
| 148 | Ga0070665_100158536 | 3300005548 | Bacteria | 2265 |
| 149 | Ga0070704_100035195 | 3300005549 | Bacteria | 3403 |
| 150 | Ga0068855_100010100 | 3300005563 | Bacteria | 11379 |
| 151 | Ga0068855_100021239 | 3300005563 | Bacteria | 7783 |
| 152 | Ga0068855_100158400 | 3300005563 | Bacteria | 2571 |
| 153 | Ga0070664_100000485 | 3300005564 | Bacteria | 30116 |
| 154 | Ga0070664_100010951 | 3300005564 | Bacteria | 7356 |
| 155 | Ga0070664_100031375 | 3300005564 | Bacteria | 4439 |
| 156 | Ga0070664_100260673 | 3300005564 | Bacteria | 1560 |
| 157 | Ga0068857_100233172 | 3300005577 | Bacteria | 1684 |
| 158 | Ga0068854_100001982 | 3300005578 | Bacteria | 12523 |
| 159 | Ga0068854_100019287 | 3300005578 | Bacteria | 4594 |
| 160 | Ga0068854_100052940 | 3300005578 | Bacteria | 2912 |
| 161 | Ga0068854_100319167 | 3300005578 | Bacteria | 1262 |
| 162 | Ga0068856_100002593 | 3300005614 | Bacteria | 18615 |
| 163 | Ga0068856_100035944 | 3300005614 | Bacteria | 4857 |
| 164 | Ga0068856_100530382 | 3300005614 | Bacteria | 1198 |
| 165 | Ga0070702_100211906 | 3300005615 | Bacteria | 1290 |
| 166 | Ga0068852_100003098 | 3300005616 | Bacteria | 11576 |
| 167 | Ga0068852_100004962 | 3300005616 | Bacteria | 9456 |
| 168 | Ga0068852_100067893 | 3300005616 | Bacteria | 3118 |
| 169 | Ga0068859_100003963 | 3300005617 | Bacteria | 15103 |
| 170 | Ga0068859_100020692 | 3300005617 | Bacteria | 6603 |
| 171 | Ga0068859_100125190 | 3300005617 | Bacteria | 2639 |
| 172 | Ga0068859_100156214 | 3300005617 | Bacteria | 2358 |
| 173 | Ga0068859_100173535 | 3300005617 | Bacteria | 2238 |
| 174 | Ga0068864_100005280 | 3300005618 | Bacteria | 10583 |
| 175 | Ga0068864_100009820 | 3300005618 | Bacteria | 7892 |
| 176 | Ga0068864_100028224 | 3300005618 | Bacteria | 4741 |
| 177 | Ga0068866_10048434 | 3300005718 | Bacteria | 2149 |
| 178 | Ga0068861_100008096 | 3300005719 | Bacteria | 7232 |
| 179 | Ga0068861_100011725 | 3300005719 | Bacteria | 6101 |
| 180 | Ga0068861_100078095 | 3300005719 | Bacteria | 2584 |
| 181 | Ga0068851_10030188 | 3300005834 | Bacteria | 2687 |
| 182 | Ga0068870_10048952 | 3300005840 | Bacteria | 2227 |
| 183 | Ga0068870_10133658 | 3300005840 | Bacteria | 1444 |
| 184 | Ga0068863_100009131 | 3300005841 | Bacteria | 9683 |
| 185 | Ga0068863_100035159 | 3300005841 | Bacteria | 4773 |
| 186 | Ga0068863_100037003 | 3300005841 | Bacteria | 4647 |
| 187 | Ga0068863_100184196 | 3300005841 | Bacteria | 2005 |
| 188 | Ga0068863_100251306 | 3300005841 | Bacteria | 1708 |
| 189 | Ga0068858_100036443 | 3300005842 | Bacteria | 4561 |
| 190 | Ga0068860_100001649 | 3300005843 | Bacteria | 23875 |
| 191 | Ga0068860_100078858 | 3300005843 | Bacteria | 3132 |
| 192 | Ga0068860_100083892 | 3300005843 | Bacteria | 3031 |
| 193 | Ga0068862_100008766 | 3300005844 | Bacteria | 8377 |
| 194 | Ga0068862_100012326 | 3300005844 | Bacteria | 7070 |
| 195 | Ga0068862_100047522 | 3300005844 | Bacteria | 3663 |
| 196 | Ga0081455_10020754 | 3300005937 | Bacteria | 6176 |
| 197 | Ga0070717_10016171 | 3300006028 | Bacteria | 5780 |
| 198 | Ga0070717_10218057 | 3300006028 | Bacteria | 1676 |
| 199 | Ga0075364_10002873 | 3300006051 | Bacteria | 9705 |
| 200 | Ga0075364_10023125 | 3300006051 | Bacteria | 3932 |
| 201 | Ga0075432_10094399 | 3300006058 | Bacteria | 1098 |
| 202 | Ga0070715_10031475 | 3300006163 | Bacteria | 2154 |
| 203 | Ga0070716_100003847 | 3300006173 | Bacteria | 7125 |
| 204 | Ga0070712_100245917 | 3300006175 | Bacteria | 1427 |
| 205 | Ga0070712_100304405 | 3300006175 | Bacteria | 1291 |
| 206 | Ga0075362_10015605 | 3300006177 | Bacteria | 3093 |
| 207 | Ga0097621_100112989 | 3300006237 | Bacteria | 2297 |
| 208 | Ga0068871_100013415 | 3300006358 | Bacteria | 6082 |
| 209 | Ga0068871_100055139 | 3300006358 | Bacteria | 3226 |
| 210 | Ga0068871_100071187 | 3300006358 | Bacteria | 2860 |
| 211 | Ga0075428_100005937 | 3300006844 | Bacteria | 13570 |
| 212 | Ga0075428_100021775 | 3300006844 | Bacteria | 7097 |
| 213 | Ga0075428_100089647 | 3300006844 | Bacteria | 3354 |
| 214 | Ga0075430_100025234 | 3300006846 | Bacteria | 5055 |
| 215 | Ga0075430_100030214 | 3300006846 | Bacteria | 4600 |
| 216 | Ga0075430_100085791 | 3300006846 | Bacteria | 2636 |
| 217 | Ga0075430_100498729 | 3300006846 | Bacteria | 1005 |
| 218 | Ga0075431_100008918 | 3300006847 | Bacteria | 10050 |
| 219 | Ga0075431_100040488 | 3300006847 | Bacteria | 4803 |
| 220 | Ga0075431_100127534 | 3300006847 | Bacteria | 2625 |
| 221 | Ga0075431_100265589 | 3300006847 | Bacteria | 1741 |
| 222 | Ga0075429_100022013 | 3300006880 | Bacteria | 5528 |
| 223 | Ga0075429_100034608 | 3300006880 | Bacteria | 4390 |
| 224 | Ga0075429_100053422 | 3300006880 | Bacteria | 3516 |
| 225 | Ga0075429_100127844 | 3300006880 | Bacteria | 2222 |
| 226 | Ga0075429_100243046 | 3300006880 | Bacteria | 1576 |
| 227 | Ga0068865_100163229 | 3300006881 | Bacteria | 1701 |
| 228 | Ga0068865_100291499 | 3300006881 | Bacteria | 1303 |
| 229 | Ga0097620_100003963 | 3300006931 | Bacteria | 15103 |
| 230 | Ga0097620_100020691 | 3300006931 | Bacteria | 6603 |
| 231 | Ga0097620_100125189 | 3300006931 | Bacteria | 2639 |
| 232 | Ga0097620_100156216 | 3300006931 | Bacteria | 2358 |
| 233 | Ga0097620_100173525 | 3300006931 | Bacteria | 2238 |
| 234 | Ga0079104_1000120 | 3300006946 | Bacteria | 111969 |
| 235 | Ga0079104_1000135 | 3300006946 | Bacteria | 103632 |
| 236 | Ga0079104_1000375 | 3300006946 | Bacteria | 52652 |
| 237 | Ga0079104_1000920 | 3300006946 | Bacteria | 23632 |
| 238 | Ga0079104_1002489 | 3300006946 | Bacteria | 9828 |
| 239 | Ga0099826_10035691 | 3300006948 | Bacteria | 3531 |
| 240 | Ga0099794_10007866 | 3300007265 | Bacteria | 4404 |
| 241 | Ga0099794_10074679 | 3300007265 | Bacteria | 1665 |
| 242 | Ga0099795_10000004 | 3300007788 | Bacteria | 108633 |
| 243 | Ga0099795_10009077 | 3300007788 | Bacteria | 2870 |
| 244 | Ga0105251_10000500 | 3300009011 | Bacteria | 37162 |
| 245 | Ga0105251_10000971 | 3300009011 | Bacteria | 25452 |
| 246 | Ga0105251_10001251 | 3300009011 | Bacteria | 22007 |
| 247 | Ga0105251_10008997 | 3300009011 | Bacteria | 5954 |
| 248 | Ga0105251_10018140 | 3300009011 | Bacteria | 3751 |
| 249 | Ga0105251_10020565 | 3300009011 | Bacteria | 3465 |
| 250 | Ga0105251_10121300 | 3300009011 | Bacteria | 1187 |
| 251 | Ga0105244_10000224 | 3300009036 | Bacteria | 58869 |
| 252 | Ga0105244_10000246 | 3300009036 | Bacteria | 55589 |
| 253 | Ga0105244_10005965 | 3300009036 | Bacteria | 7985 |
| 254 | Ga0105244_10009502 | 3300009036 | Bacteria | 5974 |
| 255 | Ga0105244_10009873 | 3300009036 | Bacteria | 5826 |
| 256 | Ga0105244_10028238 | 3300009036 | Bacteria | 3012 |
| 257 | Ga0105244_10031514 | 3300009036 | Bacteria | 2813 |
| 258 | Ga0105244_10033675 | 3300009036 | Bacteria | 2700 |
| 259 | Ga0105250_10000024 | 3300009092 | Bacteria | 218115 |
| 260 | Ga0105250_10001909 | 3300009092 | Bacteria | 10814 |
| 261 | Ga0105250_10002486 | 3300009092 | Bacteria | 9247 |
| 262 | Ga0105250_10003102 | 3300009092 | Bacteria | 7995 |
| 263 | Ga0105250_10008560 | 3300009092 | Bacteria | 4338 |
| 264 | Ga0105250_10040436 | 3300009092 | Bacteria | 1870 |
| 265 | Ga0105240_10029428 | 3300009093 | Bacteria | 7155 |
| 266 | Ga0105240_10058195 | 3300009093 | Bacteria | 4825 |
| 267 | Ga0105240_10159492 | 3300009093 | Bacteria | 2681 |
| 268 | Ga0105240_10170151 | 3300009093 | Bacteria | 2581 |
| 269 | Ga0105240_10215765 | 3300009093 | Bacteria | 2239 |
| 270 | Ga0111539_10013105 | 3300009094 | Bacteria | 10372 |
| 271 | Ga0111539_10275565 | 3300009094 | Bacteria | 1958 |
| 272 | Ga0105245_10036619 | 3300009098 | Bacteria | 4360 |
| 273 | Ga0105245_10142930 | 3300009098 | Bacteria | 2255 |
| 274 | Ga0105245_10148507 | 3300009098 | Bacteria | 2214 |
| 275 | Ga0105245_10155204 | 3300009098 | Bacteria | 2168 |
| 276 | Ga0105247_10007410 | 3300009101 | Bacteria | 6735 |
| 277 | Ga0105243_10001321 | 3300009148 | Bacteria | 22100 |
| 278 | Ga0105243_10002510 | 3300009148 | Bacteria | 15315 |
| 279 | Ga0105243_10178641 | 3300009148 | Bacteria | 1844 |
| 280 | Ga0105241_10460500 | 3300009174 | Bacteria | 1127 |
| 281 | Ga0105241_10525067 | 3300009174 | Bacteria | 1059 |
| 282 | Ga0105242_10012095 | 3300009176 | Bacteria | 6640 |
| 283 | Ga0105242_10064552 | 3300009176 | Bacteria | 3019 |
| 284 | Ga0105248_10033962 | 3300009177 | Bacteria | 5701 |
| 285 | Ga0105248_10046079 | 3300009177 | Bacteria | 4887 |
| 286 | Ga0105248_10545284 | 3300009177 | Bacteria | 1308 |
| 287 | Ga0105237_10000335 | 3300009545 | Bacteria | 66335 |
| 288 | Ga0105237_10006477 | 3300009545 | Bacteria | 12975 |
| 289 | Ga0105238_10001931 | 3300009551 | Bacteria | 20819 |
| 290 | Ga0105238_10002259 | 3300009551 | Bacteria | 19408 |
| 291 | Ga0105238_10085859 | 3300009551 | Bacteria | 3135 |
| 292 | Ga0105238_10241394 | 3300009551 | Bacteria | 1784 |
| 293 | Ga0105249_10024343 | 3300009553 | Bacteria | 5441 |
| 294 | Ga0105249_10392022 | 3300009553 | Bacteria | 1417 |
| 295 | Ga0105030_102265 | 3300009987 | Bacteria | 1684 |
| 296 | Ga0099796_10000006 | 3300010159 | Bacteria | 66689 |
| 297 | Ga0099796_10014045 | 3300010159 | Bacteria | 2302 |
| 298 | Ga0105239_10013236 | 3300010375 | Bacteria | 9169 |
| 299 | Ga0105239_10067141 | 3300010375 | Bacteria | 3939 |
| 300 | Ga0105246_10005977 | 3300011119 | Bacteria | 7432 |
| 301 | Ga0105246_10069796 | 3300011119 | Bacteria | 2469 |
| 302 | Ga0105246_10153728 | 3300011119 | Bacteria | 1745 |
| 303 | Ga0157345_1000334 | 3300012498 | Bacteria | 5606 |
| 304 | Ga0157373_10021414 | 3300013100 | Bacteria | 4697 |
| 305 | Ga0157373_10070915 | 3300013100 | Bacteria | 2462 |
| 306 | Ga0157373_10072867 | 3300013100 | Bacteria | 2424 |
| 307 | Ga0157373_10078059 | 3300013100 | Bacteria | 2335 |
| 308 | Ga0157371_10000406 | 3300013102 | Bacteria | 53786 |
| 309 | Ga0157371_10004097 | 3300013102 | Bacteria | 12880 |
| 310 | Ga0157371_10006011 | 3300013102 | Bacteria | 10112 |
| 311 | Ga0157371_10012661 | 3300013102 | Bacteria | 6435 |
| 312 | Ga0157371_10079558 | 3300013102 | Bacteria | 2322 |
| 313 | Ga0157370_10001889 | 3300013104 | Bacteria | 25787 |
| 314 | Ga0157370_10002468 | 3300013104 | Bacteria | 22309 |
| 315 | Ga0157370_10004655 | 3300013104 | Bacteria | 15667 |
| 316 | Ga0157370_10012990 | 3300013104 | Bacteria | 8605 |
| 317 | Ga0157370_10031845 | 3300013104 | Bacteria | 5155 |
| 318 | Ga0157370_10044001 | 3300013104 | Bacteria | 4296 |
| 319 | Ga0157370_10086697 | 3300013104 | Bacteria | 2941 |
| 320 | Ga0157369_10000107 | 3300013105 | Bacteria | 117307 |
| 321 | Ga0157369_10001202 | 3300013105 | Bacteria | 32234 |
| 322 | Ga0157369_10007741 | 3300013105 | Bacteria | 12359 |
| 323 | Ga0157369_10007861 | 3300013105 | Bacteria | 12263 |
| 324 | Ga0157369_10057845 | 3300013105 | Bacteria | 4182 |
| 325 | Ga0157374_10000600 | 3300013296 | Bacteria | 31879 |
| 326 | Ga0157374_10266450 | 3300013296 | Bacteria | 1689 |
| 327 | Ga0157378_10385231 | 3300013297 | Bacteria | 1378 |
| 328 | Ga0163162_10001668 | 3300013306 | Bacteria | 20833 |
| 329 | Ga0163162_10021683 | 3300013306 | Bacteria | 6327 |
| 330 | Ga0163162_10133574 | 3300013306 | Bacteria | 2592 |
| 331 | Ga0157372_10000715 | 3300013307 | Bacteria | 36428 |
| 332 | Ga0157372_10003727 | 3300013307 | Bacteria | 16365 |
| 333 | Ga0157372_10004291 | 3300013307 | Bacteria | 15241 |
| 334 | Ga0157372_10010698 | 3300013307 | Bacteria | 9764 |
| 335 | Ga0157372_10032929 | 3300013307 | Bacteria | 5688 |
| 336 | Ga0157372_10066732 | 3300013307 | Bacteria | 4042 |
| 337 | Ga0157372_10088454 | 3300013307 | Bacteria | 3517 |
| 338 | Ga0157375_10007002 | 3300013308 | Bacteria | 9846 |
| 339 | Ga0157375_10060961 | 3300013308 | Bacteria | 3744 |
| 340 | Ga0157375_10360902 | 3300013308 | Bacteria | 1619 |
| 341 | Ga0157375_10607457 | 3300013308 | Bacteria | 1252 |
| 342 | Ga0163163_10000168 | 3300014325 | Bacteria | 68808 |
| 343 | Ga0163163_10000848 | 3300014325 | Bacteria | 26014 |
| 344 | Ga0163163_10022217 | 3300014325 | Bacteria | 6002 |
| 345 | Ga0163163_10118014 | 3300014325 | Bacteria | 2685 |
| 346 | Ga0157380_10000204 | 3300014326 | Bacteria | 34955 |
| 347 | Ga0157380_10000702 | 3300014326 | Bacteria | 20873 |
| 348 | Ga0157380_10004085 | 3300014326 | Bacteria | 10080 |
| 349 | Ga0157380_10011556 | 3300014326 | Bacteria | 6380 |
| 350 | Ga0157380_10120408 | 3300014326 | Bacteria | 2222 |
| 351 | Ga0157380_10211056 | 3300014326 | Bacteria | 1730 |
| 352 | Ga0182008_10002836 | 3300014497 | Bacteria | 10718 |
| 353 | Ga0182008_10006502 | 3300014497 | Bacteria | 6526 |
| 354 | Ga0182008_10057780 | 3300014497 | Bacteria | 1915 |
| 355 | Ga0182008_10059674 | 3300014497 | Bacteria | 1882 |
| 356 | Ga0157379_10000153 | 3300014968 | Bacteria | 51100 |
| 357 | Ga0157379_10321153 | 3300014968 | Bacteria | 1414 |
| 358 | Ga0157376_10166433 | 3300014969 | Bacteria | 2003 |
| 359 | Ga0157376_10367091 | 3300014969 | Bacteria | 1382 |
| 360 | Ga0182006_1000027 | 3300015261 | Bacteria | 252946 |
| 361 | Ga0182006_1006580 | 3300015261 | Bacteria | 5384 |
| 362 | Ga0182006_1029155 | 3300015261 | Bacteria | 2238 |
| 363 | Ga0182006_1030073 | 3300015261 | Bacteria | 2198 |
| 364 | Ga0182007_10030939 | 3300015262 | Bacteria | 1826 |
| 365 | Ga0163161_10085264 | 3300017792 | Bacteria | 2330 |
| 366 | Ga0163161_10167816 | 3300017792 | Bacteria | 1677 |
| 367 | Ga0163161_10225715 | 3300017792 | Bacteria | 1452 |
| 368 | Ga0163161_10540087 | 3300017792 | Bacteria | 954 |
| 369 | Ga0206356_10269087 | 3300020070 | Bacteria | 4369 |
| 370 | Ga0206354_10944045 | 3300020081 | Bacteria | 3035 |
| 371 | Ga0206353_10734867 | 3300020082 | Bacteria | 5930 |
| 372 | Ga0206353_10961766 | 3300020082 | Bacteria | 11309 |
| 373 | Ga0154015_1412532 | 3300020610 | Bacteria | 1600 |
| 374 | Ga0213871_10020754 | 3300021441 | Bacteria | 1631 |
| 375 | Ga0209760_100079 | 3300025207 | Bacteria | 77345 |
| 376 | Ga0209760_100211 | 3300025207 | Bacteria | 26630 |
| 377 | Ga0209784_100128 | 3300025224 | Bacteria | 76497 |
| 378 | Ga0209566_100157 | 3300025225 | Bacteria | 76430 |
| 379 | Ga0209674_100180 | 3300025226 | Bacteria | 76497 |
| 380 | Ga0209674_100523 | 3300025226 | Bacteria | 15570 |
| 381 | Ga0209674_103020 | 3300025226 | Bacteria | 3247 |
| 382 | Ga0209672_100018 | 3300025228 | Bacteria | 432924 |
| 383 | Ga0209147_100183 | 3300025229 | Bacteria | 75926 |
| 384 | Ga0209563_100144 | 3300025230 | Bacteria | 76497 |
| 385 | Ga0209563_100231 | 3300025230 | Bacteria | 27006 |
| 386 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 387 | Ga0207427_100048 | 3300025231 | Bacteria | 238464 |
| 388 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 389 | Ga0209437_100094 | 3300025233 | Bacteria | 238465 |
| 390 | Ga0209437_101381 | 3300025233 | Bacteria | 6152 |
| 391 | Ga0209258_100024 | 3300025242 | Bacteria | 542096 |
| 392 | Ga0209258_100310 | 3300025242 | Bacteria | 76430 |
| 393 | Ga0209646_1000355 | 3300025246 | Bacteria | 32593 |
| 394 | Ga0209026_1000056 | 3300025250 | Bacteria | 236450 |
| 395 | Ga0209677_100127 | 3300025253 | Bacteria | 76548 |
| 396 | Ga0209677_101128 | 3300025253 | Bacteria | 12514 |
| 397 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 398 | Ga0209759_1000166 | 3300025256 | Bacteria | 113080 |
| 399 | Ga0209129_1006397 | 3300025258 | Bacteria | 3819 |
| 400 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 401 | Ga0209233_1000106 | 3300025261 | Bacteria | 268795 |
| 402 | Ga0209455_1000029 | 3300025272 | Bacteria | 542096 |
| 403 | Ga0209675_1011730 | 3300025291 | Bacteria | 2884 |
| 404 | Ga0209676_1000055 | 3300025292 | Bacteria | 361565 |
| 405 | Ga0209676_1000115 | 3300025292 | Bacteria | 205183 |
| 406 | Ga0209676_1000556 | 3300025292 | Bacteria | 56739 |
| 407 | Ga0209676_1000950 | 3300025292 | Bacteria | 35488 |
| 408 | Ga0209676_1000959 | 3300025292 | Bacteria | 34915 |
| 409 | Ga0209676_1004177 | 3300025292 | Bacteria | 8207 |
| 410 | Ga0209758_1034692 | 3300025297 | Bacteria | 2002 |
| 411 | Ga0209050_1000606 | 3300025298 | Bacteria | 57003 |
| 412 | Ga0209050_1000941 | 3300025298 | Bacteria | 37976 |
| 413 | Ga0209050_1000970 | 3300025298 | Bacteria | 36710 |
| 414 | Ga0209050_1016874 | 3300025298 | Bacteria | 2952 |
| 415 | Ga0207426_1046525 | 3300025302 | Bacteria | 1313 |
| 416 | Ga0209051_1000054 | 3300025303 | Bacteria | 280804 |
| 417 | Ga0209051_1000083 | 3300025303 | Bacteria | 192732 |
| 418 | Ga0209051_1000429 | 3300025303 | Bacteria | 57551 |
| 419 | Ga0209257_1000090 | 3300025304 | Bacteria | 274746 |
| 420 | Ga0209257_1000175 | 3300025304 | Bacteria | 165070 |
| 421 | Ga0209257_1018791 | 3300025304 | Bacteria | 2638 |
| 422 | Ga0209257_1030643 | 3300025304 | Bacteria | 1733 |
| 423 | Ga0207656_10001116 | 3300025321 | Bacteria | 8827 |
| 424 | Ga0207656_10002494 | 3300025321 | Bacteria | 6219 |
| 425 | Ga0207656_10070981 | 3300025321 | Bacteria | 1547 |
| 426 | Ga0207696_1000019 | 3300025711 | Bacteria | 476309 |
| 427 | Ga0207696_1000175 | 3300025711 | Bacteria | 102142 |
| 428 | Ga0207696_1000275 | 3300025711 | Bacteria | 61367 |
| 429 | Ga0207696_1000383 | 3300025711 | Bacteria | 42719 |
| 430 | Ga0207696_1000426 | 3300025711 | Bacteria | 38552 |
| 431 | Ga0207696_1001872 | 3300025711 | Bacteria | 10780 |
| 432 | Ga0207696_1006240 | 3300025711 | Bacteria | 4827 |
| 433 | Ga0207696_1007110 | 3300025711 | Bacteria | 4421 |
| 434 | Ga0207696_1007189 | 3300025711 | Bacteria | 4384 |
| 435 | Ga0207696_1007329 | 3300025711 | Bacteria | 4332 |
| 436 | Ga0207696_1018686 | 3300025711 | Bacteria | 2271 |
| 437 | Ga0207655_1000004 | 3300025728 | Bacteria | 1021221 |
| 438 | Ga0207655_1000019 | 3300025728 | Bacteria | 536324 |
| 439 | Ga0207655_1000062 | 3300025728 | Bacteria | 258054 |
| 440 | Ga0207655_1000115 | 3300025728 | Bacteria | 162114 |
| 441 | Ga0207655_1000434 | 3300025728 | Bacteria | 56142 |
| 442 | Ga0207655_1001025 | 3300025728 | Bacteria | 28225 |
| 443 | Ga0207655_1001255 | 3300025728 | Bacteria | 24204 |
| 444 | Ga0207655_1001801 | 3300025728 | Bacteria | 18589 |
| 445 | Ga0207655_1001882 | 3300025728 | Bacteria | 18026 |
| 446 | Ga0207655_1005926 | 3300025728 | Bacteria | 8187 |
| 447 | Ga0207655_1010454 | 3300025728 | Bacteria | 5626 |
| 448 | Ga0207655_1014037 | 3300025728 | Bacteria | 4556 |
| 449 | Ga0207655_1033064 | 3300025728 | Bacteria | 2351 |
| 450 | Ga0207713_1000023 | 3300025735 | Bacteria | 346097 |
| 451 | Ga0207713_1000207 | 3300025735 | Bacteria | 79895 |
| 452 | Ga0207713_1000299 | 3300025735 | Bacteria | 56880 |
| 453 | Ga0207713_1000681 | 3300025735 | Bacteria | 31842 |
| 454 | Ga0207713_1003198 | 3300025735 | Bacteria | 11317 |
| 455 | Ga0207713_1003297 | 3300025735 | Bacteria | 11099 |
| 456 | Ga0207713_1004796 | 3300025735 | Bacteria | 8684 |
| 457 | Ga0207713_1006447 | 3300025735 | Bacteria | 7146 |
| 458 | Ga0207713_1009064 | 3300025735 | Bacteria | 5653 |
| 459 | Ga0207713_1011536 | 3300025735 | Bacteria | 4793 |
| 460 | Ga0207713_1014323 | 3300025735 | Bacteria | 4129 |
| 461 | Ga0207713_1015587 | 3300025735 | Bacteria | 3893 |
| 462 | Ga0207713_1016389 | 3300025735 | Bacteria | 3760 |
| 463 | Ga0207713_1019734 | 3300025735 | Bacteria | 3287 |
| 464 | Ga0207713_1052120 | 3300025735 | Bacteria | 1623 |
| 465 | Ga0207682_10017898 | 3300025893 | Bacteria | 2766 |
| 466 | Ga0207682_10085111 | 3300025893 | Bacteria | 1362 |
| 467 | Ga0207710_10022650 | 3300025900 | Bacteria | 2697 |
| 468 | Ga0207688_10018196 | 3300025901 | Bacteria | 3825 |
| 469 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 470 | Ga0207680_10000258 | 3300025903 | Bacteria | 25434 |
| 471 | Ga0207680_10017367 | 3300025903 | Bacteria | 3800 |
| 472 | Ga0207647_10000548 | 3300025904 | Bacteria | 29903 |
| 473 | Ga0207647_10041154 | 3300025904 | Bacteria | 2907 |
| 474 | Ga0207685_10035372 | 3300025905 | Bacteria | 1822 |
| 475 | Ga0207699_10056754 | 3300025906 | Bacteria | 2335 |
| 476 | Ga0207643_10015501 | 3300025908 | Bacteria | 4149 |
| 477 | Ga0207643_10078929 | 3300025908 | Bacteria | 1905 |
| 478 | Ga0207643_10213513 | 3300025908 | Bacteria | 1178 |
| 479 | Ga0207705_10000553 | 3300025909 | Bacteria | 31478 |
| 480 | Ga0207705_10001408 | 3300025909 | Bacteria | 19149 |
| 481 | Ga0207705_10001438 | 3300025909 | Bacteria | 18995 |
| 482 | Ga0207705_10003691 | 3300025909 | Bacteria | 11648 |
| 483 | Ga0207705_10368093 | 3300025909 | Bacteria | 1109 |
| 484 | Ga0207705_10511402 | 3300025909 | Bacteria | 933 |
| 485 | Ga0207654_10009586 | 3300025911 | Bacteria | 4922 |
| 486 | Ga0207707_10000216 | 3300025912 | Bacteria | 61797 |
| 487 | Ga0207707_10000535 | 3300025912 | Bacteria | 38781 |
| 488 | Ga0207707_10001364 | 3300025912 | Bacteria | 22673 |
| 489 | Ga0207707_10004165 | 3300025912 | Bacteria | 12811 |
| 490 | Ga0207707_10005396 | 3300025912 | Bacteria | 11175 |
| 491 | Ga0207707_10081172 | 3300025912 | Bacteria | 2831 |
| 492 | Ga0207707_10477963 | 3300025912 | Bacteria | 1064 |
