F495977

General Info

Members Datasets Scaffolds Average Seq Length
1887 853 1650 211

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0110727|Ga0496126_0110727_35_808
Length 257
Sequence MQGGGVRAYREYVRRRQRSSAKKDTLAKLRFNLVKTLGYLFNKIWEWNSMQVKVINHPLIQHKLTLIRDKNTGPKEFRELLEEVAMLMGYELTRDLPLEEIEIETPVTKCTCKTLSGKKIGIVPILRAGLGMVSGFLRLIPAAKVGHVGVYRDPQTLKPVEYYCKLPTDVAERDFVVIDPMLATGGSSVAAISLLKQKGAKNIKLMCLVAAPEGIHLVNEQHPDVEVYTASVDERLNDHGYIVPGLGDAGDRIFGTK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
17 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
21 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
22 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
23 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
24 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
28 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
29 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
30 2643221583 Caulobacter sp. Root655 Isolate Unclassified
31 2643221584 Caulobacter sp. Root656 Isolate Unclassified
32 2643221640 Caulobacter sp. Root342 Isolate Unclassified
33 2643221642 Caulobacter sp. Root343 Isolate Unclassified
34 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
35 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
36 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
37 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
38 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
39 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
40 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
41 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
42 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
43 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
44 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
45 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
46 2818991435 Caulobacter henricii 536 Isolate Unclassified
47 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
48 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
49 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
50 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
51 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
52 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
53 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
54 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
55 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
56 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
57 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
58 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
59 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
60 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
61 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
62 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
63 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
64 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
65 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
66 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
67 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
68 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
69 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
70 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
71 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
72 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
73 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
74 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
75 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
76 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
77 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
78 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
79 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
80 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
81 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
82 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
83 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
84 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
85 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
86 2849560528 Caulobacter zeae 410 Isolate Unclassified
87 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
88 2851153111 Caulobacter radicis 736 Isolate Unclassified
89 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
90 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
91 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
92 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
93 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
94 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
95 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
96 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
97 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
98 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
99 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
100 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
101 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
102 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
103 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
104 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
105 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
106 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
107 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
108 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
109 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
110 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
111 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
112 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
113 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
114 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
115 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
116 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
117 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
118 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
119 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
120 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
121 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
122 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
123 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
124 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
125 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
126 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
127 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
128 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
129 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
130 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
131 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
132 2922368715
133 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
134 2922425934
135 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
136 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
137 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
138 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
139 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
140 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
141 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
142 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
143 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
144 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
145 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
146 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
147 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
148 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
149 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
150 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
151 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
152 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
153 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
154 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
155 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
156 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
157 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
158 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
159 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
160 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
161 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
162 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
163 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
164 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
165 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
166 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
167 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
168 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
169 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
170 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
171 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
172 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
173 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
174 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
175 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
176 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
177 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
178 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
179 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
180 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
181 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
182 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
183 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
184 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
185 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
186 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
187 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
188 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
189 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
190 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
191 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
192 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
193 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
194 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
195 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
196 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
197 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
198 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
199 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
200 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
201 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
202 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
203 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
204 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
205 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
206 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
207 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
208 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
209 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
210 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
211 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
212 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
213 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
214 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
215 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
216 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
217 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
218 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
219 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
220 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
221 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
222 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
223 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
224 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
225 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
226 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
227 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
228 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
229 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
230 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
231 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
232 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
233 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
234 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
235 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
236 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
237 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
238 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
239 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
240 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
241 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
242 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
243 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
244 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
245 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
246 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
247 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
248 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
249 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
250 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
251 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
252 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
253 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
254 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
255 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
256 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
257 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
258 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
259 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
260 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
261 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
262 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
263 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
264 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
265 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
266 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
267 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
268 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
269 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
270 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
271 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
272 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
273 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
274 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
275 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
276 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
277 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
278 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
279 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
280 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
281 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
282 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
283 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
284 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
285 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
286 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
287 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
288 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
289 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
290 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
291 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
292 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
293 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
294 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
295 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
296 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
297 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
298 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
299 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
300 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
301 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
302 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
303 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
304 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
305 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
306 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
307 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
308 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
309 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
310 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
311 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
312 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
313 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
314 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
315 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
316 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
317 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
318 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
319 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
320 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
321 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
322 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
323 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
324 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
325 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
326 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
327 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
328 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
329 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
330 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
331 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
332 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
333 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
334 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
335 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
336 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
337 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
338 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
339 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
340 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
341 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
342 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
343 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
344 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
345 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
346 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
347 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
348 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
349 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
350 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
351 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
352 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
353 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
354 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
355 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
356 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
357 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
358 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
359 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
360 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
361 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
362 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
363 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
364 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
365 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
366 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
367 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
368 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
369 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
371 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
373 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
374 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
375 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
376 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
377 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
378 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
379 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
380 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
381 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
382 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
383 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
384 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
386 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
387 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
388 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
389 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
447 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
453 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
454 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
455 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
458 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
459 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
460 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
461 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
462 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
463 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
464 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
465 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
467 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
469 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
470 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
471 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
472 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
473 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
474 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
475 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
476 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
477 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
478 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
479 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
480 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
481 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
482 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
483 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
484 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
485 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
486 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
487 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
488 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
489 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
490 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
491 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
492 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
493 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
494 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
495 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
496 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
497 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
498 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
499 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
500 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
501 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
502 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
503 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
504 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
505 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
506 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
508 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
509 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
511 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
512 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
513 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
514 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
515 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
516 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
517 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
518 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
519 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
520 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
521 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
522 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
523 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
524 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
525 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
526 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
527 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
528 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
529 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
530 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
531 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
532 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
533 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
534 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
535 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
536 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
537 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
538 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
539 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
540 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
541 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
542 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
543 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
544 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
545 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
546 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
547 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
548 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
549 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
550 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
551 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
552 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
553 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
554 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
555 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
556 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
557 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
558 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
559 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
560 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
561 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
562 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
563 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
564 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
565 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
566 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
567 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
568 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
569 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
570 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
571 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
572 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
573 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
574 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
575 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
576 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
577 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
578 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
579 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
580 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
581 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
582 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
583 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
584 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
585 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
586 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
587 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
588 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
589 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
590 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
591 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
592 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
593 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
594 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
595 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
596 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
597 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
598 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
599 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
600 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
601 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
602 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
603 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
604 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
605 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
606 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
607 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
608 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
609 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
610 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
611 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
612 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
613 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
614 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
615 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
616 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
617 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
618 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
619 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
620 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
621 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
622 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
623 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
624 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
625 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
626 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
627 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
628 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
629 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
630 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
631 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
632 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
633 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
634 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
635 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
636 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
637 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
638 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
639 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
640 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
641 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
642 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
643 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
644 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
645 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
646 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
647 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
648 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
649 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
650 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
651 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
652 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
653 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
654 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
655 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
656 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
657 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
658 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
659 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
660 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
661 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
662 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
663 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
664 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
665 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
666 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
667 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
668 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
669 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
670 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
671 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
672 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
673 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
674 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
675 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
676 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
677 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
678 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
679 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
680 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
681 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
682 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
683 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
684 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
685 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
686 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
687 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
688 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
689 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
690 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
691 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
692 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
693 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
694 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
695 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
696 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
697 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
698 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
699 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
700 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
701 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
702 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
703 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
704 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
705 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
706 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
707 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
708 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
709 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
710 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
711 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
712 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
713 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
714 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
715 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
716 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
717 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
718 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
719 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
720 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
721 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
722 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
723 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
724 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
725 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
726 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
727 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
728 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
729 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
730 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
731 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
732 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
733 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
734 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
735 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
736 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
737 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
738 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
739 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
740 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
741 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
742 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
743 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
744 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
745 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
746 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
747 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
748 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
749 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
750 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
751 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
752 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
753 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
754 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
755 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
756 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
757 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
758 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
759 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
760 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
761 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
762 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
763 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
764 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
765 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
766 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
767 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
768 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
769 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
770 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
771 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
772 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
773 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
774 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
775 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
776 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
777 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
778 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
779 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
780 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
781 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
782 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
783 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
784 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
785 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
786 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
787 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
788 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
789 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
790 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
791 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
792 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
793 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
794 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
795 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
796 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
797 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
798 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
799 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
800 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
801 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
802 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
803 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
804 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
805 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
806 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
807 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
808 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
809 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
810 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
811 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
812 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
813 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
814 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
815 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
816 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
817 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
818 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
819 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
820 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
821 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
822 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
823 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
824 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
825 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
826 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
827 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
828 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
829 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
830 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
831 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
832 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
833 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
834 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
835 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
836 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
837 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
838 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
839 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
840 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
841 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
842 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
843 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
844 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
845 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
846 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
847 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
848 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
849 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
850 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
851 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
852 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
853 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.62
Metatranscriptomes 1.91
Isolates 12.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.68
Nodule 8.21
Rhizoplane 4.4
Rhizosphere 61.69
Stem 0
Stem Tuber 0
Unclassified 11.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1009424 3300002987 Bacteria 2579
2 JGI25151J46595_10001287 3300003187 Bacteria 17661
3 JGI25151J46595_10037149 3300003187 Bacteria 1829
4 JGI25151J46595_10074055 3300003187 Bacteria 1016
5 JGI25151J46595_10074524 3300003187 Bacteria 1011
6 JGI25406J46586_10076708 3300003203 Bacteria 1034
7 JGI25153J46596_10002853 3300003215 Bacteria 9813
8 JGI25153J46596_10017253 3300003215 Bacteria 2850
9 JGI25153J46596_10037963 3300003215 Bacteria 1525
10 rootH1_10001329 3300003316 Bacteria 28300
11 rootH2_10173050 3300003320 Bacteria 2330
12 rootH2_10273013 3300003320 Bacteria 1182
13 rootL2_10029468 3300003322 Bacteria 15048
14 rootL2_10179753 3300003322 Bacteria 1509
15 rootH1_10048253 3300003323 Bacteria 5438
16 JGI25160J50197_1000505 3300003354 Bacteria 23190
17 JGI25160J50197_1009635 3300003354 Bacteria 3563
18 Ga0006562J51391_1001388 3300003578 Bacteria 7230
19 Ga0055538_1000128 3300003751 Bacteria 55980
20 Ga0055532_1001176 3300003758 Bacteria 7896
21 Ga0055535_1007751 3300003761 Bacteria 2011
22 Ga0055542_1008160 3300003762 Bacteria 2066
23 Ga0055526_1029905 3300003771 Bacteria 1602
24 Ga0055537_1009257 3300003773 Bacteria 2191
25 Ga0055536_1002036 3300003781 Bacteria 11580
26 Ga0055536_1002279 3300003781 Bacteria 10895
27 Ga0055528_1003018 3300003790 Bacteria 8692
28 Ga0055528_1027876 3300003790 Bacteria 1574
29 Ga0055530_10004426 3300003791 Bacteria 7228
30 Ga0055530_10005947 3300003791 Bacteria 5616
31 Ga0055531_10002251 3300003794 Bacteria 13060
32 Ga0055531_10003247 3300003794 Bacteria 10438
33 Ga0055531_10016299 3300003794 Bacteria 3213
34 Ga0065165_1000254 3300005262 Bacteria 92762
35 Ga0065165_1000376 3300005262 Bacteria 72908
36 Ga0065165_1000749 3300005262 Bacteria 44604
37 Ga0065165_1004727 3300005262 Bacteria 8175
38 Ga0070658_10000029 3300005327 Bacteria 156910
39 Ga0070658_10084816 3300005327 Bacteria 2605
40 Ga0070658_10105279 3300005327 Bacteria 2334
41 Ga0070658_10125909 3300005327 Bacteria 2132
42 Ga0070676_10035897 3300005328 Bacteria 2853
43 Ga0070683_100054819 3300005329 Bacteria 3697
44 Ga0070683_100252526 3300005329 Bacteria 1677
45 Ga0070670_100041824 3300005331 Bacteria 3938
46 Ga0070670_100052926 3300005331 Bacteria 3487
47 Ga0068869_100066713 3300005334 Bacteria 2652
48 Ga0068869_100281367 3300005334 Bacteria 1338
49 Ga0068869_100878402 3300005334 Bacteria 775
50 Ga0070666_10007107 3300005335 Bacteria 6904
51 Ga0070680_100004826 3300005336 Bacteria 10146
52 Ga0070680_100039689 3300005336 Bacteria 3808
53 Ga0070660_100007310 3300005339 Bacteria 7696
54 Ga0070660_100043834 3300005339 Bacteria 3420
55 Ga0070660_100237818 3300005339 Bacteria 1483
56 Ga0070660_100351183 3300005339 Bacteria 1214
57 Ga0070689_100124083 3300005340 Bacteria 2065
58 Ga0070689_100157578 3300005340 Bacteria 1834
59 Ga0070689_100425995 3300005340 Bacteria 1125
60 Ga0070691_10005525 3300005341 Bacteria 5754
61 Ga0070661_100013672 3300005344 Bacteria 5700
62 Ga0070661_100020985 3300005344 Bacteria 4663
63 Ga0070661_100084578 3300005344 Bacteria 2344
64 Ga0070668_100010989 3300005347 Bacteria 6739
65 Ga0070668_100110111 3300005347 Bacteria 2191
66 Ga0070668_100457117 3300005347 Bacteria 1099
67 Ga0070669_100010848 3300005353 Bacteria 6467
68 Ga0070669_100053105 3300005353 Bacteria 2966
69 Ga0070669_100074367 3300005353 Bacteria 2519
70 Ga0070669_100323671 3300005353 Bacteria 1245
71 Ga0070669_100367560 3300005353 Bacteria 1171
72 Ga0070675_100301946 3300005354 Bacteria 1411
73 Ga0070675_100400389 3300005354 Bacteria 1224
74 Ga0070671_100022475 3300005355 Bacteria 5150
75 Ga0070671_100034049 3300005355 Bacteria 4216
76 Ga0070674_100140673 3300005356 Bacteria 1811
77 Ga0070674_100262803 3300005356 Bacteria 1361
78 Ga0070673_100189089 3300005364 Bacteria 1767
79 Ga0070673_100369338 3300005364 Bacteria 1277
80 Ga0070673_100470046 3300005364 Bacteria 1134
81 Ga0070673_100818547 3300005364 Bacteria 861
82 Ga0070688_100027531 3300005365 Bacteria 3386
83 Ga0070688_100061005 3300005365 Bacteria 2383
84 Ga0070659_100000968 3300005366 Bacteria 21135
85 Ga0070659_100156073 3300005366 Bacteria 1864
86 Ga0070659_100564360 3300005366 Bacteria 975
87 Ga0070667_100116779 3300005367 Bacteria 2317
88 Ga0070667_100146586 3300005367 Bacteria 2071
89 Ga0070667_100232058 3300005367 Bacteria 1646
90 Ga0070667_100285152 3300005367 Bacteria 1484
91 Ga0070667_100291136 3300005367 Bacteria 1468
92 Ga0070667_100661277 3300005367 Bacteria 965
93 Ga0070709_10000102 3300005434 Bacteria 60511
94 Ga0070709_10002668 3300005434 Bacteria 9636
95 Ga0070709_10146800 3300005434 Bacteria 1626
96 Ga0070709_10172951 3300005434 Bacteria 1511
97 Ga0070709_10273246 3300005434 Bacteria 1225
98 Ga0070714_100002572 3300005435 Bacteria 13368
99 Ga0070714_100012241 3300005435 Bacteria 6843
100 Ga0070714_100043830 3300005435 Bacteria 3786
101 Ga0070714_100113074 3300005435 Bacteria 2407
102 Ga0070714_100199734 3300005435 Bacteria 1829
103 Ga0070714_100278628 3300005435 Bacteria 1553
104 Ga0070713_100055744 3300005436 Bacteria 3286
105 Ga0070713_100139806 3300005436 Bacteria 2143
106 Ga0070713_100158262 3300005436 Bacteria 2020
107 Ga0070713_100259853 3300005436 Bacteria 1586
108 Ga0070713_100609120 3300005436 Unclassified 1038
109 Ga0070710_10000246 3300005437 Bacteria 25491
110 Ga0070710_10043267 3300005437 Bacteria 2493
111 Ga0070710_10130490 3300005437 Bacteria 1532
112 Ga0070710_10415642 3300005437 Bacteria 905
113 Ga0070710_10780798 3300005437 Bacteria 681
114 Ga0070701_10117330 3300005438 Bacteria 1495
115 Ga0070711_100001950 3300005439 Bacteria 11571
116 Ga0070711_100009139 3300005439 Bacteria 6091
117 Ga0070711_100021023 3300005439 Bacteria 4215
118 Ga0070711_100057145 3300005439 Bacteria 2701
119 Ga0070711_100149799 3300005439 Bacteria 1758
120 Ga0070705_100005393 3300005440 Bacteria 6230
121 Ga0070700_100004393 3300005441 Bacteria 7360
122 Ga0070700_100174861 3300005441 Bacteria 1489
123 Ga0070700_100256182 3300005441 Bacteria 1258
124 Ga0070694_100184113 3300005444 Bacteria 1546
125 Ga0070708_100438825 3300005445 Bacteria 1231
126 Ga0070678_100023432 3300005456 Bacteria 4113
127 Ga0070678_100060424 3300005456 Bacteria 2790
128 Ga0070678_100273035 3300005456 Bacteria 1427
129 Ga0070678_100535734 3300005456 Bacteria 1038
130 Ga0070662_100216351 3300005457 Bacteria 1527
131 Ga0070681_10014331 3300005458 Bacteria 7889
132 Ga0070681_10073996 3300005458 Bacteria 3368
133 Ga0070681_10074121 3300005458 Bacteria 3365
134 Ga0068867_100005155 3300005459 Bacteria 9226
135 Ga0068867_100031126 3300005459 Bacteria 3852
136 Ga0068867_100344861 3300005459 Bacteria 1241
137 Ga0068867_100474525 3300005459 Bacteria 1070
138 Ga0068867_100532561 3300005459 Bacteria 1015
139 Ga0070685_10213074 3300005466 Bacteria 1262
140 Ga0070685_10235950 3300005466 Bacteria 1205
141 Ga0070706_100009262 3300005467 Bacteria 9172
142 Ga0070706_100604505 3300005467 Bacteria 1019
143 Ga0070707_100038744 3300005468 Bacteria 4553
144 Ga0070707_100149343 3300005468 Bacteria 2275
145 Ga0070707_100694312 3300005468 Bacteria 980
146 Ga0070698_100001489 3300005471 Bacteria 26007
147 Ga0070698_100001894 3300005471 Bacteria 23305
148 Ga0070698_101065320 3300005471 Unclassified 756
149 Ga0070699_100020158 3300005518 Bacteria 5747
150 Ga0070699_100039020 3300005518 Bacteria 4111
151 Ga0070699_100087255 3300005518 Bacteria 2723
152 Ga0070699_100192282 3300005518 Bacteria 1813
153 Ga0070679_100015211 3300005530 Bacteria 7391
154 Ga0070679_100166416 3300005530 Bacteria 2178
155 Ga0070679_100195382 3300005530 Bacteria 1991
156 Ga0070679_100362827 3300005530 Bacteria 1396
157 Ga0070679_100629788 3300005530 Bacteria 1016
158 Ga0070684_100059203 3300005535 Bacteria 3348
159 Ga0070684_100139063 3300005535 Bacteria 2195
160 Ga0070697_100040877 3300005536 Bacteria 3752
161 Ga0070697_100053626 3300005536 Bacteria 3277
162 Ga0070697_100085917 3300005536 Bacteria 2595
163 Ga0068853_100439525 3300005539 Bacteria 1226
164 Ga0070672_100010425 3300005543 Bacteria 6449
165 Ga0070672_100037975 3300005543 Bacteria 3677
166 Ga0070672_100077938 3300005543 Bacteria 2651
167 Ga0070672_100280783 3300005543 Bacteria 1408
168 Ga0070672_100300343 3300005543 Bacteria 1361
169 Ga0070696_100277204 3300005546 Bacteria 1277
170 Ga0070665_100028600 3300005548 Bacteria 5613
171 Ga0070665_100041857 3300005548 Bacteria 4605
172 Ga0070665_100059744 3300005548 Bacteria 3822
173 Ga0070665_100321285 3300005548 Bacteria 1552
174 Ga0070665_100337936 3300005548 Bacteria 1510
175 Ga0070665_100645488 3300005548 Bacteria 1071
176 Ga0070665_100721904 3300005548 Bacteria 1009
177 Ga0070704_100645549 3300005549 Bacteria 934
178 Ga0068855_100006563 3300005563 Bacteria 14139
179 Ga0068855_100197789 3300005563 Bacteria 2264
180 Ga0068855_100285543 3300005563 Bacteria 1831
181 Ga0068855_100453266 3300005563 Bacteria 1399
182 Ga0070664_100181960 3300005564 Bacteria 1868
183 Ga0070664_100222681 3300005564 Bacteria 1688
184 Ga0068857_100068776 3300005577 Bacteria 3152
185 Ga0068857_101355763 3300005577 Bacteria 691
186 Ga0068854_101005385 3300005578 Bacteria 739
187 Ga0068856_100007916 3300005614 Bacteria 10381
188 Ga0068856_100407198 3300005614 Bacteria 1380
189 Ga0068856_100529116 3300005614 Bacteria 1200
190 Ga0068856_100710100 3300005614 Bacteria 1026
191 Ga0068852_100016405 3300005616 Bacteria 5775
192 Ga0068852_100090825 3300005616 Bacteria 2732
193 Ga0068852_100394316 3300005616 Bacteria 1360
194 Ga0068852_100445770 3300005616 Bacteria 1281
195 Ga0068852_101014365 3300005616 Bacteria 849
196 Ga0068852_101449423 3300005616 Bacteria 709
197 Ga0068859_100295661 3300005617 Bacteria 1712
198 Ga0068859_100462365 3300005617 Bacteria 1365
199 Ga0068859_100772897 3300005617 Bacteria 1049
200 Ga0068864_100024785 3300005618 Bacteria 5047
201 Ga0068864_100473808 3300005618 Bacteria 1201
202 Ga0068866_10055550 3300005718 Bacteria 2034
203 Ga0068861_100002547 3300005719 Bacteria 11913
204 Ga0068861_100025992 3300005719 Bacteria 4251
205 Ga0068861_100051216 3300005719 Bacteria 3134
206 Ga0068861_100490585 3300005719 Bacteria 1108
207 Ga0068851_10272805 3300005834 Bacteria 965
208 Ga0068870_10039834 3300005840 Bacteria 2433
209 Ga0068863_100022184 3300005841 Bacteria 6061
210 Ga0068863_100085916 3300005841 Bacteria 2981
211 Ga0068863_100348030 3300005841 Bacteria 1443
212 Ga0068858_100047990 3300005842 Bacteria 3958
213 Ga0068858_100088380 3300005842 Bacteria 2883
214 Ga0068858_100344058 3300005842 Bacteria 1428
215 Ga0068860_100000515 3300005843 Bacteria 47393
216 Ga0068860_100498547 3300005843 Bacteria 1215
217 Ga0068860_100734056 3300005843 Bacteria 999
218 Ga0068862_100017703 3300005844 Bacteria 5931
219 Ga0068862_100023047 3300005844 Bacteria 5214
220 Ga0081455_10000030 3300005937 Bacteria 148346
221 Ga0081455_10000370 3300005937 Bacteria 59432
222 Ga0081455_10048684 3300005937 Bacteria 3660
223 Ga0081455_10062637 3300005937 Bacteria 3125
224 Ga0081455_10129143 3300005937 Bacteria 1979
225 Ga0081538_10058894 3300005981 Bacteria 2224
226 Ga0081538_10096174 3300005981 Bacteria 1510
227 Ga0081538_10211686 3300005981 Bacteria 781
228 Ga0081540_1003913 3300005983 Bacteria 11600
229 Ga0081540_1016777 3300005983 Bacteria 4564
230 Ga0081540_1020037 3300005983 Bacteria 4038