| 493 | Ga0207695_10001358 | 3300025913 | Bacteria | 41520 |
| 494 | Ga0207695_10015790 | 3300025913 | Bacteria | 8870 |
| 495 | Ga0207695_10027644 | 3300025913 | Bacteria | 6312 |
| 496 | Ga0207695_10240283 | 3300025913 | Bacteria | 1713 |
| 497 | Ga0207671_10000018 | 3300025914 | Bacteria | 318130 |
| 498 | Ga0207671_10003719 | 3300025914 | Bacteria | 15034 |
| 499 | Ga0207660_10000037 | 3300025917 | Bacteria | 65071 |
| 500 | Ga0207660_10001255 | 3300025917 | Bacteria | 17001 |
| 501 | Ga0207660_10002057 | 3300025917 | Bacteria | 13362 |
| 502 | Ga0207660_10025218 | 3300025917 | Bacteria | 4034 |
| 503 | Ga0207660_10112702 | 3300025917 | Bacteria | 2049 |
| 504 | Ga0207660_10223971 | 3300025917 | Bacteria | 1477 |
| 505 | Ga0207662_10028790 | 3300025918 | Bacteria | 3214 |
| 506 | Ga0207662_10036404 | 3300025918 | Bacteria | 2876 |
| 507 | Ga0207662_10061192 | 3300025918 | Bacteria | 2260 |
| 508 | Ga0207657_10000474 | 3300025919 | Bacteria | 42311 |
| 509 | Ga0207657_10001326 | 3300025919 | Bacteria | 26300 |
| 510 | Ga0207657_10049838 | 3300025919 | Bacteria | 3646 |
| 511 | Ga0207649_10000008 | 3300025920 | Bacteria | 315683 |
| 512 | Ga0207649_10001228 | 3300025920 | Bacteria | 15387 |
| 513 | Ga0207649_10002222 | 3300025920 | Bacteria | 10968 |
| 514 | Ga0207649_10006688 | 3300025920 | Bacteria | 6267 |
| 515 | Ga0207649_10054940 | 3300025920 | Bacteria | 2481 |
| 516 | Ga0207649_10143141 | 3300025920 | Bacteria | 1638 |
| 517 | Ga0207652_10000164 | 3300025921 | Bacteria | 72008 |
| 518 | Ga0207652_10000423 | 3300025921 | Bacteria | 43871 |
| 519 | Ga0207652_10001445 | 3300025921 | Bacteria | 21033 |
| 520 | Ga0207652_10001950 | 3300025921 | Bacteria | 17852 |
| 521 | Ga0207652_10015597 | 3300025921 | Bacteria | 6183 |
| 522 | Ga0207652_10134918 | 3300025921 | Bacteria | 2204 |
| 523 | Ga0207681_10002297 | 3300025923 | Bacteria | 12156 |
| 524 | Ga0207681_10040609 | 3300025923 | Bacteria | 3097 |
| 525 | Ga0207681_10320815 | 3300025923 | Bacteria | 1232 |
| 526 | Ga0207694_10000177 | 3300025924 | Bacteria | 65875 |
| 527 | Ga0207694_10018186 | 3300025924 | Bacteria | 5314 |
| 528 | Ga0207650_10002243 | 3300025925 | Bacteria | 13495 |
| 529 | Ga0207650_10004740 | 3300025925 | Bacteria | 9292 |
| 530 | Ga0207650_10147084 | 3300025925 | Bacteria | 1857 |
| 531 | Ga0207650_10150038 | 3300025925 | Bacteria | 1839 |
| 532 | Ga0207650_10167915 | 3300025925 | Bacteria | 1742 |
| 533 | Ga0207659_10012384 | 3300025926 | Bacteria | 5424 |
| 534 | Ga0207659_10047419 | 3300025926 | Bacteria | 3039 |
| 535 | Ga0207659_10063730 | 3300025926 | Bacteria | 2666 |
| 536 | Ga0207659_10129546 | 3300025926 | Bacteria | 1945 |
| 537 | Ga0207687_10070807 | 3300025927 | Bacteria | 2490 |
| 538 | Ga0207687_10226095 | 3300025927 | Bacteria | 1476 |
| 539 | Ga0207687_10364567 | 3300025927 | Bacteria | 1180 |
| 540 | Ga0207700_10010680 | 3300025928 | Bacteria | 5810 |
| 541 | Ga0207700_10036810 | 3300025928 | Bacteria | 3538 |
| 542 | Ga0207700_10056347 | 3300025928 | Bacteria | 2958 |
| 543 | Ga0207664_10019567 | 3300025929 | Bacteria | 5006 |
| 544 | Ga0207664_10022355 | 3300025929 | Bacteria | 4720 |
| 545 | Ga0207690_10000334 | 3300025932 | Bacteria | 31412 |
| 546 | Ga0207690_10000737 | 3300025932 | Bacteria | 21081 |
| 547 | Ga0207690_10001231 | 3300025932 | Bacteria | 16169 |
| 548 | Ga0207690_10258173 | 3300025932 | Bacteria | 1349 |
| 549 | Ga0207706_10001633 | 3300025933 | Bacteria | 22226 |
| 550 | Ga0207706_10012291 | 3300025933 | Bacteria | 7801 |
| 551 | Ga0207706_10034821 | 3300025933 | Bacteria | 4480 |
| 552 | Ga0207706_10122271 | 3300025933 | Bacteria | 2289 |
| 553 | Ga0207706_10188335 | 3300025933 | Bacteria | 1811 |
| 554 | Ga0207709_10000089 | 3300025935 | Bacteria | 149139 |
| 555 | Ga0207709_10001814 | 3300025935 | Bacteria | 14255 |
| 556 | Ga0207709_10129678 | 3300025935 | Bacteria | 1716 |
| 557 | Ga0207709_10217788 | 3300025935 | Bacteria | 1375 |
| 558 | Ga0207670_10001078 | 3300025936 | Bacteria | 14370 |
| 559 | Ga0207670_10038130 | 3300025936 | Bacteria | 3136 |
| 560 | Ga0207670_10079000 | 3300025936 | Bacteria | 2296 |
| 561 | Ga0207670_10120227 | 3300025936 | Bacteria | 1908 |
| 562 | Ga0207669_10101454 | 3300025937 | Bacteria | 1904 |
| 563 | Ga0207704_10022452 | 3300025938 | Bacteria | 3381 |
| 564 | Ga0207665_10010387 | 3300025939 | Bacteria | 6116 |
| 565 | Ga0207665_10068109 | 3300025939 | Bacteria | 2425 |
| 566 | Ga0207691_10007416 | 3300025940 | Bacteria | 10560 |
| 567 | Ga0207691_10018791 | 3300025940 | Bacteria | 6546 |
| 568 | Ga0207691_10129851 | 3300025940 | Bacteria | 2226 |
| 569 | Ga0207691_10196050 | 3300025940 | Bacteria | 1759 |
| 570 | Ga0207691_10206087 | 3300025940 | Bacteria | 1710 |
| 571 | Ga0207711_10032996 | 3300025941 | Bacteria | 4379 |
| 572 | Ga0207711_10047807 | 3300025941 | Bacteria | 3660 |
| 573 | Ga0207711_10049020 | 3300025941 | Bacteria | 3615 |
| 574 | Ga0207711_10137020 | 3300025941 | Bacteria | 2199 |
| 575 | Ga0207711_10465228 | 3300025941 | Bacteria | 1178 |
| 576 | Ga0207689_10005133 | 3300025942 | Bacteria | 11774 |
| 577 | Ga0207689_10031466 | 3300025942 | Bacteria | 4417 |
| 578 | Ga0207689_10084221 | 3300025942 | Bacteria | 2614 |
| 579 | Ga0207661_10002528 | 3300025944 | Bacteria | 12590 |
| 580 | Ga0207661_10326374 | 3300025944 | Bacteria | 1381 |
| 581 | Ga0207679_10000008 | 3300025945 | Bacteria | 412057 |
| 582 | Ga0207679_10001433 | 3300025945 | Bacteria | 14989 |
| 583 | Ga0207679_10009007 | 3300025945 | Bacteria | 6379 |
| 584 | Ga0207679_10094618 | 3300025945 | Bacteria | 2320 |
| 585 | Ga0207679_10449521 | 3300025945 | Bacteria | 1142 |
| 586 | Ga0207667_10000506 | 3300025949 | Bacteria | 51465 |
| 587 | Ga0207667_10001190 | 3300025949 | Bacteria | 32639 |
| 588 | Ga0207667_10004804 | 3300025949 | Bacteria | 16526 |
| 589 | Ga0207667_10202020 | 3300025949 | Bacteria | 2039 |
| 590 | Ga0207667_10406614 | 3300025949 | Bacteria | 1386 |
| 591 | Ga0207651_10078940 | 3300025960 | Bacteria | 2363 |
| 592 | Ga0207651_10146574 | 3300025960 | Bacteria | 1831 |
| 593 | Ga0207651_10150588 | 3300025960 | Bacteria | 1810 |
| 594 | Ga0207651_10184015 | 3300025960 | Bacteria | 1660 |
| 595 | Ga0207712_10048104 | 3300025961 | Bacteria | 2965 |
| 596 | Ga0207712_10260493 | 3300025961 | Bacteria | 1406 |
| 597 | Ga0207668_10005842 | 3300025972 | Bacteria | 7247 |
| 598 | Ga0207668_10050481 | 3300025972 | Bacteria | 2867 |
| 599 | Ga0207668_10340823 | 3300025972 | Bacteria | 1250 |
| 600 | Ga0207640_10043380 | 3300025981 | Bacteria | 2874 |
| 601 | Ga0207640_10057477 | 3300025981 | Bacteria | 2559 |
| 602 | Ga0207658_10200402 | 3300025986 | Bacteria | 1666 |
| 603 | Ga0207658_10230232 | 3300025986 | Bacteria | 1564 |
| 604 | Ga0207658_10252643 | 3300025986 | Bacteria | 1499 |
| 605 | Ga0207677_10033701 | 3300026023 | Bacteria | 3307 |
| 606 | Ga0207677_10038262 | 3300026023 | Bacteria | 3144 |
| 607 | Ga0207703_10039843 | 3300026035 | Bacteria | 3757 |
| 608 | Ga0207703_10070020 | 3300026035 | Bacteria | 2894 |
| 609 | Ga0207639_10000194 | 3300026041 | Bacteria | 46634 |
| 610 | Ga0207639_10000651 | 3300026041 | Bacteria | 23922 |
| 611 | Ga0207639_10004992 | 3300026041 | Bacteria | 8936 |
| 612 | Ga0207678_10000638 | 3300026067 | Bacteria | 32186 |
| 613 | Ga0207678_10001101 | 3300026067 | Bacteria | 24769 |
| 614 | Ga0207678_10010873 | 3300026067 | Bacteria | 8000 |
| 615 | Ga0207678_10244740 | 3300026067 | Bacteria | 1536 |
| 616 | Ga0207678_10378960 | 3300026067 | Bacteria | 1223 |
| 617 | Ga0207708_10007427 | 3300026075 | Bacteria | 8100 |
| 618 | Ga0207708_10074953 | 3300026075 | Bacteria | 2594 |
| 619 | Ga0207708_10217382 | 3300026075 | Bacteria | 1530 |
| 620 | Ga0207702_10006981 | 3300026078 | Bacteria | 9665 |
| 621 | Ga0207702_10010603 | 3300026078 | Bacteria | 7701 |
| 622 | Ga0207702_10018842 | 3300026078 | Bacteria | 5709 |
| 623 | Ga0207702_10289001 | 3300026078 | Bacteria | 1553 |
| 624 | Ga0207641_10004613 | 3300026088 | Bacteria | 11896 |
| 625 | Ga0207641_10039243 | 3300026088 | Bacteria | 3959 |
| 626 | Ga0207641_10046423 | 3300026088 | Bacteria | 3661 |
| 627 | Ga0207641_10054676 | 3300026088 | Bacteria | 3388 |
| 628 | Ga0207641_10127392 | 3300026088 | Bacteria | 2281 |
| 629 | Ga0207648_10002079 | 3300026089 | Bacteria | 21809 |
| 630 | Ga0207648_10025082 | 3300026089 | Bacteria | 5316 |
| 631 | Ga0207648_10039695 | 3300026089 | Bacteria | 4138 |
| 632 | Ga0207648_10204902 | 3300026089 | Bacteria | 1750 |
| 633 | Ga0207676_10043184 | 3300026095 | Bacteria | 3469 |
| 634 | Ga0207676_10063210 | 3300026095 | Bacteria | 2939 |
| 635 | Ga0207676_10081019 | 3300026095 | Bacteria | 2636 |
| 636 | Ga0207674_10002179 | 3300026116 | Bacteria | 24771 |
| 637 | Ga0207674_10074629 | 3300026116 | Bacteria | 3403 |
| 638 | Ga0207674_10175887 | 3300026116 | Bacteria | 2093 |
| 639 | Ga0207675_100011633 | 3300026118 | Bacteria | 8229 |
| 640 | Ga0207675_100021623 | 3300026118 | Bacteria | 5990 |
| 641 | Ga0207675_100023062 | 3300026118 | Bacteria | 5788 |
| 642 | Ga0207675_100124281 | 3300026118 | Bacteria | 2443 |
| 643 | Ga0207675_100137849 | 3300026118 | Bacteria | 2316 |
| 644 | Ga0207675_100200639 | 3300026118 | Bacteria | 1916 |
| 645 | Ga0207683_10006412 | 3300026121 | Bacteria | 10076 |
| 646 | Ga0207683_10087208 | 3300026121 | Bacteria | 2775 |
| 647 | Ga0207683_10190713 | 3300026121 | Bacteria | 1861 |
| 648 | Ga0207683_10280131 | 3300026121 | Bacteria | 1524 |
| 649 | Ga0207698_10000920 | 3300026142 | Bacteria | 17121 |
| 650 | Ga0207698_10001178 | 3300026142 | Bacteria | 15251 |
| 651 | Ga0207698_10003673 | 3300026142 | Bacteria | 9269 |
| 652 | Ga0209281_1000004 | 3300027111 | Bacteria | 1253949 |
| 653 | Ga0209281_1000014 | 3300027111 | Bacteria | 643021 |
| 654 | Ga0209281_1000018 | 3300027111 | Bacteria | 579091 |
| 655 | Ga0209281_1000095 | 3300027111 | Bacteria | 238108 |
| 656 | Ga0209281_1000391 | 3300027111 | Bacteria | 68959 |
| 657 | Ga0209281_1000404 | 3300027111 | Bacteria | 65885 |
| 658 | Ga0209389_1078671 | 3300027296 | Bacteria | 1633 |
| 659 | Ga0209371_1000005 | 3300027312 | Bacteria | 1061740 |
| 660 | Ga0209371_1000559 | 3300027312 | Bacteria | 34100 |
| 661 | Ga0209371_1001783 | 3300027312 | Bacteria | 13490 |
| 662 | Ga0209371_1003533 | 3300027312 | Bacteria | 7514 |
| 663 | Ga0209371_1003732 | 3300027312 | Bacteria | 7136 |
| 664 | Ga0209371_1010795 | 3300027312 | Bacteria | 2771 |
| 665 | Ga0209969_1012383 | 3300027360 | Bacteria | 1230 |
| 666 | Ga0209179_1000092 | 3300027512 | Bacteria | 13096 |
| 667 | Ga0209179_1003038 | 3300027512 | Bacteria | 2361 |
| 668 | Ga0209999_1017394 | 3300027543 | Bacteria | 1311 |
| 669 | Ga0209282_1073187 | 3300027666 | Bacteria | 1857 |
| 670 | Ga0209971_1000283 | 3300027682 | Bacteria | 14141 |
| 671 | Ga0209966_1041067 | 3300027695 | Bacteria | 964 |
| 672 | Ga0209974_10024050 | 3300027876 | Bacteria | 2016 |
| 673 | Ga0207428_10015038 | 3300027907 | Bacteria | 6705 |
| 674 | Ga0207428_10020953 | 3300027907 | Bacteria | 5542 |
| 675 | Ga0207428_10033442 | 3300027907 | Bacteria | 4223 |
| 676 | Ga0207428_10102538 | 3300027907 | Bacteria | 2210 |
| 677 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 678 | Ga0268266_10000894 | 3300028379 | Bacteria | 38498 |
| 679 | Ga0268266_10012944 | 3300028379 | Bacteria | 7194 |
| 680 | Ga0268266_10037850 | 3300028379 | Bacteria | 4107 |
| 681 | Ga0268266_10196192 | 3300028379 | Bacteria | 1846 |
| 682 | Ga0268266_10255937 | 3300028379 | Bacteria | 1621 |
| 683 | Ga0268265_10011415 | 3300028380 | Bacteria | 6007 |
| 684 | Ga0268265_10014190 | 3300028380 | Bacteria | 5427 |
| 685 | Ga0268265_10027739 | 3300028380 | Bacteria | 4045 |
| 686 | Ga0268265_10028465 | 3300028380 | Bacteria | 4000 |
| 687 | Ga0268265_10040833 | 3300028380 | Bacteria | 3428 |
| 688 | Ga0268265_10451103 | 3300028380 | Bacteria | 1201 |
| 689 | Ga0268265_10481270 | 3300028380 | Bacteria | 1166 |
| 690 | Ga0268264_10027543 | 3300028381 | Bacteria | 4645 |
| 691 | Ga0268264_10166497 | 3300028381 | Bacteria | 1990 |
| 692 | Ga0268264_10285437 | 3300028381 | Bacteria | 1548 |
| 693 | Ga0265334_10001122 | 3300028573 | Bacteria | 13075 |
| 694 | Ga0265318_10001166 | 3300028577 | Bacteria | 16279 |
| 695 | Ga0307517_10165832 | 3300028786 | Bacteria | 1468 |
| 696 | Ga0307515_10022420 | 3300028794 | Bacteria | 11130 |
| 697 | Ga0265338_10007165 | 3300028800 | Bacteria | 13963 |
| 698 | Ga0265338_10052392 | 3300028800 | Bacteria | 3661 |
| 699 | Ga0268256_1000006 | 3300030500 | Bacteria | 1063991 |
| 700 | Ga0268256_1000683 | 3300030500 | Bacteria | 25530 |
| 701 | Ga0268256_1000960 | 3300030500 | Bacteria | 19631 |
| 702 | Ga0268256_1003107 | 3300030500 | Bacteria | 7756 |
| 703 | Ga0268256_1011635 | 3300030500 | Bacteria | 2771 |
| 704 | Ga0268256_1033619 | 3300030500 | Bacteria | 1209 |
| 705 | Ga0316179_1113066 | 3300030734 | Bacteria | 2509 |
| 706 | Ga0316178_1087112 | 3300030735 | Bacteria | 7323 |
| 707 | Ga0316183_1044454 | 3300030742 | Bacteria | 2002 |
| 708 | Ga0265763_1002977 | 3300030763 | Bacteria | 1322 |
| 709 | Ga0265770_1000369 | 3300030878 | Bacteria | 6097 |
| 710 | Ga0265760_10002759 | 3300031090 | Bacteria | 5138 |
| 711 | Ga0265330_10002921 | 3300031235 | Bacteria | 9116 |
| 712 | Ga0265332_10001420 | 3300031238 | Bacteria | 13467 |
| 713 | Ga0265328_10042645 | 3300031239 | Bacteria | 1670 |
| 714 | Ga0265320_10023023 | 3300031240 | Bacteria | 3323 |
| 715 | Ga0265325_10009644 | 3300031241 | Bacteria | 5632 |
| 716 | Ga0265329_10004113 | 3300031242 | Bacteria | 6161 |
| 717 | Ga0265340_10005180 | 3300031247 | Bacteria | 7248 |
| 718 | Ga0265331_10009198 | 3300031250 | Bacteria | 5568 |
| 719 | Ga0265331_10013558 | 3300031250 | Bacteria | 4377 |
| 720 | Ga0265327_10000014 | 3300031251 | Bacteria | 506288 |
| 721 | Ga0265327_10001336 | 3300031251 | Bacteria | 31979 |
| 722 | Ga0265327_10003077 | 3300031251 | Bacteria | 16467 |
| 723 | Ga0265327_10025433 | 3300031251 | Bacteria | 3451 |
| 724 | Ga0265316_10000792 | 3300031344 | Bacteria | 34876 |
| 725 | Ga0265316_10002874 | 3300031344 | Bacteria | 17631 |
| 726 | Ga0307513_10004368 | 3300031456 | Bacteria | 18888 |
| 727 | Ga0307513_10006131 | 3300031456 | Bacteria | 15778 |
| 728 | Ga0307513_10019623 | 3300031456 | Bacteria | 8042 |
| 729 | Ga0307513_10085159 | 3300031456 | Bacteria | 3244 |
| 730 | Ga0307513_10107892 | 3300031456 | Bacteria | 2787 |
| 731 | Ga0307408_100000077 | 3300031548 | Bacteria | 110022 |
| 732 | Ga0307408_100000411 | 3300031548 | Bacteria | 38447 |
| 733 | Ga0307408_100011122 | 3300031548 | Bacteria | 5944 |
| 734 | Ga0307408_100023679 | 3300031548 | Bacteria | 4186 |
| 735 | Ga0307408_100029897 | 3300031548 | Bacteria | 3778 |
| 736 | Ga0307408_100038986 | 3300031548 | Bacteria | 3355 |
| 737 | Ga0307408_100113396 | 3300031548 | Bacteria | 2087 |
| 738 | Ga0265313_10004882 | 3300031595 | Bacteria | 10056 |
| 739 | Ga0265313_10072893 | 3300031595 | Bacteria | 1577 |
| 740 | Ga0316575_10000552 | 3300031665 | Bacteria | 10946 |
| 741 | Ga0316575_10008898 | 3300031665 | Bacteria | 3666 |
| 742 | Ga0316575_10026536 | 3300031665 | Bacteria | 2251 |
| 743 | Ga0316575_10029416 | 3300031665 | Bacteria | 2145 |
| 744 | Ga0316575_10127780 | 3300031665 | Bacteria | 1042 |
| 745 | Ga0316579_10000781 | 3300031691 | Bacteria | 10911 |
| 746 | Ga0265314_10023013 | 3300031711 | Bacteria | 4761 |
| 747 | Ga0316576_10043312 | 3300031727 | Bacteria | 3247 |
| 748 | Ga0316576_10045016 | 3300031727 | Bacteria | 3189 |
| 749 | Ga0316576_10063907 | 3300031727 | Bacteria | 2703 |
| 750 | Ga0316576_10074584 | 3300031727 | Bacteria | 2509 |
| 751 | Ga0316576_10149937 | 3300031727 | Bacteria | 1757 |
| 752 | Ga0316578_10018465 | 3300031728 | Bacteria | 3822 |
| 753 | Ga0316578_10029466 | 3300031728 | Bacteria | 3115 |
| 754 | Ga0316578_10029662 | 3300031728 | Bacteria | 3105 |
| 755 | Ga0316578_10084779 | 3300031728 | Bacteria | 1888 |
| 756 | Ga0316578_10099491 | 3300031728 | Bacteria | 1742 |
| 757 | Ga0307405_10003135 | 3300031731 | Bacteria | 7520 |
| 758 | Ga0307405_10017965 | 3300031731 | Bacteria | 3893 |
| 759 | Ga0307405_10065702 | 3300031731 | Bacteria | 2310 |
| 760 | Ga0316577_10010475 | 3300031733 | Bacteria | 5007 |
| 761 | Ga0316577_10011297 | 3300031733 | Bacteria | 4836 |
| 762 | Ga0307413_10001598 | 3300031824 | Bacteria | 8745 |
| 763 | Ga0307413_10004458 | 3300031824 | Bacteria | 6097 |
| 764 | Ga0307413_10123809 | 3300031824 | Bacteria | 1756 |
| 765 | Ga0307413_10355241 | 3300031824 | Bacteria | 1132 |
| 766 | Ga0307410_10012094 | 3300031852 | Bacteria | 4970 |
| 767 | Ga0307410_10245534 | 3300031852 | Bacteria | 1389 |
| 768 | Ga0307410_10250298 | 3300031852 | Bacteria | 1377 |
| 769 | Ga0307406_10019065 | 3300031901 | Bacteria | 4022 |
| 770 | Ga0307406_10113897 | 3300031901 | Bacteria | 1867 |
| 771 | Ga0307406_10182936 | 3300031901 | Bacteria | 1527 |
| 772 | Ga0307407_10148287 | 3300031903 | Bacteria | 1521 |
| 773 | Ga0307407_10167267 | 3300031903 | Bacteria | 1445 |
| 774 | Ga0307412_10064739 | 3300031911 | Bacteria | 2471 |
| 775 | Ga0307412_10232155 | 3300031911 | Bacteria | 1421 |
| 776 | Ga0307409_100007399 | 3300031995 | Bacteria | 6566 |
| 777 | Ga0307416_100001771 | 3300032002 | Bacteria | 11966 |
| 778 | Ga0307416_100042601 | 3300032002 | Bacteria | 3545 |
| 779 | Ga0307416_100076158 | 3300032002 | Bacteria | 2811 |
| 780 | Ga0307416_100115811 | 3300032002 | Bacteria | 2374 |
| 781 | Ga0307416_100467903 | 3300032002 | Bacteria | 1317 |
| 782 | Ga0307414_10014501 | 3300032004 | Bacteria | 4728 |
| 783 | Ga0307414_10167961 | 3300032004 | Bacteria | 1750 |
| 784 | Ga0307414_10212399 | 3300032004 | Bacteria | 1582 |
| 785 | Ga0307411_10001359 | 3300032005 | Bacteria | 9903 |
| 786 | Ga0307411_10064378 | 3300032005 | Bacteria | 2455 |
| 787 | Ga0307411_10114681 | 3300032005 | Bacteria | 1936 |
| 788 | Ga0307415_100053847 | 3300032126 | Bacteria | 2744 |
| 789 | Ga0316583_10000442 | 3300032133 | Bacteria | 12180 |
| 790 | Ga0316585_10000027 | 3300032137 | Bacteria | 21775 |
| 791 | Ga0316580_10007512 | 3300032139 | Bacteria | 3248 |
| 792 | Ga0316580_10008044 | 3300032139 | Bacteria | 3154 |
| 793 | Ga0316593_10000073 | 3300032168 | Bacteria | 12190 |
| 794 | Ga0316593_10003440 | 3300032168 | Bacteria | 3928 |
| 795 | Ga0316593_10008222 | 3300032168 | Bacteria | 2900 |
| 796 | Ga0316593_10072220 | 3300032168 | Bacteria | 1195 |
| 797 | Ga0307510_10001742 | 3300033180 | Bacteria | 24237 |
| 798 | Ga0307510_10113435 | 3300033180 | Bacteria | 2444 |
| 799 | Ga0307510_10221506 | 3300033180 | Bacteria | 1403 |
| 800 | Ga0373923_0039004 | 3300035111 | Bacteria | 1949 |
| 801 | Ga0373945_0056733 | 3300035116 | Bacteria | 1453 |
| 802 | Ga0373957_0019132 | 3300035120 | Bacteria | 2406 |
| 803 | Ga0373946_0043285 | 3300035171 | Bacteria | 1855 |
| 804 | Ga0373955_0114736 | 3300035172 | Bacteria | 1560 |
| 805 | Ga0373942_0093954 | 3300035207 | Bacteria | 908 |
| 806 | Ga0316574_0001215 | 3300035398 | Bacteria | 11969 |
| 807 | Ga0316574_0001978 | 3300035398 | Bacteria | 10063 |
| 808 | Ga0316574_0004031 | 3300035398 | Bacteria | 7655 |
| 809 | Ga0316574_0008617 | 3300035398 | Bacteria | 5670 |
| 810 | Ga0316574_0016581 | 3300035398 | Bacteria | 4296 |
| 811 | Ga0316574_0018396 | 3300035398 | Bacteria | 4105 |
| 812 | Ga0316574_0028979 | 3300035398 | Bacteria | 3342 |
| 813 | Ga0316574_0040134 | 3300035398 | Bacteria | 2880 |
| 814 | Ga0316574_0190098 | 3300035398 | Bacteria | 1320 |
| 815 | Ga0316574_0233700 | 3300035398 | Bacteria | 1176 |
| 816 | Ga0316574_0270606 | 3300035398 | Bacteria | 1083 |
| 817 | Ga0373931_0164347 | 3300035691 | Bacteria | 1303 |
| 818 | Ga0373935_0242385 | 3300035692 | Bacteria | 1259 |
| 819 | Ga0373927_0038213 | 3300035695 | Bacteria | 3117 |
| 820 | Ga0373933_0022376 | 3300035724 | Bacteria | 3600 |
| 821 | Ga0373947_0208876 | 3300035725 | Bacteria | 1280 |
| 822 | Ga0316582_0001504 | 3300036647 | Bacteria | 10303 |
| 823 | Ga0316582_0001671 | 3300036647 | Bacteria | 9941 |
| 824 | Ga0316582_0014157 | 3300036647 | Bacteria | 4517 |
| 825 | Ga0316582_0048003 | 3300036647 | Bacteria | 2698 |
| 826 | Ga0316582_0083592 | 3300036647 | Bacteria | 2089 |
| 827 | Ga0316582_0212859 | 3300036647 | Bacteria | 1321 |
| 828 | Ga0316584_0002113 | 3300036712 | Bacteria | 12431 |
| 829 | Ga0316584_0021722 | 3300036712 | Bacteria | 4669 |
| 830 | Ga0316584_0035967 | 3300036712 | Bacteria | 3674 |
| 831 | Ga0316584_0044524 | 3300036712 | Bacteria | 3309 |
| 832 | Ga0316584_0046215 | 3300036712 | Bacteria | 3251 |
| 833 | Ga0316584_0061284 | 3300036712 | Bacteria | 2817 |
| 834 | Ga0316584_0075135 | 3300036712 | Bacteria | 2533 |
| 835 | Ga0316584_0172799 | 3300036712 | Bacteria | 1602 |
| 836 | Ga0395899_0000404 | 3300037312 | Bacteria | 50522 |
| 837 | Ga0395899_0125215 | 3300037312 | Bacteria | 1838 |
| 838 | Ga0395900_0000107 | 3300037418 | Bacteria | 149024 |