231 Ga0081540_1034549 3300005983 Bacteria 2724
232 Ga0081540_1112218 3300005983 Bacteria 1149
233 Ga0081539_10001490 3300005985 Bacteria 39594
234 Ga0081539_10049141 3300005985 Bacteria 2396
235 Ga0081539_10141583 3300005985 Bacteria 1168
236 Ga0070717_10004346 3300006028 Bacteria 10219
237 Ga0070717_10058852 3300006028 Bacteria 3178
238 Ga0070717_10069419 3300006028 Bacteria 2935
239 Ga0075365_10074563 3300006038 Bacteria 2289
240 Ga0075365_10103729 3300006038 Bacteria 1949
241 Ga0075365_10190548 3300006038 Bacteria 1435
242 Ga0075365_10275615 3300006038 Bacteria 1183
243 Ga0075365_10300052 3300006038 Bacteria 1130
244 Ga0075368_10000871 3300006042 Bacteria 9345
245 Ga0075368_10010300 3300006042 Bacteria 3378
246 Ga0075363_100001442 3300006048 Bacteria 9008
247 Ga0075363_100226462 3300006048 Bacteria 1072
248 Ga0075364_10045122 3300006051 Bacteria 2868
249 Ga0075364_10074105 3300006051 Bacteria 2244
250 Ga0075364_10236471 3300006051 Bacteria 1241
251 Ga0070715_10000170 3300006163 Bacteria 15093
252 Ga0070715_10073621 3300006163 Bacteria 1532
253 Ga0070716_100004867 3300006173 Bacteria 6456
254 Ga0070716_100030369 3300006173 Bacteria 2930
255 Ga0070716_100220603 3300006173 Bacteria 1274
256 Ga0070716_100236410 3300006173 Bacteria 1236
257 Ga0070716_100567026 3300006173 Bacteria 849
258 Ga0070716_100617204 3300006173 Bacteria 818
259 Ga0070712_100005583 3300006175 Bacteria 7780
260 Ga0070712_100033573 3300006175 Bacteria 3473
261 Ga0070712_100092117 3300006175 Bacteria 2222
262 Ga0070712_100265388 3300006175 Bacteria 1377
263 Ga0070712_100802617 3300006175 Bacteria 807
264 Ga0075362_10009303 3300006177 Bacteria 3795
265 Ga0075362_10036856 3300006177 Bacteria 2142
266 Ga0075367_10010911 3300006178 Bacteria 4788
267 Ga0075367_10013533 3300006178 Bacteria 4389
268 Ga0075367_10017380 3300006178 Bacteria 3947
269 Ga0075367_10102262 3300006178 Bacteria 1753
270 Ga0075367_10183291 3300006178 Bacteria 1306
271 Ga0075367_10195716 3300006178 Bacteria 1262
272 Ga0075367_10323223 3300006178 Bacteria 972
273 Ga0075369_10002311 3300006186 Bacteria 6779
274 Ga0075369_10005323 3300006186 Bacteria 4798
275 Ga0075369_10016536 3300006186 Bacteria 2979
276 Ga0075366_10017413 3300006195 Bacteria 4135
277 Ga0075366_10068034 3300006195 Bacteria 2120
278 Ga0075366_10133996 3300006195 Bacteria 1496
279 Ga0075366_10177373 3300006195 Bacteria 1294
280 Ga0097621_100005209 3300006237 Bacteria 9138
281 Ga0097621_100145696 3300006237 Bacteria 2027
282 Ga0097621_100267705 3300006237 Bacteria 1501
283 Ga0097621_100319132 3300006237 Bacteria 1376
284 Ga0075370_10044744 3300006353 Bacteria 2503
285 Ga0075370_10053029 3300006353 Bacteria 2302
286 Ga0075370_10272471 3300006353 Bacteria 1005
287 Ga0075370_10312223 3300006353 Bacteria 936
288 Ga0068871_100005755 3300006358 Bacteria 8703
289 Ga0068871_100053750 3300006358 Bacteria 3265
290 Ga0068871_100188522 3300006358 Bacteria 1775
291 Ga0068871_100819448 3300006358 Bacteria 859
292 Ga0075428_100020774 3300006844 Bacteria 7270
293 Ga0075428_100375906 3300006844 Bacteria 1523
294 Ga0075428_101332140 3300006844 Bacteria 754
295 Ga0075430_100011908 3300006846 Bacteria 7404
296 Ga0075430_100175942 3300006846 Bacteria 1780
297 Ga0075430_100331958 3300006846 Bacteria 1256
298 Ga0075430_100346996 3300006846 Bacteria 1226
299 Ga0075431_100017460 3300006847 Bacteria 7294
300 Ga0075431_100021552 3300006847 Bacteria 6591
301 Ga0075431_100161326 3300006847 Bacteria 2305
302 Ga0075431_100212946 3300006847 Bacteria 1973
303 Ga0075431_100433888 3300006847 Bacteria 1311
304 Ga0075434_100091249 3300006871 Bacteria 3048
305 Ga0075429_100194579 3300006880 Bacteria 1776
306 Ga0075429_100203900 3300006880 Bacteria 1733
307 Ga0075429_100268878 3300006880 Bacteria 1493
308 Ga0068865_100003574 3300006881 Bacteria 9338
309 Ga0068865_100460845 3300006881 Bacteria 1053
310 Ga0097620_100295664 3300006931 Bacteria 1712
311 Ga0097620_100462413 3300006931 Bacteria 1365
312 Ga0097620_100772883 3300006931 Bacteria 1049
313 Ga0075435_100040343 3300007076 Bacteria 3727
314 Ga0099794_10005140 3300007265 Bacteria 5223
315 Ga0099794_10013549 3300007265 Bacteria 3552
316 Ga0099795_10019288 3300007788 Bacteria 2204
317 Ga0099795_10020673 3300007788 Bacteria 2148
318 Ga0105251_10032456 3300009011 Bacteria 2601
319 Ga0105251_10202657 3300009011 Bacteria 894
320 Ga0105251_10257219 3300009011 Bacteria 787
321 Ga0105244_10023579 3300009036 Bacteria 3371
322 Ga0105244_10154257 3300009036 Bacteria 1099
323 Ga0105250_10021450 3300009092 Bacteria 2607
324 Ga0105250_10023301 3300009092 Bacteria 2494
325 Ga0105250_10051228 3300009092 Bacteria 1656
326 Ga0105240_10002493 3300009093 Bacteria 29572
327 Ga0105240_10012470 3300009093 Bacteria 11727
328 Ga0105240_10041457 3300009093 Bacteria 5876
329 Ga0105240_10172639 3300009093 Bacteria 2559
330 Ga0105240_10650698 3300009093 Bacteria 1155
331 Ga0111539_10029807 3300009094 Bacteria 6640
332 Ga0111539_10427369 3300009094 Bacteria 1543
333 Ga0111539_10568771 3300009094 Bacteria 1320
334 Ga0111539_10909798 3300009094 Bacteria 1023
335 Ga0111539_11077385 3300009094 Bacteria 934
336 Ga0111539_11642481 3300009094 Bacteria 745
337 Ga0105245_10008917 3300009098 Bacteria 8755
338 Ga0105245_10416032 3300009098 Bacteria 1346
339 Ga0105245_10611773 3300009098 Bacteria 1117
340 Ga0105247_10004796 3300009101 Bacteria 8615
341 Ga0105247_10012294 3300009101 Bacteria 5143
342 Ga0105247_10013310 3300009101 Bacteria 4938
343 Ga0114129_10068576 3300009147 Bacteria 4945
344 Ga0114129_10103640 3300009147 Bacteria 3933
345 Ga0114129_10106492 3300009147 Bacteria 3873
346 Ga0114129_10200287 3300009147 Bacteria 2705
347 Ga0114129_10336120 3300009147 Bacteria 2004
348 Ga0105243_10000209 3300009148 Bacteria 68700
349 Ga0105243_10061519 3300009148 Bacteria 3003
350 Ga0105243_10400522 3300009148 Bacteria 1275
351 Ga0105243_10874030 3300009148 Bacteria 892
352 Ga0105241_10421269 3300009174 Bacteria 1175
353 Ga0105241_10866776 3300009174 Bacteria 836
354 Ga0105242_10002692 3300009176 Bacteria 13901
355 Ga0105242_10075288 3300009176 Bacteria 2810
356 Ga0105242_10101075 3300009176 Bacteria 2443
357 Ga0105242_10364233 3300009176 Bacteria 1339
358 Ga0105242_10929947 3300009176 Bacteria 872
359 Ga0105248_10371195 3300009177 Bacteria 1611
360 Ga0105248_10408807 3300009177 Bacteria 1528
361 Ga0105248_10855041 3300009177 Bacteria 1027
362 Ga0105237_10003531 3300009545 Bacteria 18527
363 Ga0105237_10024701 3300009545 Bacteria 6147
364 Ga0105237_10425600 3300009545 Bacteria 1333
365 Ga0105237_10493410 3300009545 Bacteria 1231
366 Ga0105237_10522458 3300009545 Bacteria 1194
367 Ga0105238_10203143 3300009551 Bacteria 1957
368 Ga0105238_10257014 3300009551 Bacteria 1726
369 Ga0105238_10281676 3300009551 Bacteria 1644
370 Ga0105238_10927943 3300009551 Bacteria 890
371 Ga0105249_10009715 3300009553 Bacteria 8431
372 Ga0105249_10338592 3300009553 Bacteria 1520
373 Ga0105249_10620881 3300009553 Bacteria 1137
374 Ga0105249_10633503 3300009553 Bacteria 1126
375 Ga0105249_10770857 3300009553 Bacteria 1025
376 Ga0105028_106674 3300009993 Bacteria 1205
377 Ga0105239_10019175 3300010375 Bacteria 7556
378 Ga0105239_10072092 3300010375 Bacteria 3796
379 Ga0105239_10084759 3300010375 Bacteria 3491
380 Ga0105239_10116418 3300010375 Bacteria 2966
381 Ga0105239_10144007 3300010375 Bacteria 2657
382 Ga0105239_10435836 3300010375 Bacteria 1486
383 Ga0105239_10540923 3300010375 Bacteria 1326
384 Ga0105246_10003085 3300011119 Bacteria 10112
385 Ga0105246_10039338 3300011119 Bacteria 3185
386 Ga0105246_10205094 3300011119 Bacteria 1535
387 Ga0105246_10401504 3300011119 Bacteria 1138
388 Ga0105246_10410100 3300011119 Bacteria 1127
389 Ga0105246_10446953 3300011119 Bacteria 1085
390 Ga0105246_10510512 3300011119 Bacteria 1022
391 Ga0157373_10106549 3300013100 Bacteria 1971
392 Ga0157371_10368724 3300013102 Bacteria 1047
393 Ga0157370_10011426 3300013104 Bacteria 9285
394 Ga0157370_10115568 3300013104 Bacteria 2506
395 Ga0157370_10264351 3300013104 Bacteria 1590
396 Ga0157370_10633477 3300013104 Bacteria 978
397 Ga0157369_10039088 3300013105 Bacteria 5187
398 Ga0157369_10064374 3300013105 Bacteria 3949
399 Ga0157369_10133361 3300013105 Bacteria 2631
400 Ga0157374_10052132 3300013296 Bacteria 3809
401 Ga0157374_10113755 3300013296 Bacteria 2605
402 Ga0157374_10996330 3300013296 Bacteria 857
403 Ga0157378_10029475 3300013297 Bacteria 4845
404 Ga0157378_10196836 3300013297 Bacteria 1904
405 Ga0157378_10248316 3300013297 Bacteria 1703
406 Ga0157378_10504365 3300013297 Bacteria 1209
407 Ga0163162_10000043 3300013306 Bacteria 129324
408 Ga0163162_10008437 3300013306 Bacteria 10048
409 Ga0163162_10235517 3300013306 Bacteria 1961
410 Ga0163162_10268551 3300013306 Bacteria 1837
411 Ga0163162_10584023 3300013306 Bacteria 1244
412 Ga0157372_10135433 3300013307 Bacteria 2836
413 Ga0157375_10042199 3300013308 Bacteria 4413
414 Ga0157375_10286068 3300013308 Bacteria 1812
415 Ga0157375_10553907 3300013308 Bacteria 1311
416 Ga0157375_10751337 3300013308 Bacteria 1126
417 Ga0157375_10855511 3300013308 Bacteria 1056
418 Ga0157375_11177937 3300013308 Bacteria 898
419 Ga0163163_10010656 3300014325 Bacteria 8285
420 Ga0163163_10011142 3300014325 Bacteria 8140
421 Ga0163163_10580092 3300014325 Bacteria 1184
422 Ga0163163_11397875 3300014325 Bacteria 762
423 Ga0163163_11582014 3300014325 Bacteria 716
424 Ga0157380_10032373 3300014326 Bacteria 4021
425 Ga0157380_10053098 3300014326 Bacteria 3212
426 Ga0157380_10073359 3300014326 Bacteria 2774
427 Ga0157380_10133600 3300014326 Bacteria 2121
428 Ga0157380_10156702 3300014326 Bacteria 1974
429 Ga0157380_10709545 3300014326 Bacteria 1012
430 Ga0182008_10054106 3300014497 Bacteria 1987
431 Ga0182008_10148475 3300014497 Bacteria 1175
432 Ga0157377_10000894 3300014745 Bacteria 12440
433 Ga0157379_10077606 3300014968 Bacteria 2974
434 Ga0157379_10084010 3300014968 Bacteria 2854
435 Ga0157379_10171616 3300014968 Bacteria 1958
436 Ga0157379_10232953 3300014968 Bacteria 1670
437 Ga0157379_10296007 3300014968 Bacteria 1474
438 Ga0157379_10408745 3300014968 Bacteria 1249
439 Ga0157376_10087414 3300014969 Bacteria 2690
440 Ga0157376_10105885 3300014969 Bacteria 2467
441 Ga0157376_10134516 3300014969 Bacteria 2211
442 Ga0157376_10413471 3300014969 Bacteria 1307
443 Ga0157376_10455855 3300014969 Bacteria 1248
444 Ga0157376_10569702 3300014969 Bacteria 1123
445 Ga0182006_1095809 3300015261 Bacteria 1060
446 Ga0182005_1073410 3300015265 Bacteria 940
447 Ga0163161_10257439 3300017792 Bacteria 1362
448 Ga0163161_10311656 3300017792 Bacteria 1242
449 Ga0163161_10817341 3300017792 Bacteria 784
450 Ga0206354_11440000 3300020081 Bacteria 6386
451 Ga0206353_10040355 3300020082 Bacteria 7975
452 Ga0214544_1000001 3300021320 Bacteria 783667
453 Ga0214542_1000005 3300021321 Bacteria 389646
454 Ga0214545_1000003 3300021324 Bacteria 720274
455 Ga0214543_1000002 3300021327 Bacteria 712733
456 Ga0214543_1022088 3300021327 Bacteria 4624
457 Ga0213873_10000006 3300021358 Bacteria 408723
458 Ga0213873_10028827 3300021358 Bacteria 1364
459 Ga0213874_10032374 3300021377 Bacteria 1518
460 Ga0213874_10097772 3300021377 Bacteria 972
461 Ga0213876_10000004 3300021384 Bacteria 943822
462 Ga0213876_10004040 3300021384 Bacteria 8257
463 Ga0213876_10045989 3300021384 Bacteria 2308
464 Ga0213875_10040547 3300021388 Bacteria 2192
465 Ga0213875_10085645 3300021388 Bacteria 1470
466 Ga0213871_10000281 3300021441 Bacteria 6322
467 Ga0213871_10009471 3300021441 Bacteria 2183
468 Ga0209784_100051 3300025224 Bacteria 183666
469 Ga0209566_100112 3300025225 Bacteria 111585
470 Ga0209566_100158 3300025225 Bacteria 76076
471 Ga0209566_103510 3300025225 Bacteria 2385
472 Ga0209147_100062 3300025229 Bacteria 242831
473 Ga0209147_100101 3300025229 Bacteria 161976
474 Ga0209147_100559 3300025229 Bacteria 20945
475 Ga0209147_101819 3300025229 Bacteria 6631
476 Ga0209563_101258 3300025230 Bacteria 6952
477 Ga0209258_101869 3300025242 Bacteria 6333
478 Ga0209677_100240 3300025253 Bacteria 37740
479 Ga0209677_101553 3300025253 Bacteria 9774
480 Ga0209148_1000849 3300025254 Bacteria 21522
481 Ga0209148_1006744 3300025254 Bacteria 2456
482 Ga0209233_1004289 3300025261 Bacteria 4877
483 Ga0209233_1024415 3300025261 Bacteria 1512
484 Ga0209233_1037347 3300025261 Bacteria 1080
485 Ga0209233_1042303 3300025261 Bacteria 978
486 Ga0209565_1000195 3300025263 Bacteria 72860
487 Ga0209455_1001056 3300025272 Bacteria 13629
488 Ga0209455_1001077 3300025272 Bacteria 13457
489 Ga0209673_1001368 3300025273 Bacteria 24002
490 Ga0209673_1002410 3300025273 Bacteria 13048
491 Ga0209673_1033439 3300025273 Bacteria 1568
492 Ga0209130_1006510 3300025284 Bacteria 3778
493 Ga0209130_1011599 3300025284 Bacteria 2352
494 Ga0209675_1006600 3300025291 Bacteria 4620
495 Ga0209675_1023680 3300025291 Bacteria 1585
496 Ga0209675_1035722 3300025291 Bacteria 1131
497 Ga0209675_1053419 3300025291 Bacteria 824
498 Ga0209676_1000082 3300025292 Bacteria 280400
499 Ga0209676_1000224 3300025292 Bacteria 124160
500 Ga0209676_1000374 3300025292 Bacteria 82896
501 Ga0209676_1003709 3300025292 Bacteria 9117
502 Ga0209676_1007483 3300025292 Bacteria 5109
503 Ga0209676_1008567 3300025292 Bacteria 4539
504 Ga0209676_1010333 3300025292 Bacteria 3906
505 Ga0209676_1014012 3300025292 Bacteria 3045
506 Ga0209676_1037468 3300025292 Bacteria 1399
507 Ga0209676_1054824 3300025292 Bacteria 1025
508 Ga0209025_1001531 3300025294 Bacteria 29557
509 Ga0209025_1003426 3300025294 Bacteria 15043
510 Ga0209025_1003576 3300025294 Bacteria 14532
511 Ga0209025_1004018 3300025294 Bacteria 13184
512 Ga0209025_1004765 3300025294 Bacteria 11518
513 Ga0209025_1004804 3300025294 Bacteria 11455
514 Ga0209025_1006577 3300025294 Bacteria 8959
515 Ga0209025_1007420 3300025294 Bacteria 8189
516 Ga0209025_1008453 3300025294 Bacteria 7407
517 Ga0209025_1010494 3300025294 Bacteria 6270
518 Ga0209025_1014192 3300025294 Bacteria 4930
519 Ga0209025_1027219 3300025294 Bacteria 2842
520 Ga0209564_1001613 3300025295 Bacteria 21895
521 Ga0209564_1014164 3300025295 Bacteria 3336
522 Ga0209564_1022771 3300025295 Bacteria 2200
523 Ga0209564_1040023 3300025295 Bacteria 1279
524 Ga0209758_1000026 3300025297 Bacteria 582706
525 Ga0209758_1000526 3300025297 Bacteria 61197
526 Ga0209758_1001753 3300025297 Bacteria 24107
527 Ga0209758_1002770 3300025297 Bacteria 17161
528 Ga0209758_1004348 3300025297 Bacteria 11866
529 Ga0209758_1009300 3300025297 Bacteria 6136
530 Ga0209758_1015309 3300025297 Bacteria 3985
531 Ga0209758_1025500 3300025297 Bacteria 2592
532 Ga0209050_1000443 3300025298 Bacteria 75067
533 Ga0209050_1000735 3300025298 Bacteria 47579
534 Ga0209050_1012972 3300025298 Bacteria 3763
535 Ga0209256_1000535 3300025299 Bacteria 55077
536 Ga0209256_1022305 3300025299 Bacteria 1920
537 Ga0207426_1000213 3300025302 Bacteria 137311
538 Ga0207426_1001534 3300025302 Bacteria 18789
539 Ga0207426_1024890 3300025302 Bacteria 2024
540 Ga0209051_1002443 3300025303 Bacteria 13353
541 Ga0209051_1057187 3300025303 Bacteria 1251
542 Ga0209257_1000218 3300025304 Bacteria 135855
543 Ga0209257_1000626 3300025304 Bacteria 56850
544 Ga0209257_1000930 3300025304 Bacteria 40542
545 Ga0209257_1001466 3300025304 Bacteria 27822
546 Ga0209257_1001794 3300025304 Bacteria 23601
547 Ga0209257_1014478 3300025304 Bacteria 3386
548 Ga0207697_10096231 3300025315 Bacteria 1259
549 Ga0207696_1001433 3300025711 Bacteria 12962
550 Ga0207696_1003350 3300025711 Bacteria 7366
551 Ga0207696_1004678 3300025711 Bacteria 5847
552 Ga0207655_1004092 3300025728 Bacteria 10497
553 Ga0207655_1009156 3300025728 Bacteria 6187
554 Ga0207655_1016667 3300025728 Bacteria 4007
555 Ga0207713_1004512 3300025735 Bacteria 9016
556 Ga0207682_10026497 3300025893 Bacteria 2305
557 Ga0207692_10001394 3300025898 Bacteria 9044
558 Ga0207692_10003157 3300025898 Bacteria 6395
559 Ga0207642_10414076 3300025899 Bacteria 809
560 Ga0207710_10015614 3300025900 Bacteria 3212
561 Ga0207710_10039499 3300025900 Bacteria 2089
562 Ga0207710_10045167 3300025900 Bacteria 1964
563 Ga0207710_10136919 3300025900 Bacteria 1180
564 Ga0207688_10068259 3300025901 Bacteria 2013
565 Ga0207688_10279814 3300025901 Bacteria 1016
566 Ga0207680_10029511 3300025903 Bacteria 3082
567 Ga0207680_10431147 3300025903 Bacteria 934
568 Ga0207647_10004089 3300025904 Bacteria 10838
569 Ga0207685_10092331 3300025905 Bacteria 1277
570 Ga0207699_10004142 3300025906 Bacteria 6943
571 Ga0207699_10019092 3300025906 Bacteria 3648
572 Ga0207699_10127335 3300025906 Bacteria 1656
573 Ga0207699_10182270 3300025906 Bacteria 1412
574 Ga0207645_10063123 3300025907 Bacteria 2366
575 Ga0207645_10081161 3300025907 Bacteria 2079
576 Ga0207645_10129767 3300025907 Bacteria 1640
577 Ga0207645_10490662 3300025907 Bacteria 831
578 Ga0207643_10002912 3300025908 Bacteria 9244
579 Ga0207705_10000002 3300025909 Bacteria 2046852
580 Ga0207705_10139390 3300025909 Bacteria 1810
581 Ga0207705_10498140 3300025909 Bacteria 946
582 Ga0207684_10001378 3300025910 Bacteria 26499
583 Ga0207684_10135158 3300025910 Bacteria 2117
584 Ga0207684_10492048 3300025910 Bacteria 1052
585 Ga0207684_10847789 3300025910 Bacteria 770
586 Ga0207654_10013939 3300025911 Bacteria 4143
587 Ga0207654_10280216 3300025911 Bacteria 1127
588 Ga0207654_10287127 3300025911 Bacteria 1114
589 Ga0207707_10022121 3300025912 Bacteria 5558
590 Ga0207707_10182199 3300025912 Bacteria 1833
591 Ga0207707_10287734 3300025912 Bacteria 1422
592 Ga0207695_10000006 3300025913 Bacteria 1135309
593 Ga0207695_10026360 3300025913 Bacteria 6487
594 Ga0207695_10056087 3300025913 Bacteria 4102
595 Ga0207695_10081179 3300025913 Bacteria 3282
596 Ga0207695_10135160 3300025913 Bacteria 2420
597 Ga0207695_10149781 3300025913 Bacteria 2273
598 Ga0207695_10284512 3300025913 Bacteria 1547
599 Ga0207695_10451293 3300025913 Bacteria 1169
600 Ga0207671_10000774 3300025914 Bacteria 40531
601 Ga0207671_10064265 3300025914 Bacteria 2728
602 Ga0207671_10104187 3300025914 Bacteria 2152
603 Ga0207693_10000095 3300025915 Bacteria 78764
604 Ga0207693_10004244 3300025915 Bacteria 12153
605 Ga0207693_10023789 3300025915 Bacteria 4862
606 Ga0207693_10061212 3300025915 Bacteria 2948
607 Ga0207693_10093094 3300025915 Bacteria 2362
608 Ga0207693_10254467 3300025915 Bacteria 1378
609 Ga0207693_10495713 3300025915 Bacteria 954
610 Ga0207663_10005035 3300025916 Bacteria 6634
611 Ga0207663_10005324 3300025916 Bacteria 6475
612 Ga0207663_10010748 3300025916 Bacteria 4887
613 Ga0207663_10050440 3300025916 Bacteria 2586
614 Ga0207660_10005232 3300025917 Bacteria 8429
615 Ga0207660_10107656 3300025917 Bacteria 2092
616 Ga0207662_10143330 3300025918 Bacteria 1515
617 Ga0207657_10013159 3300025919 Bacteria 8123
618 Ga0207657_10087753 3300025919 Bacteria 2602
619 Ga0207657_10325964 3300025919 Bacteria 1214
620 Ga0207649_10026891 3300025920 Bacteria 3371
621 Ga0207649_10433260 3300025920 Bacteria 989
622 Ga0207649_10711568 3300025920 Bacteria 779
623 Ga0207652_10049918 3300025921 Bacteria 3583
624 Ga0207652_10291879 3300025921 Bacteria 1471
625 Ga0207646_10002702 3300025922 Bacteria 20798
626 Ga0207646_10003436 3300025922 Bacteria 17890
627 Ga0207646_10592602 3300025922 Bacteria 995
628 Ga0207646_10994197 3300025922 Bacteria 741
629 Ga0207681_10007974 3300025923 Bacteria 6475
630 Ga0207681_10067633 3300025923 Bacteria 2478
631 Ga0207681_10077129 3300025923 Bacteria 2342
632 Ga0207681_10082921 3300025923 Bacteria 2268
633 Ga0207681_10329699 3300025923 Bacteria 1216
634 Ga0207681_10847262 3300025923 Bacteria 764
635 Ga0207694_10040691 3300025924 Bacteria 3580
636 Ga0207694_10309862 3300025924 Bacteria 1301
637 Ga0207694_10314326 3300025924 Bacteria 1292
638 Ga0207650_10446591 3300025925 Bacteria 1076
639 Ga0207659_10247417 3300025926 Bacteria 1445
640 Ga0207659_10722854 3300025926 Bacteria 853
641 Ga0207687_10130102 3300025927 Bacteria 1896
642 Ga0207700_10113909 3300025928 Bacteria 2181
643 Ga0207700_10398544 3300025928 Unclassified 1206
644 Ga0207700_10536225 3300025928 Unclassified 1038
645 Ga0207700_10657636 3300025928 Bacteria 934
646 Ga0207664_10001459 3300025929 Bacteria 15529
647 Ga0207664_10022969 3300025929 Bacteria 4667
648 Ga0207664_10037596 3300025929 Bacteria 3748
649 Ga0207664_10260319 3300025929 Bacteria 1517
650 Ga0207664_10290736 3300025929 Bacteria 1436
651 Ga0207644_10020240 3300025931 Bacteria 4522
652 Ga0207644_10024786 3300025931 Bacteria 4121
653 Ga0207690_10002077 3300025932 Bacteria 12273
654 Ga0207690_10125035 3300025932 Bacteria 1874
655 Ga0207690_10401242 3300025932 Bacteria 1093
656 Ga0207706_10093957 3300025933 Bacteria 2638
657 Ga0207709_10026143 3300025935 Bacteria 3350
658 Ga0207709_10066606 3300025935 Bacteria 2269
659 Ga0207709_10133158 3300025935 Bacteria 1697
660 Ga0207709_10525710 3300025935 Bacteria 927
661 Ga0207670_10147234 3300025936 Bacteria 1743
662 Ga0207670_10223272 3300025936 Bacteria 1443
663 Ga0207670_10648798 3300025936 Bacteria 870
664 Ga0207669_10038820 3300025937 Bacteria 2746
665 Ga0207669_10249923 3300025937 Bacteria 1320
666 Ga0207704_10002133 3300025938 Bacteria 8872
667 Ga0207704_10673391 3300025938 Bacteria 854
668 Ga0207665_10003452 3300025939 Bacteria 10563
669 Ga0207665_10008093 3300025939 Bacteria 6940
670 Ga0207665_10042690 3300025939 Bacteria 3031
671 Ga0207665_10169939 3300025939 Bacteria 1574
672 Ga0207665_10247773 3300025939 Bacteria 1315
673 Ga0207691_10005669 3300025940 Bacteria 12069
674 Ga0207691_10098084 3300025940 Bacteria 2618
675 Ga0207691_10256370 3300025940 Bacteria 1508
676 Ga0207691_10383787 3300025940 Bacteria 1199
677 Ga0207691_10965370 3300025940 Bacteria 712
678 Ga0207711_10038629 3300025941 Bacteria 4060
679 Ga0207711_10771177 3300025941 Bacteria 896
680 Ga0207689_10009368 3300025942 Bacteria 8462
681 Ga0207689_10725979 3300025942 Bacteria 838
682 Ga0207661_10049557 3300025944 Bacteria 3343
683 Ga0207661_10054953 3300025944 Bacteria 3191
684 Ga0207661_10854058 3300025944 Bacteria 838
685 Ga0207679_10274138 3300025945 Bacteria 1444
686 Ga0207679_10363818 3300025945 Bacteria 1264
687 Ga0207667_10023653 3300025949 Bacteria 6762
688 Ga0207667_10107430 3300025949 Bacteria 2879
689 Ga0207667_10118681 3300025949 Bacteria 2726
690 Ga0207667_10177169 3300025949 Bacteria 2190
691 Ga0207667_10986539 3300025949 Bacteria 830
692 Ga0207651_10524926 3300025960 Bacteria 1026
693 Ga0207712_10068208 3300025961 Bacteria 2548
694 Ga0207712_10324111 3300025961 Bacteria 1272
695 Ga0207712_10426204 3300025961 Bacteria 1120
696 Ga0207668_10005444 3300025972 Bacteria 7496
697 Ga0207668_10049565 3300025972 Bacteria 2888
698 Ga0207668_10112239 3300025972 Bacteria 2047
699 Ga0207668_10224535 3300025972 Bacteria 1510
700 Ga0207668_10488248 3300025972 Bacteria 1057
701 Ga0207668_10631345 3300025972 Bacteria 936
702 Ga0207640_10307593 3300025981 Bacteria 1257
703 Ga0207658_10035677 3300025986 Bacteria 3563
704 Ga0207658_10826463 3300025986 Bacteria 842
705 Ga0207677_10182474 3300026023 Bacteria 1652
706 Ga0207677_10217399 3300026023 Bacteria 1530
707 Ga0207677_10331415 3300026023 Bacteria 1268
708 Ga0207703_10050438 3300026035 Bacteria 3368
709 Ga0207703_10094542 3300026035 Bacteria 2520
710 Ga0207703_10200510 3300026035 Bacteria 1773
711 Ga0207703_10253516 3300026035 Bacteria 1587
712 Ga0207639_10451984 3300026041 Bacteria 1166
713 Ga0207639_10509021 3300026041 Bacteria 1101
714 Ga0207678_10016716 3300026067 Bacteria 6444
715 Ga0207678_10150623 3300026067 Bacteria 1986
716 Ga0207708_10060761 3300026075 Bacteria 2885
717 Ga0207708_10070386 3300026075 Bacteria 2678
718 Ga0207708_10078649 3300026075 Bacteria 2533
719 Ga0207708_10159293 3300026075 Bacteria 1782
720 Ga0207702_10010788 3300026078 Bacteria 7625
721 Ga0207702_10474379 3300026078 Bacteria 1217
722 Ga0207702_10582698 3300026078 Bacteria 1097
723 Ga0207702_10736657 3300026078 Bacteria 973
724 Ga0207641_10065264 3300026088 Bacteria 3114
725 Ga0207641_10093443 3300026088 Bacteria 2636
726 Ga0207641_10250050 3300026088 Bacteria 1655
727 Ga0207641_10337251 3300026088 Bacteria 1434
728 Ga0207641_10557488 3300026088 Bacteria 1118
729 Ga0207648_10010535 3300026089 Bacteria 8755
730 Ga0207648_10010728 3300026089 Bacteria 8661
731 Ga0207648_10017971 3300026089 Bacteria 6413
732 Ga0207648_10538196 3300026089 Bacteria 1072
733 Ga0207648_10708797 3300026089 Bacteria 933
734 Ga0207676_10076218 3300026095 Bacteria 2709
735 Ga0207676_10545478 3300026095 Bacteria 1107
736 Ga0207674_10124239 3300026116 Bacteria 2547
737 Ga0207674_10150717 3300026116 Bacteria 2283
738 Ga0207674_10177820 3300026116 Bacteria 2080
739 Ga0207674_10827632 3300026116 Bacteria 893
740 Ga0207675_100007528 3300026118 Bacteria 10287
741 Ga0207675_100008033 3300026118 Bacteria 9941
742 Ga0207675_100030133 3300026118 Bacteria 5052
743 Ga0207675_100050504 3300026118 Bacteria 3880
744 Ga0207675_100187202 3300026118 Bacteria 1985
745 Ga0207683_10000755 3300026121 Bacteria 29385
746 Ga0207683_10056099 3300026121 Bacteria 3455
747 Ga0207683_10095342 3300026121 Bacteria 2653
748 Ga0207683_10309790 3300026121 Bacteria 1445
749 Ga0207683_10516764 3300026121 Bacteria 1103
750 Ga0207698_10074343 3300026142 Bacteria 2711
751 Ga0207698_11196600 3300026142 Bacteria 774
752 Ga0209389_1000057 3300027296 Bacteria 107632
753 Ga0209389_1000083 3300027296 Bacteria 88461
754 Ga0209589_1000097 3300027357 Bacteria 88461
755 Ga0209489_100105 3300027361 Bacteria 118979
756 Ga0209489_100226 3300027361 Bacteria 94384
757 Ga0209700_100085 3300027363 Bacteria 128517
758 Ga0209179_1043892 3300027512 Bacteria 946
759 Ga0209588_1008313 3300027671 Bacteria 3074
760 Ga0209588_1086926 3300027671 Bacteria 1008
761 Ga0209813_10000296 3300027866 Bacteria 13724
762 Ga0209813_10014453 3300027866 Bacteria 2125
763 Ga0207428_10337634 3300027907 Bacteria 1110
764 Ga0268266_10005077 3300028379 Bacteria 12414
765 Ga0268266_10025505 3300028379 Bacteria 5029
766 Ga0268266_10169497 3300028379 Bacteria 1981
767 Ga0268266_10191908 3300028379 Bacteria 1865
768 Ga0268266_10315252 3300028379 Bacteria 1462
769 Ga0268266_10665923 3300028379 Bacteria 1002
770 Ga0268265_10003922 3300028380 Bacteria 10479
771 Ga0268265_10006606 3300028380 Bacteria 7850
772 Ga0268265_10076812 3300028380 Bacteria 2621
773 Ga0268265_10995459 3300028380 Bacteria 828
774 Ga0268264_10000021 3300028381 Bacteria 481580
775 Ga0268264_10000158 3300028381 Bacteria 153433
776 Ga0268264_10000909 3300028381 Bacteria 31074
777 Ga0268264_10138891 3300028381 Bacteria 2164
778 Ga0268264_10642836 3300028381 Bacteria 1049
779 Ga0265326_10002188 3300028558 Bacteria 6631
780 Ga0265334_10002607 3300028573 Bacteria 8406
781 Ga0265334_10093049 3300028573 Bacteria 1098
782 Ga0265318_10002810 3300028577 Bacteria 9101
783 Ga0265318_10022359 3300028577 Bacteria 2529
784 Ga0265318_10050572 3300028577 Bacteria 1561
785 Ga0265323_10006127 3300028653 Bacteria 5075
786 Ga0265336_10001608 3300028666 Bacteria 10074
787 Ga0307517_10000008 3300028786 Bacteria 243202
788 Ga0307517_10140654 3300028786 Bacteria 1696
789 Ga0307515_10025060 3300028794 Bacteria 10346
790 Ga0265338_10000667 3300028800 Bacteria 59318
791 Ga0265324_10009512 3300029957 Bacteria 3790
792 Ga0237817_10071 3300030083 Bacteria 32381
793 Ga0307511_10013403 3300030521 Bacteria 8012
794 Ga0265330_10024167 3300031235 Bacteria 2757
795 Ga0265330_10067445 3300031235 Bacteria 1550
796 Ga0265330_10211412 3300031235 Bacteria 819
797 Ga0265332_10096717 3300031238 Bacteria 1247
798 Ga0265328_10016381 3300031239 Bacteria 2886
799 Ga0265325_10020714 3300031241 Bacteria 3621
800 Ga0265325_10253193 3300031241 Bacteria 797
801 Ga0265340_10002126 3300031247 Bacteria 11354
802 Ga0265340_10008012 3300031247 Bacteria 5725
803 Ga0265340_10036882 3300031247 Bacteria 2422
804 Ga0265340_10070901 3300031247 Bacteria 1652
805 Ga0265340_10076407 3300031247 Bacteria 1582
806 Ga0265340_10245991 3300031247 Bacteria 798
807 Ga0265339_10003572 3300031249 Bacteria 10870
808 Ga0265339_10034980 3300031249 Bacteria 2821
809 Ga0265339_10092389 3300031249 Bacteria 1584
810 Ga0265331_10003787 3300031250 Bacteria 9597
811 Ga0265331_10006365 3300031250 Bacteria 6990
812 Ga0265331_10085332 3300031250 Bacteria 1463
813 Ga0265327_10000539 3300031251 Bacteria 64832
814 Ga0265316_10020290 3300031344 Bacteria 5662
815 Ga0265316_10075672 3300031344 Bacteria 2589
816 Ga0265316_10682219 3300031344 Bacteria 725
817 Ga0265316_10718282 3300031344 Bacteria 704
818 Ga0307513_10099941 3300031456 Bacteria 2928
819 Ga0307513_10547725 3300031456 Bacteria 870
820 Ga0307509_10007761 3300031507 Bacteria 13905
821 Ga0307509_10043851 3300031507 Bacteria 4836
822 Ga0307408_100221688 3300031548 Bacteria 1543
823 Ga0307408_100842309 3300031548 Bacteria 835
824 Ga0265313_10001592 3300031595 Bacteria 21059
825 Ga0265313_10006801 3300031595 Bacteria 7987
826 Ga0265313_10018863 3300031595 Bacteria 3860
827 Ga0265313_10041246 3300031595 Bacteria 2276
828 Ga0265313_10050697 3300031595 Bacteria 1989
829 Ga0265313_10064449 3300031595 Bacteria 1704
830 Ga0307508_10000184 3300031616 Bacteria 75613
831 Ga0307508_10013800 3300031616 Bacteria 7373
832 Ga0307508_10024747 3300031616 Bacteria 5448
833 Ga0307508_10216007 3300031616 Bacteria 1517
834 Ga0316575_10066360 3300031665 Bacteria 1446
835 Ga0265314_10003493 3300031711 Bacteria 15176
836 Ga0265314_10008911 3300031711 Bacteria 8556
837 Ga0265314_10010252 3300031711 Bacteria 7838
838 Ga0265314_10026502 3300031711 Bacteria 4354
839 Ga0265314_10044930 3300031711 Bacteria 3127
840 Ga0265314_10132596 3300031711 Bacteria 1552
841 Ga0265314_10137113 3300031711 Bacteria 1518
842 Ga0265314_10140576 3300031711 Bacteria 1493
843 Ga0265314_10172036 3300031711 Bacteria 1306
844 Ga0265314_10189851 3300031711 Bacteria 1224
845 Ga0265342_10003953 3300031712 Bacteria 11882
846 Ga0265342_10013043 3300031712 Bacteria 5599
847 Ga0265342_10026766 3300031712 Bacteria 3611
848 Ga0265342_10292260 3300031712 Bacteria 860
849 Ga0307516_10012710 3300031730 Bacteria 9049
850 Ga0307516_10355250 3300031730 Bacteria 1130
851 Ga0307410_10372605 3300031852 Bacteria 1146
852 Ga0326468_10002461 3300031889 Bacteria 1546
853 Ga0307406_10007985 3300031901 Bacteria 5895
854 Ga0307406_10981947 3300031901 Bacteria 723
855 Ga0307407_10031773 3300031903 Bacteria 2863
856 Ga0307409_100363645 3300031995 Bacteria 1369
857 Ga0307416_100041543 3300032002 Bacteria 3583
858 Ga0307416_100061274 3300032002 Bacteria 3069
859 Ga0307416_101346609 3300032002 Bacteria 820
860 Ga0307414_10059903 3300032004 Bacteria 2690
861 Ga0307414_10202858 3300032004 Bacteria 1614
862 Ga0307414_10350682 3300032004 Bacteria 1267
863 Ga0307415_100152714 3300032126 Bacteria 1779
864 Ga0307415_100199571 3300032126 Bacteria 1586
865 Ga0307415_100737647 3300032126 Bacteria 893
866 Ga0316583_10060288 3300032133 Bacteria 1330
867 Ga0316593_10040228 3300032168 Bacteria 1553
868 Ga0307507_10063835 3300033179 Bacteria 3405
869 Ga0307507_10255242 3300033179 Bacteria 1127
870 Ga0307510_10003242 3300033180 Bacteria 18921
871 Ga0307510_10003590 3300033180 Bacteria 18110
872 Ga0307510_10099597 3300033180 Bacteria 2704
873 Ga0316592_1016208 3300033524 Bacteria 1556
874 Ga0373926_0005666 3300035083 Bacteria 4122
875 Ga0373936_0053817 3300035113 Bacteria 1632
876 Ga0373953_0132028 3300035117 Bacteria 1065
877 Ga0373956_0062435 3300035119 Bacteria 1689
878 Ga0373957_0003459 3300035120 Bacteria 4667
879 Ga0373946_0360026 3300035171 Bacteria 729
880 Ga0373955_0051120 3300035172 Bacteria 2250
881 Ga0316574_0291335 3300035398 Bacteria 1039
882 Ga0373924_0003807 3300035410 Bacteria 5220
883 Ga0373931_0336080 3300035691 Bacteria 942
884 Ga0373931_0361234 3300035691 Bacteria 911
885 Ga0373931_0654474 3300035691 Bacteria 691
886 Ga0373935_0083060 3300035692 Bacteria 2085
887 Ga0373935_0153275 3300035692 Bacteria 1565
888 Ga0373935_0325993 3300035692 Bacteria 1091
889 Ga0373935_0485164 3300035692 Bacteria 896
890 Ga0373927_0022539 3300035695 Bacteria 4126
891 Ga0373927_0026045 3300035695 Bacteria 3823
892 Ga0373927_0030308 3300035695 Bacteria 3529
893 Ga0373927_0128707 3300035695 Bacteria 1653
894 Ga0373927_0179436 3300035695 Bacteria 1389
895 Ga0373933_0353323 3300035724 Bacteria 955
896 Ga0373947_0531977 3300035725 Bacteria 800
897 Ga0373937_0055118 3300036401 Bacteria 3649
898 Ga0373937_0150953 3300036401 Bacteria 2176
899 Ga0373937_0218966 3300036401 Bacteria 1792
900 Ga0373937_0386260 3300036401 Bacteria 1328
901 Ga0373937_0650628 3300036401 Bacteria 999
902 Ga0373937_1218146 3300036401 Bacteria 701
903 Ga0372808_002239 3300036459 Bacteria 2195
904 Ga0316584_0208416 3300036712 Bacteria 1439
905 Ga0373925_0110789 3300037068 Bacteria 2120
906 Ga0373925_0142985 3300037068 Bacteria 1874
907 Ga0373925_0283358 3300037068 Bacteria 1335
908 Ga0373925_0473705 3300037068 Bacteria 1027
909 Ga0373925_0680739 3300037068 Bacteria 848
910 Ga0395899_0001159 3300037312 Bacteria 23305
911 Ga0395899_0011006 3300037312 Bacteria 6929
912 Ga0395899_0070194 3300037312 Bacteria 2564
913 Ga0395899_0092039 3300037312 Bacteria 2196
914 Ga0395899_0164827 3300037312 Bacteria 1564
915 Ga0395899_0188373 3300037312 Bacteria 1445
916 Ga0395900_0004505 3300037418 Bacteria 14743
917 Ga0395900_0004870 3300037418 Bacteria 14149
918 Ga0395900_0007092 3300037418 Bacteria 11611
919 Ga0395900_0007882 3300037418 Bacteria 10969
920 Ga0395900_0022962 3300037418 Bacteria 6384
921 Ga0395900_0205599 3300037418 Bacteria 1990
922 Ga0395900_0400546 3300037418 Bacteria 1337
923 Ga0395898_0002205 3300037466 Bacteria 23788
924 Ga0395898_0002340 3300037466 Bacteria 22604
925 Ga0395898_0006553 3300037466 Bacteria 12425
926 Ga0395898_0016065 3300037466 Bacteria 7669
927 Ga0395905_0011090 3300037471 Bacteria 8721
928 Ga0395905_0076407 3300037471 Bacteria 3139
929 Ga0395905_0115269 3300037471 Bacteria 2525
930 Ga0395905_0492751 3300037471 Bacteria 1125
931 Ga0395905_1008018 3300037471 Bacteria 736
932 Ga0436364_0025958 3300037853 Bacteria 795
933 Ga0436364_0729208 3300037853 Bacteria 1474
934 Ga0436364_0863831 3300037853 Bacteria 2033
935 Ga0436364_1046819 3300037853 Bacteria 692
936 Ga0436364_1211238 3300037853 Bacteria 2202
937 Ga0395901_0001255 3300038443 Bacteria 26957
938 Ga0395901_0002098 3300038443 Bacteria 20468
939 Ga0395901_0004054 3300038443 Bacteria 14749
940 Ga0395901_0017180 3300038443 Bacteria 7380
941 Ga0395901_0025446 3300038443 Bacteria 6075
942 Ga0395901_0159461 3300038443 Bacteria 2369
943 Ga0395901_0234083 3300038443 Bacteria 1917
944 Ga0237819_01648 3300038705 Bacteria 5487
945 Ga0237819_03074 3300038705 Bacteria 3076
946 Ga0400483_035464 3300039062 Bacteria 7353
947 Ga0400483_162571 3300039062 Bacteria 1170
948 Ga0400483_230547 3300039062 Bacteria 1338
949 Ga0400483_232283 3300039062 Bacteria 2664
950 Ga0436365_0297386 3300039437 Bacteria 1779
951 Ga0436365_0850398 3300039437 Bacteria 3811
952 Ga0436365_0862833 3300039437 Bacteria 88455
953 Ga0436365_0904767 3300039437 Bacteria 1044
954 Ga0436365_1259102 3300039437 Bacteria 59061
955 Ga0436365_1361494 3300039437 Bacteria 15892
956 Ga0436365_1399381 3300039437 Bacteria 1354
957 Ga0436365_1412995 3300039437 Bacteria 975
958 Ga0436365_1505352 3300039437 Bacteria 3854
959 Ga0436360_0092664 3300039438 Bacteria 2317
960 Ga0436360_0289993 3300039438 Bacteria 871
961 Ga0436360_0314853 3300039438 Bacteria 6681
962 Ga0436360_0751338 3300039438 Bacteria 15392
963 Ga0436360_0800977 3300039438 Bacteria 1240
964 Ga0436360_1276686 3300039438 Bacteria 985
965 Ga0436361_0229945 3300039447 Bacteria 4611
966 Ga0436361_0391251 3300039447 Bacteria 3624
967 Ga0436361_0491334 3300039447 Bacteria 1304
968 Ga0436361_0573255 3300039447 Bacteria 11361
969 Ga0436361_0830107 3300039447 Bacteria 2406
970 Ga0436363_0329632 3300039450 Bacteria 694
971 Ga0436363_0643564 3300039450 Bacteria 1860
972 Ga0436363_0877282 3300039450 Bacteria 993
973 Ga0436363_1266422 3300039450 Bacteria 843
974 Ga0436363_1291996 3300039450 Bacteria 5612
975 Ga0436363_1400984 3300039450 Bacteria 4807
976 Ga0436363_1409784 3300039450 Bacteria 1274
977 Ga0436363_1420176 3300039450 Bacteria 778
978 Ga0436362_0487773 3300039453 Bacteria 3231
979 Ga0436362_0949954 3300039453 Bacteria 89092
980 Ga0436362_1231252 3300039453 Bacteria 895
981 Ga0439465_0039777 3300041413 Bacteria 1519
982 Ga0451791_0196258 3300041451 Bacteria 1180
983 Ga0451797_0142036 3300041453 Bacteria 1539
984 Ga0451802_1663335 3300041460 Bacteria 878
985 Ga0451841_0626317 3300041498 Bacteria 1782
986 Ga0451855_0157495 3300041511 Bacteria 1789
987 Ga0439442_025710 3300042002 Bacteria 1225
988 Ga0439449_0003421 3300042007 Bacteria 6176
989 Ga0439462_0130740 3300042015 Bacteria 701
990 Ga0450898_011683 3300042134 Bacteria 1442
991 Ga0439459_0003351 3300042438 Bacteria 2534
992 Ga0451577_0264940 3300042876 Bacteria 1556
993 Ga0466969_0012669 3300044656 Bacteria 4441
994 Ga0466969_0022851 3300044656 Bacteria 3225
995 Ga0466972_0000702 3300044658 Bacteria 16004
996 Ga0466972_0020059 3300044658 Bacteria 3342
997 Ga0466972_0028369 3300044658 Bacteria 2761
998 Ga0453683_0068854 3300044673 Bacteria 2212
999 Ga0466966_0257824 3300044684 Bacteria 1050
1000 Ga0466961_0000359 3300044693 Bacteria 29797
1001 Ga0466961_0452019 3300044693 Bacteria 777
1002 Ga0466963_0007691 3300044694 Bacteria 6436
1003 Ga0466963_0034178 3300044694 Bacteria 3307
1004 Ga0466963_0378839 3300044694 Bacteria 997
1005 Ga0466964_0146541 3300044706 Bacteria 1090
1006 Ga0466964_0148531 3300044706 Bacteria 1084
1007 Ga0466964_0350923 3300044706 Bacteria 758
1008 Ga0453684_0005307 3300044712 Bacteria 25693
1009 Ga0453684_0009814 3300044712 Bacteria 16591
1010 Ga0453684_0015205 3300044712 Bacteria 12208
1011 Ga0453684_0255034 3300044712 Bacteria 2012
1012 Ga0466968_0073219 3300044735 Bacteria 1494
1013 Ga0466968_0086161 3300044735 Bacteria 1386
1014 Ga0466968_0111331 3300044735 Bacteria 1231
1015 Ga0466970_0153259 3300044765 Bacteria 1273
1016 Ga0466970_0355302 3300044765 Bacteria 832
1017 Ga0466970_0389531 3300044765 Bacteria 794
1018 Ga0466970_0394039 3300044765 Bacteria 790
1019 Ga0466957_0158787 3300044842 Bacteria 1467
1020 Ga0466957_0624444 3300044842 Bacteria 756
1021 Ga0466959_0003116 3300045049 Bacteria 10755
1022 Ga0466959_0010713 3300045049 Bacteria 6566
1023 Ga0466959_0026644 3300045049 Bacteria 4285
1024 Ga0466959_0061588 3300045049 Bacteria 2728
1025 Ga0466959_0113172 3300045049 Bacteria 1935
1026 Ga0451576_0004179 3300045051 Bacteria 19003
1027 Ga0451576_0273966 3300045051 Bacteria 1764
1028 Ga0466958_0064331 3300045836 Bacteria 2237
1029 Ga0466958_0160788 3300045836 Bacteria 1419
1030 Ga0466958_0236623 3300045836 Bacteria 1167
1031 Ga0466958_0441706 3300045836 Bacteria 842
1032 Ga0466967_0000079 3300045976 Bacteria 34795
1033 Ga0466967_0282289 3300045976 Bacteria 1593
1034 Ga0466967_0438093 3300045976 Bacteria 1276
1035 Ga0495617_018456 3300046452 Bacteria 2359
1036 Ga0495617_055985 3300046452 Bacteria 1308
1037 Ga0495592_0358320 3300046454 Bacteria 933
1038 Ga0495603_0009099 3300046455 Bacteria 6004
1039 Ga0495603_0020396 3300046455 Bacteria 4017
1040 Ga0495603_0180948 3300046455 Bacteria 1220
1041 Ga0495590_0027387 3300046457 Bacteria 2000
1042 Ga0495590_0192929 3300046457 Bacteria 747
1043 Ga0495629_0099345 3300046459 Bacteria 2031
1044 Ga0495638_0000413 3300046460 Bacteria 52033
1045 Ga0495638_0000547 3300046460 Bacteria 42980
1046 Ga0495638_0005379 3300046460 Bacteria 9546
1047 Ga0495638_0009130 3300046460 Bacteria 6978
1048 Ga0495638_0200613 3300046460 Bacteria 1126
1049 Ga0495638_0315614 3300046460 Bacteria 837
1050 Ga0495641_0099339 3300046461 Bacteria 1299
1051 Ga0495651_0053435 3300046462 Bacteria 3110
1052 Ga0495651_0089752 3300046462 Bacteria 2306
1053 Ga0495651_0199099 3300046462 Bacteria 1403
1054 Ga0495651_0331429 3300046462 Bacteria 1011
1055 Ga0495653_0096827 3300046463 Bacteria 2145
1056 Ga0495650_0000020 3300046471 Bacteria 533839
1057 Ga0495580_0376078 3300046472 Bacteria 960
1058 Ga0495582_0304869 3300046473 Bacteria 916
1059 Ga0495605_0190260 3300046474 Bacteria 898
1060 Ga0495639_0058838 3300046475 Bacteria 1759
1061 Ga0495639_0090833 3300046475 Bacteria 1433
1062 Ga0495662_0093608 3300046476 Bacteria 1467
1063 Ga0495664_0017425 3300046477 Bacteria 4106
1064 Ga0495664_0075557 3300046477 Bacteria 2016
1065 Ga0495584_0102596 3300046491 Bacteria 1446
1066 Ga0495584_0196399 3300046491 Bacteria 1026
1067 Ga0495585_0043001 3300046492 Bacteria 2528
1068 Ga0495585_0164099 3300046492 Bacteria 1151
1069 Ga0495585_0194741 3300046492 Bacteria 1035
1070 Ga0495594_0032506 3300046499 Bacteria 2833
1071 Ga0495594_0182714 3300046499 Bacteria 1194
1072 Ga0495596_0036246 3300046500 Bacteria 1954
1073 Ga0495607_0047785 3300046501 Bacteria 2505
1074 Ga0495583_0000001 3300046506 Bacteria 811973
1075 Ga0495606_0010700 3300046507 Bacteria 7572
1076 Ga0495608_0078112 3300046511 Bacteria 2154
1077 Ga0495610_0000056 3300046512 Bacteria 138703
1078 Ga0495610_0004429 3300046512 Bacteria 10387
1079 Ga0495610_0005750 3300046512 Bacteria 8730
1080 Ga0495616_0000254 3300046513 Bacteria 43310
1081 Ga0495618_0110920 3300046514 Bacteria 1756
1082 Ga0495618_0115264 3300046514 Bacteria 1720
1083 Ga0495620_0066723 3300046515 Bacteria 1482
1084 Ga0495620_0072441 3300046515 Bacteria 1407
1085 Ga0495628_0162046 3300046516 Bacteria 1699
1086 Ga0495630_0726175 3300046517 Bacteria 760
1087 Ga0495631_0126324 3300046518 Bacteria 1099
1088 Ga0495631_0287262 3300046518 Bacteria 700
1089 Ga0495632_0001149 3300046519 Bacteria 22554
1090 Ga0495632_0007628 3300046519 Bacteria 6765
1091 Ga0495632_0175361 3300046519 Bacteria 983
1092 Ga0495632_0202204 3300046519 Bacteria 904
1093 Ga0495637_0070240 3300046520 Bacteria 1415
1094 Ga0495643_0014223 3300046522 Bacteria 4738
1095 Ga0495648_0000130 3300046524 Bacteria 88368
1096 Ga0495648_0019710 3300046524 Bacteria 4730
1097 Ga0495648_0266006 3300046524 Bacteria 820
1098 Ga0495663_0034886 3300046525 Bacteria 1509
1099 Ga0495663_0060364 3300046525 Bacteria 1191
1100 Ga0495666_0163109 3300046526 Bacteria 1033
1101 Ga0495652_0210660 3300046529 Bacteria 1467
1102 Ga0495652_0287465 3300046529 Bacteria 1201
1103 Ga0495654_0000010 3300046530 Bacteria 378481
1104 Ga0495640_0368059 3300046533 Bacteria 885
1105 Ga0495586_0014667 3300046535 Bacteria 4165
1106 Ga0495586_0104772 3300046535 Bacteria 1572
1107 Ga0495586_0152938 3300046535 Bacteria 1299
1108 Ga0495587_0006206 3300046536 Bacteria 7799
1109 Ga0495587_0031030 3300046536 Bacteria 3238
1110 Ga0495598_0048538 3300046537 Bacteria 1270
1111 Ga0495609_0087918 3300046538 Bacteria 1353
1112 Ga0495621_0005934 3300046539 Bacteria 3540
1113 Ga0495597_0137797 3300046542 Bacteria 1008
1114 Ga0495645_0040795 3300046543 Bacteria 3385
1115 Ga0495622_0005097 3300046557 Bacteria 6087
1116 Ga0495622_0035148 3300046557 Bacteria 2337
1117 Ga0495622_0149554 3300046557 Bacteria 1057
1118 Ga0495667_0010326 3300046559 Bacteria 6316
1119 Ga0495667_0080493 3300046559 Bacteria 2117
1120 Ga0495656_0180597 3300046615 Bacteria 1037
1121 Ga0495668_0000060 3300046616 Bacteria 193823
1122 Ga0495668_0004514 3300046616 Bacteria 9850
1123 Ga0495668_0033084 3300046616 Bacteria 2906
1124 Ga0495634_0085375 3300046642 Bacteria 2057
1125 Ga0495634_0270058 3300046642 Bacteria 1035
1126 Ga0495625_0000165 3300046660 Bacteria 102988
1127 Ga0495625_0001352 3300046660 Bacteria 30305
1128 Ga0495625_0004210 3300046660 Bacteria 13708
1129 Ga0495625_0016705 3300046660 Bacteria 5764
1130 Ga0495625_0048877 3300046660 Bacteria 3042
1131 Ga0495625_0427619 3300046660 Bacteria 822
1132 Ga0495635_0013096 3300046663 Bacteria 5805
1133 Ga0495661_0282195 3300046665 Bacteria 837
1134 Ga0495588_0117184 3300046674 Bacteria 1404
1135 Ga0495657_0025104 3300046675 Bacteria 4235
1136 Ga0495657_0042461 3300046675 Bacteria 3104
1137 Ga0495599_0009207 3300046678 Bacteria 6027
1138 Ga0495623_0029108 3300046679 Bacteria 3555
1139 Ga0495623_0069084 3300046679 Bacteria 2202
1140 Ga0495646_0038536 3300046680 Bacteria 2951
1141 Ga0495658_0149623 3300046683 Bacteria 1433
1142 Ga0495658_0184829 3300046683 Bacteria 1294
1143 Ga0495613_0058830 3300046689 Bacteria 2819
1144 Ga0495613_0210780 3300046689 Bacteria 1367
1145 Ga0495671_0149733 3300046692 Bacteria 1136
1146 Ga0495649_0233491 3300046694 Bacteria 949
1147 Ga0495589_0005117 3300046794 Bacteria 6938
1148 Ga0495600_0014837 3300046809 Bacteria 4914
1149 Ga0495660_0004395 3300046810 Bacteria 8538
1150 Ga0495660_0025337 3300046810 Bacteria 3370
1151 Ga0495660_0031813 3300046810 Bacteria 2965
1152 Ga0495660_0173136 3300046810 Bacteria 1050
1153 Ga0495581_0019611 3300047315 Bacteria 3925
1154 Ga0495581_0084750 3300047315 Bacteria 1837
1155 Ga0495604_0038890 3300047317 Bacteria 3742
1156 Ga0495604_0097241 3300047317 Bacteria 2171
1157 Ga0495604_0417937 3300047317 Bacteria 880
1158 Ga0495604_0645215 3300047317 Bacteria 676
1159 Ga0495636_0041867 3300047318 Bacteria 1902
1160 Ga0495636_0103030 3300047318 Bacteria 1250
1161 Ga0495674_0046939 3300047319 Bacteria 3832
1162 Ga0495674_0072008 3300047319 Bacteria 2982
1163 Ga0495674_0741919 3300047319 Bacteria 768
1164 Ga0495672_0001149 3300047320 Bacteria 26745
1165 Ga0495672_0018868 3300047320 Bacteria 4568
1166 Ga0495676_0027294 3300047321 Bacteria 4897
1167 Ga0495676_0139474 3300047321 Bacteria 1739
1168 Ga0495676_0201161 3300047321 Bacteria 1384
1169 Ga0495676_0400391 3300047321 Bacteria 911
1170 Ga0495680_0029995 3300047322 Bacteria 4446
1171 Ga0495680_0070345 3300047322 Bacteria 2668
1172 Ga0495683_0006700 3300047323 Bacteria 6274
1173 Ga0495683_0131317 3300047323 Bacteria 1181
1174 Ga0495687_064312 3300047443 Bacteria 1498
1175 Ga0495675_0002428 3300047444 Bacteria 11139
1176 Ga0495675_0046076 3300047444 Bacteria 2776
1177 Ga0495677_0133971 3300047445 Bacteria 949
1178 Ga0495679_004273 3300047446 Bacteria 6631
1179 Ga0495685_112874 3300047447 Bacteria 894
1180 Ga0495673_0000301 3300047469 Bacteria 66146
1181 Ga0495673_0000614 3300047469 Bacteria 35232
1182 Ga0495673_0000701 3300047469 Bacteria 32560
1183 Ga0495681_0013408 3300047470 Bacteria 4756
1184 Ga0495681_0080744 3300047470 Bacteria 1452
1185 Ga0495681_0112146 3300047470 Bacteria 1180
1186 Ga0495684_0024863 3300047471 Bacteria 4606
1187 Ga0495684_0146632 3300047471 Bacteria 1767
1188 Ga0495686_0000376 3300047472 Bacteria 71769
1189 Ga0495686_0033484 3300047472 Bacteria 3317
1190 Ga0495686_0037745 3300047472 Bacteria 3093
1191 Ga0495686_0046290 3300047472 Bacteria 2750
1192 Ga0495686_0058044 3300047472 Bacteria 2414
1193 Ga0495593_0051849 3300047673 Bacteria 2170
1194 Ga0495602_0378351 3300048088 Bacteria 1015
1195 Ga0495614_0033782 3300048089 Bacteria 2200
1196 Ga0495615_0010168 3300048090 Bacteria 1873
1197 Ga0495626_0049774 3300048091 Bacteria 1939
1198 Ga0496100_0005212 3300048903 Bacteria 6978
1199 Ga0496100_0100472 3300048903 Bacteria 1993
1200 Ga0496101_0032741 3300048904 Bacteria 3662
1201 Ga0496101_0051844 3300048904 Bacteria 2957
1202 Ga0496101_0227337 3300048904 Bacteria 1450
1203 Ga0496102_0017934 3300048905 Bacteria 6210
1204 Ga0496102_0043607 3300048905 Bacteria 4068
1205 Ga0496102_0078564 3300048905 Bacteria 3038
1206 Ga0496102_0165696 3300048905 Bacteria 2079
1207 Ga0496102_0326381 3300048905 Bacteria 1446
1208 Ga0496102_0499299 3300048905 Bacteria 1139
1209 Ga0496102_0591396 3300048905 Bacteria 1033
1210 Ga0496103_0042185 3300048906 Bacteria 2806
1211 Ga0496103_0056707 3300048906 Bacteria 2432
1212 Ga0496104_0002560 3300048907 Bacteria 15667
1213 Ga0496104_0006343 3300048907 Bacteria 10402
1214 Ga0496104_0138564 3300048907 Bacteria 2338
1215 Ga0496104_0216632 3300048907 Bacteria 1826
1216 Ga0496104_0351819 3300048907 Bacteria 1386
1217 Ga0496105_0002568 3300048908 Bacteria 13185
1218 Ga0496105_0014413 3300048908 Bacteria 6293
1219 Ga0496105_0031649 3300048908 Bacteria 4337
1220 Ga0496105_0056895 3300048908 Bacteria 3229
1221 Ga0496105_0065290 3300048908 Bacteria 3004
1222 Ga0496105_0210113 3300048908 Bacteria 1586
1223 Ga0496106_0004445 3300048909 Bacteria 10394
1224 Ga0496106_0005448 3300048909 Bacteria 9418
1225 Ga0496106_0033086 3300048909 Bacteria 3856
1226 Ga0496106_0144770 3300048909 Bacteria 1871
1227 Ga0496107_0000211 3300048910 Bacteria 30778
1228 Ga0496107_0001182 3300048910 Bacteria 15862
1229 Ga0496107_0196142 3300048910 Bacteria 1501
1230 Ga0496108_0001556 3300048911 Bacteria 18160
1231 Ga0496108_0100359 3300048911 Bacteria 2468
1232 Ga0496108_0174987 3300048911 Bacteria 1858
1233 Ga0496108_0474149 3300048911 Bacteria 1093
1234 Ga0496109_0008140 3300048912 Bacteria 8890
1235 Ga0496109_0046030 3300048912 Bacteria 3961
1236 Ga0496109_0056714 3300048912 Bacteria 3574
1237 Ga0496109_0072533 3300048912 Bacteria 3163
1238 Ga0496109_0075064 3300048912 Bacteria 3109
1239 Ga0496109_0871024 3300048912 Bacteria 838
1240 Ga0496110_0027742 3300048913 Bacteria 4856
1241 Ga0496110_0032238 3300048913 Bacteria 4524
1242 Ga0496110_0081598 3300048913 Bacteria 2883
1243 Ga0496110_0090518 3300048913 Bacteria 2735
1244 Ga0496110_0129477 3300048913 Bacteria 2278
1245 Ga0496110_0145899 3300048913 Bacteria 2140
1246 Ga0496110_0234555 3300048913 Bacteria 1669
1247 Ga0496110_0298129 3300048913 Bacteria 1468
1248 Ga0496111_0017225 3300048914 Bacteria 4993
1249 Ga0496111_0046620 3300048914 Bacteria 3121
1250 Ga0496111_0076688 3300048914 Bacteria 2437
1251 Ga0496111_0079711 3300048914 Bacteria 2389
1252 Ga0496111_0210340 3300048914 Bacteria 1445
1253 Ga0496112_0008955 3300048915 Bacteria 8988
1254 Ga0496112_0035225 3300048915 Bacteria 4874
1255 Ga0496112_0036828 3300048915 Bacteria 4773
1256 Ga0496112_0067117 3300048915 Bacteria 3540
1257 Ga0496112_0144015 3300048915 Bacteria 2352
1258 Ga0496112_0195870 3300048915 Bacteria 1981
1259 Ga0496113_0057299 3300048916 Bacteria 2928
1260 Ga0496113_0170495 3300048916 Bacteria 1723
1261 Ga0496113_0202783 3300048916 Bacteria 1577
1262 Ga0496113_0258680 3300048916 Bacteria 1390
1263 Ga0496114_0070196 3300048917 Bacteria 2942
1264 Ga0496114_0196330 3300048917 Bacteria 1767
1265 Ga0496114_1002146 3300048917 Bacteria 719
1266 Ga0496115_0001558 3300048918 Bacteria 16481
1267 Ga0496115_0017161 3300048918 Bacteria 5526
1268 Ga0496115_0040034 3300048918 Bacteria 3724
1269 Ga0496115_0069793 3300048918 Bacteria 2847
1270 Ga0496115_0080322 3300048918 Bacteria 2655
1271 Ga0496115_0112551 3300048918 Bacteria 2236
1272 Ga0496115_0122480 3300048918 Bacteria 2141
1273 Ga0496115_0157203 3300048918 Bacteria 1878
1274 Ga0496115_0202159 3300048918 Bacteria 1641
1275 Ga0496115_0525688 3300048918 Bacteria 948
1276 Ga0496115_0786886 3300048918 Bacteria 741
1277 Ga0496116_0002078 3300048919 Bacteria 21426
1278 Ga0496116_0093850 3300048919 Bacteria 1815
1279 Ga0496116_0164906 3300048919 Bacteria 1209
1280 Ga0496116_0225997 3300048919 Bacteria 954
1281 Ga0496117_0031706 3300048920 Bacteria 4030
1282 Ga0496117_0042985 3300048920 Bacteria 3292
1283 Ga0496117_0177496 3300048920 Bacteria 1229
1284 Ga0496117_0232876 3300048920 Bacteria 1017
1285 Ga0496117_0298802 3300048920 Bacteria 853
1286 Ga0496118_0004424 3300048921 Bacteria 16676
1287 Ga0496118_0047127 3300048921 Bacteria 3345
1288 Ga0496118_0138954 3300048921 Bacteria 1544
1289 Ga0496118_0243177 3300048921 Bacteria 1029
1290 Ga0496119_0017095 3300048922 Bacteria 5481
1291 Ga0496119_0034837 3300048922 Bacteria 3306
1292 Ga0496119_0061238 3300048922 Bacteria 2249
1293 Ga0496119_0074875 3300048922 Bacteria 1970
1294 Ga0496119_0194523 3300048922 Bacteria 1054
1295 Ga0496119_0198599 3300048922 Bacteria 1040
1296 Ga0496120_0005339 3300048923 Bacteria 10289
1297 Ga0496120_0098903 3300048923 Bacteria 1545
1298 Ga0496121_0000595 3300048924 Bacteria 67907
1299 Ga0496121_0005557 3300048924 Bacteria 16103
1300 Ga0496121_0015876 3300048924 Bacteria 7828
1301 Ga0496121_0019434 3300048924 Bacteria 6792
1302 Ga0496121_0061191 3300048924 Bacteria 3091
1303 Ga0496121_0095902 3300048924 Bacteria 2303
1304 Ga0496121_0117010 3300048924 Bacteria 2020
1305 Ga0496121_0147280 3300048924 Bacteria 1738
1306 Ga0496121_0183519 3300048924 Bacteria 1507
1307 Ga0496121_0340274 3300048924 Bacteria 1003
1308 Ga0496121_0433533 3300048924 Bacteria 852
1309 Ga0496121_0512225 3300048924 Bacteria 759
1310 Ga0496122_0011522 3300048925 Bacteria 8943
1311 Ga0496122_0068422 3300048925 Bacteria 2549
1312 Ga0496122_0084950 3300048925 Bacteria 2186
1313 Ga0496122_0145149 3300048925 Bacteria 1476
1314 Ga0496123_0032828 3300048926 Bacteria 3748
1315 Ga0496123_0169186 3300048926 Bacteria 1155
1316 Ga0496124_0002134 3300048927 Bacteria 26572
1317 Ga0496124_0014500 3300048927 Bacteria 7618
1318 Ga0496124_0040801 3300048927 Bacteria 4011
1319 Ga0496124_0077574 3300048927 Bacteria 2740
1320 Ga0496124_0085904 3300048927 Bacteria 2577
1321 Ga0496124_0218560 3300048927 Bacteria 1435
1322 Ga0496125_0001068 3300048928 Bacteria 42349
1323 Ga0496125_0001760 3300048928 Bacteria 30047
1324 Ga0496125_0021562 3300048928 Bacteria 6005
1325 Ga0496125_0022884 3300048928 Bacteria 5789
1326 Ga0496125_0029375 3300048928 Bacteria 4941
1327 Ga0496125_0033411 3300048928 Bacteria 4552
1328 Ga0496125_0449983 3300048928 Bacteria 738
1329 Ga0496126_0002896 3300048929 Bacteria 22378
1330 Ga0496126_0003088 3300048929 Bacteria 21536
1331 Ga0496126_0012315 3300048929 Bacteria 8775
1332 Ga0496126_0014870 3300048929 Bacteria 7851
1333 Ga0496126_0018069 3300048929 Bacteria 7004
1334 Ga0496126_0024977 3300048929 Bacteria 5760
1335 Ga0496126_0028712 3300048929 Bacteria 5297
1336 Ga0496126_0035078 3300048929 Bacteria 4704
1337 Ga0496126_0078078 3300048929 Bacteria 2934
1338 Ga0496126_0100566 3300048929 Bacteria 2530
1339 Ga0496126_0110727 3300048929 Bacteria 2392
1340 Ga0496126_0232148 3300048929 Bacteria 1545
1341 Ga0496126_0259281 3300048929 Bacteria 1446
1342 Ga0496126_0276906 3300048929 Bacteria 1391
1343 Ga0496126_0318425 3300048929 Bacteria 1279
1344 Ga0496126_0394044 3300048929 Bacteria 1125
1345 Ga0501306_002656 3300049127 Bacteria 1859
1346 Ga0501306_015137 3300049127 Bacteria 1024
1347 Ga0501309_003761 3300049129 Bacteria 1737
1348 Ga0501310_023956 3300049130 Bacteria 778
1349 Ga0501305_004290 3300049161 Bacteria 1669
1350 Ga0501307_002313 3300049162 Bacteria 1759
1351 Ga0495678_000623 3300049459 Bacteria 32947
1352 Ga0501291_022338 3300049514 Bacteria 1015
1353 Ga0501311_002113 3300049527 Bacteria 1858
1354 Ga0501312_004273 3300049528 Bacteria 1673
1355 Ga0501313_002650 3300049529 Bacteria 1713
1356 Ga0501313_023568 3300049529 Bacteria 772
1357 Ga0501314_001582 3300049530 Bacteria 1664
1358 Ga0501315_002874 3300049531 Bacteria 1672
1359 Ga0501316_002563 3300049532 Bacteria 1689
1360 Ga0501316_011126 3300049532 Bacteria 1033
1361 Ga0501316_025251 3300049532 Bacteria 772
1362 Ga0501317_002615 3300049533 Bacteria 1720
1363 Ga0501318_002206 3300049534 Bacteria 1657
1364 Ga0501319_000753 3300049535 Bacteria 1665
1365 Ga0501320_001493 3300049536 Bacteria 1733
1366 Ga0501321_002190 3300049537 Bacteria 1664
1367 Ga0501322_000622 3300049538 Bacteria 1736
1368 Ga0501323_003195 3300049539 Bacteria 1660
1369 Ga0501324_002767 3300049540 Bacteria 1297
1370 Ga0501326_00418 3300049542 Bacteria 1669
1371 Ga0501328_00536 3300049544 Bacteria 1310
1372 Ga0501330_001178 3300049546 Bacteria 1308
1373 Ga0501335_001915 3300049551 Bacteria 1650
1374 Ga0501335_007363 3300049551 Bacteria 1017
1375 Ga0501031_0017200 3300049568 Bacteria 4698
1376 Ga0501031_0162521 3300049568 Bacteria 1460
1377 Ga0501032_0013398 3300049569 Bacteria 5833
1378 Ga0501032_0086860 3300049569 Bacteria 2078
1379 Ga0501033_0020362 3300049570 Bacteria 5010
1380 Ga0501033_0239388 3300049570 Bacteria 1288
1381 Ga0501033_0510540 3300049570 Bacteria 831
1382 Ga0501034_0004953 3300049571 Bacteria 14656
1383 Ga0501034_0007894 3300049571 Bacteria 11307
1384 Ga0501034_0008566 3300049571 Bacteria 10796
1385 Ga0501034_0041632 3300049571 Bacteria 4648
1386 Ga0501034_0075309 3300049571 Bacteria 3383
1387 Ga0501034_0124591 3300049571 Bacteria 2562
1388 Ga0501034_0409286 3300049571 Bacteria 1278
1389 Ga0501034_0468117 3300049571 Bacteria 1176
1390 Ga0501036_0020290 3300049572 Bacteria 5582
1391 Ga0501036_0022138 3300049572 Bacteria 5346
1392 Ga0501036_0134376 3300049572 Bacteria 2088
1393 Ga0501037_0094135 3300049573 Bacteria 2166
1394 Ga0501038_0008634 3300049574 Bacteria 9354
1395 Ga0501038_0028009 3300049574 Bacteria 5006
1396 Ga0501038_0524637 3300049574 Bacteria 903