| 839 | Ga0395900_0074336 | 3300037418 | Bacteria | 3494 |
| 840 | Ga0395898_0000211 | 3300037466 | Bacteria | 149301 |
| 841 | Ga0395898_0048094 | 3300037466 | Bacteria | 4184 |
| 842 | Ga0316581_0000969 | 3300037588 | Bacteria | 6113 |
| 843 | Ga0316581_0003338 | 3300037588 | Bacteria | 3985 |
| 844 | Ga0395901_0079858 | 3300038443 | Bacteria | 3415 |
| 845 | Ga0395901_0515479 | 3300038443 | Bacteria | 1215 |
| 846 | Ga0237819_00787 | 3300038705 | Bacteria | 10146 |
| 847 | Ga0400483_011244 | 3300039062 | Bacteria | 2678 |
| 848 | Ga0400483_096306 | 3300039062 | Bacteria | 2719 |
| 849 | Ga0400483_195378 | 3300039062 | Bacteria | 81541 |
| 850 | Ga0400483_228399 | 3300039062 | Bacteria | 1558 |
| 851 | Ga0400487_56255 | 3300039110 | Bacteria | 4084 |
| 852 | Ga0436365_1567785 | 3300039437 | Bacteria | 2066 |
| 853 | Ga0436365_1816396 | 3300039437 | Bacteria | 1842 |
| 854 | Ga0436360_0504587 | 3300039438 | Bacteria | 11481 |
| 855 | Ga0436361_0355976 | 3300039447 | Bacteria | 2771 |
| 856 | Ga0436363_0879119 | 3300039450 | Bacteria | 8518 |
| 857 | Ga0439436_0000026 | 3300041404 | Bacteria | 55607 |
| 858 | Ga0439436_0000447 | 3300041404 | Bacteria | 10513 |
| 859 | Ga0439438_000002 | 3300041405 | Bacteria | 618223 |
| 860 | Ga0439438_003174 | 3300041405 | Bacteria | 6737 |
| 861 | Ga0439438_003372 | 3300041405 | Bacteria | 6467 |
| 862 | Ga0439438_004121 | 3300041405 | Bacteria | 5676 |
| 863 | Ga0439438_007190 | 3300041405 | Bacteria | 3832 |
| 864 | Ga0439438_022997 | 3300041405 | Bacteria | 1723 |
| 865 | Ga0439447_001619 | 3300041407 | Bacteria | 8257 |
| 866 | Ga0439447_002046 | 3300041407 | Bacteria | 7411 |
| 867 | Ga0439447_008358 | 3300041407 | Bacteria | 3209 |
| 868 | Ga0439447_039422 | 3300041407 | Bacteria | 1156 |
| 869 | Ga0439461_0002255 | 3300041410 | Bacteria | 3064 |
| 870 | Ga0439466_0002104 | 3300041411 | Bacteria | 7795 |
| 871 | Ga0439466_0011580 | 3300041411 | Bacteria | 3261 |
| 872 | Ga0439466_0016193 | 3300041411 | Bacteria | 2698 |
| 873 | Ga0451791_0939169 | 3300041451 | Bacteria | 4353 |
| 874 | Ga0451807_1085369 | 3300041486 | Bacteria | 2043 |
| 875 | Ga0451833_0997501 | 3300041491 | Bacteria | 3095 |
| 876 | Ga0451853_1515730 | 3300041512 | Bacteria | 3614 |
| 877 | Ga0439441_031425 | 3300042001 | Bacteria | 1031 |
| 878 | Ga0439448_0027489 | 3300042005 | Bacteria | 1793 |
| 879 | Ga0439432_002151 | 3300042006 | Bacteria | 7433 |
| 880 | Ga0439432_003611 | 3300042006 | Bacteria | 5723 |
| 881 | Ga0439432_008528 | 3300042006 | Bacteria | 3596 |
| 882 | Ga0439432_023722 | 3300042006 | Bacteria | 2019 |
| 883 | Ga0439451_005685 | 3300042009 | Bacteria | 2550 |
| 884 | Ga0439451_006810 | 3300042009 | Bacteria | 2338 |
| 885 | Ga0439452_000015 | 3300042010 | Bacteria | 342948 |
| 886 | Ga0439452_000193 | 3300042010 | Bacteria | 44853 |
| 887 | Ga0439452_003709 | 3300042010 | Bacteria | 5280 |
| 888 | Ga0439452_015227 | 3300042010 | Bacteria | 2116 |
| 889 | Ga0439456_005372 | 3300042013 | Bacteria | 2598 |
| 890 | Ga0439456_006439 | 3300042013 | Bacteria | 2398 |
| 891 | Ga0450911_000989 | 3300042115 | Bacteria | 7366 |
| 892 | Ga0450923_000761 | 3300042125 | Bacteria | 3853 |
| 893 | Ga0450891_001834 | 3300042129 | Bacteria | 2185 |
| 894 | Ga0450896_000803 | 3300042133 | Bacteria | 3554 |
| 895 | Ga0450904_000021 | 3300042139 | Bacteria | 37453 |
| 896 | Ga0450906_001253 | 3300042145 | Bacteria | 5602 |
| 897 | Ga0450906_009578 | 3300042145 | Bacteria | 1845 |
| 898 | Ga0450907_002943 | 3300042146 | Bacteria | 3131 |
| 899 | Ga0450907_003833 | 3300042146 | Bacteria | 2632 |
| 900 | Ga0450910_001012 | 3300042147 | Bacteria | 3423 |
| 901 | Ga0439446_0001213 | 3300042156 | Bacteria | 5769 |
| 902 | Ga0439446_0005836 | 3300042156 | Bacteria | 3184 |
| 903 | Ga0439446_0019054 | 3300042156 | Bacteria | 1927 |
| 904 | Ga0450908_003922 | 3300042184 | Bacteria | 2878 |
| 905 | Ga0450908_004614 | 3300042184 | Bacteria | 2652 |
| 906 | Ga0450908_006538 | 3300042184 | Bacteria | 2209 |
| 907 | Ga0450908_008467 | 3300042184 | Bacteria | 1927 |
| 908 | Ga0439459_0002761 | 3300042438 | Bacteria | 2735 |
| 909 | Ga0439464_0000028 | 3300042439 | Bacteria | 18437 |
| 910 | Ga0450918_005543 | 3300042531 | Bacteria | 2265 |
| 911 | Ga0450901_000068 | 3300042533 | Bacteria | 10539 |
| 912 | Ga0451577_0013959 | 3300042876 | Bacteria | 7498 |
| 913 | Ga0451577_0192142 | 3300042876 | Bacteria | 1842 |
| 914 | Ga0451577_0208851 | 3300042876 | Bacteria | 1763 |
| 915 | Ga0439440_0010459 | 3300042993 | Bacteria | 1940 |
| 916 | Ga0466969_0015398 | 3300044656 | Bacteria | 4008 |
| 917 | Ga0453683_0051155 | 3300044673 | Bacteria | 2588 |
| 918 | Ga0466966_0014771 | 3300044684 | Bacteria | 5165 |
| 919 | Ga0466961_0068102 | 3300044693 | Bacteria | 2260 |
| 920 | Ga0466964_0040263 | 3300044706 | Bacteria | 1886 |
| 921 | Ga0453684_0319401 | 3300044712 | Bacteria | 1759 |
| 922 | Ga0453684_0450634 | 3300044712 | Bacteria | 1432 |
| 923 | Ga0466971_0009827 | 3300044719 | Bacteria | 4177 |
| 924 | Ga0466968_0003694 | 3300044735 | Bacteria | 5679 |
| 925 | Ga0466970_0071846 | 3300044765 | Bacteria | 1861 |
| 926 | Ga0466957_0046268 | 3300044842 | Bacteria | 2641 |
| 927 | Ga0466957_0052198 | 3300044842 | Bacteria | 2489 |
| 928 | Ga0466959_0000110 | 3300045049 | Bacteria | 52740 |
| 929 | Ga0451576_0000034 | 3300045051 | Bacteria | 390778 |
| 930 | Ga0451576_0062688 | 3300045051 | Bacteria | 3875 |
| 931 | Ga0451576_0137921 | 3300045051 | Bacteria | 2544 |
| 932 | Ga0451576_0293866 | 3300045051 | Bacteria | 1699 |
| 933 | Ga0466958_0097864 | 3300045836 | Bacteria | 1821 |
| 934 | Ga0495617_000583 | 3300046452 | Bacteria | 18579 |
| 935 | Ga0495617_001724 | 3300046452 | Bacteria | 9363 |
| 936 | Ga0495627_002133 | 3300046453 | Bacteria | 9968 |
| 937 | Ga0495627_012638 | 3300046453 | Bacteria | 2990 |
| 938 | Ga0495627_029960 | 3300046453 | Bacteria | 1727 |
| 939 | Ga0495603_0007081 | 3300046455 | Bacteria | 6730 |
| 940 | Ga0495590_0001676 | 3300046457 | Bacteria | 9432 |
| 941 | Ga0495590_0003763 | 3300046457 | Bacteria | 6180 |
| 942 | Ga0495591_000341 | 3300046458 | Bacteria | 41541 |
| 943 | Ga0495591_002220 | 3300046458 | Bacteria | 11080 |
| 944 | Ga0495591_002827 | 3300046458 | Bacteria | 9342 |
| 945 | Ga0495591_003091 | 3300046458 | Bacteria | 8816 |
| 946 | Ga0495591_006880 | 3300046458 | Bacteria | 4934 |
| 947 | Ga0495591_010564 | 3300046458 | Bacteria | 3568 |
| 948 | Ga0495591_015200 | 3300046458 | Bacteria | 2728 |
| 949 | Ga0495638_0000873 | 3300046460 | Bacteria | 31227 |
| 950 | Ga0495638_0001879 | 3300046460 | Bacteria | 18163 |
| 951 | Ga0495638_0005848 | 3300046460 | Bacteria | 9043 |
| 952 | Ga0495638_0020839 | 3300046460 | Bacteria | 4329 |
| 953 | Ga0495638_0033336 | 3300046460 | Bacteria | 3294 |
| 954 | Ga0495638_0061121 | 3300046460 | Bacteria | 2328 |
| 955 | Ga0495653_0015001 | 3300046463 | Bacteria | 6320 |
| 956 | Ga0495653_0101166 | 3300046463 | Bacteria | 2088 |
| 957 | Ga0495650_0000047 | 3300046471 | Bacteria | 335136 |
| 958 | Ga0495650_0000250 | 3300046471 | Bacteria | 105746 |
| 959 | Ga0495650_0001128 | 3300046471 | Bacteria | 29020 |
| 960 | Ga0495650_0001452 | 3300046471 | Bacteria | 22732 |
| 961 | Ga0495650_0017006 | 3300046471 | Bacteria | 3658 |
| 962 | Ga0495650_0048502 | 3300046471 | Bacteria | 1769 |
| 963 | Ga0495605_0000373 | 3300046474 | Bacteria | 42328 |
| 964 | Ga0495605_0000831 | 3300046474 | Bacteria | 21800 |
| 965 | Ga0495605_0004590 | 3300046474 | Bacteria | 8085 |
| 966 | Ga0495605_0010998 | 3300046474 | Bacteria | 5054 |
| 967 | Ga0495605_0020248 | 3300046474 | Bacteria | 3537 |
| 968 | Ga0495605_0060755 | 3300046474 | Bacteria | 1810 |
| 969 | Ga0495639_0003160 | 3300046475 | Bacteria | 7157 |
| 970 | Ga0495584_0002893 | 3300046491 | Bacteria | 9586 |
| 971 | Ga0495584_0003978 | 3300046491 | Bacteria | 7971 |
| 972 | Ga0495584_0012433 | 3300046491 | Bacteria | 4344 |
| 973 | Ga0495584_0028139 | 3300046491 | Bacteria | 2847 |
| 974 | Ga0495584_0141197 | 3300046491 | Bacteria | 1223 |
| 975 | Ga0495585_0000019 | 3300046492 | Bacteria | 156966 |
| 976 | Ga0495585_0005462 | 3300046492 | Bacteria | 8009 |
| 977 | Ga0495585_0008389 | 3300046492 | Bacteria | 6265 |
| 978 | Ga0495585_0010101 | 3300046492 | Bacteria | 5637 |
| 979 | Ga0495585_0044297 | 3300046492 | Bacteria | 2486 |
| 980 | Ga0495585_0045379 | 3300046492 | Bacteria | 2453 |
| 981 | Ga0495585_0045774 | 3300046492 | Bacteria | 2441 |
| 982 | Ga0495594_0000612 | 3300046499 | Bacteria | 18385 |
| 983 | Ga0495594_0066620 | 3300046499 | Bacteria | 1998 |
| 984 | Ga0495596_0002729 | 3300046500 | Bacteria | 9274 |
| 985 | Ga0495596_0004687 | 3300046500 | Bacteria | 6616 |
| 986 | Ga0495596_0019317 | 3300046500 | Bacteria | 2800 |
| 987 | Ga0495596_0118138 | 3300046500 | Bacteria | 1030 |
| 988 | Ga0495607_0000250 | 3300046501 | Bacteria | 57693 |
| 989 | Ga0495607_0000538 | 3300046501 | Bacteria | 37198 |
| 990 | Ga0495607_0000869 | 3300046501 | Bacteria | 28344 |
| 991 | Ga0495607_0001054 | 3300046501 | Bacteria | 25166 |
| 992 | Ga0495607_0001347 | 3300046501 | Bacteria | 21894 |
| 993 | Ga0495607_0001549 | 3300046501 | Bacteria | 20131 |
| 994 | Ga0495607_0005710 | 3300046501 | Bacteria | 8864 |
| 995 | Ga0495607_0013072 | 3300046501 | Bacteria | 5456 |
| 996 | Ga0495607_0016541 | 3300046501 | Bacteria | 4758 |
| 997 | Ga0495607_0025549 | 3300046501 | Bacteria | 3672 |
| 998 | Ga0495607_0026945 | 3300046501 | Bacteria | 3560 |
| 999 | Ga0495607_0076715 | 3300046501 | Bacteria | 1847 |
| 1000 | Ga0495607_0124245 | 3300046501 | Bacteria | 1351 |
| 1001 | Ga0495583_0000521 | 3300046506 | Bacteria | 54646 |
| 1002 | Ga0495583_0001354 | 3300046506 | Bacteria | 25389 |
| 1003 | Ga0495583_0001828 | 3300046506 | Bacteria | 19872 |
| 1004 | Ga0495583_0002363 | 3300046506 | Bacteria | 16292 |
| 1005 | Ga0495583_0004447 | 3300046506 | Bacteria | 10026 |
| 1006 | Ga0495606_0000255 | 3300046507 | Bacteria | 93984 |
| 1007 | Ga0495606_0000665 | 3300046507 | Bacteria | 53891 |
| 1008 | Ga0495606_0001039 | 3300046507 | Bacteria | 40170 |
| 1009 | Ga0495606_0001255 | 3300046507 | Bacteria | 35408 |
| 1010 | Ga0495606_0001384 | 3300046507 | Bacteria | 32777 |
| 1011 | Ga0495606_0001423 | 3300046507 | Bacteria | 32125 |
| 1012 | Ga0495606_0010914 | 3300046507 | Bacteria | 7475 |
| 1013 | Ga0495606_0017563 | 3300046507 | Bacteria | 5402 |
| 1014 | Ga0495610_0005830 | 3300046512 | Bacteria | 8655 |
| 1015 | Ga0495610_0006853 | 3300046512 | Bacteria | 7724 |
| 1016 | Ga0495610_0012420 | 3300046512 | Bacteria | 5129 |
| 1017 | Ga0495610_0012850 | 3300046512 | Bacteria | 5008 |
| 1018 | Ga0495610_0021163 | 3300046512 | Bacteria | 3583 |
| 1019 | Ga0495610_0028061 | 3300046512 | Bacteria | 2982 |
| 1020 | Ga0495610_0065014 | 3300046512 | Bacteria | 1722 |
| 1021 | Ga0495610_0073017 | 3300046512 | Bacteria | 1595 |
| 1022 | Ga0495616_0000047 | 3300046513 | Bacteria | 110592 |
| 1023 | Ga0495616_0015572 | 3300046513 | Bacteria | 4226 |
| 1024 | Ga0495616_0021705 | 3300046513 | Bacteria | 3472 |
| 1025 | Ga0495616_0029933 | 3300046513 | Bacteria | 2867 |
| 1026 | Ga0495616_0059387 | 3300046513 | Bacteria | 1881 |
| 1027 | Ga0495616_0103027 | 3300046513 | Bacteria | 1336 |
| 1028 | Ga0495620_0000413 | 3300046515 | Bacteria | 28516 |
| 1029 | Ga0495620_0004548 | 3300046515 | Bacteria | 7808 |
| 1030 | Ga0495620_0005447 | 3300046515 | Bacteria | 7097 |
| 1031 | Ga0495620_0008101 | 3300046515 | Bacteria | 5656 |
| 1032 | Ga0495620_0009649 | 3300046515 | Bacteria | 5123 |
| 1033 | Ga0495620_0011860 | 3300046515 | Bacteria | 4530 |
| 1034 | Ga0495620_0012826 | 3300046515 | Bacteria | 4310 |
| 1035 | Ga0495620_0042921 | 3300046515 | Bacteria | 1972 |
| 1036 | Ga0495620_0056293 | 3300046515 | Bacteria | 1655 |
| 1037 | Ga0495630_0132113 | 3300046517 | Bacteria | 1896 |
| 1038 | Ga0495631_0001326 | 3300046518 | Bacteria | 15169 |
| 1039 | Ga0495631_0002466 | 3300046518 | Bacteria | 10426 |
| 1040 | Ga0495631_0003442 | 3300046518 | Bacteria | 8667 |
| 1041 | Ga0495631_0086210 | 3300046518 | Bacteria | 1352 |
| 1042 | Ga0495631_0149972 | 3300046518 | Bacteria | 1000 |
| 1043 | Ga0495632_0000080 | 3300046519 | Bacteria | 99523 |
| 1044 | Ga0495632_0001147 | 3300046519 | Bacteria | 22609 |
| 1045 | Ga0495632_0002357 | 3300046519 | Bacteria | 14464 |
| 1046 | Ga0495632_0002444 | 3300046519 | Bacteria | 14138 |
| 1047 | Ga0495632_0004992 | 3300046519 | Bacteria | 8892 |
| 1048 | Ga0495632_0010987 | 3300046519 | Bacteria | 5310 |
| 1049 | Ga0495632_0109542 | 3300046519 | Bacteria | 1297 |
| 1050 | Ga0495632_0146866 | 3300046519 | Bacteria | 1091 |
| 1051 | Ga0495637_0001830 | 3300046520 | Bacteria | 12172 |
| 1052 | Ga0495637_0002110 | 3300046520 | Bacteria | 11184 |
| 1053 | Ga0495637_0002741 | 3300046520 | Bacteria | 9595 |
| 1054 | Ga0495637_0004862 | 3300046520 | Bacteria | 6910 |
| 1055 | Ga0495637_0005624 | 3300046520 | Bacteria | 6364 |
| 1056 | Ga0495637_0014903 | 3300046520 | Bacteria | 3660 |
| 1057 | Ga0495637_0020114 | 3300046520 | Bacteria | 3075 |
| 1058 | Ga0495637_0036621 | 3300046520 | Bacteria | 2135 |
| 1059 | Ga0495637_0109737 | 3300046520 | Bacteria | 1070 |
| 1060 | Ga0495643_0000717 | 3300046522 | Bacteria | 37887 |
| 1061 | Ga0495643_0009384 | 3300046522 | Bacteria | 6083 |
| 1062 | Ga0495643_0011560 | 3300046522 | Bacteria | 5369 |
| 1063 | Ga0495643_0039912 | 3300046522 | Bacteria | 2565 |
| 1064 | Ga0495644_0002686 | 3300046523 | Bacteria | 7075 |
| 1065 | Ga0495648_0000424 | 3300046524 | Bacteria | 46425 |
| 1066 | Ga0495648_0004682 | 3300046524 | Bacteria | 11605 |
| 1067 | Ga0495648_0014046 | 3300046524 | Bacteria | 5888 |
| 1068 | Ga0495648_0017048 | 3300046524 | Bacteria | 5211 |
| 1069 | Ga0495648_0022776 | 3300046524 | Bacteria | 4303 |
| 1070 | Ga0495648_0028289 | 3300046524 | Bacteria | 3736 |
| 1071 | Ga0495648_0036009 | 3300046524 | Bacteria | 3200 |
| 1072 | Ga0495648_0053069 | 3300046524 | Bacteria | 2458 |
| 1073 | Ga0495648_0146670 | 3300046524 | Bacteria | 1235 |
| 1074 | Ga0495666_0017719 | 3300046526 | Bacteria | 3545 |
| 1075 | Ga0495642_0001528 | 3300046528 | Bacteria | 10274 |
| 1076 | Ga0495642_0005253 | 3300046528 | Bacteria | 4979 |
| 1077 | Ga0495654_0000875 | 3300046530 | Bacteria | 22618 |
| 1078 | Ga0495654_0002722 | 3300046530 | Bacteria | 11159 |
| 1079 | Ga0495654_0003407 | 3300046530 | Bacteria | 9760 |
| 1080 | Ga0495654_0117720 | 3300046530 | Bacteria | 1205 |
| 1081 | Ga0495654_0134545 | 3300046530 | Bacteria | 1106 |
| 1082 | Ga0495586_0005021 | 3300046535 | Bacteria | 7081 |
| 1083 | Ga0495587_0059558 | 3300046536 | Bacteria | 2240 |
| 1084 | Ga0495587_0101663 | 3300046536 | Bacteria | 1656 |
| 1085 | Ga0495609_0000011 | 3300046538 | Bacteria | 334377 |
| 1086 | Ga0495609_0000349 | 3300046538 | Bacteria | 40285 |
| 1087 | Ga0495609_0000784 | 3300046538 | Bacteria | 23757 |
| 1088 | Ga0495609_0003919 | 3300046538 | Bacteria | 8345 |
| 1089 | Ga0495609_0010058 | 3300046538 | Bacteria | 4552 |
| 1090 | Ga0495609_0014027 | 3300046538 | Bacteria | 3773 |
| 1091 | Ga0495609_0047626 | 3300046538 | Bacteria | 1918 |
| 1092 | Ga0495597_0000221 | 3300046542 | Bacteria | 52360 |
| 1093 | Ga0495597_0002355 | 3300046542 | Bacteria | 12161 |
| 1094 | Ga0495597_0002438 | 3300046542 | Bacteria | 11798 |
| 1095 | Ga0495597_0102779 | 3300046542 | Bacteria | 1203 |
| 1096 | Ga0495597_0136610 | 3300046542 | Bacteria | 1013 |
| 1097 | Ga0495597_0152939 | 3300046542 | Bacteria | 945 |
| 1098 | Ga0495622_0000853 | 3300046557 | Bacteria | 16756 |
| 1099 | Ga0495622_0001397 | 3300046557 | Bacteria | 12265 |
| 1100 | Ga0495622_0037039 | 3300046557 | Bacteria | 2272 |
| 1101 | Ga0495622_0110250 | 3300046557 | Bacteria | 1260 |
| 1102 | Ga0495633_0000287 | 3300046558 | Bacteria | 58020 |
| 1103 | Ga0495633_0000438 | 3300046558 | Bacteria | 43059 |
| 1104 | Ga0495656_0040293 | 3300046615 | Bacteria | 1946 |
| 1105 | Ga0495668_0008912 | 3300046616 | Bacteria | 6205 |
| 1106 | Ga0495668_0022194 | 3300046616 | Bacteria | 3629 |
| 1107 | Ga0495668_0145650 | 3300046616 | Bacteria | 1296 |
| 1108 | Ga0495634_0005385 | 3300046642 | Bacteria | 9859 |
| 1109 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 1110 | Ga0495611_0000955 | 3300046648 | Bacteria | 15433 |
| 1111 | Ga0495611_0001725 | 3300046648 | Bacteria | 10580 |
| 1112 | Ga0495611_0001973 | 3300046648 | Bacteria | 9731 |
| 1113 | Ga0495611_0002094 | 3300046648 | Bacteria | 9372 |
| 1114 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 1115 | Ga0495625_0000187 | 3300046660 | Bacteria | 97797 |
| 1116 | Ga0495625_0007564 | 3300046660 | Bacteria | 9432 |
| 1117 | Ga0495625_0007957 | 3300046660 | Bacteria | 9109 |
| 1118 | Ga0495625_0008531 | 3300046660 | Bacteria | 8730 |
| 1119 | Ga0495625_0018950 | 3300046660 | Bacteria | 5355 |
| 1120 | Ga0495625_0026761 | 3300046660 | Bacteria | 4351 |
| 1121 | Ga0495625_0222071 | 3300046660 | Bacteria | 1237 |
| 1122 | Ga0495659_0001232 | 3300046664 | Bacteria | 8857 |
| 1123 | Ga0495661_0000051 | 3300046665 | Bacteria | 140353 |
| 1124 | Ga0495661_0000477 | 3300046665 | Bacteria | 42410 |
| 1125 | Ga0495661_0000596 | 3300046665 | Bacteria | 37123 |
| 1126 | Ga0495661_0001003 | 3300046665 | Bacteria | 25378 |
| 1127 | Ga0495661_0001772 | 3300046665 | Bacteria | 17368 |
| 1128 | Ga0495661_0029543 | 3300046665 | Bacteria | 3496 |
| 1129 | Ga0495661_0038148 | 3300046665 | Bacteria | 2995 |
| 1130 | Ga0495588_0107533 | 3300046674 | Bacteria | 1468 |
| 1131 | Ga0495623_0007248 | 3300046679 | Bacteria | 7197 |
| 1132 | Ga0495646_0019993 | 3300046680 | Bacteria | 4233 |
| 1133 | Ga0495658_0222963 | 3300046683 | Bacteria | 1181 |
| 1134 | Ga0495669_0034276 | 3300046684 | Bacteria | 2237 |
| 1135 | Ga0495670_0002102 | 3300046691 | Bacteria | 9827 |
| 1136 | Ga0495670_0002797 | 3300046691 | Bacteria | 8632 |
| 1137 | Ga0495670_0011627 | 3300046691 | Bacteria | 4331 |
| 1138 | Ga0495670_0019046 | 3300046691 | Bacteria | 3382 |
| 1139 | Ga0495670_0019878 | 3300046691 | Bacteria | 3309 |
| 1140 | Ga0495671_0000552 | 3300046692 | Bacteria | 28021 |
| 1141 | Ga0495671_0001180 | 3300046692 | Bacteria | 17885 |
| 1142 | Ga0495671_0007665 | 3300046692 | Bacteria | 6129 |
| 1143 | Ga0495671_0016360 | 3300046692 | Bacteria | 3961 |
| 1144 | Ga0495671_0022227 | 3300046692 | Bacteria | 3324 |
| 1145 | Ga0495671_0027804 | 3300046692 | Bacteria | 2917 |
| 1146 | Ga0495671_0158987 | 3300046692 | Bacteria | 1099 |
| 1147 | Ga0495649_0000165 | 3300046694 | Bacteria | 57643 |
| 1148 | Ga0495649_0006953 | 3300046694 | Bacteria | 6989 |
| 1149 | Ga0495649_0008252 | 3300046694 | Bacteria | 6275 |
| 1150 | Ga0495649_0008478 | 3300046694 | Bacteria | 6182 |
| 1151 | Ga0495649_0016610 | 3300046694 | Bacteria | 4170 |
| 1152 | Ga0495649_0024380 | 3300046694 | Bacteria | 3373 |
| 1153 | Ga0495649_0046070 | 3300046694 | Bacteria | 2375 |
| 1154 | Ga0495649_0055392 | 3300046694 | Bacteria | 2142 |
| 1155 | Ga0495589_0000272 | 3300046794 | Bacteria | 42126 |
| 1156 | Ga0495589_0002065 | 3300046794 | Bacteria | 11371 |
| 1157 | Ga0495589_0002775 | 3300046794 | Bacteria | 9691 |
| 1158 | Ga0495589_0004145 | 3300046794 | Bacteria | 7755 |
| 1159 | Ga0495589_0009775 | 3300046794 | Bacteria | 4980 |
| 1160 | Ga0495600_0296731 | 3300046809 | Bacteria | 1020 |
| 1161 | Ga0495660_0000746 | 3300046810 | Bacteria | 24565 |
| 1162 | Ga0495660_0000888 | 3300046810 | Bacteria | 22116 |
| 1163 | Ga0495660_0001273 | 3300046810 | Bacteria | 17539 |
| 1164 | Ga0495660_0001683 | 3300046810 | Bacteria | 14811 |
| 1165 | Ga0495660_0007204 | 3300046810 | Bacteria | 6548 |
| 1166 | Ga0495660_0013190 | 3300046810 | Bacteria | 4788 |
| 1167 | Ga0495660_0014399 | 3300046810 | Bacteria | 4577 |
| 1168 | Ga0495660_0033838 | 3300046810 | Bacteria | 2862 |
| 1169 | Ga0495660_0129028 | 3300046810 | Bacteria | 1270 |
| 1170 | Ga0495660_0172199 | 3300046810 | Bacteria | 1053 |
| 1171 | Ga0495660_0186559 | 3300046810 | Bacteria | 999 |
| 1172 | Ga0495604_0008431 | 3300047317 | Bacteria | 8139 |
| 1173 | Ga0495636_0016827 | 3300047318 | Bacteria | 2924 |
| 1174 | Ga0495636_0163909 | 3300047318 | Bacteria | 1002 |
| 1175 | Ga0495674_0348451 | 3300047319 | Bacteria | 1203 |
| 1176 | Ga0495672_0000009 | 3300047320 | Bacteria | 557755 |
| 1177 | Ga0495672_0007676 | 3300047320 | Bacteria | 8085 |
| 1178 | Ga0495672_0008500 | 3300047320 | Bacteria | 7560 |
| 1179 | Ga0495672_0009606 | 3300047320 | Bacteria | 6984 |
| 1180 | Ga0495672_0015130 | 3300047320 | Bacteria | 5250 |
| 1181 | Ga0495672_0020631 | 3300047320 | Bacteria | 4312 |
| 1182 | Ga0495672_0035405 | 3300047320 | Bacteria | 3074 |
| 1183 | Ga0495672_0141233 | 3300047320 | Bacteria | 1258 |
| 1184 | Ga0495672_0227721 | 3300047320 | Bacteria | 916 |
| 1185 | Ga0495676_0000508 | 3300047321 | Bacteria | 31862 |
| 1186 | Ga0495676_0002177 | 3300047321 | Bacteria | 17357 |