1397 Ga0501039_0014140 3300049575 Bacteria 6111
1398 Ga0501039_0045132 3300049575 Bacteria 3404
1399 Ga0501039_0372051 3300049575 Bacteria 1123
1400 Ga0501040_0023343 3300049576 Bacteria 4147
1401 Ga0501040_0577461 3300049576 Bacteria 812
1402 Ga0501041_0022151 3300049577 Bacteria 3804
1403 Ga0501041_0060877 3300049577 Bacteria 2311
1404 Ga0501042_0018622 3300049578 Bacteria 4810
1405 Ga0501043_0076813 3300049579 Bacteria 2624
1406 Ga0501043_0406978 3300049579 Bacteria 1027
1407 Ga0501046_0044421 3300049580 Bacteria 3534
1408 Ga0501047_0016648 3300049581 Bacteria 7020
1409 Ga0501047_0025791 3300049581 Bacteria 5652
1410 Ga0501047_0098304 3300049581 Bacteria 2805
1411 Ga0501047_0159512 3300049581 Bacteria 2128
1412 Ga0501047_0760205 3300049581 Bacteria 785
1413 Ga0501048_0005997 3300049582 Bacteria 9257
1414 Ga0501048_0287926 3300049582 Bacteria 1168
1415 Ga0501048_0404578 3300049582 Bacteria 976
1416 Ga0501067_0035265 3300049583 Bacteria 2777
1417 Ga0501068_0008913 3300049584 Bacteria 5599
1418 Ga0501068_0029708 3300049584 Bacteria 3239
1419 Ga0501068_0203967 3300049584 Bacteria 1254
1420 Ga0501070_0042082 3300049586 Bacteria 3804
1421 Ga0501070_0131811 3300049586 Bacteria 2064
1422 Ga0501070_0164392 3300049586 Bacteria 1829
1423 Ga0501070_0232842 3300049586 Bacteria 1509
1424 Ga0501070_0326087 3300049586 Bacteria 1248
1425 Ga0501071_0004678 3300049587 Bacteria 8697
1426 Ga0501072_0028077 3300049588 Bacteria 4393
1427 Ga0501072_0345439 3300049588 Bacteria 1182
1428 Ga0501072_0703885 3300049588 Bacteria 794
1429 Ga0501073_0003357 3300049589 Bacteria 12035
1430 Ga0501073_0039463 3300049589 Bacteria 3344
1431 Ga0501073_0165472 3300049589 Bacteria 1531
1432 Ga0501073_0642518 3300049589 Bacteria 732
1433 Ga0501074_0007721 3300049590 Bacteria 7791
1434 Ga0501074_0082232 3300049590 Bacteria 2310
1435 Ga0501074_0286036 3300049590 Bacteria 1172
1436 Ga0501075_0030276 3300049591 Bacteria 4008
1437 Ga0501075_0240906 3300049591 Bacteria 1379
1438 Ga0501075_0417521 3300049591 Bacteria 1023
1439 Ga0501076_0044414 3300049592 Bacteria 3504
1440 Ga0501076_0100948 3300049592 Bacteria 2325
1441 Ga0501076_0492937 3300049592 Bacteria 1010
1442 Ga0501077_0034231 3300049593 Bacteria 3233
1443 Ga0501077_0042563 3300049593 Bacteria 2887
1444 Ga0501077_0098574 3300049593 Bacteria 1852
1445 Ga0501077_0200672 3300049593 Bacteria 1267
1446 Ga0501217_024948 3300049661 Bacteria 1435
1447 Ga0501233_104893 3300049668 Bacteria 751
1448 Ga0501238_000691 3300049671 Bacteria 3785
1449 Ga0501252_005667 3300049682 Bacteria 1366
1450 Ga0501257_009500 3300049686 Bacteria 2198
1451 Ga0501221_014348 3300049704 Bacteria 1472
1452 Ga0501225_0137206 3300049705 Bacteria 737
1453 Ga0501234_039781 3300049707 Bacteria 768
1454 Ga0501079_0024961 3300049741 Bacteria 4585
1455 Ga0501079_0339216 3300049741 Bacteria 1177
1456 Ga0501079_0368598 3300049741 Bacteria 1126
1457 Ga0501079_0403762 3300049741 Bacteria 1072
1458 Ga0501080_0043101 3300049742 Bacteria 4201
1459 Ga0501080_0051362 3300049742 Bacteria 3836
1460 Ga0501080_0073546 3300049742 Bacteria 3180
1461 Ga0501080_0822946 3300049742 Bacteria 813
1462 Ga0501080_0879896 3300049742 Bacteria 782
1463 Ga0501081_0101801 3300049743 Bacteria 2031
1464 Ga0501081_0243872 3300049743 Bacteria 1310
1465 Ga0501081_0321787 3300049743 Bacteria 1137
1466 Ga0501083_0102703 3300049744 Bacteria 1885
1467 Ga0501083_0113618 3300049744 Bacteria 1779
1468 Ga0501275_005800 3300049772 Bacteria 1195
1469 Ga0501035_0179600 3300049822 Bacteria 1824
1470 Ga0501035_0254019 3300049822 Bacteria 1492
1471 Ga0501044_0029662 3300049823 Bacteria 5767
1472 Ga0501044_0121126 3300049823 Bacteria 2617
1473 Ga0501044_0521824 3300049823 Bacteria 1087
1474 Ga0501045_0061565 3300049824 Bacteria 2753
1475 nmdc:mga03683_206046_c1 3300050489 Bacteria 904
1476 nmdc:mga03683_2387_c1 3300050489 Bacteria 4040
1477 nmdc:mga03683_40737_c1 3300050489 Bacteria 1906
1478 nmdc:mga03n38_175383_c1 3300050490 Bacteria 1095
1479 nmdc:mga03n38_233742_c1 3300050490 Bacteria 965
1480 nmdc:mga03n38_351494_c1 3300050490 Bacteria 802
1481 nmdc:mga00v17_115272_c1 3300050491 Bacteria 1707
1482 nmdc:mga00v17_196424_c1 3300050491 Bacteria 1304
1483 nmdc:mga0yw44_104074_c1 3300050492 Bacteria 1811
1484 nmdc:mga0yw44_17493_c1 3300050492 Bacteria 3902
1485 nmdc:mga0yw44_24969_c1 3300050492 Bacteria 3391
1486 nmdc:mga0yw44_306479_c1 3300050492 Bacteria 1065
1487 nmdc:mga0yw44_35725_c1 3300050492 Bacteria 2923
1488 nmdc:mga0yw44_384153_c1 3300050492 Bacteria 948
1489 nmdc:mga0yw44_446360_c1 3300050492 Bacteria 876
1490 nmdc:mga0yw44_479903_c1 3300050492 Bacteria 843
1491 nmdc:mga0yw44_52947_c1 3300050492 Bacteria 2463
1492 nmdc:mga0k408_121808_c1 3300050493 Bacteria 1545
1493 nmdc:mga0k408_135362_c1 3300050493 Bacteria 1464
1494 nmdc:mga0k408_19861_c1 3300050493 Bacteria 3760
1495 nmdc:mga0k408_3517_c1 3300050493 Bacteria 8280
1496 nmdc:mga0k408_38074_c1 3300050493 Bacteria 2761
1497 nmdc:mga06z11_1558_c1 3300050494 Bacteria 8525
1498 nmdc:mga06z11_40602_c1 3300050494 Bacteria 2323
1499 nmdc:mga06z11_513382_c1 3300050494 Bacteria 726
1500 nmdc:mga04h51_135745_c1 3300050495 Bacteria 929
1501 nmdc:mga04h51_5029_c1 3300050495 Bacteria 3341
1502 nmdc:mga04h51_591_c1 3300050495 Bacteria 8655
1503 nmdc:mga07m45_146465_c1 3300050496 Bacteria 1369
1504 nmdc:mga07m45_328766_c1 3300050496 Bacteria 888
1505 nmdc:mga07m45_42731_c1 3300050496 Bacteria 2541
1506 nmdc:mga07m45_49433_c1 3300050496 Bacteria 2367
1507 nmdc:mga05p37_121329_c1 3300050507 Bacteria 3211
1508 nmdc:mga05p37_426432_c1 3300050507 Bacteria 1542
1509 nmdc:mga05p37_693088_c1 3300050507 Bacteria 1133
1510 nmdc:mga05p37_735416_c1 3300050507 Bacteria 1090
1511 nmdc:mga05p37_78589_c1 3300050507 Bacteria 4063
1512 nmdc:mga09592_226571_c1 3300050508 Bacteria 1619
1513 nmdc:mga09592_500131_c1 3300050508 Bacteria 1047
1514 nmdc:mga0qj67_218396_c1 3300050509 Bacteria 1548
1515 nmdc:mga0qj67_321467_c1 3300050509 Bacteria 1253
1516 nmdc:mga0qj67_7671_c1 3300050509 Bacteria 7973
1517 nmdc:mga06r32_238405_c1 3300050510 Bacteria 1807
1518 nmdc:mga06r32_34913_c1 3300050510 Bacteria 4744
1519 nmdc:mga06r32_423381_c1 3300050510 Bacteria 1313
1520 nmdc:mga06r32_873733_c1 3300050510 Bacteria 857
1521 nmdc:mga08y16_333484_c1 3300050511 Bacteria 1560
1522 nmdc:mga08y16_64120_c1 3300050511 Bacteria 3837
1523 nmdc:mga0n895_479443_c1 3300050512 Bacteria 1254
1524 nmdc:mga0rr50_326390_c1 3300050513 Bacteria 1287
1525 nmdc:mga0rr50_456314_c1 3300050513 Bacteria 1084
1526 nmdc:mga0a205_137912_c1 3300050515 Bacteria 2339
1527 nmdc:mga0a205_321426_c1 3300050515 Bacteria 1418
1528 nmdc:mga0sz30_151_c1 3300050516 Bacteria 25783
1529 nmdc:mga0sz30_23802_c1 3300050516 Bacteria 2495
1530 nmdc:mga0sz30_24447_c1 3300050516 Bacteria 2465
1531 nmdc:mga0sz30_9764_c1 3300050516 Bacteria 3659
1532 Ga0495601_0250123 3300053077 Bacteria 1158
1533 Ga0495601_0487686 3300053077 Bacteria 796
1534 Ga0495612_0017337 3300053078 Bacteria 2884
1535 Ga0495612_0138688 3300053078 Bacteria 1054
1536 Ga0500635_0176372 3300053080 Bacteria 824
1537 Ga0495595_0122373 3300053084 Bacteria 1268
1538 Ga0495619_0051692 3300053085 Bacteria 2716
1539 Ga0495619_0171202 3300053085 Bacteria 1502
1540 Ga0495619_0212571 3300053085 Bacteria 1339
1541 Ga0500578_0000809 3300053086 Bacteria 36418
1542 Ga0500578_0114986 3300053086 Bacteria 1694
1543 Ga0500578_0186426 3300053086 Bacteria 1276
1544 Ga0500643_000185 3300053087 Bacteria 60228
1545 Ga0500643_044642 3300053087 Bacteria 1287
1546 Ga0500644_0000046 3300053088 Bacteria 73850
1547 Ga0500644_0001130 3300053088 Bacteria 7816
1548 Ga0500647_0080260 3300053091 Bacteria 1565
1549 Ga0500583_0008495 3300053092 Bacteria 3688
1550 Ga0500583_0304967 3300053092 Bacteria 779
1551 Ga0500651_0012726 3300053093 Bacteria 5105
1552 Ga0500651_0031021 3300053093 Bacteria 3365
1553 Ga0500651_0312749 3300053093 Bacteria 899
1554 Ga0500651_0395386 3300053093 Bacteria 777
1555 Ga0500566_0000352 3300053094 Bacteria 24987
1556 Ga0500566_0002819 3300053094 Bacteria 10353
1557 Ga0500566_0002995 3300053094 Bacteria 10086
1558 Ga0500640_014140 3300053095 Bacteria 3317
1559 Ga0500640_031872 3300053095 Bacteria 2312
1560 Ga0500641_0002113 3300053096 Bacteria 7042
1561 Ga0500554_015008 3300053102 Bacteria 2012
1562 Ga0500556_0015525 3300053104 Bacteria 2351
1563 Ga0500557_000017 3300053105 Bacteria 96699
1564 Ga0500557_015493 3300053105 Bacteria 2062
1565 Ga0500562_000358 3300053108 Bacteria 10999
1566 Ga0500562_069680 3300053108 Bacteria 948
1567 Ga0500569_066247 3300053109 Bacteria 1127
1568 Ga0500572_000236 3300053111 Bacteria 19616
1569 Ga0500572_001411 3300053111 Bacteria 6595
1570 Ga0500572_077539 3300053111 Bacteria 1036
1571 Ga0500591_048217 3300053115 Bacteria 2003
1572 Ga0500594_0000012 3300053118 Bacteria 81832
1573 Ga0500594_0104344 3300053118 Bacteria 876
1574 Ga0500595_000003 3300053119 Bacteria 419332
1575 Ga0500595_002159 3300053119 Bacteria 10004
1576 Ga0500595_005559 3300053119 Bacteria 5492
1577 Ga0500595_016779 3300053119 Bacteria 2720
1578 Ga0500595_034990 3300053119 Bacteria 1658
1579 Ga0500607_054913 3300053121 Bacteria 2107
1580 Ga0500608_000012 3300053122 Bacteria 91378
1581 Ga0500608_110921 3300053122 Bacteria 1257
1582 Ga0500608_141294 3300053122 Bacteria 1067
1583 Ga0500614_002014 3300053123 Bacteria 4647
1584 Ga0500618_000493 3300053125 Bacteria 25278
1585 Ga0500618_097150 3300053125 Bacteria 663
1586 Ga0500642_0000181 3300053130 Bacteria 26074
1587 Ga0500642_0010289 3300053130 Bacteria 3292
1588 Ga0500655_016438 3300053133 Bacteria 1363
1589 Ga0500655_034636 3300053133 Bacteria 980
1590 Ga0500658_0003891 3300053134 Bacteria 5617
1591 Ga0500658_0044644 3300053134 Bacteria 1789
1592 Ga0500559_0000045 3300053136 Bacteria 99550
1593 Ga0500559_0000154 3300053136 Bacteria 54106
1594 Ga0500559_0002554 3300053136 Bacteria 9338
1595 Ga0500559_0003634 3300053136 Bacteria 7545
1596 Ga0500559_0004656 3300053136 Bacteria 6465
1597 Ga0500559_0008891 3300053136 Bacteria 4374
1598 Ga0500564_002954 3300053138 Bacteria 6452
1599 Ga0500573_0020144 3300053140 Bacteria 3819
1600 Ga0500573_0226628 3300053140 Bacteria 977
1601 Ga0500577_0006581 3300053142 Bacteria 3216
1602 Ga0500589_142113 3300053147 Bacteria 988
1603 Ga0500590_110123 3300053148 Bacteria 1308
1604 Ga0500603_000776 3300053150 Bacteria 7663
1605 Ga0500604_0031763 3300053151 Bacteria 1552
1606 Ga0500604_0032434 3300053151 Bacteria 1539
1607 Ga0500616_0000404 3300053153 Bacteria 59183
1608 Ga0500616_0135878 3300053153 Bacteria 1155
1609 Ga0500622_0000516 3300053156 Bacteria 35933
1610 Ga0500622_0011169 3300053156 Bacteria 4902
1611 Ga0500622_0024238 3300053156 Bacteria 3209
1612 Ga0500622_0028564 3300053156 Bacteria 2936
1613 Ga0500622_0090340 3300053156 Bacteria 1520
1614 Ga0500627_0011498 3300053158 Bacteria 3273
1615 Ga0500627_0055449 3300053158 Bacteria 1735
1616 Ga0500627_0166730 3300053158 Bacteria 993
1617 Ga0500630_005483 3300053159 Bacteria 6193
1618 Ga0500638_156108 3300053162 Bacteria 1009
1619 Ga0500639_000014 3300053163 Bacteria 122926
1620 Ga0500639_050399 3300053163 Bacteria 2169
1621 Ga0500639_123797 3300053163 Bacteria 1237
1622 Ga0500639_127709 3300053163 Bacteria 1210
1623 Ga0500636_0000343 3300053177 Bacteria 25663
1624 Ga0500636_0044785 3300053177 Bacteria 2609
1625 Ga0500636_0192202 3300053177 Bacteria 1086
1626 Ga0500637_0000189 3300053178 Bacteria 22957
1627 Ga0500645_000226 3300053730 Bacteria 42982
1628 Ga0500645_000517 3300053730 Bacteria 25761
1629 Ga0500645_007179 3300053730 Bacteria 3905
1630 Ga0500609_002886 3300053731 Bacteria 2448
1631 Ga0500609_003154 3300053731 Bacteria 2335
1632 Ga0500552_000284 3300053733 Bacteria 4613
1633 Ga0500596_000316 3300053735 Bacteria 8629
1634 Ga0500596_002168 3300053735 Bacteria 3895
1635 Ga0500596_009060 3300053735 Bacteria 1565
1636 Ga0500601_000248 3300053737 Bacteria 10437
1637 Ga0501084_0003455 3300054114 Bacteria 12831
1638 Ga0501084_0068639 3300054114 Bacteria 2967
1639 Ga0501084_0130720 3300054114 Bacteria 2114
1640 Ga0501084_0506416 3300054114 Bacteria 1020
1641 Ga0500661_000533 3300055283 Bacteria 7073
1642 Ga0587082_009854 3300059504 Bacteria 1365
1643 Ga0587079_000097 3300059647 Bacteria 5387
1644 Ga0501082_0030220 3300060353 Bacteria 4669
1645 Ga0501082_0083794 3300060353 Bacteria 2750
1646 Ga0501082_0355097 3300060353 Bacteria 1278
1647 Ga0501082_0861408 3300060353 Bacteria 793
1648 Ga0530510_0016121 3300061734 Bacteria 5284
1649 Ga0530510_0151867 3300061734 Bacteria 1710
1650 Ga0530510_0869168 3300061734 Bacteria 689

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0329632 Ga0436363_0329632_95_640 176
2 3300046519 Ga0495632_0175361 Ga0495632_0175361_359_958 199
3 3300053093 Ga0500651_0395386 Ga0500651_0395386_11_610 199
4 iso_pu_bacteria 2515154155 2515853698 203
5 iso_pu_bacteria 2675903058 2676474242 203
6 iso_pu_bacteria 2827628540 2827633289 203
7 3300005434 Ga0070709_10273246 Ga0070709_102732462 205
8 3300005435 Ga0070714_100199734 Ga0070714_1001997343 205
9 3300005436 Ga0070713_100158262 Ga0070713_1001582621 205
10 3300025929 Ga0207664_10022969 Ga0207664_100229696 205
11 iso_pu_bacteria 2510917020 2511120963 205
12 iso_pu_bacteria 2582581279 2585147041 205
13 iso_pu_bacteria 2582581280 2585150470 205
14 iso_pu_bacteria 2582581293 2585197661 205
15 iso_pu_bacteria 2643221545 2643750922 205
16 iso_pu_bacteria 2643221552 2643779023 205
17 iso_pu_bacteria 2643221583 2643925793 205
18 iso_pu_bacteria 2643221691 2644509995 205
19 iso_pu_bacteria 2818991435 2819539758 205
20 iso_pu_bacteria 2818991454 2819646943 205
21 iso_pu_bacteria 2857504554 2857504738 205
22 iso_pu_bacteria 2884960567 2884965258 205
23 iso_pu_bacteria 2928531327 2928532766 205
24 3300005327 Ga0070658_10125909 Ga0070658_101259093 206
25 3300005339 Ga0070660_100043834 Ga0070660_1000438342 206
26 3300005347 Ga0070668_100457117 Ga0070668_1004571172 206
27 3300005530 Ga0070679_100362827 Ga0070679_1003628271 206
28 3300005530 Ga0070679_100629788 Ga0070679_1006297881 206
29 3300005563 Ga0068855_100006563 Ga0068855_1000065632 206
30 3300005616 Ga0068852_100090825 Ga0068852_1000908252 206
31 3300005937 Ga0081455_10000030 Ga0081455_1000003074 206
32 3300009093 Ga0105240_10041457 Ga0105240_100414576 206
33 3300013104 Ga0157370_10011426 Ga0157370_1001142610 206
34 3300013105 Ga0157369_10064374 Ga0157369_100643746 206
35 3300021377 Ga0213874_10097772 Ga0213874_100977721 206
36 3300025913 Ga0207695_10056087 Ga0207695_100560876 206
37 3300025921 Ga0207652_10049918 Ga0207652_100499182 206
38 3300025921 Ga0207652_10291879 Ga0207652_102918792 206
39 3300025949 Ga0207667_10118681 Ga0207667_101186811 206
40 3300026142 Ga0207698_10074343 Ga0207698_100743432 206
41 3300032168 Ga0316593_10040228 Ga0316593_100402283 206
42 3300033524 Ga0316592_1016208 Ga0316592_10162083 206
43 3300037418 Ga0395900_0022962 Ga0395900_0022962_4088_4729 206
44 3300037466 Ga0395898_0016065 Ga0395898_0016065_797_1438 206
45 3300038443 Ga0395901_0025446 Ga0395901_0025446_366_1007 206
46 3300039062 Ga0400483_035464 Ga0400483_035464_2784_3404 206
47 3300039450 Ga0436363_0643564 Ga0436363_0643564_1196_1846 206
48 3300044712 Ga0453684_0005307 Ga0453684_0005307_17350_18000 206
49 3300046535 Ga0495586_0014667 Ga0495586_0014667_2789_3409 206
50 3300049586 Ga0501070_0131811 Ga0501070_0131811_478_1161 206
51 3300049586 Ga0501070_0232842 Ga0501070_0232842_473_1120 206
52 3300049590 Ga0501074_0082232 Ga0501074_0082232_63_746 206
53 3300049742 Ga0501080_0073546 Ga0501080_0073546_227_910 206
54 3300049742 Ga0501080_0822946 Ga0501080_0822946_15_656 206
55 iso_pu_bacteria 2508501128 2509147050 206
56 iso_pu_bacteria 2513237141 2513887562 206
57 iso_pu_bacteria 2857591370 2857595444 206
58 iso_pu_bacteria 2885374607 2885376627 206
59 iso_pu_bacteria 2922425934 2922433817 206
60 iso_pu_bacteria 3005506211 3005511331 206
61 iso_pu_bacteria 8019555841 8019562924 206
62 iso_pu_bacteria 8019565922 8019573003 206
63 3300014326 Ga0157380_10032373 Ga0157380_100323734 207
64 3300032133 Ga0316583_10060288 Ga0316583_100602881 207
65 3300035398 Ga0316574_0291335 Ga0316574_0291335_245_874 207
66 3300036712 Ga0316584_0208416 Ga0316584_0208416_647_1279 207
67 iso_pu_bacteria 2507262055 2507511202 207
68 iso_pu_bacteria 2508501009 2508545012 207
69 iso_pu_bacteria 2508501042 2508693749 207
70 iso_pu_bacteria 2511231028 2511394627 207
71 iso_pu_bacteria 2513237092 2513623644 207
72 iso_pu_bacteria 2513237094 2513637287 207
73 iso_pu_bacteria 2513237095 2513650839 207
74 iso_pu_bacteria 2513237102 2513704927 207
75 iso_pu_bacteria 2513237104 2513719668 207
76 iso_pu_bacteria 2513237139 2513874826 207
77 iso_pu_bacteria 2513237161 2514010451 207
78 iso_pu_bacteria 2515154112 2515625230 207
79 iso_pu_bacteria 2517093001 2517100784 207
80 iso_pu_bacteria 2524023205 2524438005 207
81 iso_pu_bacteria 2528768022 2528849189 207
82 iso_pu_bacteria 2595698237 2596373409 207
83 iso_pu_bacteria 2617270735 2617350548 207
84 iso_pu_bacteria 2617270741 2617373326 207
85 iso_pu_bacteria 2667528175 2671122013 207
86 iso_pu_bacteria 2744054633 2745081037 207
87 iso_pu_bacteria 2791355196 2793061848 207
88 iso_pu_bacteria 2791355197 2793068988 207
89 iso_pu_bacteria 2802429603 2805916827 207
90 iso_pu_bacteria 2816332527 2818238347 207
91 iso_pu_bacteria 2824600985 2824603939 207
92 iso_pu_bacteria 2824609381 2824611520 207
93 iso_pu_bacteria 2824617872 2824622518 207
94 iso_pu_bacteria 2824626560 2824630302 207
95 iso_pu_bacteria 2824635225 2824640034 207
96 iso_pu_bacteria 2824644064 2824652050 207
97 iso_pu_bacteria 2824653114 2824655456 207
98 iso_pu_bacteria 2824661429 2824663322 207
99 iso_pu_bacteria 2824671348 2824673592 207
100 iso_pu_bacteria 2824679649 2824680962 207
101 iso_pu_bacteria 2824687955 2824690285 207
102 iso_pu_bacteria 2824696289 2824698644 207
103 iso_pu_bacteria 2824704595 2824707134 207
104 iso_pu_bacteria 2824714736 2824722473 207
105 iso_pu_bacteria 2824723954 2824732144 207
106 iso_pu_bacteria 2824732956 2824737347 207
107 iso_pu_bacteria 2824746037 2824747658 207
108 iso_pu_bacteria 2824753945 2824754550 207
109 iso_pu_bacteria 2824763712 2824765404 207
110 iso_pu_bacteria 2824773399 2824773502 207
111 iso_pu_bacteria 2838122688 2838129107 207
112 iso_pu_bacteria 2841941048 2841943376 207
113 iso_pu_bacteria 2841949485 2841953896 207
114 iso_pu_bacteria 2841957949 2841962077 207
115 iso_pu_bacteria 2841966195 2841967987 207
116 iso_pu_bacteria 2841974524 2841981242 207
117 iso_pu_bacteria 2841983080 2841990350 207
118 iso_pu_bacteria 2842038055 2842042517 207
119 iso_pu_bacteria 2842045827 2842050560 207
120 iso_pu_bacteria 2844315083 2844316722 207
121 iso_pu_bacteria 2847930680 2847938745 207
122 iso_pu_bacteria 2847939898 2847944058 207
123 iso_pu_bacteria 2849076700 2849081727 207
124 iso_pu_bacteria 2857509624 2857512378 207
125 iso_pu_bacteria 2874590934 2874597937 207
126 iso_pu_bacteria 2874612657 2874619749 207
127 iso_pu_bacteria 2874620515 2874626219 207
128 iso_pu_bacteria 2874628541 2874631424 207
129 iso_pu_bacteria 2874645413 2874651465 207
130 iso_pu_bacteria 2876761206 2876763059 207
131 iso_pu_bacteria 2876771140 2876776537 207
132 iso_pu_bacteria 2876808645 2876817587 207
133 iso_pu_bacteria 2876818435 2876824873 207
134 iso_pu_bacteria 2879074833 2879081600 207
135 iso_pu_bacteria 2879083081 2879088281 207
136 iso_pu_bacteria 2879099564 2879109010 207
137 iso_pu_bacteria 2879110137 2879116255 207
138 iso_pu_bacteria 2879127579 2879134225 207
139 iso_pu_bacteria 2879142872 2879145863 207
140 iso_pu_bacteria 2881364244 2881365899 207
141 iso_pu_bacteria 2881665667 2881667455 207
142 iso_pu_bacteria 2885366525 2885366746 207
143 iso_pu_bacteria 2885409591 2885410560 207
144 iso_pu_bacteria 2888378607 2888381329 207
145 iso_pu_bacteria 2888388044 2888389311 207
146 iso_pu_bacteria 2888419890 2888421748 207
147 iso_pu_bacteria 2889306138 2889307853 207
148 iso_pu_bacteria 2902405164 2902406886 207
149 iso_pu_bacteria 2903727486 2903733777 207
150 iso_pu_bacteria 2903748898 2903750268 207
151 iso_pu_bacteria 2904666416 2904669237 207
152 iso_pu_bacteria 2904690495 2904691819 207
153 iso_pu_bacteria 2904711408 2904712544 207
154 iso_pu_bacteria 2906602504 2906608039 207
155 iso_pu_bacteria 2906626472 2906630741 207
156 iso_pu_bacteria 2906643746 2906648546 207
157 iso_pu_bacteria 2908739725 2908741366 207
158 iso_pu_bacteria 2908756301 2908763926 207
159 iso_pu_bacteria 2908775508 2908781784 207
160 iso_pu_bacteria 2922368715 2922370976 207
161 iso_pu_bacteria 2922393267 2922401188 207
162 iso_pu_bacteria 2928125067 2928127065 207
163 iso_pu_bacteria 2929615660 2929619373 207
164 iso_pu_bacteria 2929624759 2929628157 207
165 iso_pu_bacteria 2932784394 2932785672 207
166 iso_pu_bacteria 2932794094 2932799098 207
167 iso_pu_bacteria 2932801729 2932808486 207
168 iso_pu_bacteria 2932809354 2932813737 207
169 iso_pu_bacteria 2932818245 2932822295 207
170 iso_pu_bacteria 2932828146 2932830736 207
171 iso_pu_bacteria 2933577622 2933581293 207
172 iso_pu_bacteria 2935608549 2935612567 207
173 iso_pu_bacteria 2935616580 2935620783 207
174 iso_pu_bacteria 2935630451 2935635636 207
175 iso_pu_bacteria 2935638405 2935639862 207
176 iso_pu_bacteria 2935648319 2935653535 207
177 iso_pu_bacteria 2935656913 2935662284 207
178 iso_pu_bacteria 2935665750 2935667284 207
179 iso_pu_bacteria 2935675223 2935677638 207
180 iso_pu_bacteria 2935684952 2935690423 207
181 iso_pu_bacteria 2935694250 2935697253 207
182 iso_pu_bacteria 2935703347 2935705040 207
183 iso_pu_bacteria 2935713505 2935717881 207
184 iso_pu_bacteria 2935722832 2935726969 207
185 iso_pu_bacteria 2935732158 2935735739 207
186 iso_pu_bacteria 2935741537 2935744990 207
187 iso_pu_bacteria 2935750917 2935755433 207
188 iso_pu_bacteria 2935760218 2935762059 207
189 iso_pu_bacteria 2935769743 2935776125 207
190 iso_pu_bacteria 2935777560 2935781958 207
191 iso_pu_bacteria 2935785616 2935791982 207
192 iso_pu_bacteria 2935793552 2935800368 207
193 iso_pu_bacteria 2935801545 2935803558 207
194 iso_pu_bacteria 2935810662 2935811478 207
195 iso_pu_bacteria 2935819856 2935824056 207
196 iso_pu_bacteria 2935827899 2935829345 207
197 iso_pu_bacteria 2935837841 2935842677 207
198 iso_pu_bacteria 2935847175 2935852797 207
199 iso_pu_bacteria 2935855204 2935858591 207
200 iso_pu_bacteria 2935864058 2935866988 207
201 iso_pu_bacteria 2935873716 2935877118 207
202 iso_pu_bacteria 2935883170 2935884687 207
203 iso_pu_bacteria 2935908558 2935912052 207
204 iso_pu_bacteria 2935916978 2935922263 207
205 iso_pu_bacteria 2935926038 2935929081 207
206 iso_pu_bacteria 2935934488 2935935712 207
207 iso_pu_bacteria 2935942939 2935947278 207
208 iso_pu_bacteria 2935951376 2935953628 207
209 iso_pu_bacteria 2935967501 2935968654 207
210 iso_pu_bacteria 2935975950 2935976860 207
211 iso_pu_bacteria 2935984226 2935986178 207
212 iso_pu_bacteria 2935992306 2935995246 207
213 iso_pu_bacteria 2936002035 2936004133 207
214 iso_pu_bacteria 2936011229 2936016586 207
215 iso_pu_bacteria 2936019824 2936025100 207
216 iso_pu_bacteria 2936028420 2936034061 207
217 iso_pu_bacteria 2936037263 2936038060 207
218 iso_pu_bacteria 2936046547 2936051999 207
219 iso_pu_bacteria 2936055302 2936059772 207
220 iso_pu_bacteria 2940556831 2940561286 207
221 iso_pu_bacteria 2941507105 2941509285 207
222 iso_pu_bacteria 2941515067 2941517114 207
223 iso_pu_bacteria 2941523033 2941524791 207
224 iso_pu_bacteria 2941531003 2941533511 207
225 iso_pu_bacteria 2941538514 2941544476 207
226 iso_pu_bacteria 3005474847 3005475418 207
227 iso_pu_bacteria 3005483717 3005487535 207
228 iso_pu_bacteria 3005587118 3005592892 207
229 iso_pu_bacteria 3005594810 3005596335 207
230 iso_pu_bacteria 3005710791 3005712412 207
231 iso_pu_bacteria 3005718088 3005719489 207
232 iso_pu_bacteria 8006926726 8006927705 207
233 iso_pu_bacteria 8016511872 8016516669 207
234 iso_pu_bacteria 8016530956 8016537594 207
235 iso_pu_bacteria 8016539877 8016541864 207
236 iso_pu_bacteria 8016548790 8016551414 207
237 iso_pu_bacteria 8016557553 8016559798 207
238 iso_pu_bacteria 8016566248 8016567246 207
239 iso_pu_bacteria 8016575299 8016579962 207
240 iso_pu_bacteria 8016595262 8016597742 207
241 iso_pu_bacteria 8016603502 8016604571 207
242 iso_pu_bacteria 8016613128 8016620438 207
243 iso_pu_bacteria 8016622563 8016629534 207
244 iso_pu_bacteria 8016630954 8016637864 207
245 iso_pu_bacteria 8017057580 8017059886 207
246 iso_pu_bacteria 8019530166 8019537269 207
247 iso_pu_bacteria 8019538911 8019538982 207
248 iso_pu_bacteria 8019547302 8019548472 207
249 iso_pu_bacteria 8019576017 8019579376 207
250 iso_pu_bacteria 8019586578 8019597434 207
251 iso_pu_bacteria 8019597564 8019604252 207
252 iso_pu_bacteria 8019619141 8019624931 207
253 iso_pu_bacteria 8019629233 8019637255 207
254 iso_pu_bacteria 8019659431 8019665111 207
255 iso_pu_bacteria 8019668869 8019674643 207
256 iso_pu_bacteria 8019678201 8019681457 207
257 iso_pu_bacteria 8019687851 8019694323 207
258 iso_pu_bacteria 8055742211 8055749370 207
259 iso_pu_bacteria 8056967851 8056973619 207
260 3300005328 Ga0070676_10035897 Ga0070676_100358972 208
261 3300005334 Ga0068869_100066713 Ga0068869_1000667132 208
262 3300005340 Ga0070689_100425995 Ga0070689_1004259952 208
263 3300005353 Ga0070669_100053105 Ga0070669_1000531052 208
264 3300005355 Ga0070671_100022475 Ga0070671_1000224752 208
265 3300005356 Ga0070674_100262803 Ga0070674_1002628032 208
266 3300005364 Ga0070673_100189089 Ga0070673_1001890892 208
267 3300005365 Ga0070688_100061005 Ga0070688_1000610053 208
268 3300005367 Ga0070667_100232058 Ga0070667_1002320582 208
269 3300005435 Ga0070714_100012241 Ga0070714_1000122417 208
270 3300005436 Ga0070713_100609120 Ga0070713_1006091202 208
271 3300005441 Ga0070700_100256182 Ga0070700_1002561822 208
272 3300005456 Ga0070678_100273035 Ga0070678_1002730352 208
273 3300005456 Ga0070678_100535734 Ga0070678_1005357341 208
274 3300005459 Ga0068867_100474525 Ga0068867_1004745252 208
275 3300005466 Ga0070685_10235950 Ga0070685_102359501 208
276 3300005543 Ga0070672_100010425 Ga0070672_1000104253 208
277 3300005543 Ga0070672_100300343 Ga0070672_1003003431 208
278 3300005549 Ga0070704_100645549 Ga0070704_1006455491 208
279 3300005617 Ga0068859_100295661 Ga0068859_1002956611 208
280 3300005618 Ga0068864_100024785 Ga0068864_1000247852 208
281 3300005718 Ga0068866_10055550 Ga0068866_100555501 208
282 3300005719 Ga0068861_100490585 Ga0068861_1004905851 208
283 3300005840 Ga0068870_10039834 Ga0068870_100398342 208
284 3300005841 Ga0068863_100022184 Ga0068863_1000221842 208
285 3300005842 Ga0068858_100047990 Ga0068858_1000479903 208
286 3300005843 Ga0068860_100498547 Ga0068860_1004985471 208
287 3300006173 Ga0070716_100567026 Ga0070716_1005670262 208
288 3300006237 Ga0097621_100005209 Ga0097621_1000052091 208
289 3300006358 Ga0068871_100005755 Ga0068871_1000057555 208
290 3300006358 Ga0068871_100053750 Ga0068871_1000537502 208
291 3300006931 Ga0097620_100295664 Ga0097620_1002956642 208
292 3300009176 Ga0105242_10075288 Ga0105242_100752883 208
293 3300009177 Ga0105248_10855041 Ga0105248_108550411 208
294 3300013297 Ga0157378_10248316 Ga0157378_102483162 208
295 3300013306 Ga0163162_10268551 Ga0163162_102685512 208
296 3300013308 Ga0157375_10751337 Ga0157375_107513371 208
297 3300014325 Ga0163163_10010656 Ga0163163_100106565 208
298 3300014326 Ga0157380_10156702 Ga0157380_101567022 208
299 3300014968 Ga0157379_10077606 Ga0157379_100776062 208
300 3300014969 Ga0157376_10413471 Ga0157376_104134712 208
301 3300014969 Ga0157376_10455855 Ga0157376_104558551 208
302 3300017792 Ga0163161_10257439 Ga0163161_102574392 208
303 3300021358 Ga0213873_10028827 Ga0213873_100288272 208
304 3300021377 Ga0213874_10032374 Ga0213874_100323742 208
305 3300021384 Ga0213876_10045989 Ga0213876_100459893 208
306 3300021441 Ga0213871_10009471 Ga0213871_100094711 208
307 3300025253 Ga0209677_100240 Ga0209677_10024046 208
308 3300025254 Ga0209148_1006744 Ga0209148_10067442 208
309 3300025272 Ga0209455_1001056 Ga0209455_100105620 208
310 3300025907 Ga0207645_10081161 Ga0207645_100811612 208
311 3300025908 Ga0207643_10002912 Ga0207643_100029125 208
312 3300025911 Ga0207654_10280216 Ga0207654_102802162 208
313 3300025916 Ga0207663_10050440 Ga0207663_100504401 208
314 3300025923 Ga0207681_10067633 Ga0207681_100676332 208
315 3300025926 Ga0207659_10247417 Ga0207659_102474172 208
316 3300025928 Ga0207700_10398544 Ga0207700_103985442 208
317 3300025928 Ga0207700_10536225 Ga0207700_105362251 208
318 3300025929 Ga0207664_10001459 Ga0207664_1000145920 208
319 3300025931 Ga0207644_10024786 Ga0207644_100247862 208
320 3300025936 Ga0207670_10223272 Ga0207670_102232722 208
321 3300025937 Ga0207669_10038820 Ga0207669_100388201 208
322 3300025940 Ga0207691_10256370 Ga0207691_102563702 208
323 3300025942 Ga0207689_10009368 Ga0207689_100093687 208
324 3300026023 Ga0207677_10217399 Ga0207677_102173992 208
325 3300026075 Ga0207708_10060761 Ga0207708_100607612 208
326 3300026088 Ga0207641_10093443 Ga0207641_100934432 208
327 3300026088 Ga0207641_10250050 Ga0207641_102500502 208
328 3300026089 Ga0207648_10010728 Ga0207648_100107283 208
329 3300026095 Ga0207676_10076218 Ga0207676_100762183 208
330 3300026116 Ga0207674_10827632 Ga0207674_108276322 208
331 3300026118 Ga0207675_100007528 Ga0207675_1000075283 208
332 3300026121 Ga0207683_10056099 Ga0207683_100560991 208
333 3300026121 Ga0207683_10516764 Ga0207683_105167641 208
334 3300031247 Ga0265340_10008012 Ga0265340_100080125 208
335 3300037853 Ga0436364_0025958 Ga0436364_0025958_143_775 208
336 3300039437 Ga0436365_0850398 Ga0436365_0850398_492_1124 208
337 3300039438 Ga0436360_0751338 Ga0436360_0751338_12885_13622 208
338 3300039447 Ga0436361_0573255 Ga0436361_0573255_10549_11286 208
339 3300039450 Ga0436363_1291996 Ga0436363_1291996_2881_3513 208
340 3300039453 Ga0436362_0487773 Ga0436362_0487773_2380_3117 208
341 3300041413 Ga0439465_0039777 Ga0439465_0039777_866_1498 208
342 3300044694 Ga0466963_0378839 Ga0466963_0378839_108_740 208
343 3300044735 Ga0466968_0086161 Ga0466968_0086161_269_895 208
344 3300044842 Ga0466957_0624444 Ga0466957_0624444_14_646 208
345 3300046475 Ga0495639_0090833 Ga0495639_0090833_758_1390 208
346 3300046539 Ga0495621_0005934 Ga0495621_0005934_1600_2232 208
347 3300048905 Ga0496102_0043607 Ga0496102_0043607_1399_2031 208
348 3300048906 Ga0496103_0056707 Ga0496103_0056707_838_1470 208
349 3300048907 Ga0496104_0351819 Ga0496104_0351819_187_819 208
350 3300048908 Ga0496105_0065290 Ga0496105_0065290_1673_2305 208
351 3300048909 Ga0496106_0144770 Ga0496106_0144770_1126_1758 208
352 3300048911 Ga0496108_0474149 Ga0496108_0474149_291_923 208
353 3300048912 Ga0496109_0046030 Ga0496109_0046030_2159_2791 208
354 3300048913 Ga0496110_0145899 Ga0496110_0145899_1156_1788 208
355 3300048914 Ga0496111_0017225 Ga0496111_0017225_1289_1921 208
356 3300048920 Ga0496117_0177496 Ga0496117_0177496_112_744 208
357 3300048921 Ga0496118_0047127 Ga0496118_0047127_285_917 208
358 3300048924 Ga0496121_0015876 Ga0496121_0015876_7019_7651 208
359 3300048928 Ga0496125_0001068 Ga0496125_0001068_14468_15094 208
360 3300048928 Ga0496125_0021562 Ga0496125_0021562_5017_5643 208
361 3300049574 Ga0501038_0524637 Ga0501038_0524637_189_818 208
362 3300049575 Ga0501039_0372051 Ga0501039_0372051_109_738 208
363 3300049577 Ga0501041_0060877 Ga0501041_0060877_1324_1953 208
364 3300049582 Ga0501048_0287926 Ga0501048_0287926_379_1008 208
365 3300049584 Ga0501068_0203967 Ga0501068_0203967_594_1223 208
366 3300049593 Ga0501077_0098574 Ga0501077_0098574_282_911 208
367 3300049741 Ga0501079_0368598 Ga0501079_0368598_276_914 208
368 3300049743 Ga0501081_0243872 Ga0501081_0243872_280_909 208
369 3300049743 Ga0501081_0321787 Ga0501081_0321787_340_966 208
370 3300049744 Ga0501083_0102703 Ga0501083_0102703_320_949 208
371 3300050494 nmdc:mga06z11_513382_c1 nmdc:mga06z11_513382_c1_90_716 208
372 3300053158 Ga0500627_0166730 Ga0500627_0166730_76_702 208
373 3300054114 Ga0501084_0506416 Ga0501084_0506416_183_812 208
374 3300060353 Ga0501082_0083794 Ga0501082_0083794_1116_1745 208
375 3300061734 Ga0530510_0151867 Ga0530510_0151867_329_958 208
376 3300002987 JGI25159J45721_1009424 JGI25159J45721_10094242 209
377 3300003187 JGI25151J46595_10001287 JGI25151J46595_100012871 209
378 3300003187 JGI25151J46595_10037149 JGI25151J46595_100371492 209
379 3300003187 JGI25151J46595_10074055 JGI25151J46595_100740551 209
380 3300003187 JGI25151J46595_10074524 JGI25151J46595_100745241 209
381 3300003203 JGI25406J46586_10076708 JGI25406J46586_100767082 209
382 3300003215 JGI25153J46596_10002853 JGI25153J46596_100028538 209
383 3300003215 JGI25153J46596_10017253 JGI25153J46596_100172532 209
384 3300003215 JGI25153J46596_10037963 JGI25153J46596_100379631 209
385 3300003316 rootH1_10001329 rootH1_1000132926 209
386 3300003320 rootH2_10173050 rootH2_101730502 209
387 3300003320 rootH2_10273013 rootH2_102730132 209
388 3300003322 rootL2_10029468 rootL2_1002946811 209
389 3300003322 rootL2_10179753 rootL2_101797532 209
390 3300003323 rootH1_10048253 rootH1_100482533 209
391 3300003354 JGI25160J50197_1000505 JGI25160J50197_100050517 209
392 3300003354 JGI25160J50197_1009635 JGI25160J50197_10096355 209
393 3300003578 Ga0006562J51391_1001388 Ga0006562J51391_10013888 209
394 3300003751 Ga0055538_1000128 Ga0055538_10001282 209
395 3300003758 Ga0055532_1001176 Ga0055532_10011762 209
396 3300003761 Ga0055535_1007751 Ga0055535_10077512 209
397 3300003762 Ga0055542_1008160 Ga0055542_10081603 209
398 3300003771 Ga0055526_1029905 Ga0055526_10299052 209
399 3300003773 Ga0055537_1009257 Ga0055537_10092572 209
400 3300003781 Ga0055536_1002036 Ga0055536_10020365 209
401 3300003781 Ga0055536_1002279 Ga0055536_10022795 209
402 3300003790 Ga0055528_1003018 Ga0055528_100301810 209
403 3300003790 Ga0055528_1027876 Ga0055528_10278762 209
404 3300003791 Ga0055530_10004426 Ga0055530_100044265 209
405 3300003791 Ga0055530_10005947 Ga0055530_100059475 209
406 3300003794 Ga0055531_10002251 Ga0055531_100022519 209
407 3300003794 Ga0055531_10003247 Ga0055531_100032477 209
408 3300003794 Ga0055531_10016299 Ga0055531_100162995 209
409 3300005262 Ga0065165_1000254 Ga0065165_100025412 209
410 3300005262 Ga0065165_1000376 Ga0065165_100037626 209
411 3300005262 Ga0065165_1000749 Ga0065165_100074925 209
412 3300005262 Ga0065165_1004727 Ga0065165_100472713 209
413 3300005327 Ga0070658_10000029 Ga0070658_1000002972 209
414 3300005327 Ga0070658_10084816 Ga0070658_100848162 209
415 3300005327 Ga0070658_10105279 Ga0070658_101052792 209
416 3300005329 Ga0070683_100054819 Ga0070683_1000548194 209
417 3300005329 Ga0070683_100252526 Ga0070683_1002525262 209
418 3300005331 Ga0070670_100041824 Ga0070670_1000418243 209
419 3300005331 Ga0070670_100052926 Ga0070670_1000529264 209
420 3300005334 Ga0068869_100281367 Ga0068869_1002813672 209
421 3300005334 Ga0068869_100878402 Ga0068869_1008784021 209
422 3300005335 Ga0070666_10007107 Ga0070666_100071074 209
423 3300005336 Ga0070680_100004826 Ga0070680_1000048266 209
424 3300005336 Ga0070680_100039689 Ga0070680_1000396892 209
425 3300005339 Ga0070660_100007310 Ga0070660_1000073106 209
426 3300005339 Ga0070660_100237818 Ga0070660_1002378182 209
427 3300005339 Ga0070660_100351183 Ga0070660_1003511832 209
428 3300005340 Ga0070689_100124083 Ga0070689_1001240832 209
429 3300005340 Ga0070689_100157578 Ga0070689_1001575782 209
430 3300005341 Ga0070691_10005525 Ga0070691_100055253 209
431 3300005344 Ga0070661_100013672 Ga0070661_1000136722 209
432 3300005344 Ga0070661_100020985 Ga0070661_1000209852 209
433 3300005344 Ga0070661_100084578 Ga0070661_1000845782 209
434 3300005347 Ga0070668_100010989 Ga0070668_1000109892 209
435 3300005347 Ga0070668_100110111 Ga0070668_1001101113 209
436 3300005353 Ga0070669_100010848 Ga0070669_1000108487 209
437 3300005353 Ga0070669_100074367 Ga0070669_1000743672 209
438 3300005353 Ga0070669_100323671 Ga0070669_1003236712 209
439 3300005353 Ga0070669_100367560 Ga0070669_1003675601 209
440 3300005354 Ga0070675_100301946 Ga0070675_1003019462 209
441 3300005354 Ga0070675_100400389 Ga0070675_1004003892 209
442 3300005355 Ga0070671_100034049 Ga0070671_1000340493 209
443 3300005356 Ga0070674_100140673 Ga0070674_1001406732 209
444 3300005364 Ga0070673_100369338 Ga0070673_1003693381 209
445 3300005364 Ga0070673_100470046 Ga0070673_1004700462 209
446 3300005364 Ga0070673_100818547 Ga0070673_1008185471 209
447 3300005365 Ga0070688_100027531 Ga0070688_1000275313 209
448 3300005366 Ga0070659_100000968 Ga0070659_10000096814 209
449 3300005366 Ga0070659_100156073 Ga0070659_1001560732 209
450 3300005366 Ga0070659_100564360 Ga0070659_1005643601 209
451 3300005367 Ga0070667_100116779 Ga0070667_1001167792 209
452 3300005367 Ga0070667_100146586 Ga0070667_1001465862 209
453 3300005367 Ga0070667_100285152 Ga0070667_1002851521 209
454 3300005367 Ga0070667_100291136 Ga0070667_1002911362 209
455 3300005367 Ga0070667_100661277 Ga0070667_1006612771 209
456 3300005434 Ga0070709_10000102 Ga0070709_1000010247 209
457 3300005434 Ga0070709_10002668 Ga0070709_100026688 209
458 3300005434 Ga0070709_10146800 Ga0070709_101468002 209
459 3300005434 Ga0070709_10172951 Ga0070709_101729512 209
460 3300005435 Ga0070714_100002572 Ga0070714_10000257212 209
461 3300005435 Ga0070714_100043830 Ga0070714_1000438302 209
462 3300005435 Ga0070714_100113074 Ga0070714_1001130743 209
463 3300005435 Ga0070714_100278628 Ga0070714_1002786281 209
464 3300005436 Ga0070713_100055744 Ga0070713_1000557442 209
465 3300005436 Ga0070713_100139806 Ga0070713_1001398062 209
466 3300005436 Ga0070713_100259853 Ga0070713_1002598531 209
467 3300005437 Ga0070710_10000246 Ga0070710_100002463 209
468 3300005437 Ga0070710_10043267 Ga0070710_100432673 209
469 3300005437 Ga0070710_10130490 Ga0070710_101304903 209
470 3300005437 Ga0070710_10415642 Ga0070710_104156421 209
471 3300005437 Ga0070710_10780798 Ga0070710_107807981 209
472 3300005438 Ga0070701_10117330 Ga0070701_101173302 209
473 3300005439 Ga0070711_100001950 Ga0070711_1000019503 209
474 3300005439 Ga0070711_100009139 Ga0070711_1000091394 209
475 3300005439 Ga0070711_100021023 Ga0070711_1000210235 209
476 3300005439 Ga0070711_100057145 Ga0070711_1000571452 209
477 3300005439 Ga0070711_100149799 Ga0070711_1001497993 209
478 3300005440 Ga0070705_100005393 Ga0070705_1000053932 209
479 3300005441 Ga0070700_100004393 Ga0070700_1000043931 209
480 3300005441 Ga0070700_100174861 Ga0070700_1001748611 209
481 3300005444 Ga0070694_100184113 Ga0070694_1001841132 209
482 3300005445 Ga0070708_100438825 Ga0070708_1004388252 209
483 3300005456 Ga0070678_100023432 Ga0070678_1000234325 209
484 3300005456 Ga0070678_100060424 Ga0070678_1000604242 209
485 3300005457 Ga0070662_100216351 Ga0070662_1002163512 209
486 3300005458 Ga0070681_10014331 Ga0070681_100143314 209
487 3300005458 Ga0070681_10073996 Ga0070681_100739962 209
488 3300005458 Ga0070681_10074121 Ga0070681_100741211 209
489 3300005459 Ga0068867_100005155 Ga0068867_1000051552 209
490 3300005459 Ga0068867_100031126 Ga0068867_1000311263 209
491 3300005459 Ga0068867_100344861 Ga0068867_1003448612 209
492 3300005459 Ga0068867_100532561 Ga0068867_1005325611 209
493 3300005466 Ga0070685_10213074 Ga0070685_102130742 209
494 3300005467 Ga0070706_100009262 Ga0070706_1000092626 209
495 3300005467 Ga0070706_100604505 Ga0070706_1006045052 209
496 3300005468 Ga0070707_100038744 Ga0070707_1000387442 209
497 3300005468 Ga0070707_100149343 Ga0070707_1001493432 209
498 3300005468 Ga0070707_100694312 Ga0070707_1006943121 209
499 3300005471 Ga0070698_100001489 Ga0070698_10000148926 209
500 3300005471 Ga0070698_100001894 Ga0070698_10000189410 209
501 3300005471 Ga0070698_101065320 Ga0070698_1010653201 209
502 3300005518 Ga0070699_100020158 Ga0070699_1000201586 209
503 3300005518 Ga0070699_100039020 Ga0070699_1000390203 209
504 3300005518 Ga0070699_100087255 Ga0070699_1000872552 209
505 3300005518 Ga0070699_100192282 Ga0070699_1001922822 209
506 3300005530 Ga0070679_100015211 Ga0070679_1000152115 209
507 3300005530 Ga0070679_100166416 Ga0070679_1001664163 209
508 3300005530 Ga0070679_100195382 Ga0070679_1001953822 209
509 3300005535 Ga0070684_100059203 Ga0070684_1000592033 209
510 3300005535 Ga0070684_100139063 Ga0070684_1001390632 209
511 3300005536 Ga0070697_100040877 Ga0070697_1000408775 209
512 3300005536 Ga0070697_100053626 Ga0070697_1000536262 209
513 3300005536 Ga0070697_100085917 Ga0070697_1000859172 209
514 3300005539 Ga0068853_100439525 Ga0068853_1004395252 209
515 3300005543 Ga0070672_100037975 Ga0070672_1000379753 209
516 3300005543 Ga0070672_100077938 Ga0070672_1000779382 209
517 3300005543 Ga0070672_100280783 Ga0070672_1002807832 209
518 3300005546 Ga0070696_100277204 Ga0070696_1002772042 209
519 3300005548 Ga0070665_100028600 Ga0070665_1000286002 209
520 3300005548 Ga0070665_100041857 Ga0070665_1000418574 209
521 3300005548 Ga0070665_100059744 Ga0070665_1000597443 209
522 3300005548 Ga0070665_100321285 Ga0070665_1003212852 209
523 3300005548 Ga0070665_100337936 Ga0070665_1003379362 209
524 3300005548 Ga0070665_100645488 Ga0070665_1006454882 209
525 3300005548 Ga0070665_100721904 Ga0070665_1007219042 209
526 3300005563 Ga0068855_100197789 Ga0068855_1001977892 209
527 3300005563 Ga0068855_100285543 Ga0068855_1002855432 209
528 3300005563 Ga0068855_100453266 Ga0068855_1004532662 209
529 3300005564 Ga0070664_100181960 Ga0070664_1001819602 209
530 3300005564 Ga0070664_100222681 Ga0070664_1002226815 209
531 3300005577 Ga0068857_100068776 Ga0068857_1000687764 209
532 3300005577 Ga0068857_101355763 Ga0068857_1013557631 209
533 3300005578 Ga0068854_101005385 Ga0068854_1010053851 209
534 3300005614 Ga0068856_100007916 Ga0068856_1000079168 209
535 3300005614 Ga0068856_100407198 Ga0068856_1004071982 209
536 3300005614 Ga0068856_100529116 Ga0068856_1005291161 209
537 3300005614 Ga0068856_100710100 Ga0068856_1007101001 209
538 3300005616 Ga0068852_100016405 Ga0068852_1000164054 209
539 3300005616 Ga0068852_100394316 Ga0068852_1003943162 209
540 3300005616 Ga0068852_100445770 Ga0068852_1004457702 209
541 3300005616 Ga0068852_101014365 Ga0068852_1010143651 209
542 3300005616 Ga0068852_101449423 Ga0068852_1014494231 209
543 3300005617 Ga0068859_100462365 Ga0068859_1004623652 209
544 3300005617 Ga0068859_100772897 Ga0068859_1007728972 209
545 3300005618 Ga0068864_100473808 Ga0068864_1004738083 209
546 3300005719 Ga0068861_100002547 Ga0068861_1000025472 209
547 3300005719 Ga0068861_100025992 Ga0068861_1000259923 209
548 3300005719 Ga0068861_100051216 Ga0068861_1000512167 209
549 3300005834 Ga0068851_10272805 Ga0068851_102728051 209
550 3300005841 Ga0068863_100085916 Ga0068863_1000859163 209
551 3300005841 Ga0068863_100348030 Ga0068863_1003480302 209
552 3300005842 Ga0068858_100088380 Ga0068858_1000883802 209
553 3300005842 Ga0068858_100344058 Ga0068858_1003440581 209
554 3300005843 Ga0068860_100000515 Ga0068860_10000051514 209
555 3300005843 Ga0068860_100734056 Ga0068860_1007340562 209
556 3300005844 Ga0068862_100017703 Ga0068862_1000177035 209
557 3300005844 Ga0068862_100023047 Ga0068862_1000230473 209
558 3300005937 Ga0081455_10000370 Ga0081455_1000037035 209
559 3300005937 Ga0081455_10048684 Ga0081455_100486842 209
560 3300005937 Ga0081455_10062637 Ga0081455_100626372 209
561 3300005937 Ga0081455_10129143 Ga0081455_101291432 209
562 3300005981 Ga0081538_10058894 Ga0081538_100588942 209
563 3300005981 Ga0081538_10096174 Ga0081538_100961742 209
564 3300005981 Ga0081538_10211686 Ga0081538_102116862 209
565 3300005983 Ga0081540_1003913 Ga0081540_10039134 209
566 3300005983 Ga0081540_1016777 Ga0081540_10167776 209
567 3300005983 Ga0081540_1020037 Ga0081540_10200372 209
568 3300005983 Ga0081540_1034549 Ga0081540_10345493 209
569 3300005983 Ga0081540_1112218 Ga0081540_11122181 209
570 3300005985 Ga0081539_10001490 Ga0081539_1000149030 209
571 3300005985 Ga0081539_10049141 Ga0081539_100491413 209
572 3300005985 Ga0081539_10141583 Ga0081539_101415831 209
573 3300006028 Ga0070717_10004346 Ga0070717_100043464 209
574 3300006028 Ga0070717_10058852 Ga0070717_100588523 209
575 3300006028 Ga0070717_10069419 Ga0070717_100694192 209
576 3300006038 Ga0075365_10074563 Ga0075365_100745632 209
577 3300006038 Ga0075365_10103729 Ga0075365_101037292 209
578 3300006038 Ga0075365_10190548 Ga0075365_101905481 209
579 3300006038 Ga0075365_10275615 Ga0075365_102756152 209
580 3300006038 Ga0075365_10300052 Ga0075365_103000522 209
581 3300006042 Ga0075368_10000871 Ga0075368_100008717 209
582 3300006042 Ga0075368_10010300 Ga0075368_100103002 209
583 3300006048 Ga0075363_100001442 Ga0075363_10000144210 209
584 3300006048 Ga0075363_100226462 Ga0075363_1002264622 209
585 3300006051 Ga0075364_10045122 Ga0075364_100451222 209
586 3300006051 Ga0075364_10074105 Ga0075364_100741052 209
587 3300006051 Ga0075364_10236471 Ga0075364_102364712 209
588 3300006163 Ga0070715_10000170 Ga0070715_100001706 209
589 3300006163 Ga0070715_10073621 Ga0070715_100736212 209
590 3300006173 Ga0070716_100004867 Ga0070716_1000048675 209
591 3300006173 Ga0070716_100030369 Ga0070716_1000303693 209
592 3300006173 Ga0070716_100220603 Ga0070716_1002206032 209
593 3300006173 Ga0070716_100236410 Ga0070716_1002364101 209
594 3300006173 Ga0070716_100617204 Ga0070716_1006172041 209
595 3300006175 Ga0070712_100005583 Ga0070712_1000055837 209
596 3300006175 Ga0070712_100033573 Ga0070712_1000335733 209
597 3300006175 Ga0070712_100092117 Ga0070712_1000921173 209
598 3300006175 Ga0070712_100265388 Ga0070712_1002653883 209
599 3300006175 Ga0070712_100802617 Ga0070712_1008026171 209
600 3300006177 Ga0075362_10009303 Ga0075362_100093033 209
601 3300006177 Ga0075362_10036856 Ga0075362_100368562 209
602 3300006178 Ga0075367_10010911 Ga0075367_100109114 209
603 3300006178 Ga0075367_10013533 Ga0075367_100135332 209
604 3300006178 Ga0075367_10017380 Ga0075367_100173802 209
605 3300006178 Ga0075367_10102262 Ga0075367_101022623 209
606 3300006178 Ga0075367_10183291 Ga0075367_101832911 209
607 3300006178 Ga0075367_10195716 Ga0075367_101957162 209
608 3300006178 Ga0075367_10323223 Ga0075367_103232231 209
609 3300006186 Ga0075369_10002311 Ga0075369_100023113 209
610 3300006186 Ga0075369_10005323 Ga0075369_100053235 209
611 3300006186 Ga0075369_10016536 Ga0075369_100165362 209
612 3300006195 Ga0075366_10017413 Ga0075366_100174133 209
613 3300006195 Ga0075366_10068034 Ga0075366_100680343 209
614 3300006195 Ga0075366_10133996 Ga0075366_101339962 209
615 3300006195 Ga0075366_10177373 Ga0075366_101773732 209
616 3300006237 Ga0097621_100145696 Ga0097621_1001456962 209
617 3300006237 Ga0097621_100267705 Ga0097621_1002677052 209
618 3300006237 Ga0097621_100319132 Ga0097621_1003191322 209
619 3300006353 Ga0075370_10044744 Ga0075370_100447444 209
620 3300006353 Ga0075370_10053029 Ga0075370_100530294 209
621 3300006353 Ga0075370_10272471 Ga0075370_102724712 209
622 3300006353 Ga0075370_10312223 Ga0075370_103122231 209
623 3300006358 Ga0068871_100188522 Ga0068871_1001885222 209
624 3300006358 Ga0068871_100819448 Ga0068871_1008194482 209
625 3300006844 Ga0075428_100020774 Ga0075428_1000207747 209
626 3300006844 Ga0075428_100375906 Ga0075428_1003759062 209
627 3300006844 Ga0075428_101332140 Ga0075428_1013321401 209
628 3300006846 Ga0075430_100011908 Ga0075430_10001190812 209
629 3300006846 Ga0075430_100175942 Ga0075430_1001759422 209
630 3300006846 Ga0075430_100331958 Ga0075430_1003319581 209
631 3300006846 Ga0075430_100346996 Ga0075430_1003469961 209
632 3300006847 Ga0075431_100017460 Ga0075431_1000174604 209
633 3300006847 Ga0075431_100021552 Ga0075431_1000215522 209
634 3300006847 Ga0075431_100161326 Ga0075431_1001613263 209
635 3300006847 Ga0075431_100212946 Ga0075431_1002129462 209
636 3300006847 Ga0075431_100433888 Ga0075431_1004338881 209
637 3300006871 Ga0075434_100091249 Ga0075434_1000912492 209
638 3300006880 Ga0075429_100194579 Ga0075429_1001945792 209
639 3300006880 Ga0075429_100203900 Ga0075429_1002039002 209
640 3300006880 Ga0075429_100268878 Ga0075429_1002688782 209
641 3300006881 Ga0068865_100003574 Ga0068865_1000035743 209
642 3300006881 Ga0068865_100460845 Ga0068865_1004608452 209
643 3300006931 Ga0097620_100462413 Ga0097620_1004624132 209
644 3300006931 Ga0097620_100772883 Ga0097620_1007728832 209
645 3300007076 Ga0075435_100040343 Ga0075435_1000403432 209
646 3300007265 Ga0099794_10005140 Ga0099794_100051406 209
647 3300007265 Ga0099794_10013549 Ga0099794_100135492 209
648 3300007788 Ga0099795_10019288 Ga0099795_100192881 209
649 3300007788 Ga0099795_10020673 Ga0099795_100206732 209
650 3300009011 Ga0105251_10032456 Ga0105251_100324563 209
651 3300009011 Ga0105251_10202657 Ga0105251_102026572 209
652 3300009011 Ga0105251_10257219 Ga0105251_102572191 209
653 3300009036 Ga0105244_10023579 Ga0105244_100235793 209
654 3300009036 Ga0105244_10154257 Ga0105244_101542571 209
655 3300009092 Ga0105250_10021450 Ga0105250_100214502 209
656 3300009092 Ga0105250_10023301 Ga0105250_100233013 209
657 3300009092 Ga0105250_10051228 Ga0105250_100512283 209
658 3300009093 Ga0105240_10002493 Ga0105240_100024934 209
659 3300009093 Ga0105240_10012470 Ga0105240_100124709 209
660 3300009093 Ga0105240_10172639 Ga0105240_101726392 209
661 3300009093 Ga0105240_10650698 Ga0105240_106506981 209
662 3300009094 Ga0111539_10029807 Ga0111539_100298071 209
663 3300009094 Ga0111539_10427369 Ga0111539_104273692 209
664 3300009094 Ga0111539_10568771 Ga0111539_105687712 209
665 3300009094 Ga0111539_10909798 Ga0111539_109097982 209
666 3300009094 Ga0111539_11077385 Ga0111539_110773851 209
667 3300009094 Ga0111539_11642481 Ga0111539_116424811 209
668 3300009098 Ga0105245_10008917 Ga0105245_100089173 209
669 3300009098 Ga0105245_10416032 Ga0105245_104160322 209
670 3300009098 Ga0105245_10611773 Ga0105245_106117732 209
671 3300009101 Ga0105247_10004796 Ga0105247_1000479610 209
672 3300009101 Ga0105247_10012294 Ga0105247_100122942 209
673 3300009101 Ga0105247_10013310 Ga0105247_100133104 209
674 3300009147 Ga0114129_10068576 Ga0114129_100685763 209
675 3300009147 Ga0114129_10103640 Ga0114129_101036402 209
676 3300009147 Ga0114129_10106492 Ga0114129_101064924 209
677 3300009147 Ga0114129_10200287 Ga0114129_102002873 209
678 3300009147 Ga0114129_10336120 Ga0114129_103361203 209
679 3300009148 Ga0105243_10000209 Ga0105243_1000020920 209
680 3300009148 Ga0105243_10061519 Ga0105243_100615192 209
681 3300009148 Ga0105243_10400522 Ga0105243_104005222 209
682 3300009148 Ga0105243_10874030 Ga0105243_108740302 209
683 3300009174 Ga0105241_10421269 Ga0105241_104212692 209
684 3300009174 Ga0105241_10866776 Ga0105241_108667762 209
685 3300009176 Ga0105242_10002692 Ga0105242_1000269212 209
686 3300009176 Ga0105242_10101075 Ga0105242_101010752 209
687 3300009176 Ga0105242_10364233 Ga0105242_103642332 209
688 3300009176 Ga0105242_10929947 Ga0105242_109299472 209
689 3300009177 Ga0105248_10371195 Ga0105248_103711952 209
690 3300009177 Ga0105248_10408807 Ga0105248_104088073 209
691 3300009545 Ga0105237_10003531 Ga0105237_1000353112 209
692 3300009545 Ga0105237_10024701 Ga0105237_100247018 209
693 3300009545 Ga0105237_10425600 Ga0105237_104256002 209
694 3300009545 Ga0105237_10493410 Ga0105237_104934102 209
695 3300009545 Ga0105237_10522458 Ga0105237_105224582 209
696 3300009551 Ga0105238_10203143 Ga0105238_102031432 209
697 3300009551 Ga0105238_10257014 Ga0105238_102570142 209
698 3300009551 Ga0105238_10281676 Ga0105238_102816762 209
699 3300009551 Ga0105238_10927943 Ga0105238_109279431 209
700 3300009553 Ga0105249_10009715 Ga0105249_100097153 209
701 3300009553 Ga0105249_10338592 Ga0105249_103385922 209
702 3300009553 Ga0105249_10620881 Ga0105249_106208812 209
703 3300009553 Ga0105249_10633503 Ga0105249_106335031 209
704 3300009553 Ga0105249_10770857 Ga0105249_107708572 209
705 3300009993 Ga0105028_106674 Ga0105028_1066741 209
706 3300010375 Ga0105239_10019175 Ga0105239_100191757 209
707 3300010375 Ga0105239_10072092 Ga0105239_100720925 209
708 3300010375 Ga0105239_10084759 Ga0105239_100847594 209
709 3300010375 Ga0105239_10116418 Ga0105239_101164183 209
710 3300010375 Ga0105239_10144007 Ga0105239_101440073 209
711 3300010375 Ga0105239_10435836 Ga0105239_104358362 209
712 3300010375 Ga0105239_10540923 Ga0105239_105409232 209
713 3300011119 Ga0105246_10003085 Ga0105246_1000308510 209
714 3300011119 Ga0105246_10039338 Ga0105246_100393388 209
715 3300011119 Ga0105246_10205094 Ga0105246_102050942 209
716 3300011119 Ga0105246_10401504 Ga0105246_104015041 209
717 3300011119 Ga0105246_10410100 Ga0105246_104101002 209
718 3300011119 Ga0105246_10446953 Ga0105246_104469532 209
719 3300011119 Ga0105246_10510512 Ga0105246_105105121 209
720 3300013100 Ga0157373_10106549 Ga0157373_101065491 209
721 3300013102 Ga0157371_10368724 Ga0157371_103687241 209
722 3300013104 Ga0157370_10115568 Ga0157370_101155682 209
723 3300013104 Ga0157370_10264351 Ga0157370_102643512 209
724 3300013104 Ga0157370_10633477 Ga0157370_106334771 209
725 3300013105 Ga0157369_10039088 Ga0157369_100390884 209
726 3300013105 Ga0157369_10133361 Ga0157369_101333612 209
727 3300013296 Ga0157374_10052132 Ga0157374_100521322 209
728 3300013296 Ga0157374_10113755 Ga0157374_101137553 209
729 3300013296 Ga0157374_10996330 Ga0157374_109963301 209
730 3300013297 Ga0157378_10029475 Ga0157378_100294753 209
731 3300013297 Ga0157378_10196836 Ga0157378_101968362 209
732 3300013297 Ga0157378_10504365 Ga0157378_105043652 209
733 3300013306 Ga0163162_10000043 Ga0163162_10000043105 209
734 3300013306 Ga0163162_10008437 Ga0163162_100084379 209
735 3300013306 Ga0163162_10235517 Ga0163162_102355172 209
736 3300013306 Ga0163162_10584023 Ga0163162_105840232 209
737 3300013307 Ga0157372_10135433 Ga0157372_101354332 209
738 3300013308 Ga0157375_10042199 Ga0157375_100421993 209
739 3300013308 Ga0157375_10286068 Ga0157375_102860682 209
740 3300013308 Ga0157375_10553907 Ga0157375_105539072 209
741 3300013308 Ga0157375_10855511 Ga0157375_108555112 209
742 3300013308 Ga0157375_11177937 Ga0157375_111779371 209
743 3300014325 Ga0163163_10011142 Ga0163163_100111422 209
744 3300014325 Ga0163163_10580092 Ga0163163_105800921 209
745 3300014325 Ga0163163_11397875 Ga0163163_113978752 209
746 3300014325 Ga0163163_11582014 Ga0163163_115820141 209
747 3300014326 Ga0157380_10053098 Ga0157380_100530981 209
748 3300014326 Ga0157380_10073359 Ga0157380_100733592 209
749 3300014326 Ga0157380_10133600 Ga0157380_101336001 209
750 3300014326 Ga0157380_10709545 Ga0157380_107095452 209
751 3300014497 Ga0182008_10054106 Ga0182008_100541062 209
752 3300014497 Ga0182008_10148475 Ga0182008_101484752 209
753 3300014745 Ga0157377_10000894 Ga0157377_1000089415 209
754 3300014968 Ga0157379_10084010 Ga0157379_100840102 209
755 3300014968 Ga0157379_10171616 Ga0157379_101716162 209
756 3300014968 Ga0157379_10232953 Ga0157379_102329532 209
757 3300014968 Ga0157379_10296007 Ga0157379_102960071 209
758 3300014968 Ga0157379_10408745 Ga0157379_104087452 209
759 3300014969 Ga0157376_10087414 Ga0157376_100874143 209
760 3300014969 Ga0157376_10105885 Ga0157376_101058852 209
761 3300014969 Ga0157376_10134516 Ga0157376_101345163 209
762 3300014969 Ga0157376_10569702 Ga0157376_105697022 209
763 3300015261 Ga0182006_1095809 Ga0182006_10958091 209
764 3300015265 Ga0182005_1073410 Ga0182005_10734101 209
765 3300017792 Ga0163161_10311656 Ga0163161_103116562 209
766 3300017792 Ga0163161_10817341 Ga0163161_108173412 209
767 3300020081 Ga0206354_11440000 Ga0206354_114400009 209
768 3300020082 Ga0206353_10040355 Ga0206353_100403553 209
769 3300021320 Ga0214544_1000001 Ga0214544_1000001151 209
770 3300021321 Ga0214542_1000005 Ga0214542_1000005151 209
771 3300021324 Ga0214545_1000003 Ga0214545_1000003613 209
772 3300021327 Ga0214543_1000002 Ga0214543_1000002152 209
773 3300021327 Ga0214543_1022088 Ga0214543_10220883 209
774 3300021358 Ga0213873_10000006 Ga0213873_10000006168 209
775 3300021384 Ga0213876_10000004 Ga0213876_10000004674 209
776 3300021384 Ga0213876_10004040 Ga0213876_100040404 209
777 3300021388 Ga0213875_10040547 Ga0213875_100405472 209
778 3300021388 Ga0213875_10085645 Ga0213875_100856452 209
779 3300021441 Ga0213871_10000281 Ga0213871_100002813 209