| 1187 | Ga0495680_0014817 | 3300047322 | Bacteria | 6740 |
| 1188 | Ga0495680_0127637 | 3300047322 | Bacteria | 1871 |
| 1189 | Ga0495683_0000053 | 3300047323 | Bacteria | 121769 |
| 1190 | Ga0495683_0000129 | 3300047323 | Bacteria | 75590 |
| 1191 | Ga0495683_0002438 | 3300047323 | Bacteria | 11243 |
| 1192 | Ga0495683_0003047 | 3300047323 | Bacteria | 9849 |
| 1193 | Ga0495683_0003636 | 3300047323 | Bacteria | 8943 |
| 1194 | Ga0495687_004396 | 3300047443 | Bacteria | 9556 |
| 1195 | Ga0495687_010164 | 3300047443 | Bacteria | 5181 |
| 1196 | Ga0495675_0012350 | 3300047444 | Bacteria | 5375 |
| 1197 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 1198 | Ga0495679_000075 | 3300047446 | Bacteria | 95844 |
| 1199 | Ga0495679_000381 | 3300047446 | Bacteria | 34012 |
| 1200 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 1201 | Ga0495673_0000071 | 3300047469 | Bacteria | 217117 |
| 1202 | Ga0495673_0000099 | 3300047469 | Bacteria | 179978 |
| 1203 | Ga0495673_0001468 | 3300047469 | Bacteria | 18689 |
| 1204 | Ga0495673_0003834 | 3300047469 | Bacteria | 9708 |
| 1205 | Ga0495673_0004508 | 3300047469 | Bacteria | 8694 |
| 1206 | Ga0495673_0005014 | 3300047469 | Bacteria | 8123 |
| 1207 | Ga0495673_0005967 | 3300047469 | Bacteria | 7250 |
| 1208 | Ga0495673_0014795 | 3300047469 | Bacteria | 4045 |
| 1209 | Ga0495673_0022827 | 3300047469 | Bacteria | 3058 |
| 1210 | Ga0495673_0068555 | 3300047469 | Bacteria | 1498 |
| 1211 | Ga0495673_0116260 | 3300047469 | Bacteria | 1063 |
| 1212 | Ga0495681_0002160 | 3300047470 | Bacteria | 14254 |
| 1213 | Ga0495681_0017030 | 3300047470 | Bacteria | 4049 |
| 1214 | Ga0495681_0026095 | 3300047470 | Bacteria | 3049 |
| 1215 | Ga0495681_0026592 | 3300047470 | Bacteria | 3007 |
| 1216 | Ga0495681_0103111 | 3300047470 | Bacteria | 1244 |
| 1217 | Ga0495684_0015811 | 3300047471 | Bacteria | 5808 |
| 1218 | Ga0495686_0000255 | 3300047472 | Bacteria | 95600 |
| 1219 | Ga0495686_0003112 | 3300047472 | Bacteria | 14658 |
| 1220 | Ga0495686_0013966 | 3300047472 | Bacteria | 5552 |
| 1221 | Ga0495686_0128482 | 3300047472 | Bacteria | 1504 |
| 1222 | Ga0495686_0246428 | 3300047472 | Bacteria | 1005 |
| 1223 | Ga0495593_0029323 | 3300047673 | Bacteria | 3017 |
| 1224 | Ga0495626_0000250 | 3300048091 | Bacteria | 62295 |
| 1225 | Ga0495626_0003380 | 3300048091 | Bacteria | 10269 |
| 1226 | Ga0495626_0005631 | 3300048091 | Bacteria | 7260 |
| 1227 | Ga0495626_0031579 | 3300048091 | Bacteria | 2547 |
| 1228 | Ga0495626_0065118 | 3300048091 | Bacteria | 1650 |
| 1229 | Ga0495626_0079876 | 3300048091 | Bacteria | 1454 |
| 1230 | Ga0496100_0097587 | 3300048903 | Bacteria | 2018 |
| 1231 | Ga0496100_0269206 | 3300048903 | Bacteria | 1266 |
| 1232 | Ga0496101_0042073 | 3300048904 | Bacteria | 3261 |
| 1233 | Ga0496102_0006510 | 3300048905 | Bacteria | 9963 |
| 1234 | Ga0496102_0052861 | 3300048905 | Bacteria | 3702 |
| 1235 | Ga0496103_0007448 | 3300048906 | Bacteria | 6523 |
| 1236 | Ga0496103_0196798 | 3300048906 | Bacteria | 1296 |
| 1237 | Ga0496105_0000498 | 3300048908 | Bacteria | 25929 |
| 1238 | Ga0496105_0136287 | 3300048908 | Bacteria | 2022 |
| 1239 | Ga0496106_0000153 | 3300048909 | Bacteria | 51161 |
| 1240 | Ga0496106_0019257 | 3300048909 | Bacteria | 5062 |
| 1241 | Ga0496108_0058937 | 3300048911 | Bacteria | 3229 |
| 1242 | Ga0496109_0054813 | 3300048912 | Bacteria | 3636 |
| 1243 | Ga0496115_0438437 | 3300048918 | Bacteria | 1056 |
| 1244 | Ga0496116_0000005 | 3300048919 | Bacteria | 827804 |
| 1245 | Ga0496116_0000420 | 3300048919 | Bacteria | 59988 |
| 1246 | Ga0496116_0000426 | 3300048919 | Bacteria | 59252 |
| 1247 | Ga0496116_0017981 | 3300048919 | Bacteria | 5465 |
| 1248 | Ga0496116_0052335 | 3300048919 | Bacteria | 2706 |
| 1249 | Ga0496117_0001337 | 3300048920 | Bacteria | 36234 |
| 1250 | Ga0496117_0014648 | 3300048920 | Bacteria | 6742 |
| 1251 | Ga0496117_0038224 | 3300048920 | Bacteria | 3563 |
| 1252 | Ga0496118_0000749 | 3300048921 | Bacteria | 52548 |
| 1253 | Ga0496118_0003213 | 3300048921 | Bacteria | 20858 |
| 1254 | Ga0496118_0003350 | 3300048921 | Bacteria | 20288 |
| 1255 | Ga0496118_0004127 | 3300048921 | Bacteria | 17575 |
| 1256 | Ga0496118_0006111 | 3300048921 | Bacteria | 13384 |
| 1257 | Ga0496118_0039751 | 3300048921 | Bacteria | 3750 |
| 1258 | Ga0496118_0045640 | 3300048921 | Bacteria | 3417 |
| 1259 | Ga0496118_0204389 | 3300048921 | Bacteria | 1166 |
| 1260 | Ga0496119_0000943 | 3300048922 | Bacteria | 37460 |
| 1261 | Ga0496119_0010600 | 3300048922 | Bacteria | 7731 |
| 1262 | Ga0496119_0027685 | 3300048922 | Bacteria | 3889 |
| 1263 | Ga0496119_0036096 | 3300048922 | Bacteria | 3230 |
| 1264 | Ga0496119_0049647 | 3300048922 | Bacteria | 2592 |
| 1265 | Ga0496120_0000081 | 3300048923 | Bacteria | 158294 |
| 1266 | Ga0496120_0002521 | 3300048923 | Bacteria | 18302 |
| 1267 | Ga0496120_0002840 | 3300048923 | Bacteria | 16687 |
| 1268 | Ga0496121_0000126 | 3300048924 | Bacteria | 168873 |
| 1269 | Ga0496121_0000210 | 3300048924 | Bacteria | 128287 |
| 1270 | Ga0496121_0002035 | 3300048924 | Bacteria | 31995 |
| 1271 | Ga0496121_0003354 | 3300048924 | Bacteria | 22975 |
| 1272 | Ga0496121_0003580 | 3300048924 | Bacteria | 21935 |
| 1273 | Ga0496121_0006074 | 3300048924 | Bacteria | 15198 |
| 1274 | Ga0496121_0007739 | 3300048924 | Bacteria | 12880 |
| 1275 | Ga0496121_0021277 | 3300048924 | Bacteria | 6362 |
| 1276 | Ga0496121_0042326 | 3300048924 | Bacteria | 3964 |
| 1277 | Ga0496121_0056799 | 3300048924 | Bacteria | 3248 |
| 1278 | Ga0496121_0207584 | 3300048924 | Bacteria | 1390 |
| 1279 | Ga0496122_0000003 | 3300048925 | Bacteria | 645810 |
| 1280 | Ga0496122_0004101 | 3300048925 | Bacteria | 18456 |
| 1281 | Ga0496122_0010966 | 3300048925 | Bacteria | 9262 |
| 1282 | Ga0496122_0015351 | 3300048925 | Bacteria | 7326 |
| 1283 | Ga0496122_0019389 | 3300048925 | Bacteria | 6216 |
| 1284 | Ga0496122_0026085 | 3300048925 | Bacteria | 5054 |
| 1285 | Ga0496122_0026167 | 3300048925 | Bacteria | 5041 |
| 1286 | Ga0496122_0043240 | 3300048925 | Bacteria | 3532 |
| 1287 | Ga0496122_0148532 | 3300048925 | Bacteria | 1451 |
| 1288 | Ga0496122_0163767 | 3300048925 | Bacteria | 1352 |
| 1289 | Ga0496123_0000012 | 3300048926 | Bacteria | 458760 |
| 1290 | Ga0496123_0001037 | 3300048926 | Bacteria | 42105 |
| 1291 | Ga0496123_0002927 | 3300048926 | Bacteria | 19981 |
| 1292 | Ga0496123_0003252 | 3300048926 | Bacteria | 18456 |
| 1293 | Ga0496123_0006129 | 3300048926 | Bacteria | 11789 |
| 1294 | Ga0496123_0008715 | 3300048926 | Bacteria | 9259 |
| 1295 | Ga0496123_0047090 | 3300048926 | Bacteria | 2917 |
| 1296 | Ga0496124_0000382 | 3300048927 | Bacteria | 80986 |
| 1297 | Ga0496124_0001085 | 3300048927 | Bacteria | 42903 |
| 1298 | Ga0496124_0007002 | 3300048927 | Bacteria | 12084 |
| 1299 | Ga0496124_0011459 | 3300048927 | Bacteria | 8863 |
| 1300 | Ga0496124_0034709 | 3300048927 | Bacteria | 4421 |
| 1301 | Ga0496124_0044392 | 3300048927 | Bacteria | 3814 |
| 1302 | Ga0496124_0061908 | 3300048927 | Bacteria | 3134 |
| 1303 | Ga0496124_0111270 | 3300048927 | Bacteria | 2203 |
| 1304 | Ga0496124_0153205 | 3300048927 | Bacteria | 1805 |
| 1305 | Ga0496125_0003846 | 3300048928 | Bacteria | 17813 |
| 1306 | Ga0496125_0005039 | 3300048928 | Bacteria | 14904 |
| 1307 | Ga0496125_0111055 | 3300048928 | Bacteria | 1985 |
| 1308 | Ga0496125_0135733 | 3300048928 | Bacteria | 1721 |
| 1309 | Ga0496126_0013672 | 3300048929 | Bacteria | 8240 |
| 1310 | Ga0496126_0025112 | 3300048929 | Bacteria | 5740 |
| 1311 | Ga0496126_0210905 | 3300048929 | Bacteria | 1635 |
| 1312 | Ga0496126_0256171 | 3300048929 | Bacteria | 1457 |
| 1313 | Ga0495678_000207 | 3300049459 | Bacteria | 68441 |
| 1314 | Ga0495678_000362 | 3300049459 | Bacteria | 46331 |
| 1315 | Ga0495678_000688 | 3300049459 | Bacteria | 31040 |
| 1316 | Ga0495678_003571 | 3300049459 | Bacteria | 9521 |
| 1317 | Ga0495678_009139 | 3300049459 | Bacteria | 4936 |
| 1318 | Ga0495682_0000268 | 3300049460 | Bacteria | 41058 |
| 1319 | Ga0495682_0001604 | 3300049460 | Bacteria | 11665 |
| 1320 | Ga0495682_0002356 | 3300049460 | Bacteria | 8981 |
| 1321 | Ga0495682_0007117 | 3300049460 | Bacteria | 4472 |
| 1322 | Ga0501031_0018035 | 3300049568 | Bacteria | 4591 |
| 1323 | Ga0501031_0025351 | 3300049568 | Bacteria | 3868 |
| 1324 | Ga0501031_0031753 | 3300049568 | Bacteria | 3445 |
| 1325 | Ga0501032_0002909 | 3300049569 | Bacteria | 13306 |
| 1326 | Ga0501032_0035250 | 3300049569 | Bacteria | 3422 |
| 1327 | Ga0501032_0077868 | 3300049569 | Bacteria | 2207 |
| 1328 | Ga0501032_0198587 | 3300049569 | Bacteria | 1309 |
| 1329 | Ga0501033_0087350 | 3300049570 | Bacteria | 2282 |
| 1330 | Ga0501034_0002351 | 3300049571 | Bacteria | 23045 |
| 1331 | Ga0501034_0021040 | 3300049571 | Bacteria | 6657 |
| 1332 | Ga0501034_0081004 | 3300049571 | Bacteria | 3249 |
| 1333 | Ga0501034_0242331 | 3300049571 | Bacteria | 1749 |
| 1334 | Ga0501036_0006637 | 3300049572 | Bacteria | 9404 |
| 1335 | Ga0501036_0007248 | 3300049572 | Bacteria | 9030 |
| 1336 | Ga0501036_0023358 | 3300049572 | Bacteria | 5208 |
| 1337 | Ga0501037_0000336 | 3300049573 | Bacteria | 39761 |
| 1338 | Ga0501037_0000890 | 3300049573 | Bacteria | 22295 |
| 1339 | Ga0501037_0009363 | 3300049573 | Bacteria | 7190 |
| 1340 | Ga0501037_0026716 | 3300049573 | Bacteria | 4266 |
| 1341 | Ga0501037_0067848 | 3300049573 | Bacteria | 2597 |
| 1342 | Ga0501037_0100311 | 3300049573 | Bacteria | 2090 |
| 1343 | Ga0501038_0000613 | 3300049574 | Bacteria | 31786 |
| 1344 | Ga0501038_0000890 | 3300049574 | Bacteria | 26458 |
| 1345 | Ga0501038_0004044 | 3300049574 | Bacteria | 13629 |
| 1346 | Ga0501038_0026144 | 3300049574 | Bacteria | 5200 |
| 1347 | Ga0501038_0038270 | 3300049574 | Bacteria | 4201 |
| 1348 | Ga0501038_0097095 | 3300049574 | Bacteria | 2458 |
| 1349 | Ga0501039_0001459 | 3300049575 | Bacteria | 17382 |
| 1350 | Ga0501039_0009292 | 3300049575 | Bacteria | 7487 |
| 1351 | Ga0501039_0087227 | 3300049575 | Bacteria | 2431 |
| 1352 | Ga0501040_0008402 | 3300049576 | Bacteria | 6708 |
| 1353 | Ga0501040_0009285 | 3300049576 | Bacteria | 6406 |
| 1354 | Ga0501040_0048208 | 3300049576 | Bacteria | 2911 |
| 1355 | Ga0501040_0252368 | 3300049576 | Bacteria | 1258 |
| 1356 | Ga0501041_0022214 | 3300049577 | Bacteria | 3798 |
| 1357 | Ga0501041_0066644 | 3300049577 | Bacteria | 2206 |
| 1358 | Ga0501042_0006811 | 3300049578 | Bacteria | 7451 |
| 1359 | Ga0501042_0012620 | 3300049578 | Bacteria | 5730 |
| 1360 | Ga0501042_0022927 | 3300049578 | Bacteria | 4362 |
| 1361 | Ga0501042_0068854 | 3300049578 | Bacteria | 2531 |
| 1362 | Ga0501042_0076687 | 3300049578 | Bacteria | 2393 |
| 1363 | Ga0501042_0132794 | 3300049578 | Bacteria | 1794 |
| 1364 | Ga0501043_0001577 | 3300049579 | Bacteria | 19829 |
| 1365 | Ga0501043_0005458 | 3300049579 | Bacteria | 10279 |
| 1366 | Ga0501043_0027068 | 3300049579 | Bacteria | 4501 |
| 1367 | Ga0501046_0002547 | 3300049580 | Bacteria | 17048 |
| 1368 | Ga0501046_0015065 | 3300049580 | Bacteria | 6502 |
| 1369 | Ga0501046_0041807 | 3300049580 | Bacteria | 3656 |
| 1370 | Ga0501046_0226372 | 3300049580 | Bacteria | 1383 |
| 1371 | Ga0501047_0013033 | 3300049581 | Bacteria | 7875 |
| 1372 | Ga0501047_0079878 | 3300049581 | Bacteria | 3144 |
| 1373 | Ga0501047_0092112 | 3300049581 | Bacteria | 2909 |
| 1374 | Ga0501048_0001575 | 3300049582 | Bacteria | 17326 |
| 1375 | Ga0501048_0049744 | 3300049582 | Bacteria | 2987 |
| 1376 | Ga0501048_0435151 | 3300049582 | Bacteria | 939 |
| 1377 | Ga0501068_0000860 | 3300049584 | Bacteria | 15814 |
| 1378 | Ga0501069_0019390 | 3300049585 | Bacteria | 3678 |
| 1379 | Ga0501069_0030778 | 3300049585 | Bacteria | 2949 |
| 1380 | Ga0501069_0033248 | 3300049585 | Bacteria | 2840 |
| 1381 | Ga0501070_0000970 | 3300049586 | Bacteria | 25738 |
| 1382 | Ga0501070_0005927 | 3300049586 | Bacteria | 10421 |
| 1383 | Ga0501070_0007212 | 3300049586 | Bacteria | 9435 |
| 1384 | Ga0501070_0026151 | 3300049586 | Bacteria | 4898 |
| 1385 | Ga0501070_0057879 | 3300049586 | Bacteria | 3213 |
| 1386 | Ga0501070_0059757 | 3300049586 | Bacteria | 3160 |
| 1387 | Ga0501070_0306057 | 3300049586 | Bacteria | 1294 |
| 1388 | Ga0501070_0512149 | 3300049586 | Bacteria | 963 |
| 1389 | Ga0501071_0006866 | 3300049587 | Bacteria | 7419 |
| 1390 | Ga0501071_0008275 | 3300049587 | Bacteria | 6868 |
| 1391 | Ga0501071_0028510 | 3300049587 | Bacteria | 3936 |
| 1392 | Ga0501071_0046888 | 3300049587 | Bacteria | 3104 |
| 1393 | Ga0501071_0199893 | 3300049587 | Bacteria | 1501 |
| 1394 | Ga0501072_0001665 | 3300049588 | Bacteria | 16559 |
| 1395 | Ga0501072_0050306 | 3300049588 | Bacteria | 3281 |
| 1396 | Ga0501072_0081218 | 3300049588 | Bacteria | 2569 |
| 1397 | Ga0501072_0222534 | 3300049588 | Bacteria | 1504 |
| 1398 | Ga0501073_0001296 | 3300049589 | Bacteria | 18376 |
| 1399 | Ga0501073_0005417 | 3300049589 | Bacteria | 9556 |
| 1400 | Ga0501074_0003467 | 3300049590 | Bacteria | 11194 |
| 1401 | Ga0501074_0004606 | 3300049590 | Bacteria | 9872 |
| 1402 | Ga0501074_0046643 | 3300049590 | Bacteria | 3133 |
| 1403 | Ga0501074_0051278 | 3300049590 | Bacteria | 2978 |
| 1404 | Ga0501075_0005794 | 3300049591 | Bacteria | 8453 |
| 1405 | Ga0501076_0004278 | 3300049592 | Bacteria | 10114 |
| 1406 | Ga0501076_0017297 | 3300049592 | Bacteria | 5477 |
| 1407 | Ga0501076_0080183 | 3300049592 | Bacteria | 2619 |
| 1408 | Ga0501076_0087147 | 3300049592 | Bacteria | 2510 |
| 1409 | Ga0501076_0096624 | 3300049592 | Bacteria | 2380 |
| 1410 | Ga0501076_0184567 | 3300049592 | Bacteria | 1701 |
| 1411 | Ga0501076_0263768 | 3300049592 | Bacteria | 1410 |
| 1412 | Ga0501077_0004143 | 3300049593 | Bacteria | 8765 |
| 1413 | Ga0501077_0005084 | 3300049593 | Bacteria | 7983 |
| 1414 | Ga0501077_0015808 | 3300049593 | Bacteria | 4753 |
| 1415 | Ga0501077_0018766 | 3300049593 | Bacteria | 4376 |
| 1416 | Ga0501079_0005616 | 3300049741 | Bacteria | 9360 |
| 1417 | Ga0501079_0038157 | 3300049741 | Bacteria | 3705 |
| 1418 | Ga0501079_0066439 | 3300049741 | Bacteria | 2782 |
| 1419 | Ga0501079_0102905 | 3300049741 | Bacteria | 2215 |
| 1420 | Ga0501080_0009700 | 3300049742 | Bacteria | 8791 |
| 1421 | Ga0501080_0037690 | 3300049742 | Bacteria | 4514 |
| 1422 | Ga0501080_0051433 | 3300049742 | Bacteria | 3833 |
| 1423 | Ga0501081_0000359 | 3300049743 | Bacteria | 24723 |
| 1424 | Ga0501081_0006393 | 3300049743 | Bacteria | 7645 |
| 1425 | Ga0501081_0018913 | 3300049743 | Bacteria | 4578 |
| 1426 | Ga0501081_0021470 | 3300049743 | Bacteria | 4309 |
| 1427 | Ga0501083_0069785 | 3300049744 | Bacteria | 2338 |
| 1428 | Ga0501035_0002833 | 3300049822 | Bacteria | 16759 |
| 1429 | Ga0501035_0017003 | 3300049822 | Bacteria | 6703 |
| 1430 | Ga0501035_0025839 | 3300049822 | Bacteria | 5381 |
| 1431 | Ga0501035_0030682 | 3300049822 | Bacteria | 4900 |
| 1432 | Ga0501035_0047129 | 3300049822 | Bacteria | 3871 |
| 1433 | Ga0501035_0049018 | 3300049822 | Bacteria | 3786 |
| 1434 | Ga0501035_0100512 | 3300049822 | Bacteria | 2539 |
| 1435 | Ga0501044_0000233 | 3300049823 | Bacteria | 69824 |
| 1436 | Ga0501044_0007876 | 3300049823 | Bacteria | 11711 |
| 1437 | Ga0501044_0027700 | 3300049823 | Bacteria | 5982 |
| 1438 | Ga0501044_0178374 | 3300049823 | Bacteria | 2092 |
| 1439 | Ga0501044_0398670 | 3300049823 | Bacteria | 1289 |
| 1440 | Ga0501045_0015215 | 3300049824 | Bacteria | 5460 |
| 1441 | Ga0501045_0216215 | 3300049824 | Bacteria | 1427 |
| 1442 | Ga0501226_000016 | 3300049853 | Bacteria | 154924 |
| 1443 | nmdc:mga05p37_11639_c1 | 3300050507 | Bacteria | 10485 |
| 1444 | nmdc:mga05p37_50302_c1 | 3300050507 | Bacteria | 5125 |
| 1445 | nmdc:mga05p37_683579_c1 | 3300050507 | Bacteria | 1143 |
| 1446 | nmdc:mga05p37_704269_c1 | 3300050507 | Bacteria | 1121 |
| 1447 | nmdc:mga09592_121791_c1 | 3300050508 | Bacteria | 2241 |
| 1448 | nmdc:mga09592_1590_c1 | 3300050508 | Bacteria | 18289 |
| 1449 | nmdc:mga09592_28889_c1 | 3300050508 | Bacteria | 4611 |
| 1450 | nmdc:mga09592_42861_c1 | 3300050508 | Bacteria | 3807 |
| 1451 | nmdc:mga0qj67_256366_c1 | 3300050509 | Bacteria | 1419 |
| 1452 | nmdc:mga0qj67_27615_c1 | 3300050509 | Bacteria | 4401 |
| 1453 | nmdc:mga0qj67_35491_c1 | 3300050509 | Bacteria | 3899 |
| 1454 | nmdc:mga06r32_12939_c1 | 3300050510 | Bacteria | 7544 |
| 1455 | nmdc:mga06r32_21093_c1 | 3300050510 | Bacteria | 6011 |
| 1456 | nmdc:mga06r32_2483_c1 | 3300050510 | Bacteria | 16504 |
| 1457 | nmdc:mga06r32_29_c1 | 3300050510 | Bacteria | 85620 |
| 1458 | nmdc:mga06r32_52865_c1 | 3300050510 | Bacteria | 3891 |
| 1459 | nmdc:mga06r32_73794_c1 | 3300050510 | Bacteria | 3306 |
| 1460 | nmdc:mga08y16_17178_c1 | 3300050511 | Bacteria | 7616 |
| 1461 | nmdc:mga08y16_223682_c1 | 3300050511 | Bacteria | 1948 |
| 1462 | nmdc:mga08y16_228495_c1 | 3300050511 | Bacteria | 1925 |
| 1463 | nmdc:mga08y16_34011_c1 | 3300050511 | Bacteria | 5354 |
| 1464 | nmdc:mga08y16_56030_c1 | 3300050511 | Bacteria | 4120 |
| 1465 | nmdc:mga0n895_387277_c1 | 3300050512 | Bacteria | 1414 |
| 1466 | nmdc:mga08x19_27949_c1 | 3300050514 | Bacteria | 3530 |
| 1467 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 1468 | Ga0500646_0009536 | 3300053090 | Bacteria | 2485 |
| 1469 | Ga0500651_0010486 | 3300053093 | Bacteria | 5557 |
| 1470 | Ga0500641_0004188 | 3300053096 | Bacteria | 5090 |
| 1471 | Ga0500555_001433 | 3300053103 | Bacteria | 7310 |
| 1472 | Ga0500573_0188865 | 3300053140 | Bacteria | 1102 |
| 1473 | Ga0500645_013165 | 3300053730 | Bacteria | 2660 |
| 1474 | Ga0501084_0007065 | 3300054114 | Bacteria | 9251 |
| 1475 | Ga0501084_0021309 | 3300054114 | Bacteria | 5402 |
| 1476 | Ga0501082_0078438 | 3300060353 | Bacteria | 2849 |
| 1477 | Ga0501082_0148097 | 3300060353 | Bacteria | 2038 |
| 1478 | Ga0501082_0323856 | 3300060353 | Bacteria | 1343 |
| 1479 | Ga0501082_0368765 | 3300060353 | Bacteria | 1252 |
| 1480 | Ga0530510_0000025 | 3300061734 | Bacteria | 67946 |
| 1481 | Ga0530510_0198611 | 3300061734 | Bacteria | 1489 |
| 1482 | Ga0530510_0216908 | 3300061734 | Bacteria | 1422 |
| 1483 | 2506584749 | 2506520008 | Bacteria | 5443009 |
| 1484 | 2508853399 | 2508501071 | Bacteria | 5454741 |
| 1485 | 2511257597 | 2511231004 | Bacteria | 6669789 |
| 1486 | 2511263655 | 2511231006 | Bacteria | 6794709 |
| 1487 | 2511270258 | 2511231007 | Bacteria | 6306603 |
| 1488 | 2511276448 | 2511231008 | Bacteria | 6624100 |
| 1489 | 2511291008 | 2511231010 | Bacteria | 6373152 |
| 1490 | 2511294262 | 2511231011 | Bacteria | 6149768 |
| 1491 | 2511302443 | 2511231012 | Bacteria | 6738011 |
| 1492 | 2511314040 | 2511231014 | Bacteria | 6462302 |
| 1493 | 2511320000 | 2511231015 | Bacteria | 6598026 |
| 1494 | 2511324788 | 2511231016 | Bacteria | 6704427 |
| 1495 | 2511330333 | 2511231017 | Bacteria | 6503007 |
| 1496 | 2511338012 | 2511231018 | Bacteria | 6436256 |
| 1497 | 2511342823 | 2511231019 | Bacteria | 6520662 |
| 1498 | 2511348792 | 2511231020 | Bacteria | 6115223 |
| 1499 | 2511354868 | 2511231021 | Bacteria | 7302637 |
| 1500 | 2511365893 | 2511231022 | Bacteria | 6719296 |
| 1501 | 2511369961 | 2511231023 | Bacteria | 6808468 |
| 1502 | 2511373241 | 2511231024 | Bacteria | 5835885 |
| 1503 | 2511380098 | 2511231025 | Bacteria | 5324661 |
| 1504 | 2511413258 | 2511231031 | Bacteria | 6558529 |
| 1505 | 2511434916 | 2511231035 | Bacteria | 5341610 |
| 1506 | 2511823903 | 2511231156 | Bacteria | 6845832 |
| 1507 | 2512326837 | 2512047018 | Bacteria | 6663241 |
| 1508 | 2538425420 | 2537561728 | Bacteria | 5149301 |
| 1509 | 2547697344 | 2547132181 | Bacteria | 4945084 |
| 1510 | 2548647709 | 2547132416 | Bacteria | 4633861 |
| 1511 | 2555259895 | 2554235234 | Bacteria | 5762085 |
| 1512 | 2555669063 | 2554235341 | Bacteria | 6867980 |
| 1513 | 2562463631 | 2561511199 | Bacteria | 5155034 |
| 1514 | 2583791469 | 2582580891 | Bacteria | 6800976 |
| 1515 | 2585827701 | 2585427591 | Bacteria | 5482980 |
| 1516 | 2585834813 | 2585427592 | Bacteria | 5370892 |
| 1517 | 2595445752 | 2593339238 | Bacteria | 4182970 |
| 1518 | 2595449395 | 2593339239 | Bacteria | 4124669 |
| 1519 | 2597857203 | 2597489887 | Bacteria | 6666321 |
| 1520 | 2597864875 | 2597489888 | Bacteria | 6179543 |
| 1521 | 2597870751 | 2597489889 | Bacteria | 6297495 |
| 1522 | 2599328646 | 2599185155 | Bacteria | 5827168 |
| 1523 | 2599358045 | 2599185160 | Bacteria | 6844013 |
| 1524 | 2599361803 | 2599185161 | Bacteria | 6960462 |
| 1525 | 2599368124 | 2599185162 | Bacteria | 6957254 |
| 1526 | 2599374913 | 2599185163 | Bacteria | 6995158 |
| 1527 | 2599383210 | 2599185164 | Bacteria | 6841688 |
| 1528 | 2599389407 | 2599185165 | Bacteria | 6843250 |
| 1529 | 2599393771 | 2599185166 | Bacteria | 6959206 |
| 1530 | 2599398057 | 2599185167 | Bacteria | 6353609 |
| 1531 | 2599405538 | 2599185168 | Bacteria | 6997636 |
| 1532 | 2599452514 | 2599185179 | Bacteria | 6611171 |
| 1533 | 2599464860 | 2599185181 | Bacteria | 6844519 |
| 1534 | 2599468412 | 2599185182 | Bacteria | 6883168 |
| 1535 | 2599484225 | 2599185185 | Bacteria | 6652270 |
| 1536 | 2599493884 | 2599185186 | Bacteria | 6831633 |
| 1537 | 2599503152 | 2599185188 | Bacteria | 6164180 |
| 1538 | 2599507060 | 2599185189 | Bacteria | 5862825 |
| 1539 | 2599516188 | 2599185190 | Bacteria | 6285678 |
| 1540 | 2599518382 | 2599185191 | Bacteria | 6297582 |
| 1541 | 2599614830 | 2599185212 | Bacteria | 6765997 |
| 1542 | 2599769713 | 2599185248 | Bacteria | 6696816 |
| 1543 | 2599801875 | 2599185257 | Bacteria | 6492581 |
| 1544 | 2599878216 | 2599185288 | Bacteria | 6666191 |
| 1545 | 2599889033 | 2599185289 | Bacteria | 6778765 |
| 1546 | 2599895514 | 2599185290 | Bacteria | 6289611 |
| 1547 | 2599901605 | 2599185291 | Bacteria | 6775623 |
| 1548 | 2599933658 | 2599185300 | Bacteria | 6062622 |
| 1549 | 2599942829 | 2599185302 | Bacteria | 5954930 |
| 1550 | 2599947409 | 2599185303 | Bacteria | 6512725 |
| 1551 | 2599953578 | 2599185304 | Bacteria | 5951361 |
| 1552 | 2599959264 | 2599185305 | Bacteria | 6748700 |
| 1553 | 2599964532 | 2599185306 | Bacteria | 6637356 |
| 1554 | 2599972107 | 2599185307 | Bacteria | 6194719 |
| 1555 | 2599975595 | 2599185308 | Bacteria | 6621546 |
| 1556 | 2599982163 | 2599185309 | Bacteria | 5969593 |
| 1557 | 2599988966 | 2599185310 | Bacteria | 6014457 |
| 1558 | 2599994711 | 2599185311 | Bacteria | 6354990 |
| 1559 | 2599999571 | 2599185312 | Bacteria | 5912071 |
| 1560 | 2600007312 | 2599185313 | Bacteria | 6658188 |
| 1561 | 2600009768 | 2599185314 | Bacteria | 6621749 |
| 1562 | 2600020513 | 2599185315 | Bacteria | 6771107 |
| 1563 | 2600025236 | 2599185316 | Bacteria | 6320029 |
| 1564 | 2600029745 | 2599185317 | Bacteria | 6435722 |
| 1565 | 2600037815 | 2599185318 | Bacteria | 6961590 |
| 1566 | 2600042008 | 2599185319 | Bacteria | 6637840 |
| 1567 | 2600046915 | 2599185320 | Bacteria | 5963263 |
| 1568 | 2600055026 | 2599185321 | Bacteria | 6764560 |
| 1569 | 2600057774 | 2599185322 | Bacteria | 6763055 |
| 1570 | 2600064789 | 2599185323 | Bacteria | 6688755 |
| 1571 | 2600071676 | 2599185324 | Bacteria | 6590677 |
| 1572 | 2600076039 | 2599185325 | Bacteria | 6324919 |
| 1573 | 2600217591 | 2599185356 | Bacteria | 6843884 |
| 1574 | 2600359340 | 2600254930 | Bacteria | 6431253 |
| 1575 | 2600365442 | 2600254931 | Bacteria | 6734225 |
| 1576 | 2600445635 | 2600254954 | Bacteria | 5100516 |
| 1577 | 2601524225 | 2600255254 | Bacteria | 5281859 |
| 1578 | 2601529379 | 2600255255 | Bacteria | 5282785 |
| 1579 | 2601540068 | 2600255257 | Bacteria | 5597196 |
| 1580 | 2601616213 | 2600255280 | Bacteria | 5292309 |
| 1581 | 2601620935 | 2600255281 | Bacteria | 5288753 |
| 1582 | 2601628789 | 2600255283 | Bacteria | 6061572 |
| 1583 | 2601644281 | 2600255287 | Bacteria | 5210468 |
| 1584 | 2601649332 | 2600255288 | Bacteria | 5282738 |
| 1585 | 2601654259 | 2600255289 | Bacteria | 5281907 |
| 1586 | 2601659681 | 2600255290 | Bacteria | 5282218 |
| 1587 | 2601664103 | 2600255291 | Bacteria | 5217298 |
| 1588 | 2601689848 | 2600255296 | Bacteria | 5784754 |
| 1589 | 2601697063 | 2600255298 | Bacteria | 5215185 |
| 1590 | 2601702109 | 2600255299 | Bacteria | 5218662 |
| 1591 | 2601707003 | 2600255300 | Bacteria | 5287774 |
| 1592 | 2601712045 | 2600255301 | Bacteria | 5280532 |
| 1593 | 2601717520 | 2600255302 | Bacteria | 5288235 |
| 1594 | 2601722211 | 2600255303 | Bacteria | 5219315 |
| 1595 | 2601727448 | 2600255304 | Bacteria | 5283973 |
| 1596 | 2601732487 | 2600255305 | Bacteria | 5282329 |
| 1597 | 2601736998 | 2600255306 | Bacteria | 5281613 |
| 1598 | 2601741280 | 2600255307 | Bacteria | 5439064 |
| 1599 | 2601752466 | 2600255309 | Bacteria | 5431045 |
| 1600 | 2601758691 | 2600255310 | Bacteria | 5600903 |
| 1601 | 2601764805 | 2600255311 | Bacteria | 5598766 |
| 1602 | 2601777759 | 2600255313 | Bacteria | 6842543 |
| 1603 | 2601795825 | 2600255318 | Bacteria | 6383414 |
| 1604 | 2602010051 | 2600255389 | Bacteria | 5275336 |
| 1605 | 2602019307 | 2600255392 | Bacteria | 5437392 |
| 1606 | 2603636847 | 2602042046 | Bacteria | 5483348 |
| 1607 | 2603645400 | 2602042047 | Bacteria | 4697674 |
| 1608 | 2603662266 | 2602042052 | Bacteria | 5215873 |
| 1609 | 2603667162 | 2602042053 | Bacteria | 5214361 |
| 1610 | 2603699374 | 2602042066 | Bacteria | 4423871 |
| 1611 | 2603705403 | 2602042067 | Bacteria | 4863713 |
| 1612 | 2603839872 | 2602042103 | Bacteria | 5284714 |
| 1613 | 2603844949 | 2602042104 | Bacteria | 5281639 |
| 1614 | 2603850047 | 2602042105 | Bacteria | 5282303 |
| 1615 | 2603855090 | 2602042106 | Bacteria | 5282744 |
| 1616 | 2603867905 | 2602042109 | Bacteria | 5152801 |
| 1617 | 2603872670 | 2602042110 | Bacteria | 5283285 |
| 1618 | 2603877973 | 2602042111 | Bacteria | 5212080 |
| 1619 | 2606049873 | 2603880178 | Bacteria | 5283018 |
| 1620 | 2606071534 | 2603880184 | Bacteria | 5217896 |
| 1621 | 2606075328 | 2603880185 | Bacteria | 6379190 |
| 1622 | 2606128191 | 2603880199 | Bacteria | 6377649 |
| 1623 | 2606147534 | 2603880202 | Bacteria | 5284684 |
| 1624 | 2606177762 | 2603880211 | Bacteria | 5284226 |
| 1625 | 2608381633 | 2606217733 | Bacteria | 6360972 |
| 1626 | 2609909621 | 2609459761 | Bacteria | 5513740 |
| 1627 | 2621298532 | 2619619299 | Bacteria | 6649820 |
| 1628 | 2624479762 | 2623620443 | Bacteria | 6427864 |
| 1629 | 2624491417 | 2623620446 | Bacteria | 6500345 |
| 1630 | 2637224047 | 2636415599 | Bacteria | 5718434 |
| 1631 | 2643842568 | 2643221565 | Bacteria | 6216018 |
| 1632 | 2643871578 | 2643221571 | Bacteria | 6228673 |
| 1633 | 2643884595 | 2643221574 | Bacteria | 2789653 |
| 1634 | 2643952955 | 2643221589 | Bacteria | 6250934 |
| 1635 | 2644022717 | 2643221602 | Bacteria | 6249926 |
| 1636 | 2644188890 | 2643221633 | Bacteria | 6733554 |
| 1637 | 2644284957 | 2643221650 | Bacteria | 7029547 |
| 1638 | 2644351436 | 2643221663 | Bacteria | 3425771 |
| 1639 | 2644549017 | 2643221699 | Bacteria | 5731501 |
| 1640 | 2644553250 | 2643221699 | Bacteria | 5731501 |
| 1641 | 2644621633 | 2643221713 | Bacteria | 6554480 |
| 1642 | 2650895788 | 2648501693 | Bacteria | 5069560 |
| 1643 | 2652548559 | 2651869719 | Bacteria | 6047974 |
| 1644 | 2656276958 | 2654587920 | Bacteria | 5475511 |
| 1645 | 2671093484 | 2667528170 | Bacteria | 6786960 |
| 1646 | 2671098442 | 2667528171 | Bacteria | 6900659 |
| 1647 | 2671101086 | 2667528172 | Bacteria | 5170840 |
| 1648 | 2671107136 | 2667528173 | Bacteria | 5375747 |
| 1649 | 2671128314 | 2667528176 | Bacteria | 6724917 |
| 1650 | 2671584508 | 2671180115 | Bacteria | 5353919 |
| 1651 | 2671768824 | 2671180172 | Bacteria | 6495783 |
| 1652 | 2676405455 | 2675903046 | Bacteria | 5451247 |
| 1653 | 2677899632 | 2675903420 | Bacteria | 6247433 |
| 1654 | 2678264255 | 2675903515 | Bacteria | 6580491 |
| 1655 | 2681996188 | 2681812866 | Bacteria | 4552357 |
| 1656 | 2682006476 | 2681812869 | Bacteria | 5014465 |
| 1657 | 2686354200 | 2684622997 | Bacteria | 4624240 |
| 1658 | 2687578747 | 2687453129 | Bacteria | 4387428 |
| 1659 | 2689446132 | 2687453601 | Bacteria | 5546041 |
| 1660 | 2707098858 | 2706794495 | Bacteria | 4536932 |
| 1661 | 2712468851 | 2711768156 | Bacteria | 4471618 |
| 1662 | 2715752533 | 2713897148 | Bacteria | 5883533 |
| 1663 | 2715758928 | 2713897149 | Bacteria | 6506249 |
| 1664 | 2718633434 | 2718217725 | Bacteria | 5758958 |
| 1665 | 2721027940 | 2718218334 | Bacteria | 4765486 |
| 1666 | 2723249632 | 2721755607 | Bacteria | 5841722 |
| 1667 | 2729148192 | 2728369097 | Bacteria | 4333476 |
| 1668 | 2735836488 | 2734482264 | Unclassified | 5014763 |
| 1669 | 2738674558 | 2738541265 | Bacteria | 6594665 |
| 1670 | 2738752951 | 2738541282 | Bacteria | 6593925 |
| 1671 | 2738809710 | 2738541294 | Bacteria | 6925949 |
| 1672 | 2738861992 | 2738541303 | Bacteria | 6591772 |
| 1673 | 2738897070 | 2738541309 | Bacteria | 6926455 |
| 1674 | 2739199792 | 2738543004 | Bacteria | 6381073 |
| 1675 | 2739227413 | 2738543009 | Bacteria | 4944499 |
| 1676 | 2739259433 | 2738543015 | Bacteria | 6750701 |
| 1677 | 2739264367 | 2738543016 | Bacteria | 5657564 |
| 1678 | 2739284986 | 2738543020 | Bacteria | 5718238 |
| 1679 | 2739290300 | 2738543021 | Bacteria | 5718241 |
| 1680 | 2739315789 | 2738543025 | Bacteria | 6600348 |
| 1681 | 2743736619 | 2740892503 | Bacteria | 6855563 |
| 1682 | 2745004710 | 2744054620 | Bacteria | 6551379 |
| 1683 | 2753856950 | 2751185917 | Bacteria | 4551186 |
| 1684 | 2765585220 | 2765235841 | Bacteria | 6137024 |
| 1685 | 2765590055 | 2765235842 | Bacteria | 4799256 |
| 1686 | 2772440047 | 2772190666 | Bacteria | 5117644 |
| 1687 | 2774120998 | 2773857670 | Bacteria | 6407454 |
| 1688 | 2774137343 | 2773857673 | Bacteria | 6513460 |
| 1689 | 2775541273 | 2775506706 | Bacteria | 4873073 |
| 1690 | 2777020980 | 2775507074 | Bacteria | 5532402 |
| 1691 | 2784263653 | 2784132063 | Bacteria | 6262788 |
| 1692 | 2784314070 | 2784132072 | Bacteria | 6596533 |
| 1693 | 2791922321 | 2791354903 | Bacteria | 4937680 |
| 1694 | 2792311987 | 2791355010 | Bacteria | 4864581 |
| 1695 | 2793404707 | 2791355275 | Bacteria | 4429597 |
| 1696 | 2794596658 | 2791355520 | Bacteria | 5948615 |
| 1697 | 2807179676 | 2806310673 | Bacteria | 4801221 |
| 1698 | 2807407436 | 2806310737 | Bacteria | 5751088 |
| 1699 | 2807455764 | 2806310745 | Bacteria | 5742165 |
| 1700 | 2807455775 | 2806310745 | Bacteria | 5742165 |
| 1701 | 2808857651 | 2808606361 | Bacteria | 6136259 |
| 1702 | 2808904411 | 2808606373 | Bacteria | 4423627 |
| 1703 | 2808924733 | 2808606376 | Bacteria | 6248667 |
| 1704 | 2808927746 | 2808606377 | Bacteria | 6646337 |
| 1705 | 2808937821 | 2808606378 | Bacteria | 6177535 |
| 1706 | 2808939157 | 2808606379 | Bacteria | 5022697 |
| 1707 | 2808946835 | 2808606380 | Bacteria | 6248705 |
| 1708 | 2808949714 | 2808606381 | Bacteria | 6646461 |
| 1709 | 2808960249 | 2808606382 | Bacteria | 6841132 |
| 1710 | 2808966135 | 2808606383 | Bacteria | 6138645 |
| 1711 | 2808977164 | 2808606385 | Bacteria | 6711065 |
| 1712 | 2808992319 | 2808606388 | Bacteria | 6706662 |
| 1713 | 2809000975 | 2808606389 | Bacteria | 6138126 |
| 1714 | 2809125231 | 2808606414 | Bacteria | 4917181 |
| 1715 | 2809216713 | 2808606445 | Bacteria | 6057339 |
| 1716 | 2812365694 | 2811994881 | Bacteria | 6298475 |
| 1717 | 2813727857 | 2811995292 | Bacteria | 5303342 |
| 1718 | 2814695400 | 2814123068 | Bacteria | 5687681 |
| 1719 | 2817492320 | 2816332298 | Bacteria | 6852809 |
| 1720 | 2819563880 | 2818991440 | Bacteria | 4774720 |
| 1721 | 2819656463 | 2818991456 | Bacteria | 6123676 |
| 1722 | 2819703522 | 2818991464 | Bacteria | 6907494 |
| 1723 | 2821121074 | 2821118458 | Bacteria | 4714306 |
| 1724 | 2823375708 | 2823373977 | Bacteria | 4779415 |
| 1725 | 2823424115 | 2823421272 | Bacteria | 5372474 |
| 1726 | 2825656805 | 2825651385 | Bacteria | 6715909 |
| 1727 | 2826583643 | 2826581358 | Bacteria | 5963467 |
| 1728 | 2834033736 | 2834028612 | Bacteria | 6354979 |
| 1729 | 2842809437 | 2842805378 | Bacteria | 5385175 |
| 1730 | 2842818139 | 2842815866 | Bacteria | 5947510 |
| 1731 | 2842831129 | 2842826826 | Bacteria | 5974129 |
| 1732 | 2842832365 | 2842832357 | Bacteria | 5959113 |
| 1733 | 2842842388 | 2842837860 | Bacteria | 6066181 |
| 1734 | 2842848654 | 2842843487 | Bacteria | 6004777 |
| 1735 | 2842849226 | 2842849001 | Bacteria | 5924277 |
| 1736 | 2842854798 | 2842854478 | Bacteria | 6143501 |
| 1737 | 2842915603 | 2842914999 | Bacteria | 4419378 |
| 1738 | 2842919568 | 2842918807 | Bacteria | 4289178 |
| 1739 | 2844428399 | 2844425489 | Bacteria | 4854065 |
| 1740 | 2844529159 | 2844528606 | Bacteria | 4733806 |
| 1741 | 2844669501 | 2844665904 | Bacteria | 6817974 |
| 1742 | 2846540673 | 2846540461 | Bacteria | 5471451 |
| 1743 | 2847086590 | 2847085930 | Bacteria | 5070450 |
| 1744 | 2847798937 | 2847797336 | Bacteria | 5176640 |
| 1745 | 2852107054 | 2852103415 | Bacteria | 5193810 |
| 1746 | 2852613482 | 2852612431 | Bacteria | 6885235 |
| 1747 | 2852658271 | 2852657418 | Bacteria | 6472974 |
| 1748 | 2852668782 | 2852667396 | Bacteria | 6885555 |
| 1749 | 2854606083 | 2854601825 | Bacteria | 4797592 |
| 1750 | 2855197391 | 2855195626 | Bacteria | 4927512 |
| 1751 | 2858468363 | 2858466076 | Bacteria | 4722413 |
| 1752 | 2860339622 | 2860339153 | Bacteria | 6846989 |
| 1753 | 2860871385 | 2860867994 | Bacteria | 5645326 |
| 1754 | 2865016591 | 2865014394 | Bacteria | 4764573 |
| 1755 | 2869555482 | 2869551831 | Bacteria | 5474685 |
| 1756 | 2871275976 | 2871272651 | Bacteria | 5042015 |
| 1757 | 2871285832 | 2871282230 | Bacteria | 4917173 |
| 1758 | 2876603243 | 2876601092 | Bacteria | 5114497 |
| 1759 | 2878031774 | 2878029506 | Bacteria | 6418441 |
| 1760 | 2880234275 | 2880230671 | Bacteria | 6140320 |
| 1761 | 2881612562 | 2881609920 | Bacteria | 4405319 |
| 1762 | 2884087839 | 2884086401 | Bacteria | 5005459 |
| 1763 | 2887632269 | 2887630918 | Bacteria | 3239855 |
| 1764 | 2888370139 | 2888366609 | Bacteria | 5155009 |
| 1765 | 2891672373 | 2891670763 | Bacteria | 4967099 |
| 1766 | 2895516091 | 2895511927 | Bacteria | 6802080 |
| 1767 | 2900053002 | 2900051742 | Bacteria | 4985156 |
| 1768 | 2904464516 | 2904463128 | Bacteria | 4775606 |
| 1769 | 2904476060 | 2904474040 | Bacteria | 5504324 |
| 1770 | 2904515361 | 2904513164 | Bacteria | 5476410 |
| 1771 | 2904523609 | 2904518522 | Bacteria | 6068986 |
| 1772 | 2904554295 | 2904550169 | Bacteria | 6221258 |
| 1773 | 2908450760 | 2908446538 | Bacteria | 6829095 |
| 1774 | 2908672462 | 2908669403 | Bacteria | 5740494 |
| 1775 | 2912967484 | 2912963787 | Bacteria | 5646108 |
| 1776 | 2913040732 | 2913036834 | Bacteria | 6704877 |
| 1777 | 2916180199 | 2916178963 | Bacteria | 5265078 |
| 1778 | 2917072860 | 2917070673 | Bacteria | 6868303 |
| 1779 | 2919068248 | 2919063839 | Bacteria | 6302690 |
| 1780 | 2919111007 | 2919108558 | Bacteria | 5897419 |
| 1781 | 2919152229 | 2919150387 | Bacteria | 5500879 |
| 1782 | 2919157317 | 2919155634 | Bacteria | 4860545 |
| 1783 | 2919386740 | 2919385768 | Bacteria | 5897293 |
| 1784 | 2919405911 | 2919404418 | Bacteria | 4232372 |
| 1785 | 2919456715 | 2919456309 | Bacteria | 6586567 |
| 1786 | 2919482150 | 2919481497 | Bacteria | 6907839 |
| 1787 | 2919491521 | 2919487758 | Bacteria | 5929766 |
| 1788 | 2919503826 | 2919501602 | Bacteria | 5286340 |
| 1789 | 2919692392 | 2919688452 | Bacteria | 4595932 |
| 1790 | 2919701024 | 2919697872 | Bacteria | 6553725 |
| 1791 | 2923155636 | 2923153595 | Bacteria | 6870622 |
| 1792 | 2923525661 | 2923519811 | Bacteria | 6298479 |
| 1793 | 2923587715 | 2923586266 | Bacteria | 6565975 |
| 1794 | 2923635923 | 2923634449 | Bacteria | 4753480 |
| 1795 | 2926065602 | 2926063275 | Bacteria | 5285848 |
| 1796 | 2927144898 | 2927143783 | Bacteria | 5504251 |
| 1797 | 2927837579 | 2927833300 | Bacteria | 4923934 |
| 1798 | 2929148228 | 2929144301 | Bacteria | 6622272 |
| 1799 | 2929193405 | 2929189879 | Bacteria | 5930554 |
| 1800 | 2931374359 | 2931369376 | Bacteria | 6847892 |
| 1801 | 2931394715 | 2931390751 | Bacteria | 6273349 |
| 1802 | 2931400494 | 2931396565 | Bacteria | 7251677 |
| 1803 | 2932410093 | 2932406140 | Bacteria | 5134491 |
| 1804 | 2935359288 | 2935353572 | Unclassified | 6955622 |
| 1805 | 2935625736 | 2935625433 | Bacteria | 5042964 |
| 1806 | 2937542412 | 2937539931 | Bacteria | 4639830 |
| 1807 | 2937968671 | 2937967321 | Bacteria | 5094075 |
| 1808 | 2939570070 | 2939568625 | Bacteria | 4542555 |
| 1809 | 2939575390 | 2939573065 | Bacteria | 4926053 |
| 1810 | 2939581433 | 2939577877 | Bacteria | 5132791 |
| 1811 | 2939604837 | 2939602548 | Bacteria | 4950493 |
| 1812 | 2939608652 | 2939607340 | Bacteria | 4719256 |
| 1813 | 2939618515 | 2939617950 | Bacteria | 4820956 |
| 1814 | 2939639264 | 2939636861 | Bacteria | 6297853 |
| 1815 | 2939642911 | 2939642701 | Bacteria | 4475280 |
| 1816 | 2939652992 | 2939651529 | Bacteria | 5895393 |
| 1817 | 2941474613 | 2941471342 | Bacteria | 5018624 |
| 1818 | 2945876809 | 2945874760 | Bacteria | 5527237 |
| 1819 | 2945932574 | 2945928738 | Bacteria | 6053221 |
| 1820 | 2945952193 | 2945951305 | Bacteria | 4918162 |
| 1821 | 2945962481 | 2945961074 | Bacteria | 7342064 |
| 1822 | 2946008817 | 2946006987 | Bacteria | 6705746 |
| 1823 | 2946031879 | 2946027586 | Bacteria | 6049274 |
| 1824 | 2947238707 | 2947233263 | Bacteria | 6439278 |
| 1825 | 2952253277 | 2952252522 | Bacteria | 4171745 |
| 1826 | 2953997967 | 2953994433 | Bacteria | 4303959 |
| 1827 | 2969081081 | 2969079654 | Bacteria | 5439582 |
| 1828 | 2969306568 | 2969304461 | Bacteria | 6601805 |
| 1829 | 2971822455 | 2971820967 | Bacteria | 5823634 |
| 1830 | 2974291745 | 2974289157 | Bacteria | 6080362 |
| 1831 | 2974311057 | 2974310843 | Bacteria | 4947816 |
| 1832 | 2974439310 | 2974435778 | Bacteria | 4876478 |
| 1833 | 2978978667 | 2978975091 | Bacteria | 4704313 |
| 1834 | 2984290384 | 2984286254 | Bacteria | 6702062 |
| 1835 | 2984497566 | 2984494565 | Bacteria | 5000175 |
| 1836 | 2984563539 | 2984559226 | Bacteria | 5683096 |
| 1837 | 2984596273 | 2984595703 | Bacteria | 5682994 |
| 1838 | 2988729875 | 2988728565 | Bacteria | 6124362 |
| 1839 | 2990261514 | 2990261002 | Bacteria | 4919493 |
| 1840 | 2998141954 | 2998139840 | Bacteria | 6073514 |
| 1841 | 3007253506 | 3007252601 | Bacteria | 4559114 |
| 1842 | 3007317721 | 3007315729 | Bacteria | 5076637 |
| 1843 | 3007401219 | 3007395558 | Bacteria | 6755444 |
| 1844 | 3007421605 | 3007419365 | Bacteria | 7026924 |
| 1845 | 3007513375 | 3007511990 | Bacteria | 6481491 |
| 1846 | 3007618399 | 3007614139 | Bacteria | 6053559 |
| 1847 | 3007619868 | 3007619802 | Bacteria | 6411688 |
| 1848 | 3007723774 | 3007718800 | Bacteria | 5971527 |
| 1849 | 3007803567 | 3007803356 | Bacteria | 5931491 |
| 1850 | 3007860664 | 3007855910 | Bacteria | 5637581 |
| 1851 | 3007862819 | 3007861166 | Bacteria | 6045338 |
| 1852 | 3007868313 | 3007866637 | Bacteria | 5899198 |
| 1853 | 3007876340 | 3007872151 | Bacteria | 5268868 |
| 1854 | 637319412 | 637000220 | Bacteria | 7074893 |
| 1855 | 640487732 | 640427133 | Bacteria | 4567418 |
| 1856 | 640938878 | 640753048 | Bacteria | 5495657 |
| 1857 | 8004596202 | 8004592986 | Bacteria | 5122074 |
| 1858 | 8015397842 | 8015394850 | Bacteria | 5064660 |
| 1859 | 8015689893 | 8015687852 | Bacteria | 6613826 |
| 1860 | 8016735036 | 8016733728 | Bacteria | 5274317 |
| 1861 | 8018223619 | 8018221730 | Bacteria | 4616064 |
| 1862 | 8018409207 | 8018405270 | Bacteria | 4978981 |
| 1863 | 8019501481 | 8019499862 | Bacteria | 5169538 |
| 1864 | 8019505147 | 8019504834 | Bacteria | 4819156 |
| 1865 | 8019775270 | 8019769354 | Bacteria | 6924660 |
| 1866 | 8019778312 | 8019775933 | Bacteria | 6858656 |
| 1867 | 8029998744 | 8029995093 | Bacteria | 5990776 |
| 1868 | 8034965870 | 8034962539 | Bacteria | 4884839 |
| 1869 | 8052496157 | 8052494512 | Bacteria | 5765634 |
| 1870 | 8054288543 | 8054285046 | Bacteria | 6919322 |
| 1871 | 8054349179 | 8054347763 | Bacteria | 5901107 |
| 1872 | 8054359886 | 8054357960 | Bacteria | 2867777 |
| 1873 | 8054507254 | 8054503363 | Bacteria | 6101651 |
| 1874 | 8054846663 | 8054844752 | Bacteria | 4450330 |
| 1875 | 8054852004 | 8054849141 | Bacteria | 5232694 |
| 1876 | 8054932865 | 8054929484 | Bacteria | 5599761 |
| 1877 | 8055092195 | 8055087960 | Bacteria | 4784273 |
| 1878 | 8055095521 | 8055092621 | Bacteria | 4873875 |
| 1879 | 8055100231 | 8055097453 | Bacteria | 4865496 |
| 1880 | 8055696887 | 8055693939 | Bacteria | 4772047 |
| 1881 | 8055772998 | 8055770955 | Bacteria | 6827675 |
| 1882 | 8055822159 | 8055817908 | Bacteria | 6609162 |
| 1883 | 8055879640 | 8055878733 | Bacteria | 5907058 |
| 1884 | 8056117871 | 8056115690 | Bacteria | 5527654 |
| 1885 | 8056124420 | 8056120720 | Bacteria | 5758328 |
| 1886 | 8056127924 | 8056125926 | Bacteria | 6228218 |
| 1887 | 8056135644 | 8056131705 | Bacteria | 6107031 |
| 1888 | 8056139077 | 8056137416 | Bacteria | 6147080 |
| 1889 | 8056147116 | 8056143049 | Bacteria | 6307666 |
| 1890 | 8056152945 | 8056148874 | Bacteria | 6479865 |
| 1891 | 8056155976 | 8056155041 | Bacteria | 6486948 |
| 1892 | 8056161843 | 8056161164 | Bacteria | 6106669 |
| 1893 | 8056169047 | 8056166840 | Bacteria | 5820959 |
| 1894 | 8056175195 | 8056172158 | Bacteria | 6133900 |
| 1895 | 8056183519 | 8056177738 | Bacteria | 6748268 |
| 1896 | 8056573002 | 8056569372 | Bacteria | 5997322 |
| 1897 | 8057161537 | 8057160832 | Bacteria | 3268302 |
| 1898 | 8057306736 | 8057304971 | Bacteria | 4649742 |
| 1899 | 8057799429 | 8057798959 | Bacteria | 6713499 |
| 1900 | Ga0439466_0034534 | |||
| 1901 | SwRhRL2b_contig_1293351 | |||
| 1902 | SwRhRL2b_contig_3043338 | |||
| 1903 | JGI24741J21665_1000158 | |||
| 1904 | JGI24741J21665_1006265 | |||
| 1905 | JGI24741J21665_1010208 | |||
| 1906 | JGI24740J21852_10000049 | |||