780 3300025224 Ga0209784_100051 Ga0209784_10005157 209
781 3300025225 Ga0209566_100112 Ga0209566_10011248 209
782 3300025225 Ga0209566_100158 Ga0209566_10015833 209
783 3300025225 Ga0209566_103510 Ga0209566_1035103 209
784 3300025229 Ga0209147_100062 Ga0209147_100062160 209
785 3300025229 Ga0209147_100101 Ga0209147_100101151 209
786 3300025229 Ga0209147_100559 Ga0209147_10055921 209
787 3300025229 Ga0209147_101819 Ga0209147_1018199 209
788 3300025230 Ga0209563_101258 Ga0209563_1012587 209
789 3300025242 Ga0209258_101869 Ga0209258_1018692 209
790 3300025253 Ga0209677_101553 Ga0209677_1015537 209
791 3300025254 Ga0209148_1000849 Ga0209148_10008495 209
792 3300025261 Ga0209233_1004289 Ga0209233_10042891 209
793 3300025261 Ga0209233_1024415 Ga0209233_10244152 209
794 3300025261 Ga0209233_1037347 Ga0209233_10373471 209
795 3300025261 Ga0209233_1042303 Ga0209233_10423031 209
796 3300025263 Ga0209565_1000195 Ga0209565_100019522 209
797 3300025272 Ga0209455_1001077 Ga0209455_100107715 209
798 3300025273 Ga0209673_1001368 Ga0209673_100136813 209
799 3300025273 Ga0209673_1002410 Ga0209673_10024109 209
800 3300025273 Ga0209673_1033439 Ga0209673_10334392 209
801 3300025284 Ga0209130_1006510 Ga0209130_10065102 209
802 3300025284 Ga0209130_1011599 Ga0209130_10115993 209
803 3300025291 Ga0209675_1006600 Ga0209675_10066004 209
804 3300025291 Ga0209675_1023680 Ga0209675_10236802 209
805 3300025291 Ga0209675_1035722 Ga0209675_10357222 209
806 3300025291 Ga0209675_1053419 Ga0209675_10534191 209
807 3300025292 Ga0209676_1000082 Ga0209676_1000082143 209
808 3300025292 Ga0209676_1000224 Ga0209676_100022444 209
809 3300025292 Ga0209676_1000374 Ga0209676_100037472 209
810 3300025292 Ga0209676_1003709 Ga0209676_10037096 209
811 3300025292 Ga0209676_1007483 Ga0209676_10074832 209
812 3300025292 Ga0209676_1008567 Ga0209676_10085673 209
813 3300025292 Ga0209676_1010333 Ga0209676_10103332 209
814 3300025292 Ga0209676_1014012 Ga0209676_10140122 209
815 3300025292 Ga0209676_1037468 Ga0209676_10374682 209
816 3300025292 Ga0209676_1054824 Ga0209676_10548242 209
817 3300025294 Ga0209025_1001531 Ga0209025_100153112 209
818 3300025294 Ga0209025_1003426 Ga0209025_100342610 209
819 3300025294 Ga0209025_1003576 Ga0209025_100357617 209
820 3300025294 Ga0209025_1004018 Ga0209025_10040185 209
821 3300025294 Ga0209025_1004765 Ga0209025_100476510 209
822 3300025294 Ga0209025_1004804 Ga0209025_10048045 209
823 3300025294 Ga0209025_1006577 Ga0209025_10065776 209
824 3300025294 Ga0209025_1007420 Ga0209025_10074202 209
825 3300025294 Ga0209025_1008453 Ga0209025_10084534 209
826 3300025294 Ga0209025_1010494 Ga0209025_10104944 209
827 3300025294 Ga0209025_1014192 Ga0209025_10141921 209
828 3300025294 Ga0209025_1027219 Ga0209025_10272192 209
829 3300025295 Ga0209564_1001613 Ga0209564_100161324 209
830 3300025295 Ga0209564_1014164 Ga0209564_10141643 209
831 3300025295 Ga0209564_1022771 Ga0209564_10227713 209
832 3300025295 Ga0209564_1040023 Ga0209564_10400232 209
833 3300025297 Ga0209758_1000026 Ga0209758_1000026179 209
834 3300025297 Ga0209758_1000526 Ga0209758_100052619 209
835 3300025297 Ga0209758_1001753 Ga0209758_100175325 209
836 3300025297 Ga0209758_1002770 Ga0209758_100277016 209
837 3300025297 Ga0209758_1004348 Ga0209758_10043488 209
838 3300025297 Ga0209758_1009300 Ga0209758_10093005 209
839 3300025297 Ga0209758_1015309 Ga0209758_10153092 209
840 3300025297 Ga0209758_1025500 Ga0209758_10255002 209
841 3300025298 Ga0209050_1000443 Ga0209050_100044311 209
842 3300025298 Ga0209050_1000735 Ga0209050_100073544 209
843 3300025298 Ga0209050_1012972 Ga0209050_10129724 209
844 3300025299 Ga0209256_1000535 Ga0209256_100053525 209
845 3300025299 Ga0209256_1022305 Ga0209256_10223052 209
846 3300025302 Ga0207426_1000213 Ga0207426_100021392 209
847 3300025302 Ga0207426_1001534 Ga0207426_10015347 209
848 3300025302 Ga0207426_1024890 Ga0207426_10248902 209
849 3300025303 Ga0209051_1002443 Ga0209051_100244313 209
850 3300025303 Ga0209051_1057187 Ga0209051_10571873 209
851 3300025304 Ga0209257_1000218 Ga0209257_100021832 209
852 3300025304 Ga0209257_1000626 Ga0209257_100062644 209
853 3300025304 Ga0209257_1000930 Ga0209257_100093029 209
854 3300025304 Ga0209257_1001466 Ga0209257_100146623 209
855 3300025304 Ga0209257_1001794 Ga0209257_100179418 209
856 3300025304 Ga0209257_1014478 Ga0209257_10144781 209
857 3300025315 Ga0207697_10096231 Ga0207697_100962312 209
858 3300025711 Ga0207696_1001433 Ga0207696_100143316 209
859 3300025711 Ga0207696_1003350 Ga0207696_10033506 209
860 3300025711 Ga0207696_1004678 Ga0207696_10046784 209
861 3300025728 Ga0207655_1004092 Ga0207655_10040928 209
862 3300025728 Ga0207655_1009156 Ga0207655_10091569 209
863 3300025728 Ga0207655_1016667 Ga0207655_10166672 209
864 3300025735 Ga0207713_1004512 Ga0207713_10045123 209
865 3300025893 Ga0207682_10026497 Ga0207682_100264973 209
866 3300025898 Ga0207692_10001394 Ga0207692_100013947 209
867 3300025898 Ga0207692_10003157 Ga0207692_100031573 209
868 3300025899 Ga0207642_10414076 Ga0207642_104140761 209
869 3300025900 Ga0207710_10015614 Ga0207710_100156143 209
870 3300025900 Ga0207710_10039499 Ga0207710_100394993 209
871 3300025900 Ga0207710_10045167 Ga0207710_100451672 209
872 3300025900 Ga0207710_10136919 Ga0207710_101369192 209
873 3300025901 Ga0207688_10068259 Ga0207688_100682592 209
874 3300025901 Ga0207688_10279814 Ga0207688_102798141 209
875 3300025903 Ga0207680_10029511 Ga0207680_100295111 209
876 3300025903 Ga0207680_10431147 Ga0207680_104311471 209
877 3300025904 Ga0207647_10004089 Ga0207647_100040897 209
878 3300025905 Ga0207685_10092331 Ga0207685_100923311 209
879 3300025906 Ga0207699_10004142 Ga0207699_1000414210 209
880 3300025906 Ga0207699_10019092 Ga0207699_100190924 209
881 3300025906 Ga0207699_10127335 Ga0207699_101273351 209
882 3300025906 Ga0207699_10182270 Ga0207699_101822701 209
883 3300025907 Ga0207645_10063123 Ga0207645_100631234 209
884 3300025907 Ga0207645_10129767 Ga0207645_101297672 209
885 3300025907 Ga0207645_10490662 Ga0207645_104906621 209
886 3300025909 Ga0207705_10000002 Ga0207705_10000002805 209
887 3300025909 Ga0207705_10139390 Ga0207705_101393902 209
888 3300025909 Ga0207705_10498140 Ga0207705_104981402 209
889 3300025910 Ga0207684_10001378 Ga0207684_100013782 209
890 3300025910 Ga0207684_10135158 Ga0207684_101351582 209
891 3300025910 Ga0207684_10492048 Ga0207684_104920481 209
892 3300025910 Ga0207684_10847789 Ga0207684_108477891 209
893 3300025911 Ga0207654_10013939 Ga0207654_100139392 209
894 3300025911 Ga0207654_10287127 Ga0207654_102871272 209
895 3300025912 Ga0207707_10022121 Ga0207707_100221212 209
896 3300025912 Ga0207707_10182199 Ga0207707_101821991 209
897 3300025912 Ga0207707_10287734 Ga0207707_102877342 209
898 3300025913 Ga0207695_10000006 Ga0207695_100000061014 209
899 3300025913 Ga0207695_10026360 Ga0207695_100263608 209
900 3300025913 Ga0207695_10081179 Ga0207695_100811792 209
901 3300025913 Ga0207695_10135160 Ga0207695_101351604 209
902 3300025913 Ga0207695_10149781 Ga0207695_101497812 209
903 3300025913 Ga0207695_10284512 Ga0207695_102845122 209
904 3300025913 Ga0207695_10451293 Ga0207695_104512932 209
905 3300025914 Ga0207671_10000774 Ga0207671_1000077433 209
906 3300025914 Ga0207671_10064265 Ga0207671_100642652 209
907 3300025914 Ga0207671_10104187 Ga0207671_101041871 209
908 3300025915 Ga0207693_10000095 Ga0207693_1000009529 209
909 3300025915 Ga0207693_10004244 Ga0207693_100042444 209
910 3300025915 Ga0207693_10023789 Ga0207693_100237891 209
911 3300025915 Ga0207693_10061212 Ga0207693_100612124 209
912 3300025915 Ga0207693_10093094 Ga0207693_100930943 209
913 3300025915 Ga0207693_10254467 Ga0207693_102544672 209
914 3300025915 Ga0207693_10495713 Ga0207693_104957131 209
915 3300025916 Ga0207663_10005035 Ga0207663_100050354 209
916 3300025916 Ga0207663_10005324 Ga0207663_100053247 209
917 3300025916 Ga0207663_10010748 Ga0207663_100107483 209
918 3300025917 Ga0207660_10005232 Ga0207660_100052327 209
919 3300025917 Ga0207660_10107656 Ga0207660_101076562 209
920 3300025918 Ga0207662_10143330 Ga0207662_101433302 209
921 3300025919 Ga0207657_10013159 Ga0207657_100131596 209
922 3300025919 Ga0207657_10087753 Ga0207657_100877534 209
923 3300025919 Ga0207657_10325964 Ga0207657_103259642 209
924 3300025920 Ga0207649_10026891 Ga0207649_100268913 209
925 3300025920 Ga0207649_10433260 Ga0207649_104332601 209
926 3300025920 Ga0207649_10711568 Ga0207649_107115681 209
927 3300025922 Ga0207646_10002702 Ga0207646_1000270211 209
928 3300025922 Ga0207646_10003436 Ga0207646_1000343616 209
929 3300025922 Ga0207646_10592602 Ga0207646_105926022 209
930 3300025922 Ga0207646_10994197 Ga0207646_109941971 209
931 3300025923 Ga0207681_10007974 Ga0207681_100079742 209
932 3300025923 Ga0207681_10077129 Ga0207681_100771293 209
933 3300025923 Ga0207681_10082921 Ga0207681_100829212 209
934 3300025923 Ga0207681_10329699 Ga0207681_103296992 209
935 3300025923 Ga0207681_10847262 Ga0207681_108472621 209
936 3300025924 Ga0207694_10040691 Ga0207694_100406917 209
937 3300025924 Ga0207694_10309862 Ga0207694_103098622 209
938 3300025924 Ga0207694_10314326 Ga0207694_103143262 209
939 3300025925 Ga0207650_10446591 Ga0207650_104465912 209
940 3300025926 Ga0207659_10722854 Ga0207659_107228541 209
941 3300025927 Ga0207687_10130102 Ga0207687_101301022 209
942 3300025928 Ga0207700_10113909 Ga0207700_101139093 209
943 3300025928 Ga0207700_10657636 Ga0207700_106576361 209
944 3300025929 Ga0207664_10037596 Ga0207664_100375962 209
945 3300025929 Ga0207664_10260319 Ga0207664_102603192 209
946 3300025929 Ga0207664_10290736 Ga0207664_102907362 209
947 3300025931 Ga0207644_10020240 Ga0207644_100202403 209
948 3300025932 Ga0207690_10002077 Ga0207690_1000207712 209
949 3300025932 Ga0207690_10125035 Ga0207690_101250352 209
950 3300025932 Ga0207690_10401242 Ga0207690_104012421 209
951 3300025933 Ga0207706_10093957 Ga0207706_100939572 209
952 3300025935 Ga0207709_10026143 Ga0207709_100261432 209
953 3300025935 Ga0207709_10066606 Ga0207709_100666062 209
954 3300025935 Ga0207709_10133158 Ga0207709_101331582 209
955 3300025935 Ga0207709_10525710 Ga0207709_105257101 209
956 3300025936 Ga0207670_10147234 Ga0207670_101472342 209
957 3300025936 Ga0207670_10648798 Ga0207670_106487981 209
958 3300025937 Ga0207669_10249923 Ga0207669_102499232 209
959 3300025938 Ga0207704_10002133 Ga0207704_100021338 209
960 3300025938 Ga0207704_10673391 Ga0207704_106733911 209
961 3300025939 Ga0207665_10003452 Ga0207665_100034522 209
962 3300025939 Ga0207665_10008093 Ga0207665_100080932 209
963 3300025939 Ga0207665_10042690 Ga0207665_100426902 209
964 3300025939 Ga0207665_10169939 Ga0207665_101699392 209
965 3300025939 Ga0207665_10247773 Ga0207665_102477732 209
966 3300025940 Ga0207691_10005669 Ga0207691_100056698 209
967 3300025940 Ga0207691_10098084 Ga0207691_100980843 209
968 3300025940 Ga0207691_10383787 Ga0207691_103837871 209
969 3300025940 Ga0207691_10965370 Ga0207691_109653701 209
970 3300025941 Ga0207711_10038629 Ga0207711_100386294 209
971 3300025941 Ga0207711_10771177 Ga0207711_107711772 209
972 3300025942 Ga0207689_10725979 Ga0207689_107259792 209
973 3300025944 Ga0207661_10049557 Ga0207661_100495573 209
974 3300025944 Ga0207661_10054953 Ga0207661_100549532 209
975 3300025944 Ga0207661_10854058 Ga0207661_108540582 209
976 3300025945 Ga0207679_10274138 Ga0207679_102741383 209
977 3300025945 Ga0207679_10363818 Ga0207679_103638182 209
978 3300025949 Ga0207667_10023653 Ga0207667_100236533 209
979 3300025949 Ga0207667_10107430 Ga0207667_101074303 209
980 3300025949 Ga0207667_10177169 Ga0207667_101771692 209
981 3300025949 Ga0207667_10986539 Ga0207667_109865392 209
982 3300025960 Ga0207651_10524926 Ga0207651_105249262 209
983 3300025961 Ga0207712_10068208 Ga0207712_100682082 209
984 3300025961 Ga0207712_10324111 Ga0207712_103241112 209
985 3300025961 Ga0207712_10426204 Ga0207712_104262041 209
986 3300025972 Ga0207668_10005444 Ga0207668_100054444 209
987 3300025972 Ga0207668_10049565 Ga0207668_100495653 209
988 3300025972 Ga0207668_10112239 Ga0207668_101122392 209
989 3300025972 Ga0207668_10224535 Ga0207668_102245352 209
990 3300025972 Ga0207668_10488248 Ga0207668_104882482 209
991 3300025972 Ga0207668_10631345 Ga0207668_106313452 209
992 3300025981 Ga0207640_10307593 Ga0207640_103075931 209
993 3300025986 Ga0207658_10035677 Ga0207658_100356774 209
994 3300025986 Ga0207658_10826463 Ga0207658_108264631 209
995 3300026023 Ga0207677_10182474 Ga0207677_101824742 209
996 3300026023 Ga0207677_10331415 Ga0207677_103314152 209
997 3300026035 Ga0207703_10050438 Ga0207703_100504382 209
998 3300026035 Ga0207703_10094542 Ga0207703_100945422 209
999 3300026035 Ga0207703_10200510 Ga0207703_102005101 209
1000 3300026035 Ga0207703_10253516 Ga0207703_102535161 209
1001 3300026041 Ga0207639_10451984 Ga0207639_104519842 209
1002 3300026041 Ga0207639_10509021 Ga0207639_105090212 209
1003 3300026067 Ga0207678_10016716 Ga0207678_100167167 209
1004 3300026067 Ga0207678_10150623 Ga0207678_101506232 209
1005 3300026075 Ga0207708_10070386 Ga0207708_100703862 209
1006 3300026075 Ga0207708_10078649 Ga0207708_100786492 209
1007 3300026075 Ga0207708_10159293 Ga0207708_101592933 209
1008 3300026078 Ga0207702_10010788 Ga0207702_100107882 209
1009 3300026078 Ga0207702_10474379 Ga0207702_104743793 209
1010 3300026078 Ga0207702_10582698 Ga0207702_105826982 209
1011 3300026078 Ga0207702_10736657 Ga0207702_107366571 209
1012 3300026088 Ga0207641_10065264 Ga0207641_100652643 209
1013 3300026088 Ga0207641_10337251 Ga0207641_103372512 209
1014 3300026088 Ga0207641_10557488 Ga0207641_105574882 209
1015 3300026089 Ga0207648_10010535 Ga0207648_100105355 209
1016 3300026089 Ga0207648_10017971 Ga0207648_100179716 209
1017 3300026089 Ga0207648_10538196 Ga0207648_105381962 209
1018 3300026089 Ga0207648_10708797 Ga0207648_107087971 209
1019 3300026095 Ga0207676_10545478 Ga0207676_105454782 209
1020 3300026116 Ga0207674_10124239 Ga0207674_101242398 209
1021 3300026116 Ga0207674_10150717 Ga0207674_101507173 209
1022 3300026116 Ga0207674_10177820 Ga0207674_101778202 209
1023 3300026118 Ga0207675_100008033 Ga0207675_1000080331 209
1024 3300026118 Ga0207675_100030133 Ga0207675_1000301333 209
1025 3300026118 Ga0207675_100050504 Ga0207675_1000505043 209
1026 3300026118 Ga0207675_100187202 Ga0207675_1001872024 209
1027 3300026121 Ga0207683_10000755 Ga0207683_100007552 209
1028 3300026121 Ga0207683_10095342 Ga0207683_100953422 209
1029 3300026121 Ga0207683_10309790 Ga0207683_103097904 209
1030 3300026142 Ga0207698_11196600 Ga0207698_111966001 209
1031 3300027296 Ga0209389_1000057 Ga0209389_100005774 209
1032 3300027296 Ga0209389_1000083 Ga0209389_100008344 209
1033 3300027357 Ga0209589_1000097 Ga0209589_100009744 209
1034 3300027361 Ga0209489_100105 Ga0209489_10010570 209
1035 3300027361 Ga0209489_100226 Ga0209489_10022663 209
1036 3300027363 Ga0209700_100085 Ga0209700_10008591 209
1037 3300027512 Ga0209179_1043892 Ga0209179_10438921 209
1038 3300027671 Ga0209588_1008313 Ga0209588_10083133 209
1039 3300027671 Ga0209588_1086926 Ga0209588_10869262 209
1040 3300027866 Ga0209813_10000296 Ga0209813_1000029610 209
1041 3300027866 Ga0209813_10014453 Ga0209813_100144534 209
1042 3300027907 Ga0207428_10337634 Ga0207428_103376342 209
1043 3300028379 Ga0268266_10005077 Ga0268266_100050779 209
1044 3300028379 Ga0268266_10025505 Ga0268266_100255052 209
1045 3300028379 Ga0268266_10169497 Ga0268266_101694972 209
1046 3300028379 Ga0268266_10191908 Ga0268266_101919082 209
1047 3300028379 Ga0268266_10315252 Ga0268266_103152522 209
1048 3300028379 Ga0268266_10665923 Ga0268266_106659232 209
1049 3300028380 Ga0268265_10003922 Ga0268265_100039222 209
1050 3300028380 Ga0268265_10006606 Ga0268265_100066066 209
1051 3300028380 Ga0268265_10076812 Ga0268265_100768122 209
1052 3300028380 Ga0268265_10995459 Ga0268265_109954591 209
1053 3300028381 Ga0268264_10000021 Ga0268264_1000002175 209
1054 3300028381 Ga0268264_10000158 Ga0268264_10000158105 209
1055 3300028381 Ga0268264_10000909 Ga0268264_100009094 209
1056 3300028381 Ga0268264_10138891 Ga0268264_101388912 209
1057 3300028381 Ga0268264_10642836 Ga0268264_106428361 209
1058 3300028558 Ga0265326_10002188 Ga0265326_100021882 209
1059 3300028573 Ga0265334_10002607 Ga0265334_100026072 209
1060 3300028573 Ga0265334_10093049 Ga0265334_100930492 209
1061 3300028577 Ga0265318_10002810 Ga0265318_100028106 209
1062 3300028577 Ga0265318_10022359 Ga0265318_100223592 209
1063 3300028577 Ga0265318_10050572 Ga0265318_100505721 209
1064 3300028653 Ga0265323_10006127 Ga0265323_100061273 209
1065 3300028666 Ga0265336_10001608 Ga0265336_100016086 209
1066 3300028786 Ga0307517_10000008 Ga0307517_10000008143 209
1067 3300028786 Ga0307517_10140654 Ga0307517_101406544 209
1068 3300028794 Ga0307515_10025060 Ga0307515_1002506011 209
1069 3300028800 Ga0265338_10000667 Ga0265338_1000066729 209
1070 3300029957 Ga0265324_10009512 Ga0265324_100095124 209
1071 3300030083 Ga0237817_10071 Ga0237817_1007117 209
1072 3300030521 Ga0307511_10013403 Ga0307511_100134032 209
1073 3300031235 Ga0265330_10024167 Ga0265330_100241673 209
1074 3300031235 Ga0265330_10067445 Ga0265330_100674452 209
1075 3300031235 Ga0265330_10211412 Ga0265330_102114121 209
1076 3300031238 Ga0265332_10096717 Ga0265332_100967172 209
1077 3300031239 Ga0265328_10016381 Ga0265328_100163812 209
1078 3300031241 Ga0265325_10020714 Ga0265325_100207143 209
1079 3300031241 Ga0265325_10253193 Ga0265325_102531931 209
1080 3300031247 Ga0265340_10002126 Ga0265340_100021262 209
1081 3300031247 Ga0265340_10036882 Ga0265340_100368822 209
1082 3300031247 Ga0265340_10070901 Ga0265340_100709012 209
1083 3300031247 Ga0265340_10076407 Ga0265340_100764072 209
1084 3300031247 Ga0265340_10245991 Ga0265340_102459911 209
1085 3300031249 Ga0265339_10003572 Ga0265339_100035726 209
1086 3300031249 Ga0265339_10034980 Ga0265339_100349801 209
1087 3300031249 Ga0265339_10092389 Ga0265339_100923891 209
1088 3300031250 Ga0265331_10003787 Ga0265331_100037873 209
1089 3300031250 Ga0265331_10006365 Ga0265331_100063655 209
1090 3300031250 Ga0265331_10085332 Ga0265331_100853322 209
1091 3300031251 Ga0265327_10000539 Ga0265327_1000053942 209
1092 3300031344 Ga0265316_10020290 Ga0265316_100202905 209
1093 3300031344 Ga0265316_10075672 Ga0265316_100756722 209
1094 3300031344 Ga0265316_10682219 Ga0265316_106822191 209
1095 3300031344 Ga0265316_10718282 Ga0265316_107182821 209
1096 3300031456 Ga0307513_10099941 Ga0307513_100999411 209
1097 3300031456 Ga0307513_10547725 Ga0307513_105477251 209
1098 3300031507 Ga0307509_10007761 Ga0307509_100077614 209
1099 3300031507 Ga0307509_10043851 Ga0307509_100438512 209
1100 3300031548 Ga0307408_100221688 Ga0307408_1002216882 209
1101 3300031548 Ga0307408_100842309 Ga0307408_1008423091 209
1102 3300031595 Ga0265313_10001592 Ga0265313_100015928 209
1103 3300031595 Ga0265313_10006801 Ga0265313_100068013 209
1104 3300031595 Ga0265313_10018863 Ga0265313_100188633 209
1105 3300031595 Ga0265313_10041246 Ga0265313_100412462 209
1106 3300031595 Ga0265313_10050697 Ga0265313_100506973 209
1107 3300031595 Ga0265313_10064449 Ga0265313_100644491 209
1108 3300031616 Ga0307508_10000184 Ga0307508_1000018443 209
1109 3300031616 Ga0307508_10013800 Ga0307508_100138003 209
1110 3300031616 Ga0307508_10024747 Ga0307508_100247473 209
1111 3300031616 Ga0307508_10216007 Ga0307508_102160072 209
1112 3300031665 Ga0316575_10066360 Ga0316575_100663601 209
1113 3300031711 Ga0265314_10003493 Ga0265314_100034936 209
1114 3300031711 Ga0265314_10008911 Ga0265314_100089114 209
1115 3300031711 Ga0265314_10010252 Ga0265314_100102523 209
1116 3300031711 Ga0265314_10026502 Ga0265314_100265021 209
1117 3300031711 Ga0265314_10044930 Ga0265314_100449301 209
1118 3300031711 Ga0265314_10132596 Ga0265314_101325962 209
1119 3300031711 Ga0265314_10137113 Ga0265314_101371132 209
1120 3300031711 Ga0265314_10140576 Ga0265314_101405762 209
1121 3300031711 Ga0265314_10172036 Ga0265314_101720361 209
1122 3300031711 Ga0265314_10189851 Ga0265314_101898511 209
1123 3300031712 Ga0265342_10003953 Ga0265342_100039538 209
1124 3300031712 Ga0265342_10013043 Ga0265342_100130435 209
1125 3300031712 Ga0265342_10026766 Ga0265342_100267663 209
1126 3300031712 Ga0265342_10292260 Ga0265342_102922601 209
1127 3300031730 Ga0307516_10012710 Ga0307516_100127104 209
1128 3300031730 Ga0307516_10355250 Ga0307516_103552502 209
1129 3300031852 Ga0307410_10372605 Ga0307410_103726052 209
1130 3300031889 Ga0326468_10002461 Ga0326468_100024611 209
1131 3300031901 Ga0307406_10007985 Ga0307406_100079853 209
1132 3300031901 Ga0307406_10981947 Ga0307406_109819471 209
1133 3300031903 Ga0307407_10031773 Ga0307407_100317733 209
1134 3300031995 Ga0307409_100363645 Ga0307409_1003636452 209
1135 3300032002 Ga0307416_100041543 Ga0307416_1000415432 209
1136 3300032002 Ga0307416_100061274 Ga0307416_1000612742 209
1137 3300032002 Ga0307416_101346609 Ga0307416_1013466092 209
1138 3300032004 Ga0307414_10059903 Ga0307414_100599032 209
1139 3300032004 Ga0307414_10202858 Ga0307414_102028582 209
1140 3300032004 Ga0307414_10350682 Ga0307414_103506822 209
1141 3300032126 Ga0307415_100152714 Ga0307415_1001527142 209
1142 3300032126 Ga0307415_100199571 Ga0307415_1001995712 209
1143 3300032126 Ga0307415_100737647 Ga0307415_1007376471 209
1144 3300033179 Ga0307507_10063835 Ga0307507_100638352 209
1145 3300033179 Ga0307507_10255242 Ga0307507_102552422 209
1146 3300033180 Ga0307510_10003242 Ga0307510_1000324214 209
1147 3300033180 Ga0307510_10003590 Ga0307510_1000359019 209
1148 3300033180 Ga0307510_10099597 Ga0307510_100995975 209
1149 3300035083 Ga0373926_0005666 Ga0373926_0005666_894_1529 209
1150 3300035113 Ga0373936_0053817 Ga0373936_0053817_874_1515 209
1151 3300035117 Ga0373953_0132028 Ga0373953_0132028_45_683 209
1152 3300035119 Ga0373956_0062435 Ga0373956_0062435_127_765 209
1153 3300035120 Ga0373957_0003459 Ga0373957_0003459_2603_3241 209
1154 3300035171 Ga0373946_0360026 Ga0373946_0360026_56_694 209
1155 3300035172 Ga0373955_0051120 Ga0373955_0051120_177_815 209
1156 3300035410 Ga0373924_0003807 Ga0373924_0003807_139_777 209
1157 3300035691 Ga0373931_0336080 Ga0373931_0336080_66_701 209
1158 3300035691 Ga0373931_0361234 Ga0373931_0361234_47_685 209
1159 3300035691 Ga0373931_0654474 Ga0373931_0654474_22_651 209
1160 3300035692 Ga0373935_0083060 Ga0373935_0083060_580_1215 209
1161 3300035692 Ga0373935_0153275 Ga0373935_0153275_724_1359 209
1162 3300035692 Ga0373935_0325993 Ga0373935_0325993_257_895 209
1163 3300035692 Ga0373935_0485164 Ga0373935_0485164_94_723 209
1164 3300035695 Ga0373927_0022539 Ga0373927_0022539_2495_3127 209
1165 3300035695 Ga0373927_0026045 Ga0373927_0026045_2722_3363 209
1166 3300035695 Ga0373927_0030308 Ga0373927_0030308_2375_3010 209
1167 3300035695 Ga0373927_0128707 Ga0373927_0128707_388_1023 209
1168 3300035695 Ga0373927_0179436 Ga0373927_0179436_680_1315 209
1169 3300035724 Ga0373933_0353323 Ga0373933_0353323_109_747 209
1170 3300035725 Ga0373947_0531977 Ga0373947_0531977_48_686 209
1171 3300036401 Ga0373937_0055118 Ga0373937_0055118_781_1410 209
1172 3300036401 Ga0373937_0150953 Ga0373937_0150953_585_1220 209
1173 3300036401 Ga0373937_0218966 Ga0373937_0218966_732_1370 209
1174 3300036401 Ga0373937_0386260 Ga0373937_0386260_97_726 209
1175 3300036401 Ga0373937_0650628 Ga0373937_0650628_289_918 209
1176 3300036401 Ga0373937_1218146 Ga0373937_1218146_24_662 209
1177 3300036459 Ga0372808_002239 Ga0372808_002239_1187_1822 209
1178 3300037068 Ga0373925_0110789 Ga0373925_0110789_1009_1650 209
1179 3300037068 Ga0373925_0142985 Ga0373925_0142985_213_851 209
1180 3300037068 Ga0373925_0283358 Ga0373925_0283358_246_884 209
1181 3300037068 Ga0373925_0473705 Ga0373925_0473705_158_787 209
1182 3300037068 Ga0373925_0680739 Ga0373925_0680739_191_820 209
1183 3300037312 Ga0395899_0001159 Ga0395899_0001159_16342_16980 209
1184 3300037312 Ga0395899_0011006 Ga0395899_0011006_4481_5119 209
1185 3300037312 Ga0395899_0070194 Ga0395899_0070194_381_1010 209
1186 3300037312 Ga0395899_0092039 Ga0395899_0092039_1247_1885 209
1187 3300037312 Ga0395899_0164827 Ga0395899_0164827_615_1250 209
1188 3300037312 Ga0395899_0188373 Ga0395899_0188373_550_1191 209
1189 3300037418 Ga0395900_0004505 Ga0395900_0004505_2604_3239 209
1190 3300037418 Ga0395900_0004870 Ga0395900_0004870_9359_9997 209
1191 3300037418 Ga0395900_0007092 Ga0395900_0007092_7481_8119 209
1192 3300037418 Ga0395900_0007882 Ga0395900_0007882_9438_10076 209
1193 3300037418 Ga0395900_0205599 Ga0395900_0205599_309_950 209
1194 3300037418 Ga0395900_0400546 Ga0395900_0400546_95_724 209
1195 3300037466 Ga0395898_0002205 Ga0395898_0002205_9977_10615 209
1196 3300037466 Ga0395898_0002340 Ga0395898_0002340_13390_14028 209
1197 3300037466 Ga0395898_0006553 Ga0395898_0006553_306_941 209
1198 3300037471 Ga0395905_0011090 Ga0395905_0011090_4901_5536 209
1199 3300037471 Ga0395905_0076407 Ga0395905_0076407_1913_2548 209
1200 3300037471 Ga0395905_0115269 Ga0395905_0115269_258_887 209
1201 3300037471 Ga0395905_0492751 Ga0395905_0492751_243_878 209
1202 3300037471 Ga0395905_1008018 Ga0395905_1008018_16_654 209
1203 3300037853 Ga0436364_0729208 Ga0436364_0729208_105_734 209
1204 3300037853 Ga0436364_0863831 Ga0436364_0863831_12_641 209
1205 3300037853 Ga0436364_1046819 Ga0436364_1046819_17_658 209
1206 3300037853 Ga0436364_1211238 Ga0436364_1211238_388_1023 209
1207 3300038443 Ga0395901_0001255 Ga0395901_0001255_12458_13096 209
1208 3300038443 Ga0395901_0002098 Ga0395901_0002098_15526_16164 209
1209 3300038443 Ga0395901_0004054 Ga0395901_0004054_7727_8365 209
1210 3300038443 Ga0395901_0017180 Ga0395901_0017180_1900_2538 209
1211 3300038443 Ga0395901_0159461 Ga0395901_0159461_473_1108 209
1212 3300038443 Ga0395901_0234083 Ga0395901_0234083_44_679 209
1213 3300038705 Ga0237819_01648 Ga0237819_01648_805_1434 209
1214 3300038705 Ga0237819_03074 Ga0237819_03074_1639_2268 209
1215 3300039062 Ga0400483_162571 Ga0400483_162571_178_807 209
1216 3300039062 Ga0400483_230547 Ga0400483_230547_470_1099 209
1217 3300039062 Ga0400483_232283 Ga0400483_232283_1016_1666 209
1218 3300039437 Ga0436365_0297386 Ga0436365_0297386_464_1099 209
1219 3300039437 Ga0436365_0862833 Ga0436365_0862833_74806_75438 209
1220 3300039437 Ga0436365_0904767 Ga0436365_0904767_244_873 209
1221 3300039437 Ga0436365_1259102 Ga0436365_1259102_48021_48650 209
1222 3300039437 Ga0436365_1361494 Ga0436365_1361494_2406_3041 209
1223 3300039437 Ga0436365_1399381 Ga0436365_1399381_116_751 209
1224 3300039437 Ga0436365_1412995 Ga0436365_1412995_27_665 209
1225 3300039437 Ga0436365_1505352 Ga0436365_1505352_1714_2343 209
1226 3300039438 Ga0436360_0092664 Ga0436360_0092664_867_1502 209
1227 3300039438 Ga0436360_0289993 Ga0436360_0289993_189_821 209
1228 3300039438 Ga0436360_0314853 Ga0436360_0314853_4125_4757 209
1229 3300039438 Ga0436360_0800977 Ga0436360_0800977_248_883 209
1230 3300039438 Ga0436360_1276686 Ga0436360_1276686_100_729 209
1231 3300039447 Ga0436361_0229945 Ga0436361_0229945_1485_2117 209
1232 3300039447 Ga0436361_0391251 Ga0436361_0391251_451_1083 209
1233 3300039447 Ga0436361_0491334 Ga0436361_0491334_364_1002 209
1234 3300039447 Ga0436361_0830107 Ga0436361_0830107_1348_1977 209
1235 3300039450 Ga0436363_0877282 Ga0436363_0877282_272_910 209
1236 3300039450 Ga0436363_1266422 Ga0436363_1266422_132_761 209
1237 3300039450 Ga0436363_1400984 Ga0436363_1400984_2523_3158 209
1238 3300039450 Ga0436363_1409784 Ga0436363_1409784_123_752 209
1239 3300039450 Ga0436363_1420176 Ga0436363_1420176_75_710 209
1240 3300039453 Ga0436362_0949954 Ga0436362_0949954_28464_29096 209
1241 3300039453 Ga0436362_1231252 Ga0436362_1231252_175_807 209
1242 3300041451 Ga0451791_0196258 Ga0451791_0196258_502_1137 209
1243 3300041453 Ga0451797_0142036 Ga0451797_0142036_540_1175 209
1244 3300041460 Ga0451802_1663335 Ga0451802_1663335_216_851 209
1245 3300041498 Ga0451841_0626317 Ga0451841_0626317_41_676 209
1246 3300041511 Ga0451855_0157495 Ga0451855_0157495_374_1003 209
1247 3300042002 Ga0439442_025710 Ga0439442_025710_537_1175 209
1248 3300042007 Ga0439449_0003421 Ga0439449_0003421_4266_4895 209