| 1907 | JGI24739J22299_10000804 | |||
| 1908 | JGI24738J21930_10001700 | |||
| 1909 | JGI25162J39368_1006058 | |||
| 1910 | JGI25157J39369_1000298 | |||
| 1911 | rootH2_10071538 | |||
| 1912 | rootH1_10026054 | |||
| 1913 | Ga0006562J51391_1059289 | |||
| 1914 | Ga0006562J51391_1067747 | |||
| 1915 | Ga0055538_1000093 | |||
| 1916 | Ga0055539_1000138 | |||
| 1917 | Ga0055539_1002413 | |||
| 1918 | Ga0055533_1000142 | |||
| 1919 | Ga0055532_1000152 | |||
| 1920 | Ga0055525_1000342 | |||
| 1921 | Ga0055527_1000266 | |||
| 1922 | Ga0055535_1000606 | |||
| 1923 | Ga0055535_1000805 | |||
| 1924 | Ga0055535_1007291 | |||
| 1925 | Ga0055542_1000803 | |||
| 1926 | Ga0055529_1000709 | |||
| 1927 | Ga0055536_1001963 | |||
| 1928 | Ga0055536_1002321 | |||
| 1929 | Ga0055536_1004042 | |||
| 1930 | Ga0055530_10003078 | |||
| 1931 | Ga0055540_1002628 | |||
| 1932 | Ga0055531_10000517 | |||
| 1933 | Ga0055541_1000091 | |||
| 1934 | Ga0065165_1000113 | |||
| 1935 | Ga0065714_10065334 | |||
| 1936 | Ga0065704_10001088 | |||
| 1937 | Ga0065704_10003695 | |||
| 1938 | Ga0065704_10017716 | |||
| 1939 | Ga0065704_10072724 | |||
| 1940 | Ga0065704_10109043 | |||
| 1941 | Ga0065712_10070206 | |||
| 1942 | Ga0065707_10108505 | |||
| 1943 | Ga0070658_10000868 | |||
| 1944 | Ga0070658_10017382 | |||
| 1945 | Ga0070690_100010523 | |||
| 1946 | Ga0070690_100027356 | |||
| 1947 | Ga0070690_100122135 | |||
| 1948 | Ga0070670_100005617 | |||
| 1949 | Ga0070670_100029308 | |||
| 1950 | Ga0070670_100234669 | |||
| 1951 | Ga0070677_10036026 | |||
| 1952 | Ga0070677_10040457 | |||
| 1953 | Ga0068869_100004095 | |||
| 1954 | Ga0068869_100072327 | |||
| 1955 | Ga0070666_10000007 | |||
| 1956 | Ga0070666_10000444 | |||
| 1957 | Ga0070666_10027083 | |||
| 1958 | Ga0070680_100000343 | |||
| 1959 | Ga0070680_100037245 | |||
| 1960 | Ga0070680_100223442 | |||
| 1961 | Ga0070682_100007669 | |||
| 1962 | Ga0070682_100026930 | |||
| 1963 | Ga0070682_100060755 | |||
| 1964 | Ga0070682_100395971 | |||
| 1965 | Ga0068868_100053801 | |||
| 1966 | Ga0068868_100162531 | |||
| 1967 | Ga0068868_100223465 | |||
| 1968 | Ga0070660_100043062 | |||
| 1969 | Ga0070689_100002094 | |||
| 1970 | Ga0070689_100008406 | |||
| 1971 | Ga0070691_10001257 | |||
| 1972 | Ga0070691_10082888 | |||
| 1973 | Ga0070691_10148897 | |||
| 1974 | Ga0070687_100002366 | |||
| 1975 | Ga0070687_100047574 | |||
| 1976 | Ga0070687_100129424 | |||
| 1977 | Ga0070661_100000757 | |||
| 1978 | Ga0070661_100000961 | |||
| 1979 | Ga0070661_100027551 | |||
| 1980 | Ga0070692_10000083 | |||
| 1981 | Ga0070692_10047225 | |||
| 1982 | Ga0070668_100006043 | |||
| 1983 | Ga0070668_100042258 | |||
| 1984 | Ga0070669_100000904 | |||
| 1985 | Ga0070669_100024486 | |||
| 1986 | Ga0070669_100029850 | |||
| 1987 | Ga0070669_100144693 | |||
| 1988 | Ga0070675_100001548 | |||
| 1989 | Ga0070675_100064282 | |||
| 1990 | Ga0070675_100086732 | |||
| 1991 | Ga0070671_100075147 | |||
| 1992 | Ga0070674_100330205 | |||
| 1993 | Ga0070673_100016400 | |||
| 1994 | Ga0070688_100002539 | |||
| 1995 | Ga0070659_100003826 | |||
| 1996 | Ga0070659_100069288 | |||
| 1997 | Ga0070709_10013734 | |||
| 1998 | Ga0070714_100002422 | |||
| 1999 | Ga0070714_100020495 | |||
| 2000 | Ga0070713_100482727 | |||
| 2001 | Ga0070701_10004182 | |||
| 2002 | Ga0070701_10008464 | |||
| 2003 | Ga0070701_10016863 | |||
| 2004 | Ga0070701_10061065 | |||
| 2005 | Ga0070711_100112475 | |||
| 2006 | Ga0070711_100173829 | |||
| 2007 | Ga0070700_100050794 | |||
| 2008 | Ga0070700_100063045 | |||
| 2009 | Ga0070694_100029016 | |||
| 2010 | Ga0070694_100051756 | |||
| 2011 | Ga0070708_100264494 | |||
| 2012 | Ga0070663_100010299 | |||
| 2013 | Ga0070663_100037660 | |||
| 2014 | Ga0070663_100194549 | |||
| 2015 | Ga0070678_100067305 | |||
| 2016 | Ga0070678_100276515 | |||
| 2017 | Ga0070662_100002124 | |||
| 2018 | Ga0070662_100035570 | |||
| 2019 | Ga0070681_10002432 | |||
| 2020 | Ga0070681_10009557 | |||
| 2021 | Ga0070681_10031584 | |||
| 2022 | Ga0068867_100071160 | |||
| 2023 | Ga0068867_100087873 | |||
| 2024 | Ga0068867_100088040 | |||
| 2025 | Ga0070685_10156004 | |||
| 2026 | Ga0070706_100201738 | |||
| 2027 | Ga0070679_100000091 | |||
| 2028 | Ga0070679_100000372 | |||
| 2029 | Ga0070679_100061780 | |||
| 2030 | Ga0070679_100190196 | |||
| 2031 | Ga0070684_100002177 | |||
| 2032 | Ga0070684_100183733 | |||
| 2033 | Ga0070697_100462287 | |||
| 2034 | Ga0068853_100008118 | |||
| 2035 | Ga0070672_100028669 | |||
| 2036 | Ga0070672_100141552 | |||
| 2037 | Ga0070686_100001564 | |||
| 2038 | Ga0070686_100005969 | |||
| 2039 | Ga0070695_100068983 | |||
| 2040 | Ga0070696_100001089 | |||
| 2041 | Ga0070693_100017566 | |||
| 2042 | Ga0070665_100000374 | |||
| 2043 | Ga0070665_100000817 | |||
| 2044 | Ga0070665_100001536 | |||
| 2045 | Ga0070665_100047770 | |||
| 2046 | Ga0070665_100110420 | |||
| 2047 | Ga0070665_100158536 | |||
| 2048 | Ga0070704_100035195 | |||
| 2049 | Ga0068855_100010100 | |||
| 2050 | Ga0068855_100021239 | |||
| 2051 | Ga0068855_100158400 | |||
| 2052 | Ga0070664_100000485 | |||
| 2053 | Ga0070664_100010951 | |||
| 2054 | Ga0070664_100031375 | |||
| 2055 | Ga0070664_100260673 | |||
| 2056 | Ga0068857_100233172 | |||
| 2057 | Ga0068854_100001982 | |||
| 2058 | Ga0068854_100019287 | |||
| 2059 | Ga0068854_100052940 | |||
| 2060 | Ga0068854_100319167 | |||
| 2061 | Ga0068856_100002593 | |||
| 2062 | Ga0068856_100035944 | |||
| 2063 | Ga0068856_100530382 | |||
| 2064 | Ga0070702_100211906 | |||
| 2065 | Ga0068852_100003098 | |||
| 2066 | Ga0068852_100004962 | |||
| 2067 | Ga0068852_100067893 | |||
| 2068 | Ga0068859_100003963 | |||
| 2069 | Ga0068859_100020692 | |||
| 2070 | Ga0068859_100125190 | |||
| 2071 | Ga0068859_100156214 | |||
| 2072 | Ga0068859_100173535 | |||
| 2073 | Ga0068864_100005280 | |||
| 2074 | Ga0068864_100009820 | |||
| 2075 | Ga0068864_100028224 | |||
| 2076 | Ga0068866_10048434 | |||
| 2077 | Ga0068861_100008096 | |||
| 2078 | Ga0068861_100011725 | |||
| 2079 | Ga0068861_100078095 | |||
| 2080 | Ga0068851_10030188 | |||
| 2081 | Ga0068870_10048952 | |||
| 2082 | Ga0068870_10133658 | |||
| 2083 | Ga0068863_100009131 | |||
| 2084 | Ga0068863_100035159 | |||
| 2085 | Ga0068863_100037003 | |||
| 2086 | Ga0068863_100184196 | |||
| 2087 | Ga0068863_100251306 | |||
| 2088 | Ga0068858_100036443 | |||
| 2089 | Ga0068860_100001649 | |||
| 2090 | Ga0068860_100078858 | |||
| 2091 | Ga0068860_100083892 | |||
| 2092 | Ga0068862_100008766 | |||
| 2093 | Ga0068862_100012326 | |||
| 2094 | Ga0068862_100047522 | |||
| 2095 | Ga0081455_10020754 | |||
| 2096 | Ga0070717_10016171 | |||
| 2097 | Ga0070717_10218057 | |||
| 2098 | Ga0075364_10002873 | |||
| 2099 | Ga0075364_10023125 | |||
| 2100 | Ga0075432_10094399 | |||
| 2101 | Ga0070715_10031475 | |||
| 2102 | Ga0070716_100003847 | |||
| 2103 | Ga0070712_100245917 | |||
| 2104 | Ga0070712_100304405 | |||
| 2105 | Ga0075362_10015605 | |||
| 2106 | Ga0097621_100112989 | |||
| 2107 | Ga0068871_100013415 | |||
| 2108 | Ga0068871_100055139 | |||
| 2109 | Ga0068871_100071187 | |||
| 2110 | Ga0075428_100005937 | |||
| 2111 | Ga0075428_100021775 | |||
| 2112 | Ga0075428_100089647 | |||
| 2113 | Ga0075430_100025234 | |||
| 2114 | Ga0075430_100030214 | |||
| 2115 | Ga0075430_100085791 | |||
| 2116 | Ga0075430_100498729 | |||
| 2117 | Ga0075431_100008918 | |||
| 2118 | Ga0075431_100040488 | |||
| 2119 | Ga0075431_100127534 | |||
| 2120 | Ga0075431_100265589 | |||
| 2121 | Ga0075429_100022013 | |||
| 2122 | Ga0075429_100034608 | |||
| 2123 | Ga0075429_100053422 | |||
| 2124 | Ga0075429_100127844 | |||
| 2125 | Ga0075429_100243046 | |||
| 2126 | Ga0068865_100163229 | |||
| 2127 | Ga0068865_100291499 | |||
| 2128 | Ga0097620_100003963 | |||
| 2129 | Ga0097620_100020691 | |||
| 2130 | Ga0097620_100125189 | |||
| 2131 | Ga0097620_100156216 | |||
| 2132 | Ga0097620_100173525 | |||
| 2133 | Ga0079104_1000120 | |||
| 2134 | Ga0079104_1000135 | |||
| 2135 | Ga0079104_1000375 | |||
| 2136 | Ga0079104_1000920 | |||
| 2137 | Ga0079104_1002489 | |||
| 2138 | Ga0099826_10035691 | |||
| 2139 | Ga0099794_10007866 | |||
| 2140 | Ga0099794_10074679 | |||
| 2141 | Ga0099795_10000004 | |||
| 2142 | Ga0099795_10009077 | |||
| 2143 | Ga0105251_10000500 | |||
| 2144 | Ga0105251_10000971 | |||
| 2145 | Ga0105251_10001251 | |||
| 2146 | Ga0105251_10008997 | |||
| 2147 | Ga0105251_10018140 | |||
| 2148 | Ga0105251_10020565 | |||
| 2149 | Ga0105251_10121300 | |||
| 2150 | Ga0105244_10000224 | |||
| 2151 | Ga0105244_10000246 | |||
| 2152 | Ga0105244_10005965 | |||
| 2153 | Ga0105244_10009502 | |||
| 2154 | Ga0105244_10009873 | |||
| 2155 | Ga0105244_10028238 | |||
| 2156 | Ga0105244_10031514 | |||
| 2157 | Ga0105244_10033675 | |||
| 2158 | Ga0105250_10000024 | |||
| 2159 | Ga0105250_10001909 | |||
| 2160 | Ga0105250_10002486 | |||
| 2161 | Ga0105250_10003102 | |||
| 2162 | Ga0105250_10008560 | |||
| 2163 | Ga0105250_10040436 | |||
| 2164 | Ga0105240_10029428 | |||
| 2165 | Ga0105240_10058195 | |||
| 2166 | Ga0105240_10159492 | |||
| 2167 | Ga0105240_10170151 | |||
| 2168 | Ga0105240_10215765 | |||
| 2169 | Ga0111539_10013105 | |||
| 2170 | Ga0111539_10275565 | |||
| 2171 | Ga0105245_10036619 | |||
| 2172 | Ga0105245_10142930 | |||
| 2173 | Ga0105245_10148507 | |||
| 2174 | Ga0105245_10155204 | |||
| 2175 | Ga0105247_10007410 | |||
| 2176 | Ga0105243_10001321 | |||
| 2177 | Ga0105243_10002510 | |||
| 2178 | Ga0105243_10178641 | |||
| 2179 | Ga0105241_10460500 | |||
| 2180 | Ga0105241_10525067 | |||
| 2181 | Ga0105242_10012095 | |||
| 2182 | Ga0105242_10064552 | |||
| 2183 | Ga0105248_10033962 | |||
| 2184 | Ga0105248_10046079 | |||
| 2185 | Ga0105248_10545284 | |||
| 2186 | Ga0105237_10000335 | |||
| 2187 | Ga0105237_10006477 | |||
| 2188 | Ga0105238_10001931 | |||
| 2189 | Ga0105238_10002259 | |||
| 2190 | Ga0105238_10085859 | |||
| 2191 | Ga0105238_10241394 | |||
| 2192 | Ga0105249_10024343 | |||
| 2193 | Ga0105249_10392022 | |||
| 2194 | Ga0105030_102265 | |||
| 2195 | Ga0099796_10000006 | |||
| 2196 | Ga0099796_10014045 | |||
| 2197 | Ga0105239_10013236 | |||
| 2198 | Ga0105239_10067141 | |||
| 2199 | Ga0105246_10005977 | |||
| 2200 | Ga0105246_10069796 | |||
| 2201 | Ga0105246_10153728 | |||
| 2202 | Ga0157345_1000334 | |||
| 2203 | Ga0157373_10021414 | |||
| 2204 | Ga0157373_10070915 | |||
| 2205 | Ga0157373_10072867 | |||
| 2206 | Ga0157373_10078059 | |||
| 2207 | Ga0157371_10000406 | |||
| 2208 | Ga0157371_10004097 | |||
| 2209 | Ga0157371_10006011 | |||
| 2210 | Ga0157371_10012661 | |||
| 2211 | Ga0157371_10079558 | |||
| 2212 | Ga0157370_10001889 | |||
| 2213 | Ga0157370_10002468 | |||
| 2214 | Ga0157370_10004655 | |||
| 2215 | Ga0157370_10012990 | |||
| 2216 | Ga0157370_10031845 | |||
| 2217 | Ga0157370_10044001 | |||
| 2218 | Ga0157370_10086697 | |||
| 2219 | Ga0157369_10000107 | |||
| 2220 | Ga0157369_10001202 | |||
| 2221 | Ga0157369_10007741 | |||
| 2222 | Ga0157369_10007861 | |||
| 2223 | Ga0157369_10057845 | |||
| 2224 | Ga0157374_10000600 | |||
| 2225 | Ga0157374_10266450 | |||
| 2226 | Ga0157378_10385231 | |||
| 2227 | Ga0163162_10001668 | |||
| 2228 | Ga0163162_10021683 | |||
| 2229 | Ga0163162_10133574 | |||
| 2230 | Ga0157372_10000715 | |||
| 2231 | Ga0157372_10003727 | |||
| 2232 | Ga0157372_10004291 | |||
| 2233 | Ga0157372_10010698 | |||
| 2234 | Ga0157372_10032929 | |||
| 2235 | Ga0157372_10066732 | |||
| 2236 | Ga0157372_10088454 | |||
| 2237 | Ga0157375_10007002 | |||
| 2238 | Ga0157375_10060961 | |||
| 2239 | Ga0157375_10360902 | |||
| 2240 | Ga0157375_10607457 | |||
| 2241 | Ga0163163_10000168 | |||
| 2242 | Ga0163163_10000848 | |||
| 2243 | Ga0163163_10022217 | |||
| 2244 | Ga0163163_10118014 | |||
| 2245 | Ga0157380_10000204 | |||
| 2246 | Ga0157380_10000702 | |||
| 2247 | Ga0157380_10004085 | |||
| 2248 | Ga0157380_10011556 | |||
| 2249 | Ga0157380_10120408 | |||
| 2250 | Ga0157380_10211056 | |||
| 2251 | Ga0182008_10002836 | |||
| 2252 | Ga0182008_10006502 | |||
| 2253 | Ga0182008_10057780 | |||
| 2254 | Ga0182008_10059674 | |||
| 2255 | Ga0157379_10000153 | |||
| 2256 | Ga0157379_10321153 | |||
| 2257 | Ga0157376_10166433 | |||
| 2258 | Ga0157376_10367091 | |||
| 2259 | Ga0182006_1000027 | |||
| 2260 | Ga0182006_1006580 | |||
| 2261 | Ga0182006_1029155 | |||
| 2262 | Ga0182006_1030073 | |||
| 2263 | Ga0182007_10030939 | |||
| 2264 | Ga0163161_10085264 | |||
| 2265 | Ga0163161_10167816 | |||
| 2266 | Ga0163161_10225715 | |||
| 2267 | Ga0163161_10540087 | |||
| 2268 | Ga0206356_10269087 | |||
| 2269 | Ga0206354_10944045 | |||
| 2270 | Ga0206353_10734867 | |||
| 2271 | Ga0206353_10961766 | |||
| 2272 | Ga0154015_1412532 | |||
| 2273 | Ga0213871_10020754 | |||
| 2274 | Ga0209760_100079 | |||
| 2275 | Ga0209760_100211 | |||
| 2276 | Ga0209784_100128 | |||
| 2277 | Ga0209566_100157 | |||
| 2278 | Ga0209674_100180 | |||
| 2279 | Ga0209674_100523 | |||
| 2280 | Ga0209674_103020 | |||
| 2281 | Ga0209672_100018 | |||
| 2282 | Ga0209147_100183 | |||
| 2283 | Ga0209563_100144 | |||
| 2284 | Ga0209563_100231 | |||
| 2285 | Ga0207427_100001 | |||
| 2286 | Ga0207427_100048 | |||
| 2287 | Ga0209437_100003 | |||
| 2288 | Ga0209437_100094 | |||
| 2289 | Ga0209437_101381 | |||
| 2290 | Ga0209258_100024 | |||
| 2291 | Ga0209258_100310 | |||
| 2292 | Ga0209646_1000355 | |||
| 2293 | Ga0209026_1000056 | |||
| 2294 | Ga0209677_100127 | |||
| 2295 | Ga0209677_101128 | |||
| 2296 | Ga0209148_1000009 | |||
| 2297 | Ga0209759_1000166 | |||
| 2298 | Ga0209129_1006397 | |||
| 2299 | Ga0209233_1000007 | |||
| 2300 | Ga0209233_1000106 | |||
| 2301 | Ga0209455_1000029 | |||
| 2302 | Ga0209675_1011730 | |||
| 2303 | Ga0209676_1000055 | |||
| 2304 | Ga0209676_1000115 | |||
| 2305 | Ga0209676_1000556 | |||
| 2306 | Ga0209676_1000950 | |||
| 2307 | Ga0209676_1000959 | |||
| 2308 | Ga0209676_1004177 | |||
| 2309 | Ga0209758_1034692 | |||
| 2310 | Ga0209050_1000606 | |||
| 2311 | Ga0209050_1000941 | |||
| 2312 | Ga0209050_1000970 | |||
| 2313 | Ga0209050_1016874 | |||
| 2314 | Ga0207426_1046525 | |||
| 2315 | Ga0209051_1000054 | |||
| 2316 | Ga0209051_1000083 | |||
| 2317 | Ga0209051_1000429 | |||
| 2318 | Ga0209257_1000090 | |||
| 2319 | Ga0209257_1000175 | |||
| 2320 | Ga0209257_1018791 | |||
| 2321 | Ga0209257_1030643 | |||
| 2322 | Ga0207656_10001116 | |||
| 2323 | Ga0207656_10002494 | |||
| 2324 | Ga0207656_10070981 | |||
| 2325 | Ga0207696_1000019 | |||
| 2326 | Ga0207696_1000175 | |||
| 2327 | Ga0207696_1000275 | |||
| 2328 | Ga0207696_1000383 | |||
| 2329 | Ga0207696_1000426 | |||
| 2330 | Ga0207696_1001872 | |||
| 2331 | Ga0207696_1006240 | |||
| 2332 | Ga0207696_1007110 | |||
| 2333 | Ga0207696_1007189 | |||
| 2334 | Ga0207696_1007329 | |||
| 2335 | Ga0207696_1018686 | |||
| 2336 | Ga0207655_1000004 | |||
| 2337 | Ga0207655_1000019 | |||
| 2338 | Ga0207655_1000062 | |||
| 2339 | Ga0207655_1000115 | |||
| 2340 | Ga0207655_1000434 | |||
| 2341 | Ga0207655_1001025 | |||
| 2342 | Ga0207655_1001255 | |||
| 2343 | Ga0207655_1001801 | |||
| 2344 | Ga0207655_1001882 | |||
| 2345 | Ga0207655_1005926 | |||
| 2346 | Ga0207655_1010454 | |||
| 2347 | Ga0207655_1014037 | |||
| 2348 | Ga0207655_1033064 | |||
| 2349 | Ga0207713_1000023 | |||
| 2350 | Ga0207713_1000207 | |||
| 2351 | Ga0207713_1000299 | |||
| 2352 | Ga0207713_1000681 | |||
| 2353 | Ga0207713_1003198 | |||
| 2354 | Ga0207713_1003297 | |||
| 2355 | Ga0207713_1004796 | |||
| 2356 | Ga0207713_1006447 | |||
| 2357 | Ga0207713_1009064 | |||
| 2358 | Ga0207713_1011536 | |||
| 2359 | Ga0207713_1014323 | |||
| 2360 | Ga0207713_1015587 | |||
| 2361 | Ga0207713_1016389 | |||
| 2362 | Ga0207713_1019734 | |||
| 2363 | Ga0207713_1052120 | |||
| 2364 | Ga0207682_10017898 | |||
| 2365 | Ga0207682_10085111 | |||
| 2366 | Ga0207710_10022650 | |||
| 2367 | Ga0207688_10018196 | |||
| 2368 | Ga0207680_10000002 | |||
| 2369 | Ga0207680_10000258 | |||
| 2370 | Ga0207680_10017367 | |||
| 2371 | Ga0207647_10000548 | |||
| 2372 | Ga0207647_10041154 | |||
| 2373 | Ga0207685_10035372 | |||
| 2374 | Ga0207699_10056754 | |||
| 2375 | Ga0207643_10015501 | |||
| 2376 | Ga0207643_10078929 | |||
| 2377 | Ga0207643_10213513 | |||
| 2378 | Ga0207705_10000553 | |||
| 2379 | Ga0207705_10001408 | |||
| 2380 | Ga0207705_10001438 | |||
| 2381 | Ga0207705_10003691 | |||
| 2382 | Ga0207705_10368093 | |||
| 2383 | Ga0207705_10511402 | |||
| 2384 | Ga0207654_10009586 | |||
| 2385 | Ga0207707_10000216 | |||
| 2386 | Ga0207707_10000535 | |||
| 2387 | Ga0207707_10001364 | |||
| 2388 | Ga0207707_10004165 | |||
| 2389 | Ga0207707_10005396 | |||
| 2390 | Ga0207707_10081172 | |||
| 2391 | Ga0207707_10477963 | |||
| 2392 | Ga0207695_10001358 | |||
| 2393 | Ga0207695_10015790 | |||
| 2394 | Ga0207695_10027644 | |||
| 2395 | Ga0207695_10240283 | |||
| 2396 | Ga0207671_10000018 | |||
| 2397 | Ga0207671_10003719 | |||
| 2398 | Ga0207660_10000037 | |||
| 2399 | Ga0207660_10001255 | |||
| 2400 | Ga0207660_10002057 | |||
| 2401 | Ga0207660_10025218 | |||
| 2402 | Ga0207660_10112702 | |||
| 2403 | Ga0207660_10223971 | |||
| 2404 | Ga0207662_10028790 | |||
| 2405 | Ga0207662_10036404 | |||
| 2406 | Ga0207662_10061192 | |||
| 2407 | Ga0207657_10000474 | |||
| 2408 | Ga0207657_10001326 | |||
| 2409 | Ga0207657_10049838 | |||
| 2410 | Ga0207649_10000008 | |||
| 2411 | Ga0207649_10001228 | |||
| 2412 | Ga0207649_10002222 | |||
| 2413 | Ga0207649_10006688 | |||
| 2414 | Ga0207649_10054940 | |||
| 2415 | Ga0207649_10143141 | |||
| 2416 | Ga0207652_10000164 | |||
| 2417 | Ga0207652_10000423 | |||
| 2418 | Ga0207652_10001445 | |||
| 2419 | Ga0207652_10001950 | |||
| 2420 | Ga0207652_10015597 | |||
| 2421 | Ga0207652_10134918 | |||
| 2422 | Ga0207681_10002297 | |||
| 2423 | Ga0207681_10040609 | |||
| 2424 | Ga0207681_10320815 | |||
| 2425 | Ga0207694_10000177 | |||
| 2426 | Ga0207694_10018186 | |||
| 2427 | Ga0207650_10002243 | |||
| 2428 | Ga0207650_10004740 | |||
| 2429 | Ga0207650_10147084 | |||
| 2430 | Ga0207650_10150038 | |||
| 2431 | Ga0207650_10167915 | |||
| 2432 | Ga0207659_10012384 | |||
| 2433 | Ga0207659_10047419 | |||
| 2434 | Ga0207659_10063730 | |||
| 2435 | Ga0207659_10129546 | |||
| 2436 | Ga0207687_10070807 | |||
| 2437 | Ga0207687_10226095 | |||
| 2438 | Ga0207687_10364567 | |||
| 2439 | Ga0207700_10010680 | |||
| 2440 | Ga0207700_10036810 | |||
| 2441 | Ga0207700_10056347 | |||
| 2442 | Ga0207664_10019567 | |||
| 2443 | Ga0207664_10022355 | |||
| 2444 | Ga0207690_10000334 | |||
| 2445 | Ga0207690_10000737 | |||
| 2446 | Ga0207690_10001231 | |||
| 2447 | Ga0207690_10258173 | |||
| 2448 | Ga0207706_10001633 | |||
| 2449 | Ga0207706_10012291 | |||
| 2450 | Ga0207706_10034821 | |||
| 2451 | Ga0207706_10122271 | |||
| 2452 | Ga0207706_10188335 | |||
| 2453 | Ga0207709_10000089 | |||
| 2454 | Ga0207709_10001814 | |||
| 2455 | Ga0207709_10129678 | |||
| 2456 | Ga0207709_10217788 | |||
| 2457 | Ga0207670_10001078 | |||
| 2458 | Ga0207670_10038130 | |||
| 2459 | Ga0207670_10079000 | |||
| 2460 | Ga0207670_10120227 | |||
| 2461 | Ga0207669_10101454 | |||
| 2462 | Ga0207704_10022452 | |||
| 2463 | Ga0207665_10010387 | |||
| 2464 | Ga0207665_10068109 | |||
| 2465 | Ga0207691_10007416 | |||
| 2466 | Ga0207691_10018791 | |||
| 2467 | Ga0207691_10129851 | |||
| 2468 | Ga0207691_10196050 | |||
| 2469 | Ga0207691_10206087 | |||
| 2470 | Ga0207711_10032996 | |||
| 2471 | Ga0207711_10047807 | |||
| 2472 | Ga0207711_10049020 | |||
| 2473 | Ga0207711_10137020 | |||
| 2474 | Ga0207711_10465228 | |||
| 2475 | Ga0207689_10005133 | |||
| 2476 | Ga0207689_10031466 | |||
| 2477 | Ga0207689_10084221 | |||
| 2478 | Ga0207661_10002528 | |||
| 2479 | Ga0207661_10326374 | |||
| 2480 | Ga0207679_10000008 | |||
| 2481 | Ga0207679_10001433 | |||
| 2482 | Ga0207679_10009007 | |||
| 2483 | Ga0207679_10094618 | |||
| 2484 | Ga0207679_10449521 | |||
| 2485 | Ga0207667_10000506 | |||
| 2486 | Ga0207667_10001190 | |||
| 2487 | Ga0207667_10004804 | |||
| 2488 | Ga0207667_10202020 | |||
| 2489 | Ga0207667_10406614 | |||
| 2490 | Ga0207651_10078940 | |||
| 2491 | Ga0207651_10146574 | |||
| 2492 | Ga0207651_10150588 | |||
| 2493 | Ga0207651_10184015 | |||
| 2494 | Ga0207712_10048104 | |||
| 2495 | Ga0207712_10260493 | |||
| 2496 | Ga0207668_10005842 | |||
| 2497 | Ga0207668_10050481 | |||
| 2498 | Ga0207668_10340823 | |||
| 2499 | Ga0207640_10043380 | |||
| 2500 | Ga0207640_10057477 | |||
| 2501 | Ga0207658_10200402 | |||
| 2502 | Ga0207658_10230232 | |||
| 2503 | Ga0207658_10252643 | |||
| 2504 | Ga0207677_10033701 | |||
| 2505 | Ga0207677_10038262 | |||
| 2506 | Ga0207703_10039843 | |||
| 2507 | Ga0207703_10070020 | |||
| 2508 | Ga0207639_10000194 | |||
| 2509 | Ga0207639_10000651 | |||
| 2510 | Ga0207639_10004992 | |||
| 2511 | Ga0207678_10000638 | |||
| 2512 | Ga0207678_10001101 | |||
| 2513 | Ga0207678_10010873 | |||
| 2514 | Ga0207678_10244740 | |||
| 2515 | Ga0207678_10378960 | |||
| 2516 | Ga0207708_10007427 | |||
| 2517 | Ga0207708_10074953 | |||
| 2518 | Ga0207708_10217382 | |||
| 2519 | Ga0207702_10006981 | |||
| 2520 | Ga0207702_10010603 | |||
| 2521 | Ga0207702_10018842 | |||
| 2522 | Ga0207702_10289001 | |||
| 2523 | Ga0207641_10004613 | |||
| 2524 | Ga0207641_10039243 | |||
| 2525 | Ga0207641_10046423 | |||
| 2526 | Ga0207641_10054676 | |||
| 2527 | Ga0207641_10127392 | |||
| 2528 | Ga0207648_10002079 | |||
| 2529 | Ga0207648_10025082 | |||
| 2530 | Ga0207648_10039695 | |||
| 2531 | Ga0207648_10204902 | |||
| 2532 | Ga0207676_10043184 | |||
| 2533 | Ga0207676_10063210 | |||
| 2534 | Ga0207676_10081019 | |||
| 2535 | Ga0207674_10002179 | |||
| 2536 | Ga0207674_10074629 | |||
| 2537 | Ga0207674_10175887 | |||
| 2538 | Ga0207675_100011633 | |||
| 2539 | Ga0207675_100021623 | |||
| 2540 | Ga0207675_100023062 | |||
| 2541 | Ga0207675_100124281 | |||
| 2542 | Ga0207675_100137849 | |||
| 2543 | Ga0207675_100200639 | |||
| 2544 | Ga0207683_10006412 | |||
| 2545 | Ga0207683_10087208 | |||
| 2546 | Ga0207683_10190713 | |||
| 2547 | Ga0207683_10280131 | |||
| 2548 | Ga0207698_10000920 | |||
| 2549 | Ga0207698_10001178 | |||
| 2550 | Ga0207698_10003673 | |||
| 2551 | Ga0209281_1000004 | |||
| 2552 | Ga0209281_1000014 | |||
| 2553 | Ga0209281_1000018 | |||
| 2554 | Ga0209281_1000095 | |||
| 2555 | Ga0209281_1000391 | |||
| 2556 | Ga0209281_1000404 | |||
| 2557 | Ga0209389_1078671 | |||
| 2558 | Ga0209371_1000005 | |||
| 2559 | Ga0209371_1000559 | |||
| 2560 | Ga0209371_1001783 | |||
| 2561 | Ga0209371_1003533 | |||
| 2562 | Ga0209371_1003732 | |||
| 2563 | Ga0209371_1010795 | |||
| 2564 | Ga0209969_1012383 | |||
| 2565 | Ga0209179_1000092 | |||
| 2566 | Ga0209179_1003038 | |||
| 2567 | Ga0209999_1017394 | |||
| 2568 | Ga0209282_1073187 | |||
| 2569 | Ga0209971_1000283 | |||
| 2570 | Ga0209966_1041067 | |||
| 2571 | Ga0209974_10024050 | |||
| 2572 | Ga0207428_10015038 | |||
| 2573 | Ga0207428_10020953 | |||
| 2574 | Ga0207428_10033442 | |||
| 2575 | Ga0207428_10102538 | |||
| 2576 | Ga0268266_10000004 | |||
| 2577 | Ga0268266_10000894 | |||
| 2578 | Ga0268266_10012944 | |||
| 2579 | Ga0268266_10037850 | |||
| 2580 | Ga0268266_10196192 | |||
| 2581 | Ga0268266_10255937 | |||
| 2582 | Ga0268265_10011415 | |||
| 2583 | Ga0268265_10014190 | |||
| 2584 | Ga0268265_10027739 | |||
| 2585 | Ga0268265_10028465 | |||
| 2586 | Ga0268265_10040833 | |||
| 2587 | Ga0268265_10451103 | |||
| 2588 | Ga0268265_10481270 | |||
| 2589 | Ga0268264_10027543 | |||
| 2590 | Ga0268264_10166497 | |||
| 2591 | Ga0268264_10285437 | |||
| 2592 | Ga0265334_10001122 | |||
| 2593 | Ga0265318_10001166 | |||
| 2594 | Ga0307517_10165832 | |||
| 2595 | Ga0307515_10022420 | |||
| 2596 | Ga0265338_10007165 | |||
| 2597 | Ga0265338_10052392 | |||
| 2598 | Ga0268256_1000006 | |||
| 2599 | Ga0268256_1000683 | |||
| 2600 | Ga0268256_1000960 | |||
| 2601 | Ga0268256_1003107 | |||
| 2602 | Ga0268256_1011635 | |||
| 2603 | Ga0268256_1033619 | |||
| 2604 | Ga0316179_1113066 | |||
| 2605 | Ga0316178_1087112 | |||
| 2606 | Ga0316183_1044454 | |||
| 2607 | Ga0265763_1002977 | |||
| 2608 | Ga0265770_1000369 | |||
| 2609 | Ga0265760_10002759 | |||
| 2610 | Ga0265330_10002921 | |||
| 2611 | Ga0265332_10001420 | |||
| 2612 | Ga0265328_10042645 | |||
| 2613 | Ga0265320_10023023 | |||
| 2614 | Ga0265325_10009644 | |||
| 2615 | Ga0265329_10004113 | |||
| 2616 | Ga0265340_10005180 | |||
| 2617 | Ga0265331_10009198 | |||
| 2618 | Ga0265331_10013558 | |||
| 2619 | Ga0265327_10000014 | |||
| 2620 | Ga0265327_10001336 | |||
| 2621 | Ga0265327_10003077 | |||
| 2622 | Ga0265327_10025433 | |||
| 2623 | Ga0265316_10000792 | |||
| 2624 | Ga0265316_10002874 | |||
| 2625 | Ga0307513_10004368 | |||
| 2626 | Ga0307513_10006131 | |||
| 2627 | Ga0307513_10019623 | |||
| 2628 | Ga0307513_10085159 | |||
| 2629 | Ga0307513_10107892 | |||
| 2630 | Ga0307408_100000077 | |||
| 2631 | Ga0307408_100000411 | |||
| 2632 | Ga0307408_100011122 | |||
| 2633 | Ga0307408_100023679 | |||
| 2634 | Ga0307408_100029897 | |||
| 2635 | Ga0307408_100038986 | |||
| 2636 | Ga0307408_100113396 | |||
| 2637 | Ga0265313_10004882 | |||
| 2638 | Ga0265313_10072893 | |||
| 2639 | Ga0316575_10000552 | |||
| 2640 | Ga0316575_10008898 | |||
| 2641 | Ga0316575_10026536 | |||
| 2642 | Ga0316575_10029416 | |||
| 2643 | Ga0316575_10127780 | |||
| 2644 | Ga0316579_10000781 | |||
| 2645 | Ga0265314_10023013 | |||
| 2646 | Ga0316576_10043312 | |||
| 2647 | Ga0316576_10045016 | |||
| 2648 | Ga0316576_10063907 | |||
| 2649 | Ga0316576_10074584 | |||
| 2650 | Ga0316576_10149937 | |||
| 2651 | Ga0316578_10018465 | |||
| 2652 | Ga0316578_10029466 | |||
| 2653 | Ga0316578_10029662 | |||
| 2654 | Ga0316578_10084779 | |||
| 2655 | Ga0316578_10099491 | |||
| 2656 | Ga0307405_10003135 | |||
| 2657 | Ga0307405_10017965 | |||
| 2658 | Ga0307405_10065702 | |||
| 2659 | Ga0316577_10010475 | |||
| 2660 | Ga0316577_10011297 | |||
| 2661 | Ga0307413_10001598 | |||
| 2662 | Ga0307413_10004458 | |||
| 2663 | Ga0307413_10123809 | |||
| 2664 | Ga0307413_10355241 | |||
| 2665 | Ga0307410_10012094 | |||
| 2666 | Ga0307410_10245534 | |||
| 2667 | Ga0307410_10250298 | |||
| 2668 | Ga0307406_10019065 | |||
| 2669 | Ga0307406_10113897 | |||
| 2670 | Ga0307406_10182936 | |||
| 2671 | Ga0307407_10148287 | |||
| 2672 | Ga0307407_10167267 | |||
| 2673 | Ga0307412_10064739 | |||
| 2674 | Ga0307412_10232155 | |||
| 2675 | Ga0307409_100007399 | |||
| 2676 | Ga0307416_100001771 | |||
| 2677 | Ga0307416_100042601 | |||
| 2678 | Ga0307416_100076158 | |||
| 2679 | Ga0307416_100115811 | |||
| 2680 | Ga0307416_100467903 | |||
| 2681 | Ga0307414_10014501 | |||
| 2682 | Ga0307414_10167961 | |||
| 2683 | Ga0307414_10212399 | |||
| 2684 | Ga0307411_10001359 | |||
| 2685 | Ga0307411_10064378 | |||
| 2686 | Ga0307411_10114681 | |||
| 2687 | Ga0307415_100053847 | |||
| 2688 | Ga0316583_10000442 | |||
| 2689 | Ga0316585_10000027 | |||
| 2690 | Ga0316580_10007512 | |||
| 2691 | Ga0316580_10008044 | |||
| 2692 | Ga0316593_10000073 | |||
| 2693 | Ga0316593_10003440 | |||
| 2694 | Ga0316593_10008222 | |||
| 2695 | Ga0316593_10072220 | |||
| 2696 | Ga0307510_10001742 | |||
| 2697 | Ga0307510_10113435 | |||
| 2698 | Ga0307510_10221506 | |||
| 2699 | Ga0373923_0039004 | |||
| 2700 | Ga0373945_0056733 | |||
| 2701 | Ga0373957_0019132 | |||
| 2702 | Ga0373946_0043285 | |||
| 2703 | Ga0373955_0114736 | |||
| 2704 | Ga0373942_0093954 | |||
| 2705 | Ga0316574_0001215 | |||
| 2706 | Ga0316574_0001978 | |||
| 2707 | Ga0316574_0004031 | |||
| 2708 | Ga0316574_0008617 | |||
| 2709 | Ga0316574_0016581 | |||
| 2710 | Ga0316574_0018396 | |||
| 2711 | Ga0316574_0028979 | |||
| 2712 | Ga0316574_0040134 | |||
| 2713 | Ga0316574_0190098 | |||
| 2714 | Ga0316574_0233700 | |||
| 2715 | Ga0316574_0270606 | |||
| 2716 | Ga0373931_0164347 | |||
| 2717 | Ga0373935_0242385 | |||
| 2718 | Ga0373927_0038213 | |||
| 2719 | Ga0373933_0022376 | |||
| 2720 | Ga0373947_0208876 | |||
| 2721 | Ga0316582_0001504 | |||
| 2722 | Ga0316582_0001671 | |||
| 2723 | Ga0316582_0014157 | |||
| 2724 | Ga0316582_0048003 | |||
| 2725 | Ga0316582_0083592 | |||
| 2726 | Ga0316582_0212859 | |||
| 2727 | Ga0316584_0002113 | |||
| 2728 | Ga0316584_0021722 | |||
| 2729 | Ga0316584_0035967 | |||
| 2730 | Ga0316584_0044524 | |||
| 2731 | Ga0316584_0046215 | |||
| 2732 | Ga0316584_0061284 | |||
| 2733 | Ga0316584_0075135 | |||
| 2734 | Ga0316584_0172799 | |||
| 2735 | Ga0395899_0000404 | |||
| 2736 | Ga0395899_0125215 | |||
| 2737 | Ga0395900_0000107 | |||
| 2738 | Ga0395900_0074336 | |||
| 2739 | Ga0395898_0000211 | |||
| 2740 | Ga0395898_0048094 | |||
| 2741 | Ga0316581_0000969 | |||
| 2742 | Ga0316581_0003338 | |||
| 2743 | Ga0395901_0079858 | |||
| 2744 | Ga0395901_0515479 | |||
| 2745 | Ga0237819_00787 | |||
| 2746 | Ga0400483_011244 | |||
| 2747 | Ga0400483_096306 | |||
| 2748 | Ga0400483_195378 | |||
| 2749 | Ga0400483_228399 | |||
| 2750 | Ga0400487_56255 | |||
| 2751 | Ga0436365_1567785 | |||
| 2752 | Ga0436365_1816396 | |||
| 2753 | Ga0436360_0504587 | |||
| 2754 | Ga0436361_0355976 | |||
| 2755 | Ga0436363_0879119 | |||
| 2756 | Ga0439436_0000026 | |||
| 2757 | Ga0439436_0000447 | |||
| 2758 | Ga0439438_000002 | |||
| 2759 | Ga0439438_003174 | |||
| 2760 | Ga0439438_003372 | |||
| 2761 | Ga0439438_004121 | |||
| 2762 | Ga0439438_007190 | |||
| 2763 | Ga0439438_022997 | |||
| 2764 | Ga0439447_001619 | |||
| 2765 | Ga0439447_002046 | |||
| 2766 | Ga0439447_008358 | |||
| 2767 | Ga0439447_039422 | |||
| 2768 | Ga0439461_0002255 | |||
| 2769 | Ga0439466_0002104 | |||
| 2770 | Ga0439466_0011580 | |||
| 2771 | Ga0439466_0016193 | |||
| 2772 | Ga0451791_0939169 | |||
| 2773 | Ga0451807_1085369 | |||
| 2774 | Ga0451833_0997501 | |||
| 2775 | Ga0451853_1515730 | |||
| 2776 | Ga0439441_031425 | |||
| 2777 | Ga0439448_0027489 | |||
| 2778 | Ga0439432_002151 | |||
| 2779 | Ga0439432_003611 | |||
| 2780 | Ga0439432_008528 | |||
| 2781 | Ga0439432_023722 | |||
| 2782 | Ga0439451_005685 | |||
| 2783 | Ga0439451_006810 | |||
| 2784 | Ga0439452_000015 | |||
| 2785 | Ga0439452_000193 | |||
| 2786 | Ga0439452_003709 | |||
| 2787 | Ga0439452_015227 | |||
| 2788 | Ga0439456_005372 | |||
| 2789 | Ga0439456_006439 | |||
| 2790 | Ga0450911_000989 | |||
| 2791 | Ga0450923_000761 | |||
| 2792 | Ga0450891_001834 | |||
| 2793 | Ga0450896_000803 | |||
| 2794 | Ga0450904_000021 | |||
| 2795 | Ga0450906_001253 | |||
| 2796 | Ga0450906_009578 | |||
| 2797 | Ga0450907_002943 | |||
| 2798 | Ga0450907_003833 | |||
| 2799 | Ga0450910_001012 | |||
| 2800 | Ga0439446_0001213 | |||
| 2801 | Ga0439446_0005836 | |||
| 2802 | Ga0439446_0019054 | |||
| 2803 | Ga0450908_003922 | |||
| 2804 | Ga0450908_004614 | |||
| 2805 | Ga0450908_006538 | |||
| 2806 | Ga0450908_008467 | |||
| 2807 | Ga0439459_0002761 | |||
| 2808 | Ga0439464_0000028 | |||
| 2809 | Ga0450918_005543 | |||
| 2810 | Ga0450901_000068 | |||
| 2811 | Ga0451577_0013959 | |||
| 2812 | Ga0451577_0192142 | |||
| 2813 | Ga0451577_0208851 | |||
| 2814 | Ga0439440_0010459 | |||
| 2815 | Ga0466969_0015398 | |||
| 2816 | Ga0453683_0051155 | |||
| 2817 | Ga0466966_0014771 | |||
| 2818 | Ga0466961_0068102 | |||
| 2819 | Ga0466964_0040263 | |||
| 2820 | Ga0453684_0319401 | |||
| 2821 | Ga0453684_0450634 | |||
| 2822 | Ga0466971_0009827 | |||
| 2823 | Ga0466968_0003694 | |||
| 2824 | Ga0466970_0071846 | |||
| 2825 | Ga0466957_0046268 | |||
| 2826 | Ga0466957_0052198 | |||
| 2827 | Ga0466959_0000110 | |||
| 2828 | Ga0451576_0000034 | |||
| 2829 | Ga0451576_0062688 | |||
| 2830 | Ga0451576_0137921 | |||
| 2831 | Ga0451576_0293866 | |||
| 2832 | Ga0466958_0097864 | |||
| 2833 | Ga0495617_000583 | |||
| 2834 | Ga0495617_001724 | |||
| 2835 | Ga0495627_002133 | |||
| 2836 | Ga0495627_012638 | |||
| 2837 | Ga0495627_029960 | |||
| 2838 | Ga0495603_0007081 | |||
| 2839 | Ga0495590_0001676 | |||
| 2840 | Ga0495590_0003763 | |||
| 2841 | Ga0495591_000341 | |||
| 2842 | Ga0495591_002220 | |||
| 2843 | Ga0495591_002827 | |||
| 2844 | Ga0495591_003091 | |||
| 2845 | Ga0495591_006880 | |||
| 2846 | Ga0495591_010564 | |||
| 2847 | Ga0495591_015200 | |||
| 2848 | Ga0495638_0000873 | |||
| 2849 | Ga0495638_0001879 | |||
| 2850 | Ga0495638_0005848 | |||
| 2851 | Ga0495638_0020839 | |||
| 2852 | Ga0495638_0033336 | |||
| 2853 | Ga0495638_0061121 | |||
| 2854 | Ga0495653_0015001 | |||
| 2855 | Ga0495653_0101166 | |||
| 2856 | Ga0495650_0000047 | |||
| 2857 | Ga0495650_0000250 | |||
| 2858 | Ga0495650_0001128 | |||
| 2859 | Ga0495650_0001452 | |||
| 2860 | Ga0495650_0017006 | |||
| 2861 | Ga0495650_0048502 | |||
| 2862 | Ga0495605_0000373 | |||
| 2863 | Ga0495605_0000831 | |||
| 2864 | Ga0495605_0004590 | |||
| 2865 | Ga0495605_0010998 | |||
| 2866 | Ga0495605_0020248 | |||
| 2867 | Ga0495605_0060755 | |||
| 2868 | Ga0495639_0003160 | |||
| 2869 | Ga0495584_0002893 | |||
| 2870 | Ga0495584_0003978 | |||
| 2871 | Ga0495584_0012433 | |||
| 2872 | Ga0495584_0028139 | |||
| 2873 | Ga0495584_0141197 | |||
| 2874 | Ga0495585_0000019 | |||
| 2875 | Ga0495585_0005462 | |||
| 2876 | Ga0495585_0008389 | |||
| 2877 | Ga0495585_0010101 | |||
| 2878 | Ga0495585_0044297 | |||
| 2879 | Ga0495585_0045379 | |||
| 2880 | Ga0495585_0045774 | |||
| 2881 | Ga0495594_0000612 | |||
| 2882 | Ga0495594_0066620 | |||
| 2883 | Ga0495596_0002729 | |||
| 2884 | Ga0495596_0004687 | |||
| 2885 | Ga0495596_0019317 | |||
| 2886 | Ga0495596_0118138 | |||
| 2887 | Ga0495607_0000250 | |||
| 2888 | Ga0495607_0000538 | |||
| 2889 | Ga0495607_0000869 | |||
| 2890 | Ga0495607_0001054 | |||
| 2891 | Ga0495607_0001347 | |||
| 2892 | Ga0495607_0001549 | |||
| 2893 | Ga0495607_0005710 | |||
| 2894 | Ga0495607_0013072 | |||
| 2895 | Ga0495607_0016541 | |||
| 2896 | Ga0495607_0025549 | |||
| 2897 | Ga0495607_0026945 | |||
| 2898 | Ga0495607_0076715 | |||
| 2899 | Ga0495607_0124245 | |||
| 2900 | Ga0495583_0000521 | |||
| 2901 | Ga0495583_0001354 | |||
| 2902 | Ga0495583_0001828 | |||
| 2903 | Ga0495583_0002363 | |||
| 2904 | Ga0495583_0004447 | |||
| 2905 | Ga0495606_0000255 | |||
| 2906 | Ga0495606_0000665 | |||
| 2907 | Ga0495606_0001039 | |||
| 2908 | Ga0495606_0001255 | |||
| 2909 | Ga0495606_0001384 | |||
| 2910 | Ga0495606_0001423 | |||
| 2911 | Ga0495606_0010914 | |||
| 2912 | Ga0495606_0017563 | |||
| 2913 | Ga0495610_0005830 | |||
| 2914 | Ga0495610_0006853 | |||
| 2915 | Ga0495610_0012420 | |||
| 2916 | Ga0495610_0012850 | |||
| 2917 | Ga0495610_0021163 | |||
| 2918 | Ga0495610_0028061 | |||
| 2919 | Ga0495610_0065014 | |||
| 2920 | Ga0495610_0073017 | |||
| 2921 | Ga0495616_0000047 | |||
| 2922 | Ga0495616_0015572 | |||
| 2923 | Ga0495616_0021705 | |||
| 2924 | Ga0495616_0029933 | |||
| 2925 | Ga0495616_0059387 | |||
| 2926 | Ga0495616_0103027 | |||
| 2927 | Ga0495620_0000413 | |||
| 2928 | Ga0495620_0004548 | |||
| 2929 | Ga0495620_0005447 | |||
| 2930 | Ga0495620_0008101 | |||
| 2931 | Ga0495620_0009649 | |||
| 2932 | Ga0495620_0011860 | |||
| 2933 | Ga0495620_0012826 | |||
| 2934 | Ga0495620_0042921 | |||
| 2935 | Ga0495620_0056293 | |||
| 2936 | Ga0495630_0132113 | |||
| 2937 | Ga0495631_0001326 | |||
| 2938 | Ga0495631_0002466 | |||
| 2939 | Ga0495631_0003442 | |||
| 2940 | Ga0495631_0086210 | |||
| 2941 | Ga0495631_0149972 | |||
| 2942 | Ga0495632_0000080 | |||
| 2943 | Ga0495632_0001147 | |||
| 2944 | Ga0495632_0002357 | |||
| 2945 | Ga0495632_0002444 | |||
| 2946 | Ga0495632_0004992 | |||
| 2947 | Ga0495632_0010987 | |||
| 2948 | Ga0495632_0109542 | |||
| 2949 | Ga0495632_0146866 | |||
| 2950 | Ga0495637_0001830 | |||
| 2951 | Ga0495637_0002110 | |||
| 2952 | Ga0495637_0002741 | |||
| 2953 | Ga0495637_0004862 | |||
| 2954 | Ga0495637_0005624 | |||
| 2955 | Ga0495637_0014903 | |||
| 2956 | Ga0495637_0020114 | |||
| 2957 | Ga0495637_0036621 | |||
| 2958 | Ga0495637_0109737 | |||
| 2959 | Ga0495643_0000717 | |||
| 2960 | Ga0495643_0009384 | |||
| 2961 | Ga0495643_0011560 | |||
| 2962 | Ga0495643_0039912 | |||
| 2963 | Ga0495644_0002686 | |||
| 2964 | Ga0495648_0000424 | |||
| 2965 | Ga0495648_0004682 | |||
| 2966 | Ga0495648_0014046 | |||
| 2967 | Ga0495648_0017048 | |||
| 2968 | Ga0495648_0022776 | |||
| 2969 | Ga0495648_0028289 | |||
| 2970 | Ga0495648_0036009 | |||
| 2971 | Ga0495648_0053069 | |||
| 2972 | Ga0495648_0146670 | |||
| 2973 | Ga0495666_0017719 | |||
| 2974 | Ga0495642_0001528 | |||
| 2975 | Ga0495642_0005253 | |||
| 2976 | Ga0495654_0000875 | |||
| 2977 | Ga0495654_0002722 | |||
| 2978 | Ga0495654_0003407 | |||
| 2979 | Ga0495654_0117720 | |||
| 2980 | Ga0495654_0134545 | |||
| 2981 | Ga0495586_0005021 | |||
| 2982 | Ga0495587_0059558 | |||
| 2983 | Ga0495587_0101663 | |||
| 2984 | Ga0495609_0000011 | |||
| 2985 | Ga0495609_0000349 | |||
| 2986 | Ga0495609_0000784 | |||
| 2987 | Ga0495609_0003919 | |||
| 2988 | Ga0495609_0010058 | |||
| 2989 | Ga0495609_0014027 | |||
| 2990 | Ga0495609_0047626 | |||
| 2991 | Ga0495597_0000221 | |||
| 2992 | Ga0495597_0002355 | |||
| 2993 | Ga0495597_0002438 | |||
| 2994 | Ga0495597_0102779 | |||
| 2995 | Ga0495597_0136610 | |||
| 2996 | Ga0495597_0152939 | |||
| 2997 | Ga0495622_0000853 | |||
| 2998 | Ga0495622_0001397 | |||
| 2999 | Ga0495622_0037039 | |||
| 3000 | Ga0495622_0110250 | |||
| 3001 | Ga0495633_0000287 | |||
| 3002 | Ga0495633_0000438 | |||
| 3003 | Ga0495656_0040293 | |||
| 3004 | Ga0495668_0008912 | |||
| 3005 | Ga0495668_0022194 | |||
| 3006 | Ga0495668_0145650 | |||
| 3007 | Ga0495634_0005385 | |||
| 3008 | Ga0495611_0000001 | |||
| 3009 | Ga0495611_0000955 | |||
| 3010 | Ga0495611_0001725 | |||
| 3011 | Ga0495611_0001973 | |||
| 3012 | Ga0495611_0002094 | |||
| 3013 | Ga0495625_0000001 | |||
| 3014 | Ga0495625_0000187 | |||
| 3015 | Ga0495625_0007564 | |||
| 3016 | Ga0495625_0007957 | |||
| 3017 | Ga0495625_0008531 | |||
| 3018 | Ga0495625_0018950 | |||
| 3019 | Ga0495625_0026761 | |||
| 3020 | Ga0495625_0222071 | |||
| 3021 | Ga0495659_0001232 | |||
| 3022 | Ga0495661_0000051 | |||
| 3023 | Ga0495661_0000477 | |||
| 3024 | Ga0495661_0000596 | |||
| 3025 | Ga0495661_0001003 | |||
| 3026 | Ga0495661_0001772 | |||
| 3027 | Ga0495661_0029543 | |||
| 3028 | Ga0495661_0038148 | |||
| 3029 | Ga0495588_0107533 | |||
| 3030 | Ga0495623_0007248 | |||
| 3031 | Ga0495646_0019993 | |||
| 3032 | Ga0495658_0222963 | |||
| 3033 | Ga0495669_0034276 | |||
| 3034 | Ga0495670_0002102 | |||
| 3035 | Ga0495670_0002797 | |||
| 3036 | Ga0495670_0011627 | |||
| 3037 | Ga0495670_0019046 | |||
| 3038 | Ga0495670_0019878 | |||
| 3039 | Ga0495671_0000552 | |||
| 3040 | Ga0495671_0001180 | |||
| 3041 | Ga0495671_0007665 | |||
| 3042 | Ga0495671_0016360 | |||
| 3043 | Ga0495671_0022227 | |||
| 3044 | Ga0495671_0027804 | |||
| 3045 | Ga0495671_0158987 | |||
| 3046 | Ga0495649_0000165 | |||
| 3047 | Ga0495649_0006953 | |||
| 3048 | Ga0495649_0008252 | |||
| 3049 | Ga0495649_0008478 | |||
| 3050 | Ga0495649_0016610 | |||
| 3051 | Ga0495649_0024380 | |||
| 3052 | Ga0495649_0046070 | |||
| 3053 | Ga0495649_0055392 | |||
| 3054 | Ga0495589_0000272 | |||
| 3055 | Ga0495589_0002065 | |||
| 3056 | Ga0495589_0002775 | |||
| 3057 | Ga0495589_0004145 | |||
| 3058 | Ga0495589_0009775 | |||
| 3059 | Ga0495600_0296731 | |||
| 3060 | Ga0495660_0000746 | |||
| 3061 | Ga0495660_0000888 | |||
| 3062 | Ga0495660_0001273 | |||
| 3063 | Ga0495660_0001683 | |||
| 3064 | Ga0495660_0007204 | |||
| 3065 | Ga0495660_0013190 | |||
| 3066 | Ga0495660_0014399 | |||
| 3067 | Ga0495660_0033838 | |||
| 3068 | Ga0495660_0129028 | |||
| 3069 | Ga0495660_0172199 | |||
| 3070 | Ga0495660_0186559 | |||
| 3071 | Ga0495604_0008431 | |||
| 3072 | Ga0495636_0016827 | |||
| 3073 | Ga0495636_0163909 | |||
| 3074 | Ga0495674_0348451 | |||
| 3075 | Ga0495672_0000009 | |||
| 3076 | Ga0495672_0007676 | |||
| 3077 | Ga0495672_0008500 | |||
| 3078 | Ga0495672_0009606 | |||
| 3079 | Ga0495672_0015130 | |||
| 3080 | Ga0495672_0020631 | |||
| 3081 | Ga0495672_0035405 | |||
| 3082 | Ga0495672_0141233 | |||
| 3083 | Ga0495672_0227721 | |||
| 3084 | Ga0495676_0000508 | |||
| 3085 | Ga0495676_0002177 | |||
| 3086 | Ga0495680_0014817 | |||
| 3087 | Ga0495680_0127637 | |||
| 3088 | Ga0495683_0000053 | |||
| 3089 | Ga0495683_0000129 | |||
| 3090 | Ga0495683_0002438 | |||
| 3091 | Ga0495683_0003047 | |||
| 3092 | Ga0495683_0003636 | |||
| 3093 | Ga0495687_004396 | |||
| 3094 | Ga0495687_010164 | |||
| 3095 | Ga0495675_0012350 | |||
| 3096 | Ga0495679_000001 | |||
| 3097 | Ga0495679_000075 | |||
| 3098 | Ga0495679_000381 | |||
| 3099 | Ga0495673_0000001 | |||
| 3100 | Ga0495673_0000071 | |||
| 3101 | Ga0495673_0000099 | |||
| 3102 | Ga0495673_0001468 | |||
| 3103 | Ga0495673_0003834 | |||
| 3104 | Ga0495673_0004508 | |||
| 3105 | Ga0495673_0005014 | |||
| 3106 | Ga0495673_0005967 | |||
| 3107 | Ga0495673_0014795 | |||
| 3108 | Ga0495673_0022827 | |||
| 3109 | Ga0495673_0068555 | |||
| 3110 | Ga0495673_0116260 | |||
| 3111 | Ga0495681_0002160 | |||
| 3112 | Ga0495681_0017030 | |||
| 3113 | Ga0495681_0026095 | |||
| 3114 | Ga0495681_0026592 | |||
| 3115 | Ga0495681_0103111 | |||
| 3116 | Ga0495684_0015811 | |||
| 3117 | Ga0495686_0000255 | |||
| 3118 | Ga0495686_0003112 | |||
| 3119 | Ga0495686_0013966 | |||
| 3120 | Ga0495686_0128482 | |||
| 3121 | Ga0495686_0246428 | |||
| 3122 | Ga0495593_0029323 | |||
| 3123 | Ga0495626_0000250 | |||
| 3124 | Ga0495626_0003380 | |||
| 3125 | Ga0495626_0005631 | |||
| 3126 | Ga0495626_0031579 | |||
| 3127 | Ga0495626_0065118 | |||
| 3128 | Ga0495626_0079876 | |||
| 3129 | Ga0496100_0097587 | |||
| 3130 | Ga0496100_0269206 | |||
| 3131 | Ga0496101_0042073 | |||
| 3132 | Ga0496102_0006510 | |||
| 3133 | Ga0496102_0052861 | |||
| 3134 | Ga0496103_0007448 | |||
| 3135 | Ga0496103_0196798 | |||
| 3136 | Ga0496105_0000498 | |||
| 3137 | Ga0496105_0136287 | |||
| 3138 | Ga0496106_0000153 | |||
| 3139 | Ga0496106_0019257 | |||
| 3140 | Ga0496108_0058937 | |||
| 3141 | Ga0496109_0054813 | |||
| 3142 | Ga0496115_0438437 | |||
| 3143 | Ga0496116_0000005 | |||