1249 3300042015 Ga0439462_0130740 Ga0439462_0130740_38_667 209
1250 3300042134 Ga0450898_011683 Ga0450898_011683_511_1140 209
1251 3300042438 Ga0439459_0003351 Ga0439459_0003351_1771_2400 209
1252 3300042876 Ga0451577_0264940 Ga0451577_0264940_352_996 209
1253 3300044656 Ga0466969_0012669 Ga0466969_0012669_924_1553 209
1254 3300044656 Ga0466969_0022851 Ga0466969_0022851_1564_2199 209
1255 3300044658 Ga0466972_0000702 Ga0466972_0000702_3892_4527 209
1256 3300044658 Ga0466972_0020059 Ga0466972_0020059_718_1353 209
1257 3300044658 Ga0466972_0028369 Ga0466972_0028369_1327_1962 209
1258 3300044673 Ga0453683_0068854 Ga0453683_0068854_542_1240 209
1259 3300044684 Ga0466966_0257824 Ga0466966_0257824_343_978 209
1260 3300044693 Ga0466961_0000359 Ga0466961_0000359_24180_24815 209
1261 3300044693 Ga0466961_0452019 Ga0466961_0452019_79_714 209
1262 3300044694 Ga0466963_0007691 Ga0466963_0007691_1323_1961 209
1263 3300044694 Ga0466963_0034178 Ga0466963_0034178_1046_1681 209
1264 3300044706 Ga0466964_0146541 Ga0466964_0146541_30_665 209
1265 3300044706 Ga0466964_0148531 Ga0466964_0148531_174_803 209
1266 3300044706 Ga0466964_0350923 Ga0466964_0350923_13_681 209
1267 3300044712 Ga0453684_0009814 Ga0453684_0009814_5277_5921 209
1268 3300044712 Ga0453684_0015205 Ga0453684_0015205_3690_4334 209
1269 3300044712 Ga0453684_0255034 Ga0453684_0255034_917_1564 209
1270 3300044735 Ga0466968_0073219 Ga0466968_0073219_357_998 209
1271 3300044735 Ga0466968_0111331 Ga0466968_0111331_228_863 209
1272 3300044765 Ga0466970_0153259 Ga0466970_0153259_576_1241 209
1273 3300044765 Ga0466970_0355302 Ga0466970_0355302_79_708 209
1274 3300044765 Ga0466970_0389531 Ga0466970_0389531_54_689 209
1275 3300044765 Ga0466970_0394039 Ga0466970_0394039_99_728 209
1276 3300044842 Ga0466957_0158787 Ga0466957_0158787_818_1453 209
1277 3300045049 Ga0466959_0003116 Ga0466959_0003116_5015_5650 209
1278 3300045049 Ga0466959_0010713 Ga0466959_0010713_3502_4131 209
1279 3300045049 Ga0466959_0026644 Ga0466959_0026644_2534_3169 209
1280 3300045049 Ga0466959_0061588 Ga0466959_0061588_698_1327 209
1281 3300045049 Ga0466959_0113172 Ga0466959_0113172_41_673 209
1282 3300045051 Ga0451576_0004179 Ga0451576_0004179_7575_8222 209
1283 3300045051 Ga0451576_0273966 Ga0451576_0273966_839_1471 209
1284 3300045836 Ga0466958_0064331 Ga0466958_0064331_486_1115 209
1285 3300045836 Ga0466958_0160788 Ga0466958_0160788_485_1114 209
1286 3300045836 Ga0466958_0236623 Ga0466958_0236623_83_718 209
1287 3300045836 Ga0466958_0441706 Ga0466958_0441706_92_727 209
1288 3300045976 Ga0466967_0000079 Ga0466967_0000079_13905_14534 209
1289 3300045976 Ga0466967_0282289 Ga0466967_0282289_528_1163 209
1290 3300045976 Ga0466967_0438093 Ga0466967_0438093_637_1266 209
1291 3300046452 Ga0495617_018456 Ga0495617_018456_1177_1812 209
1292 3300046452 Ga0495617_055985 Ga0495617_055985_363_998 209
1293 3300046454 Ga0495592_0358320 Ga0495592_0358320_275_913 209
1294 3300046455 Ga0495603_0009099 Ga0495603_0009099_949_1623 209
1295 3300046455 Ga0495603_0020396 Ga0495603_0020396_1885_2514 209
1296 3300046455 Ga0495603_0180948 Ga0495603_0180948_350_985 209
1297 3300046457 Ga0495590_0027387 Ga0495590_0027387_370_1005 209
1298 3300046457 Ga0495590_0192929 Ga0495590_0192929_56_685 209
1299 3300046459 Ga0495629_0099345 Ga0495629_0099345_665_1339 209
1300 3300046460 Ga0495638_0000413 Ga0495638_0000413_3640_4269 209
1301 3300046460 Ga0495638_0000547 Ga0495638_0000547_7780_8409 209
1302 3300046460 Ga0495638_0005379 Ga0495638_0005379_4372_5001 209
1303 3300046460 Ga0495638_0009130 Ga0495638_0009130_3811_4446 209
1304 3300046460 Ga0495638_0200613 Ga0495638_0200613_446_1087 209
1305 3300046460 Ga0495638_0315614 Ga0495638_0315614_64_699 209
1306 3300046461 Ga0495641_0099339 Ga0495641_0099339_616_1251 209
1307 3300046462 Ga0495651_0053435 Ga0495651_0053435_1050_1685 209
1308 3300046462 Ga0495651_0089752 Ga0495651_0089752_1393_2031 209
1309 3300046462 Ga0495651_0199099 Ga0495651_0199099_175_810 209
1310 3300046462 Ga0495651_0331429 Ga0495651_0331429_171_800 209
1311 3300046463 Ga0495653_0096827 Ga0495653_0096827_1169_1807 209
1312 3300046471 Ga0495650_0000020 Ga0495650_0000020_312182_312811 209
1313 3300046472 Ga0495580_0376078 Ga0495580_0376078_227_856 209
1314 3300046473 Ga0495582_0304869 Ga0495582_0304869_171_806 209
1315 3300046474 Ga0495605_0190260 Ga0495605_0190260_123_758 209
1316 3300046475 Ga0495639_0058838 Ga0495639_0058838_838_1473 209
1317 3300046476 Ga0495662_0093608 Ga0495662_0093608_40_675 209
1318 3300046477 Ga0495664_0017425 Ga0495664_0017425_685_1320 209
1319 3300046477 Ga0495664_0075557 Ga0495664_0075557_50_688 209
1320 3300046491 Ga0495584_0102596 Ga0495584_0102596_226_861 209
1321 3300046491 Ga0495584_0196399 Ga0495584_0196399_328_963 209
1322 3300046492 Ga0495585_0043001 Ga0495585_0043001_58_687 209
1323 3300046492 Ga0495585_0164099 Ga0495585_0164099_303_977 209
1324 3300046492 Ga0495585_0194741 Ga0495585_0194741_214_843 209
1325 3300046499 Ga0495594_0032506 Ga0495594_0032506_809_1483 209
1326 3300046499 Ga0495594_0182714 Ga0495594_0182714_31_666 209
1327 3300046500 Ga0495596_0036246 Ga0495596_0036246_206_841 209
1328 3300046501 Ga0495607_0047785 Ga0495607_0047785_1723_2451 209
1329 3300046506 Ga0495583_0000001 Ga0495583_0000001_83479_84108 209
1330 3300046507 Ga0495606_0010700 Ga0495606_0010700_5078_5707 209
1331 3300046511 Ga0495608_0078112 Ga0495608_0078112_702_1337 209
1332 3300046512 Ga0495610_0000056 Ga0495610_0000056_97694_98323 209
1333 3300046512 Ga0495610_0004429 Ga0495610_0004429_572_1201 209
1334 3300046512 Ga0495610_0005750 Ga0495610_0005750_7074_7703 209
1335 3300046513 Ga0495616_0000254 Ga0495616_0000254_23099_23728 209
1336 3300046514 Ga0495618_0110920 Ga0495618_0110920_815_1450 209
1337 3300046514 Ga0495618_0115264 Ga0495618_0115264_1016_1654 209
1338 3300046515 Ga0495620_0066723 Ga0495620_0066723_159_788 209
1339 3300046515 Ga0495620_0072441 Ga0495620_0072441_207_842 209
1340 3300046516 Ga0495628_0162046 Ga0495628_0162046_889_1527 209
1341 3300046517 Ga0495630_0726175 Ga0495630_0726175_95_733 209
1342 3300046518 Ga0495631_0126324 Ga0495631_0126324_330_965 209
1343 3300046518 Ga0495631_0287262 Ga0495631_0287262_25_660 209
1344 3300046519 Ga0495632_0001149 Ga0495632_0001149_652_1281 209
1345 3300046519 Ga0495632_0007628 Ga0495632_0007628_255_884 209
1346 3300046519 Ga0495632_0202204 Ga0495632_0202204_154_789 209
1347 3300046520 Ga0495637_0070240 Ga0495637_0070240_677_1306 209
1348 3300046522 Ga0495643_0014223 Ga0495643_0014223_3565_4200 209
1349 3300046524 Ga0495648_0000130 Ga0495648_0000130_9162_9791 209
1350 3300046524 Ga0495648_0019710 Ga0495648_0019710_1187_1816 209
1351 3300046524 Ga0495648_0266006 Ga0495648_0266006_84_725 209
1352 3300046525 Ga0495663_0034886 Ga0495663_0034886_712_1341 209
1353 3300046525 Ga0495663_0060364 Ga0495663_0060364_160_789 209
1354 3300046526 Ga0495666_0163109 Ga0495666_0163109_316_990 209
1355 3300046529 Ga0495652_0210660 Ga0495652_0210660_46_684 209
1356 3300046529 Ga0495652_0287465 Ga0495652_0287465_115_744 209
1357 3300046530 Ga0495654_0000010 Ga0495654_0000010_36872_37501 209
1358 3300046533 Ga0495640_0368059 Ga0495640_0368059_24_662 209
1359 3300046535 Ga0495586_0104772 Ga0495586_0104772_551_1189 209
1360 3300046535 Ga0495586_0152938 Ga0495586_0152938_565_1200 209
1361 3300046536 Ga0495587_0006206 Ga0495587_0006206_3184_3819 209
1362 3300046536 Ga0495587_0031030 Ga0495587_0031030_2286_2924 209
1363 3300046537 Ga0495598_0048538 Ga0495598_0048538_288_962 209
1364 3300046538 Ga0495609_0087918 Ga0495609_0087918_153_788 209
1365 3300046542 Ga0495597_0137797 Ga0495597_0137797_14_655 209
1366 3300046543 Ga0495645_0040795 Ga0495645_0040795_1385_2020 209
1367 3300046557 Ga0495622_0005097 Ga0495622_0005097_5381_6016 209
1368 3300046557 Ga0495622_0035148 Ga0495622_0035148_1144_1779 209
1369 3300046557 Ga0495622_0149554 Ga0495622_0149554_97_726 209
1370 3300046559 Ga0495667_0010326 Ga0495667_0010326_1841_2476 209
1371 3300046559 Ga0495667_0080493 Ga0495667_0080493_13_651 209
1372 3300046615 Ga0495656_0180597 Ga0495656_0180597_100_729 209
1373 3300046616 Ga0495668_0000060 Ga0495668_0000060_121934_122563 209
1374 3300046616 Ga0495668_0004514 Ga0495668_0004514_3328_3957 209
1375 3300046616 Ga0495668_0033084 Ga0495668_0033084_1540_2169 209
1376 3300046642 Ga0495634_0085375 Ga0495634_0085375_1134_1769 209
1377 3300046642 Ga0495634_0270058 Ga0495634_0270058_172_810 209
1378 3300046660 Ga0495625_0000165 Ga0495625_0000165_75866_76495 209
1379 3300046660 Ga0495625_0001352 Ga0495625_0001352_8277_8906 209
1380 3300046660 Ga0495625_0004210 Ga0495625_0004210_9926_10555 209
1381 3300046660 Ga0495625_0016705 Ga0495625_0016705_4566_5195 209
1382 3300046660 Ga0495625_0048877 Ga0495625_0048877_2312_2953 209
1383 3300046660 Ga0495625_0427619 Ga0495625_0427619_145_786 209
1384 3300046663 Ga0495635_0013096 Ga0495635_0013096_1450_2085 209
1385 3300046665 Ga0495661_0282195 Ga0495661_0282195_59_688 209
1386 3300046674 Ga0495588_0117184 Ga0495588_0117184_584_1258 209
1387 3300046675 Ga0495657_0025104 Ga0495657_0025104_1448_2086 209
1388 3300046675 Ga0495657_0042461 Ga0495657_0042461_207_842 209
1389 3300046678 Ga0495599_0009207 Ga0495599_0009207_3470_4105 209
1390 3300046679 Ga0495623_0029108 Ga0495623_0029108_1607_2245 209
1391 3300046679 Ga0495623_0069084 Ga0495623_0069084_917_1552 209
1392 3300046680 Ga0495646_0038536 Ga0495646_0038536_1809_2444 209
1393 3300046683 Ga0495658_0149623 Ga0495658_0149623_68_709 209
1394 3300046683 Ga0495658_0184829 Ga0495658_0184829_377_1012 209
1395 3300046689 Ga0495613_0058830 Ga0495613_0058830_1714_2349 209
1396 3300046689 Ga0495613_0210780 Ga0495613_0210780_300_938 209
1397 3300046692 Ga0495671_0149733 Ga0495671_0149733_43_717 209
1398 3300046694 Ga0495649_0233491 Ga0495649_0233491_38_667 209
1399 3300046794 Ga0495589_0005117 Ga0495589_0005117_5904_6533 209
1400 3300046809 Ga0495600_0014837 Ga0495600_0014837_1222_1857 209
1401 3300046810 Ga0495660_0004395 Ga0495660_0004395_7354_7983 209
1402 3300046810 Ga0495660_0025337 Ga0495660_0025337_1904_2533 209
1403 3300046810 Ga0495660_0031813 Ga0495660_0031813_243_872 209
1404 3300046810 Ga0495660_0173136 Ga0495660_0173136_145_780 209
1405 3300047315 Ga0495581_0019611 Ga0495581_0019611_3170_3805 209
1406 3300047315 Ga0495581_0084750 Ga0495581_0084750_607_1242 209
1407 3300047317 Ga0495604_0038890 Ga0495604_0038890_2859_3494 209
1408 3300047317 Ga0495604_0097241 Ga0495604_0097241_1331_1969 209
1409 3300047317 Ga0495604_0417937 Ga0495604_0417937_200_835 209
1410 3300047317 Ga0495604_0645215 Ga0495604_0645215_30_665 209
1411 3300047318 Ga0495636_0041867 Ga0495636_0041867_937_1566 209
1412 3300047318 Ga0495636_0103030 Ga0495636_0103030_243_914 209
1413 3300047319 Ga0495674_0046939 Ga0495674_0046939_2875_3510 209
1414 3300047319 Ga0495674_0072008 Ga0495674_0072008_736_1482 209
1415 3300047319 Ga0495674_0741919 Ga0495674_0741919_89_724 209
1416 3300047320 Ga0495672_0001149 Ga0495672_0001149_4681_5310 209
1417 3300047320 Ga0495672_0018868 Ga0495672_0018868_1797_2432 209
1418 3300047321 Ga0495676_0027294 Ga0495676_0027294_1038_1673 209
1419 3300047321 Ga0495676_0139474 Ga0495676_0139474_533_1162 209
1420 3300047321 Ga0495676_0201161 Ga0495676_0201161_484_1119 209
1421 3300047321 Ga0495676_0400391 Ga0495676_0400391_135_809 209
1422 3300047322 Ga0495680_0029995 Ga0495680_0029995_1043_1678 209
1423 3300047322 Ga0495680_0070345 Ga0495680_0070345_1269_1907 209
1424 3300047323 Ga0495683_0006700 Ga0495683_0006700_1256_1885 209
1425 3300047323 Ga0495683_0131317 Ga0495683_0131317_522_1157 209
1426 3300047443 Ga0495687_064312 Ga0495687_064312_713_1348 209
1427 3300047444 Ga0495675_0002428 Ga0495675_0002428_2288_2923 209
1428 3300047444 Ga0495675_0046076 Ga0495675_0046076_1439_2077 209
1429 3300047445 Ga0495677_0133971 Ga0495677_0133971_197_832 209
1430 3300047446 Ga0495679_004273 Ga0495679_004273_3862_4491 209
1431 3300047447 Ga0495685_112874 Ga0495685_112874_41_676 209
1432 3300047469 Ga0495673_0000301 Ga0495673_0000301_14883_15512 209
1433 3300047469 Ga0495673_0000614 Ga0495673_0000614_30493_31122 209
1434 3300047469 Ga0495673_0000701 Ga0495673_0000701_24897_25526 209
1435 3300047470 Ga0495681_0013408 Ga0495681_0013408_2331_2960 209
1436 3300047470 Ga0495681_0080744 Ga0495681_0080744_730_1359 209
1437 3300047470 Ga0495681_0112146 Ga0495681_0112146_248_883 209
1438 3300047471 Ga0495684_0024863 Ga0495684_0024863_3075_3713 209
1439 3300047471 Ga0495684_0146632 Ga0495684_0146632_867_1502 209
1440 3300047472 Ga0495686_0000376 Ga0495686_0000376_61008_61649 209
1441 3300047472 Ga0495686_0033484 Ga0495686_0033484_796_1425 209
1442 3300047472 Ga0495686_0037745 Ga0495686_0037745_2014_2649 209
1443 3300047472 Ga0495686_0046290 Ga0495686_0046290_1263_1892 209
1444 3300047472 Ga0495686_0058044 Ga0495686_0058044_474_1109 209
1445 3300047673 Ga0495593_0051849 Ga0495593_0051849_1253_1888 209
1446 3300048088 Ga0495602_0378351 Ga0495602_0378351_215_853 209
1447 3300048089 Ga0495614_0033782 Ga0495614_0033782_1206_1841 209
1448 3300048090 Ga0495615_0010168 Ga0495615_0010168_964_1593 209
1449 3300048091 Ga0495626_0049774 Ga0495626_0049774_81_716 209
1450 3300048903 Ga0496100_0005212 Ga0496100_0005212_4412_5041 209
1451 3300048903 Ga0496100_0100472 Ga0496100_0100472_1269_1907 209
1452 3300048904 Ga0496101_0032741 Ga0496101_0032741_2095_2730 209
1453 3300048904 Ga0496101_0051844 Ga0496101_0051844_753_1388 209
1454 3300048904 Ga0496101_0227337 Ga0496101_0227337_111_740 209
1455 3300048905 Ga0496102_0017934 Ga0496102_0017934_944_1582 209
1456 3300048905 Ga0496102_0078564 Ga0496102_0078564_821_1456 209
1457 3300048905 Ga0496102_0165696 Ga0496102_0165696_477_1112 209
1458 3300048905 Ga0496102_0326381 Ga0496102_0326381_641_1315 209
1459 3300048905 Ga0496102_0499299 Ga0496102_0499299_104_733 209
1460 3300048905 Ga0496102_0591396 Ga0496102_0591396_208_837 209
1461 3300048906 Ga0496103_0042185 Ga0496103_0042185_1938_2567 209
1462 3300048907 Ga0496104_0002560 Ga0496104_0002560_6916_7545 209
1463 3300048907 Ga0496104_0006343 Ga0496104_0006343_841_1479 209
1464 3300048907 Ga0496104_0138564 Ga0496104_0138564_373_1002 209
1465 3300048907 Ga0496104_0216632 Ga0496104_0216632_312_947 209
1466 3300048908 Ga0496105_0002568 Ga0496105_0002568_6844_7473 209
1467 3300048908 Ga0496105_0014413 Ga0496105_0014413_1232_1867 209
1468 3300048908 Ga0496105_0031649 Ga0496105_0031649_1136_1771 209
1469 3300048908 Ga0496105_0056895 Ga0496105_0056895_2109_2747 209
1470 3300048908 Ga0496105_0210113 Ga0496105_0210113_745_1380 209
1471 3300048909 Ga0496106_0004445 Ga0496106_0004445_108_743 209
1472 3300048909 Ga0496106_0005448 Ga0496106_0005448_7995_8624 209
1473 3300048909 Ga0496106_0033086 Ga0496106_0033086_750_1379 209
1474 3300048910 Ga0496107_0000211 Ga0496107_0000211_18980_19609 209
1475 3300048910 Ga0496107_0001182 Ga0496107_0001182_8897_9526 209
1476 3300048910 Ga0496107_0196142 Ga0496107_0196142_675_1304 209
1477 3300048911 Ga0496108_0001556 Ga0496108_0001556_17174_17803 209
1478 3300048911 Ga0496108_0100359 Ga0496108_0100359_1279_1908 209
1479 3300048911 Ga0496108_0174987 Ga0496108_0174987_278_907 209
1480 3300048912 Ga0496109_0008140 Ga0496109_0008140_2421_3050 209
1481 3300048912 Ga0496109_0056714 Ga0496109_0056714_2335_2964 209
1482 3300048912 Ga0496109_0072533 Ga0496109_0072533_1678_2313 209
1483 3300048912 Ga0496109_0075064 Ga0496109_0075064_187_822 209
1484 3300048912 Ga0496109_0871024 Ga0496109_0871024_153_791 209
1485 3300048913 Ga0496110_0027742 Ga0496110_0027742_2247_2876 209
1486 3300048913 Ga0496110_0032238 Ga0496110_0032238_1958_2587 209
1487 3300048913 Ga0496110_0081598 Ga0496110_0081598_1895_2524 209
1488 3300048913 Ga0496110_0090518 Ga0496110_0090518_1836_2465 209
1489 3300048913 Ga0496110_0129477 Ga0496110_0129477_229_864 209
1490 3300048913 Ga0496110_0234555 Ga0496110_0234555_277_912 209
1491 3300048913 Ga0496110_0298129 Ga0496110_0298129_171_809 209
1492 3300048914 Ga0496111_0046620 Ga0496111_0046620_56_685 209
1493 3300048914 Ga0496111_0076688 Ga0496111_0076688_1437_2075 209
1494 3300048914 Ga0496111_0079711 Ga0496111_0079711_34_669 209
1495 3300048914 Ga0496111_0210340 Ga0496111_0210340_629_1258 209
1496 3300048915 Ga0496112_0008955 Ga0496112_0008955_2108_2737 209
1497 3300048915 Ga0496112_0035225 Ga0496112_0035225_3419_4099 209
1498 3300048915 Ga0496112_0036828 Ga0496112_0036828_2051_2689 209
1499 3300048915 Ga0496112_0067117 Ga0496112_0067117_2355_2984 209
1500 3300048915 Ga0496112_0144015 Ga0496112_0144015_465_1094 209
1501 3300048915 Ga0496112_0195870 Ga0496112_0195870_179_814 209
1502 3300048916 Ga0496113_0057299 Ga0496113_0057299_400_1038 209
1503 3300048916 Ga0496113_0170495 Ga0496113_0170495_417_1052 209
1504 3300048916 Ga0496113_0202783 Ga0496113_0202783_39_668 209
1505 3300048916 Ga0496113_0258680 Ga0496113_0258680_562_1197 209
1506 3300048917 Ga0496114_0070196 Ga0496114_0070196_2245_2883 209
1507 3300048917 Ga0496114_0196330 Ga0496114_0196330_1008_1643 209
1508 3300048917 Ga0496114_1002146 Ga0496114_1002146_49_687 209
1509 3300048918 Ga0496115_0001558 Ga0496115_0001558_6432_7061 209
1510 3300048918 Ga0496115_0017161 Ga0496115_0017161_3523_4152 209
1511 3300048918 Ga0496115_0040034 Ga0496115_0040034_1985_2620 209
1512 3300048918 Ga0496115_0069793 Ga0496115_0069793_1848_2486 209
1513 3300048918 Ga0496115_0080322 Ga0496115_0080322_289_918 209
1514 3300048918 Ga0496115_0112551 Ga0496115_0112551_795_1436 209
1515 3300048918 Ga0496115_0122480 Ga0496115_0122480_1126_1761 209
1516 3300048918 Ga0496115_0157203 Ga0496115_0157203_82_717 209
1517 3300048918 Ga0496115_0202159 Ga0496115_0202159_737_1375 209
1518 3300048918 Ga0496115_0525688 Ga0496115_0525688_245_883 209
1519 3300048918 Ga0496115_0786886 Ga0496115_0786886_17_646 209
1520 3300048919 Ga0496116_0002078 Ga0496116_0002078_15199_15828 209
1521 3300048919 Ga0496116_0093850 Ga0496116_0093850_233_868 209
1522 3300048919 Ga0496116_0164906 Ga0496116_0164906_258_887 209
1523 3300048919 Ga0496116_0225997 Ga0496116_0225997_116_745 209
1524 3300048920 Ga0496117_0031706 Ga0496117_0031706_2619_3248 209
1525 3300048920 Ga0496117_0042985 Ga0496117_0042985_1473_2102 209
1526 3300048920 Ga0496117_0232876 Ga0496117_0232876_70_705 209
1527 3300048920 Ga0496117_0298802 Ga0496117_0298802_80_715 209
1528 3300048921 Ga0496118_0004424 Ga0496118_0004424_11651_12286 209
1529 3300048921 Ga0496118_0138954 Ga0496118_0138954_16_645 209
1530 3300048921 Ga0496118_0243177 Ga0496118_0243177_189_818 209
1531 3300048922 Ga0496119_0017095 Ga0496119_0017095_2818_3447 209
1532 3300048922 Ga0496119_0034837 Ga0496119_0034837_27_656 209
1533 3300048922 Ga0496119_0061238 Ga0496119_0061238_626_1261 209
1534 3300048922 Ga0496119_0074875 Ga0496119_0074875_200_835 209
1535 3300048922 Ga0496119_0194523 Ga0496119_0194523_17_652 209
1536 3300048922 Ga0496119_0198599 Ga0496119_0198599_203_838 209
1537 3300048923 Ga0496120_0005339 Ga0496120_0005339_3907_4542 209
1538 3300048923 Ga0496120_0098903 Ga0496120_0098903_220_849 209
1539 3300048924 Ga0496121_0000595 Ga0496121_0000595_435_1070 209
1540 3300048924 Ga0496121_0005557 Ga0496121_0005557_3847_4476 209
1541 3300048924 Ga0496121_0019434 Ga0496121_0019434_375_1010 209
1542 3300048924 Ga0496121_0061191 Ga0496121_0061191_788_1423 209
1543 3300048924 Ga0496121_0095902 Ga0496121_0095902_848_1483 209
1544 3300048924 Ga0496121_0117010 Ga0496121_0117010_648_1283 209
1545 3300048924 Ga0496121_0147280 Ga0496121_0147280_580_1212 209
1546 3300048924 Ga0496121_0183519 Ga0496121_0183519_400_1074 209
1547 3300048924 Ga0496121_0340274 Ga0496121_0340274_14_643 209
1548 3300048924 Ga0496121_0433533 Ga0496121_0433533_172_801 209
1549 3300048924 Ga0496121_0512225 Ga0496121_0512225_38_673 209
1550 3300048925 Ga0496122_0011522 Ga0496122_0011522_5247_5876 209
1551 3300048925 Ga0496122_0068422 Ga0496122_0068422_50_679 209
1552 3300048925 Ga0496122_0084950 Ga0496122_0084950_709_1338 209
1553 3300048925 Ga0496122_0145149 Ga0496122_0145149_582_1211 209
1554 3300048926 Ga0496123_0032828 Ga0496123_0032828_2208_2837 209
1555 3300048926 Ga0496123_0169186 Ga0496123_0169186_72_701 209
1556 3300048927 Ga0496124_0002134 Ga0496124_0002134_21162_21797 209
1557 3300048927 Ga0496124_0014500 Ga0496124_0014500_2982_3611 209
1558 3300048927 Ga0496124_0040801 Ga0496124_0040801_78_713 209
1559 3300048927 Ga0496124_0077574 Ga0496124_0077574_717_1352 209
1560 3300048927 Ga0496124_0085904 Ga0496124_0085904_421_1050 209
1561 3300048927 Ga0496124_0218560 Ga0496124_0218560_32_661 209
1562 3300048928 Ga0496125_0001760 Ga0496125_0001760_26710_27339 209
1563 3300048928 Ga0496125_0022884 Ga0496125_0022884_1720_2355 209
1564 3300048928 Ga0496125_0029375 Ga0496125_0029375_3605_4234 209
1565 3300048928 Ga0496125_0033411 Ga0496125_0033411_2342_2971 209
1566 3300048928 Ga0496125_0449983 Ga0496125_0449983_13_648 209
1567 3300048929 Ga0496126_0002896 Ga0496126_0002896_4265_4894 209
1568 3300048929 Ga0496126_0003088 Ga0496126_0003088_8687_9316 209
1569 3300048929 Ga0496126_0012315 Ga0496126_0012315_86_721 209
1570 3300048929 Ga0496126_0014870 Ga0496126_0014870_3574_4209 209
1571 3300048929 Ga0496126_0018069 Ga0496126_0018069_4912_5583 209
1572 3300048929 Ga0496126_0024977 Ga0496126_0024977_2747_3385 209
1573 3300048929 Ga0496126_0028712 Ga0496126_0028712_585_1220 209
1574 3300048929 Ga0496126_0035078 Ga0496126_0035078_3494_4132 209
1575 3300048929 Ga0496126_0078078 Ga0496126_0078078_113_742 209
1576 3300048929 Ga0496126_0100566 Ga0496126_0100566_505_1140 209
1577 3300048929 Ga0496126_0110727 Ga0496126_0110727_35_808 209
1578 3300048929 Ga0496126_0232148 Ga0496126_0232148_799_1434 209
1579 3300048929 Ga0496126_0259281 Ga0496126_0259281_340_975 209
1580 3300048929 Ga0496126_0276906 Ga0496126_0276906_580_1209 209
1581 3300048929 Ga0496126_0318425 Ga0496126_0318425_303_938 209
1582 3300048929 Ga0496126_0394044 Ga0496126_0394044_388_1023 209
1583 3300049127 Ga0501306_002656 Ga0501306_002656_1139_1768 209
1584 3300049127 Ga0501306_015137 Ga0501306_015137_134_763 209
1585 3300049129 Ga0501309_003761 Ga0501309_003761_1018_1647 209
1586 3300049130 Ga0501310_023956 Ga0501310_023956_59_688 209
1587 3300049161 Ga0501305_004290 Ga0501305_004290_947_1576 209
1588 3300049162 Ga0501307_002313 Ga0501307_002313_183_812 209
1589 3300049459 Ga0495678_000623 Ga0495678_000623_3659_4288 209
1590 3300049514 Ga0501291_022338 Ga0501291_022338_150_788 209
1591 3300049527 Ga0501311_002113 Ga0501311_002113_90_719 209
1592 3300049528 Ga0501312_004273 Ga0501312_004273_93_722 209
1593 3300049529 Ga0501313_002650 Ga0501313_002650_996_1625 209
1594 3300049529 Ga0501313_023568 Ga0501313_023568_11_640 209
1595 3300049530 Ga0501314_001582 Ga0501314_001582_947_1576 209
1596 3300049531 Ga0501315_002874 Ga0501315_002874_92_721 209
1597 3300049532 Ga0501316_002563 Ga0501316_002563_970_1599 209
1598 3300049532 Ga0501316_011126 Ga0501316_011126_348_977 209
1599 3300049532 Ga0501316_025251 Ga0501316_025251_14_643 209
1600 3300049533 Ga0501317_002615 Ga0501317_002615_947_1576 209
1601 3300049534 Ga0501318_002206 Ga0501318_002206_938_1567 209
1602 3300049535 Ga0501319_000753 Ga0501319_000753_90_719 209
1603 3300049536 Ga0501320_001493 Ga0501320_001493_88_717 209
1604 3300049537 Ga0501321_002190 Ga0501321_002190_947_1576 209
1605 3300049538 Ga0501322_000622 Ga0501322_000622_90_719 209
1606 3300049539 Ga0501323_003195 Ga0501323_003195_83_712 209
1607 3300049540 Ga0501324_002767 Ga0501324_002767_82_711 209
1608 3300049542 Ga0501326_00418 Ga0501326_00418_951_1580 209
1609 3300049544 Ga0501328_00536 Ga0501328_00536_79_708 209
1610 3300049546 Ga0501330_001178 Ga0501330_001178_69_698 209
1611 3300049551 Ga0501335_001915 Ga0501335_001915_79_708 209
1612 3300049551 Ga0501335_007363 Ga0501335_007363_300_929 209
1613 3300049568 Ga0501031_0017200 Ga0501031_0017200_2911_3552 209
1614 3300049568 Ga0501031_0162521 Ga0501031_0162521_570_1199 209
1615 3300049569 Ga0501032_0013398 Ga0501032_0013398_3069_3698 209
1616 3300049569 Ga0501032_0086860 Ga0501032_0086860_615_1256 209
1617 3300049570 Ga0501033_0020362 Ga0501033_0020362_3187_3816 209
1618 3300049570 Ga0501033_0239388 Ga0501033_0239388_491_1129 209
1619 3300049570 Ga0501033_0510540 Ga0501033_0510540_26_655 209
1620 3300049571 Ga0501034_0004953 Ga0501034_0004953_1453_2091 209
1621 3300049571 Ga0501034_0007894 Ga0501034_0007894_352_981 209
1622 3300049571 Ga0501034_0008566 Ga0501034_0008566_1780_2418 209
1623 3300049571 Ga0501034_0041632 Ga0501034_0041632_1033_1662 209
1624 3300049571 Ga0501034_0075309 Ga0501034_0075309_37_666 209
1625 3300049571 Ga0501034_0124591 Ga0501034_0124591_835_1464 209
1626 3300049571 Ga0501034_0409286 Ga0501034_0409286_468_1097 209
1627 3300049571 Ga0501034_0468117 Ga0501034_0468117_269_898 209
1628 3300049572 Ga0501036_0020290 Ga0501036_0020290_1083_1712 209
1629 3300049572 Ga0501036_0022138 Ga0501036_0022138_3034_3675 209
1630 3300049572 Ga0501036_0134376 Ga0501036_0134376_491_1129 209
1631 3300049573 Ga0501037_0094135 Ga0501037_0094135_986_1615 209
1632 3300049574 Ga0501038_0008634 Ga0501038_0008634_5242_5871 209
1633 3300049574 Ga0501038_0028009 Ga0501038_0028009_3704_4345 209
1634 3300049575 Ga0501039_0014140 Ga0501039_0014140_2047_2688 209
1635 3300049575 Ga0501039_0045132 Ga0501039_0045132_2218_2847 209
1636 3300049576 Ga0501040_0023343 Ga0501040_0023343_2807_3448 209
1637 3300049576 Ga0501040_0577461 Ga0501040_0577461_80_721 209
1638 3300049577 Ga0501041_0022151 Ga0501041_0022151_1892_2533 209
1639 3300049578 Ga0501042_0018622 Ga0501042_0018622_1066_1707 209
1640 3300049579 Ga0501043_0076813 Ga0501043_0076813_901_1542 209
1641 3300049579 Ga0501043_0406978 Ga0501043_0406978_301_930 209
1642 3300049580 Ga0501046_0044421 Ga0501046_0044421_1472_2113 209
1643 3300049581 Ga0501047_0016648 Ga0501047_0016648_33_662 209
1644 3300049581 Ga0501047_0025791 Ga0501047_0025791_3915_4544 209
1645 3300049581 Ga0501047_0098304 Ga0501047_0098304_283_912 209
1646 3300049581 Ga0501047_0159512 Ga0501047_0159512_478_1107 209
1647 3300049581 Ga0501047_0760205 Ga0501047_0760205_78_707 209
1648 3300049582 Ga0501048_0005997 Ga0501048_0005997_5525_6166 209
1649 3300049582 Ga0501048_0404578 Ga0501048_0404578_244_885 209
1650 3300049583 Ga0501067_0035265 Ga0501067_0035265_1019_1648 209
1651 3300049584 Ga0501068_0008913 Ga0501068_0008913_1374_2012 209
1652 3300049584 Ga0501068_0029708 Ga0501068_0029708_1363_2004 209
1653 3300049586 Ga0501070_0042082 Ga0501070_0042082_3083_3712 209
1654 3300049586 Ga0501070_0164392 Ga0501070_0164392_982_1623 209
1655 3300049586 Ga0501070_0326087 Ga0501070_0326087_282_911 209
1656 3300049587 Ga0501071_0004678 Ga0501071_0004678_6007_6648 209
1657 3300049588 Ga0501072_0028077 Ga0501072_0028077_1991_2632 209
1658 3300049588 Ga0501072_0345439 Ga0501072_0345439_167_808 209
1659 3300049588 Ga0501072_0703885 Ga0501072_0703885_88_717 209
1660 3300049589 Ga0501073_0003357 Ga0501073_0003357_8266_8895 209
1661 3300049589 Ga0501073_0039463 Ga0501073_0039463_2655_3284 209
1662 3300049589 Ga0501073_0165472 Ga0501073_0165472_713_1342 209
1663 3300049589 Ga0501073_0642518 Ga0501073_0642518_25_654 209
1664 3300049590 Ga0501074_0007721 Ga0501074_0007721_4756_5385 209
1665 3300049590 Ga0501074_0286036 Ga0501074_0286036_478_1107 209
1666 3300049591 Ga0501075_0030276 Ga0501075_0030276_987_1628 209
1667 3300049591 Ga0501075_0240906 Ga0501075_0240906_81_722 209
1668 3300049591 Ga0501075_0417521 Ga0501075_0417521_204_845 209
1669 3300049592 Ga0501076_0044414 Ga0501076_0044414_1392_2033 209
1670 3300049592 Ga0501076_0100948 Ga0501076_0100948_1399_2040 209
1671 3300049592 Ga0501076_0492937 Ga0501076_0492937_279_941 209
1672 3300049593 Ga0501077_0034231 Ga0501077_0034231_2327_2956 209
1673 3300049593 Ga0501077_0042563 Ga0501077_0042563_1112_1753 209
1674 3300049593 Ga0501077_0200672 Ga0501077_0200672_12_653 209
1675 3300049661 Ga0501217_024948 Ga0501217_024948_587_1216 209
1676 3300049668 Ga0501233_104893 Ga0501233_104893_64_693 209
1677 3300049671 Ga0501238_000691 Ga0501238_000691_516_1145 209
1678 3300049682 Ga0501252_005667 Ga0501252_005667_59_712 209
1679 3300049686 Ga0501257_009500 Ga0501257_009500