| 3144 | Ga0496116_0000420 | |||
| 3145 | Ga0496116_0000426 | |||
| 3146 | Ga0496116_0017981 | |||
| 3147 | Ga0496116_0052335 | |||
| 3148 | Ga0496117_0001337 | |||
| 3149 | Ga0496117_0014648 | |||
| 3150 | Ga0496117_0038224 | |||
| 3151 | Ga0496118_0000749 | |||
| 3152 | Ga0496118_0003213 | |||
| 3153 | Ga0496118_0003350 | |||
| 3154 | Ga0496118_0004127 | |||
| 3155 | Ga0496118_0006111 | |||
| 3156 | Ga0496118_0039751 | |||
| 3157 | Ga0496118_0045640 | |||
| 3158 | Ga0496118_0204389 | |||
| 3159 | Ga0496119_0000943 | |||
| 3160 | Ga0496119_0010600 | |||
| 3161 | Ga0496119_0027685 | |||
| 3162 | Ga0496119_0036096 | |||
| 3163 | Ga0496119_0049647 | |||
| 3164 | Ga0496120_0000081 | |||
| 3165 | Ga0496120_0002521 | |||
| 3166 | Ga0496120_0002840 | |||
| 3167 | Ga0496121_0000126 | |||
| 3168 | Ga0496121_0000210 | |||
| 3169 | Ga0496121_0002035 | |||
| 3170 | Ga0496121_0003354 | |||
| 3171 | Ga0496121_0003580 | |||
| 3172 | Ga0496121_0006074 | |||
| 3173 | Ga0496121_0007739 | |||
| 3174 | Ga0496121_0021277 | |||
| 3175 | Ga0496121_0042326 | |||
| 3176 | Ga0496121_0056799 | |||
| 3177 | Ga0496121_0207584 | |||
| 3178 | Ga0496122_0000003 | |||
| 3179 | Ga0496122_0004101 | |||
| 3180 | Ga0496122_0010966 | |||
| 3181 | Ga0496122_0015351 | |||
| 3182 | Ga0496122_0019389 | |||
| 3183 | Ga0496122_0026085 | |||
| 3184 | Ga0496122_0026167 | |||
| 3185 | Ga0496122_0043240 | |||
| 3186 | Ga0496122_0148532 | |||
| 3187 | Ga0496122_0163767 | |||
| 3188 | Ga0496123_0000012 | |||
| 3189 | Ga0496123_0001037 | |||
| 3190 | Ga0496123_0002927 | |||
| 3191 | Ga0496123_0003252 | |||
| 3192 | Ga0496123_0006129 | |||
| 3193 | Ga0496123_0008715 | |||
| 3194 | Ga0496123_0047090 | |||
| 3195 | Ga0496124_0000382 | |||
| 3196 | Ga0496124_0001085 | |||
| 3197 | Ga0496124_0007002 | |||
| 3198 | Ga0496124_0011459 | |||
| 3199 | Ga0496124_0034709 | |||
| 3200 | Ga0496124_0044392 | |||
| 3201 | Ga0496124_0061908 | |||
| 3202 | Ga0496124_0111270 | |||
| 3203 | Ga0496124_0153205 | |||
| 3204 | Ga0496125_0003846 | |||
| 3205 | Ga0496125_0005039 | |||
| 3206 | Ga0496125_0111055 | |||
| 3207 | Ga0496125_0135733 | |||
| 3208 | Ga0496126_0013672 | |||
| 3209 | Ga0496126_0025112 | |||
| 3210 | Ga0496126_0210905 | |||
| 3211 | Ga0496126_0256171 | |||
| 3212 | Ga0495678_000207 | |||
| 3213 | Ga0495678_000362 | |||
| 3214 | Ga0495678_000688 | |||
| 3215 | Ga0495678_003571 | |||
| 3216 | Ga0495678_009139 | |||
| 3217 | Ga0495682_0000268 | |||
| 3218 | Ga0495682_0001604 | |||
| 3219 | Ga0495682_0002356 | |||
| 3220 | Ga0495682_0007117 | |||
| 3221 | Ga0501031_0018035 | |||
| 3222 | Ga0501031_0025351 | |||
| 3223 | Ga0501031_0031753 | |||
| 3224 | Ga0501032_0002909 | |||
| 3225 | Ga0501032_0035250 | |||
| 3226 | Ga0501032_0077868 | |||
| 3227 | Ga0501032_0198587 | |||
| 3228 | Ga0501033_0087350 | |||
| 3229 | Ga0501034_0002351 | |||
| 3230 | Ga0501034_0021040 | |||
| 3231 | Ga0501034_0081004 | |||
| 3232 | Ga0501034_0242331 | |||
| 3233 | Ga0501036_0006637 | |||
| 3234 | Ga0501036_0007248 | |||
| 3235 | Ga0501036_0023358 | |||
| 3236 | Ga0501037_0000336 | |||
| 3237 | Ga0501037_0000890 | |||
| 3238 | Ga0501037_0009363 | |||
| 3239 | Ga0501037_0026716 | |||
| 3240 | Ga0501037_0067848 | |||
| 3241 | Ga0501037_0100311 | |||
| 3242 | Ga0501038_0000613 | |||
| 3243 | Ga0501038_0000890 | |||
| 3244 | Ga0501038_0004044 | |||
| 3245 | Ga0501038_0026144 | |||
| 3246 | Ga0501038_0038270 | |||
| 3247 | Ga0501038_0097095 | |||
| 3248 | Ga0501039_0001459 | |||
| 3249 | Ga0501039_0009292 | |||
| 3250 | Ga0501039_0087227 | |||
| 3251 | Ga0501040_0008402 | |||
| 3252 | Ga0501040_0009285 | |||
| 3253 | Ga0501040_0048208 | |||
| 3254 | Ga0501040_0252368 | |||
| 3255 | Ga0501041_0022214 | |||
| 3256 | Ga0501041_0066644 | |||
| 3257 | Ga0501042_0006811 | |||
| 3258 | Ga0501042_0012620 | |||
| 3259 | Ga0501042_0022927 | |||
| 3260 | Ga0501042_0068854 | |||
| 3261 | Ga0501042_0076687 | |||
| 3262 | Ga0501042_0132794 | |||
| 3263 | Ga0501043_0001577 | |||
| 3264 | Ga0501043_0005458 | |||
| 3265 | Ga0501043_0027068 | |||
| 3266 | Ga0501046_0002547 | |||
| 3267 | Ga0501046_0015065 | |||
| 3268 | Ga0501046_0041807 | |||
| 3269 | Ga0501046_0226372 | |||
| 3270 | Ga0501047_0013033 | |||
| 3271 | Ga0501047_0079878 | |||
| 3272 | Ga0501047_0092112 | |||
| 3273 | Ga0501048_0001575 | |||
| 3274 | Ga0501048_0049744 | |||
| 3275 | Ga0501048_0435151 | |||
| 3276 | Ga0501068_0000860 | |||
| 3277 | Ga0501069_0019390 | |||
| 3278 | Ga0501069_0030778 | |||
| 3279 | Ga0501069_0033248 | |||
| 3280 | Ga0501070_0000970 | |||
| 3281 | Ga0501070_0005927 | |||
| 3282 | Ga0501070_0007212 | |||
| 3283 | Ga0501070_0026151 | |||
| 3284 | Ga0501070_0057879 | |||
| 3285 | Ga0501070_0059757 | |||
| 3286 | Ga0501070_0306057 | |||
| 3287 | Ga0501070_0512149 | |||
| 3288 | Ga0501071_0006866 | |||
| 3289 | Ga0501071_0008275 | |||
| 3290 | Ga0501071_0028510 | |||
| 3291 | Ga0501071_0046888 | |||
| 3292 | Ga0501071_0199893 | |||
| 3293 | Ga0501072_0001665 | |||
| 3294 | Ga0501072_0050306 | |||
| 3295 | Ga0501072_0081218 | |||
| 3296 | Ga0501072_0222534 | |||
| 3297 | Ga0501073_0001296 | |||
| 3298 | Ga0501073_0005417 | |||
| 3299 | Ga0501074_0003467 | |||
| 3300 | Ga0501074_0004606 | |||
| 3301 | Ga0501074_0046643 | |||
| 3302 | Ga0501074_0051278 | |||
| 3303 | Ga0501075_0005794 | |||
| 3304 | Ga0501076_0004278 | |||
| 3305 | Ga0501076_0017297 | |||
| 3306 | Ga0501076_0080183 | |||
| 3307 | Ga0501076_0087147 | |||
| 3308 | Ga0501076_0096624 | |||
| 3309 | Ga0501076_0184567 | |||
| 3310 | Ga0501076_0263768 | |||
| 3311 | Ga0501077_0004143 | |||
| 3312 | Ga0501077_0005084 | |||
| 3313 | Ga0501077_0015808 | |||
| 3314 | Ga0501077_0018766 | |||
| 3315 | Ga0501079_0005616 | |||
| 3316 | Ga0501079_0038157 | |||
| 3317 | Ga0501079_0066439 | |||
| 3318 | Ga0501079_0102905 | |||
| 3319 | Ga0501080_0009700 | |||
| 3320 | Ga0501080_0037690 | |||
| 3321 | Ga0501080_0051433 | |||
| 3322 | Ga0501081_0000359 | |||
| 3323 | Ga0501081_0006393 | |||
| 3324 | Ga0501081_0018913 | |||
| 3325 | Ga0501081_0021470 | |||
| 3326 | Ga0501083_0069785 | |||
| 3327 | Ga0501035_0002833 | |||
| 3328 | Ga0501035_0017003 | |||
| 3329 | Ga0501035_0025839 | |||
| 3330 | Ga0501035_0030682 | |||
| 3331 | Ga0501035_0047129 | |||
| 3332 | Ga0501035_0049018 | |||
| 3333 | Ga0501035_0100512 | |||
| 3334 | Ga0501044_0000233 | |||
| 3335 | Ga0501044_0007876 | |||
| 3336 | Ga0501044_0027700 | |||
| 3337 | Ga0501044_0178374 | |||
| 3338 | Ga0501044_0398670 | |||
| 3339 | Ga0501045_0015215 | |||
| 3340 | Ga0501045_0216215 | |||
| 3341 | Ga0501226_000016 | |||
| 3342 | nmdc:mga05p37_11639_c1 | |||
| 3343 | nmdc:mga05p37_50302_c1 | |||
| 3344 | nmdc:mga05p37_683579_c1 | |||
| 3345 | nmdc:mga05p37_704269_c1 | |||
| 3346 | nmdc:mga09592_121791_c1 | |||
| 3347 | nmdc:mga09592_1590_c1 | |||
| 3348 | nmdc:mga09592_28889_c1 | |||
| 3349 | nmdc:mga09592_42861_c1 | |||
| 3350 | nmdc:mga0qj67_256366_c1 | |||
| 3351 | nmdc:mga0qj67_27615_c1 | |||
| 3352 | nmdc:mga0qj67_35491_c1 | |||
| 3353 | nmdc:mga06r32_12939_c1 | |||
| 3354 | nmdc:mga06r32_21093_c1 | |||
| 3355 | nmdc:mga06r32_2483_c1 | |||
| 3356 | nmdc:mga06r32_29_c1 | |||
| 3357 | nmdc:mga06r32_52865_c1 | |||
| 3358 | nmdc:mga06r32_73794_c1 | |||
| 3359 | nmdc:mga08y16_17178_c1 | |||
| 3360 | nmdc:mga08y16_223682_c1 | |||
| 3361 | nmdc:mga08y16_228495_c1 | |||
| 3362 | nmdc:mga08y16_34011_c1 | |||
| 3363 | nmdc:mga08y16_56030_c1 | |||
| 3364 | nmdc:mga0n895_387277_c1 | |||
| 3365 | nmdc:mga08x19_27949_c1 | |||
| 3366 | Ga0500643_000002 | |||
| 3367 | Ga0500646_0009536 | |||
| 3368 | Ga0500651_0010486 | |||
| 3369 | Ga0500641_0004188 | |||
| 3370 | Ga0500555_001433 | |||
| 3371 | Ga0500573_0188865 | |||
| 3372 | Ga0500645_013165 | |||
| 3373 | Ga0501084_0007065 | |||
| 3374 | Ga0501084_0021309 | |||
| 3375 | Ga0501082_0078438 | |||
| 3376 | Ga0501082_0148097 | |||
| 3377 | Ga0501082_0323856 | |||
| 3378 | Ga0501082_0368765 | |||
| 3379 | Ga0530510_0000025 | |||
| 3380 | Ga0530510_0198611 | |||
| 3381 | Ga0530510_0216908 | |||
| 3382 | 2506584749 | |||
| 3383 | 2508853399 | |||
| 3384 | 2511257597 | |||
| 3385 | 2511263655 | |||
| 3386 | 2511270258 | |||
| 3387 | 2511276448 | |||
| 3388 | 2511291008 | |||
| 3389 | 2511294262 | |||
| 3390 | 2511302443 | |||
| 3391 | 2511314040 | |||
| 3392 | 2511320000 | |||
| 3393 | 2511324788 | |||
| 3394 | 2511330333 | |||
| 3395 | 2511338012 | |||
| 3396 | 2511342823 | |||
| 3397 | 2511348792 | |||
| 3398 | 2511354868 | |||
| 3399 | 2511365893 | |||
| 3400 | 2511369961 | |||
| 3401 | 2511373241 | |||
| 3402 | 2511380098 | |||
| 3403 | 2511413258 | |||
| 3404 | 2511434916 | |||
| 3405 | 2511823903 | |||
| 3406 | 2512326837 | |||
| 3407 | 2538425420 | |||
| 3408 | 2547697344 | |||
| 3409 | 2548647709 | |||
| 3410 | 2555259895 | |||
| 3411 | 2555669063 | |||
| 3412 | 2562463631 | |||
| 3413 | 2583791469 | |||
| 3414 | 2585827701 | |||
| 3415 | 2585834813 | |||
| 3416 | 2595445752 | |||
| 3417 | 2595449395 | |||
| 3418 | 2597857203 | |||
| 3419 | 2597864875 | |||
| 3420 | 2597870751 | |||
| 3421 | 2599328646 | |||
| 3422 | 2599358045 | |||
| 3423 | 2599361803 | |||
| 3424 | 2599368124 | |||
| 3425 | 2599374913 | |||
| 3426 | 2599383210 | |||
| 3427 | 2599389407 | |||
| 3428 | 2599393771 | |||
| 3429 | 2599398057 | |||
| 3430 | 2599405538 | |||
| 3431 | 2599452514 | |||
| 3432 | 2599464860 | |||
| 3433 | 2599468412 | |||
| 3434 | 2599484225 | |||
| 3435 | 2599493884 | |||
| 3436 | 2599503152 | |||
| 3437 | 2599507060 | |||
| 3438 | 2599516188 | |||
| 3439 | 2599518382 | |||
| 3440 | 2599614830 | |||
| 3441 | 2599769713 | |||
| 3442 | 2599801875 | |||
| 3443 | 2599878216 | |||
| 3444 | 2599889033 | |||
| 3445 | 2599895514 | |||
| 3446 | 2599901605 | |||
| 3447 | 2599933658 | |||
| 3448 | 2599942829 | |||
| 3449 | 2599947409 | |||
| 3450 | 2599953578 | |||
| 3451 | 2599959264 | |||
| 3452 | 2599964532 | |||
| 3453 | 2599972107 | |||
| 3454 | 2599975595 | |||
| 3455 | 2599982163 | |||
| 3456 | 2599988966 | |||
| 3457 | 2599994711 | |||
| 3458 | 2599999571 | |||
| 3459 | 2600007312 | |||
| 3460 | 2600009768 | |||
| 3461 | 2600020513 | |||
| 3462 | 2600025236 | |||
| 3463 | 2600029745 | |||
| 3464 | 2600037815 | |||
| 3465 | 2600042008 | |||
| 3466 | 2600046915 | |||
| 3467 | 2600055026 | |||
| 3468 | 2600057774 | |||
| 3469 | 2600064789 | |||
| 3470 | 2600071676 | |||
| 3471 | 2600076039 | |||
| 3472 | 2600217591 | |||
| 3473 | 2600359340 | |||
| 3474 | 2600365442 | |||
| 3475 | 2600445635 | |||
| 3476 | 2601524225 | |||
| 3477 | 2601529379 | |||
| 3478 | 2601540068 | |||
| 3479 | 2601616213 | |||
| 3480 | 2601620935 | |||
| 3481 | 2601628789 | |||
| 3482 | 2601644281 | |||
| 3483 | 2601649332 | |||
| 3484 | 2601654259 | |||
| 3485 | 2601659681 | |||
| 3486 | 2601664103 | |||
| 3487 | 2601689848 | |||
| 3488 | 2601697063 | |||
| 3489 | 2601702109 | |||
| 3490 | 2601707003 | |||
| 3491 | 2601712045 | |||
| 3492 | 2601717520 | |||
| 3493 | 2601722211 | |||
| 3494 | 2601727448 | |||
| 3495 | 2601732487 | |||
| 3496 | 2601736998 | |||
| 3497 | 2601741280 | |||
| 3498 | 2601752466 | |||
| 3499 | 2601758691 | |||
| 3500 | 2601764805 | |||
| 3501 | 2601777759 | |||
| 3502 | 2601795825 | |||
| 3503 | 2602010051 | |||
| 3504 | 2602019307 | |||
| 3505 | 2603636847 | |||
| 3506 | 2603645400 | |||
| 3507 | 2603662266 | |||
| 3508 | 2603667162 | |||
| 3509 | 2603699374 | |||
| 3510 | 2603705403 | |||
| 3511 | 2603839872 | |||
| 3512 | 2603844949 | |||
| 3513 | 2603850047 | |||
| 3514 | 2603855090 | |||
| 3515 | 2603867905 | |||
| 3516 | 2603872670 | |||
| 3517 | 2603877973 | |||
| 3518 | 2606049873 | |||
| 3519 | 2606071534 | |||
| 3520 | 2606075328 | |||
| 3521 | 2606128191 | |||
| 3522 | 2606147534 | |||
| 3523 | 2606177762 | |||
| 3524 | 2608381633 | |||
| 3525 | 2609909621 | |||
| 3526 | 2621298532 | |||
| 3527 | 2624479762 | |||
| 3528 | 2624491417 | |||
| 3529 | 2637224047 | |||
| 3530 | 2643842568 | |||
| 3531 | 2643871578 | |||
| 3532 | 2643884595 | |||
| 3533 | 2643952955 | |||
| 3534 | 2644022717 | |||
| 3535 | 2644188890 | |||
| 3536 | 2644284957 | |||
| 3537 | 2644351436 | |||
| 3538 | 2644549017 | |||
| 3539 | 2644553250 | |||
| 3540 | 2644621633 | |||
| 3541 | 2650895788 | |||
| 3542 | 2652548559 | |||
| 3543 | 2656276958 | |||
| 3544 | 2671093484 | |||
| 3545 | 2671098442 | |||
| 3546 | 2671101086 | |||
| 3547 | 2671107136 | |||
| 3548 | 2671128314 | |||
| 3549 | 2671584508 | |||
| 3550 | 2671768824 | |||
| 3551 | 2676405455 | |||
| 3552 | 2677899632 | |||
| 3553 | 2678264255 | |||
| 3554 | 2681996188 | |||
| 3555 | 2682006476 | |||
| 3556 | 2686354200 | |||
| 3557 | 2687578747 | |||
| 3558 | 2689446132 | |||
| 3559 | 2707098858 | |||
| 3560 | 2712468851 | |||
| 3561 | 2715752533 | |||
| 3562 | 2715758928 | |||
| 3563 | 2718633434 | |||
| 3564 | 2721027940 | |||
| 3565 | 2723249632 | |||
| 3566 | 2729148192 | |||
| 3567 | 2735836488 | |||
| 3568 | 2738674558 | |||
| 3569 | 2738752951 | |||
| 3570 | 2738809710 | |||
| 3571 | 2738861992 | |||
| 3572 | 2738897070 | |||
| 3573 | 2739199792 | |||
| 3574 | 2739227413 | |||
| 3575 | 2739259433 | |||
| 3576 | 2739264367 | |||
| 3577 | 2739284986 | |||
| 3578 | 2739290300 | |||
| 3579 | 2739315789 | |||
| 3580 | 2743736619 | |||
| 3581 | 2745004710 | |||
| 3582 | 2753856950 | |||
| 3583 | 2765585220 | |||
| 3584 | 2765590055 | |||
| 3585 | 2772440047 | |||
| 3586 | 2774120998 | |||
| 3587 | 2774137343 | |||
| 3588 | 2775541273 | |||
| 3589 | 2777020980 | |||
| 3590 | 2784263653 | |||
| 3591 | 2784314070 | |||
| 3592 | 2791922321 | |||
| 3593 | 2792311987 | |||
| 3594 | 2793404707 | |||
| 3595 | 2794596658 | |||
| 3596 | 2807179676 | |||
| 3597 | 2807407436 | |||
| 3598 | 2807455764 | |||
| 3599 | 2807455775 | |||
| 3600 | 2808857651 | |||
| 3601 | 2808904411 | |||
| 3602 | 2808924733 | |||
| 3603 | 2808927746 | |||
| 3604 | 2808937821 | |||
| 3605 | 2808939157 | |||
| 3606 | 2808946835 | |||
| 3607 | 2808949714 | |||
| 3608 | 2808960249 | |||
| 3609 | 2808966135 | |||
| 3610 | 2808977164 | |||
| 3611 | 2808992319 | |||
| 3612 | 2809000975 | |||
| 3613 | 2809125231 | |||
| 3614 | 2809216713 | |||
| 3615 | 2812365694 | |||
| 3616 | 2813727857 | |||
| 3617 | 2814695400 | |||
| 3618 | 2817492320 | |||
| 3619 | 2819563880 | |||
| 3620 | 2819656463 | |||
| 3621 | 2819703522 | |||
| 3622 | 2821121074 | |||
| 3623 | 2823375708 | |||
| 3624 | 2823424115 | |||
| 3625 | 2825656805 | |||
| 3626 | 2826583643 | |||
| 3627 | 2834033736 | |||
| 3628 | 2842809437 | |||
| 3629 | 2842818139 | |||
| 3630 | 2842831129 | |||
| 3631 | 2842832365 | |||
| 3632 | 2842842388 | |||
| 3633 | 2842848654 | |||
| 3634 | 2842849226 | |||
| 3635 | 2842854798 | |||
| 3636 | 2842915603 | |||
| 3637 | 2842919568 | |||
| 3638 | 2844428399 | |||
| 3639 | 2844529159 | |||
| 3640 | 2844669501 | |||
| 3641 | 2846540673 | |||
| 3642 | 2847086590 | |||
| 3643 | 2847798937 | |||
| 3644 | 2852107054 | |||
| 3645 | 2852613482 | |||
| 3646 | 2852658271 | |||
| 3647 | 2852668782 | |||
| 3648 | 2854606083 | |||
| 3649 | 2855197391 | |||
| 3650 | 2858468363 | |||
| 3651 | 2860339622 | |||
| 3652 | 2860871385 | |||
| 3653 | 2865016591 | |||
| 3654 | 2869555482 | |||
| 3655 | 2871275976 | |||
| 3656 | 2871285832 | |||
| 3657 | 2876603243 | |||
| 3658 | 2878031774 | |||
| 3659 | 2880234275 | |||
| 3660 | 2881612562 | |||
| 3661 | 2884087839 | |||
| 3662 | 2887632269 | |||
| 3663 | 2888370139 | |||
| 3664 | 2891672373 | |||
| 3665 | 2895516091 | |||
| 3666 | 2900053002 | |||
| 3667 | 2904464516 | |||
| 3668 | 2904476060 | |||
| 3669 | 2904515361 | |||
| 3670 | 2904523609 | |||
| 3671 | 2904554295 | |||
| 3672 | 2908450760 | |||
| 3673 | 2908672462 | |||
| 3674 | 2912967484 | |||
| 3675 | 2913040732 | |||
| 3676 | 2916180199 | |||
| 3677 | 2917072860 | |||
| 3678 | 2919068248 | |||
| 3679 | 2919111007 | |||
| 3680 | 2919152229 | |||
| 3681 | 2919157317 | |||
| 3682 | 2919386740 | |||
| 3683 | 2919405911 | |||
| 3684 | 2919456715 | |||
| 3685 | 2919482150 | |||
| 3686 | 2919491521 | |||
| 3687 | 2919503826 | |||
| 3688 | 2919692392 | |||
| 3689 | 2919701024 | |||
| 3690 | 2923155636 | |||
| 3691 | 2923525661 | |||
| 3692 | 2923587715 | |||
| 3693 | 2923635923 | |||
| 3694 | 2926065602 | |||
| 3695 | 2927144898 | |||
| 3696 | 2927837579 | |||
| 3697 | 2929148228 | |||
| 3698 | 2929193405 | |||
| 3699 | 2931374359 | |||
| 3700 | 2931394715 | |||
| 3701 | 2931400494 | |||
| 3702 | 2932410093 | |||
| 3703 | 2935359288 | |||
| 3704 | 2935625736 | |||
| 3705 | 2937542412 | |||
| 3706 | 2937968671 | |||
| 3707 | 2939570070 | |||
| 3708 | 2939575390 | |||
| 3709 | 2939581433 | |||
| 3710 | 2939604837 | |||
| 3711 | 2939608652 | |||
| 3712 | 2939618515 | |||
| 3713 | 2939639264 | |||
| 3714 | 2939642911 | |||
| 3715 | 2939652992 | |||
| 3716 | 2941474613 | |||
| 3717 | 2945876809 | |||
| 3718 | 2945932574 | |||
| 3719 | 2945952193 | |||
| 3720 | 2945962481 | |||
| 3721 | 2946008817 | |||
| 3722 | 2946031879 | |||
| 3723 | 2947238707 | |||
| 3724 | 2952253277 | |||
| 3725 | 2953997967 | |||
| 3726 | 2969081081 | |||
| 3727 | 2969306568 | |||
| 3728 | 2971822455 | |||
| 3729 | 2974291745 | |||
| 3730 | 2974311057 | |||
| 3731 | 2974439310 | |||
| 3732 | 2978978667 | |||
| 3733 | 2984290384 | |||
| 3734 | 2984497566 | |||
| 3735 | 2984563539 | |||
| 3736 | 2984596273 | |||
| 3737 | 2988729875 | |||
| 3738 | 2990261514 | |||
| 3739 | 2998141954 | |||
| 3740 | 3007253506 | |||
| 3741 | 3007317721 | |||
| 3742 | 3007401219 | |||
| 3743 | 3007421605 | |||
| 3744 | 3007513375 | |||
| 3745 | 3007618399 | |||
| 3746 | 3007619868 | |||
| 3747 | 3007723774 | |||
| 3748 | 3007803567 | |||
| 3749 | 3007860664 | |||
| 3750 | 3007862819 | |||
| 3751 | 3007868313 | |||
| 3752 | 3007876340 | |||
| 3753 | 637319412 | |||
| 3754 | 640487732 | |||
| 3755 | 640938878 | |||
| 3756 | 8004596202 | |||
| 3757 | 8015397842 | |||
| 3758 | 8015689893 | |||
| 3759 | 8016735036 | |||
| 3760 | 8018223619 | |||
| 3761 | 8018409207 | |||
| 3762 | 8019501481 | |||
| 3763 | 8019505147 | |||
| 3764 | 8019775270 | |||
| 3765 | 8019778312 | |||
| 3766 | 8029998744 | |||
| 3767 | 8034965870 | |||
| 3768 | 8052496157 | |||
| 3769 | 8054288543 | |||
| 3770 | 8054349179 | |||
| 3771 | 8054359886 | |||
| 3772 | 8054507254 | |||
| 3773 | 8054846663 | |||
| 3774 | 8054852004 | |||
| 3775 | 8054932865 | |||
| 3776 | 8055092195 | |||
| 3777 | 8055095521 | |||
| 3778 | 8055100231 | |||
| 3779 | 8055696887 | |||
| 3780 | 8055772998 | |||
| 3781 | 8055822159 | |||
| 3782 | 8055879640 | |||
| 3783 | 8056117871 | |||
| 3784 | 8056124420 | |||
| 3785 | 8056127924 | |||
| 3786 | 8056135644 | |||
| 3787 | 8056139077 | |||
| 3788 | 8056147116 | |||
| 3789 | 8056152945 | |||
| 3790 | 8056155976 | |||
| 3791 | 8056161843 | |||
| 3792 | 8056169047 | |||
| 3793 | 8056175195 | |||
| 3794 | 8056183519 | |||
| 3795 | 8056573002 | |||
| 3796 | 8057161537 | |||
| 3797 | 8057306736 | |||
| 3798 | 8057799429 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f9y-assembly1.cif.gz_B-2 | the crystal structure of the carboxyltransferase subunit of acc from escherichia coli | 0.9677 | 28 | 287 |
| 2f9i-assembly1.cif.gz_D | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9661 | 28 | 280 |
| 2f9y-assembly1.cif.gz_B-2 | the crystal structure of the carboxyltransferase subunit of acc from escherichia coli | 0.9531 | 28 | 287 |
| 2f9i-assembly1.cif.gz_D | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.944 | 28 | 280 |
| 5kdr-assembly1.cif.gz_B-2 | the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. | 0.943 | 28 | 285 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f9yB00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9677 | 28 | 287 | 3.90.226.10 |
| 2f9yB00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9531 | 28 | 287 | 3.90.226.10 |
| af_P49158_165_424_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9519 | 27 | 285 | 3.90.226.10 |
| af_P49158_165_424_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9448 | 27 | 285 | 3.90.226.10 |
| 5kdrB00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.943 | 28 | 285 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A377CC89-F1-model_v4 | AcetylCoA carboxylase (EC 6.4.1.2) | 0.9796 | 57 | 155 |
GO:0003989
GO:0006633 GO:0009329 GO:2001295 |
| AF-A0A258C0Q4-F1-model_v4 | Acetyl-CoA carboxylase carboxyl transferase subunit beta | 0.9726 | 65 | 291 |
GO:0003989
GO:0006633 GO:0009329 GO:0016740 GO:2001295 |
| AF-A0A090QYR6-F1-model_v4 | Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2) | 0.9724 | 57 | 164 |
GO:0003989
GO:0006633 GO:0009329 GO:0016740 GO:2001295 |
| AF-A0A350D4F3-F1-model_v4 | Acetyl-CoA carboxylase carboxyl transferase subunit beta | 0.9694 | 27 | 285 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016740 GO:0046872 GO:2001295 |
| AF-A0A840UZB0-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) | 0.9689 | 38 | 281 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |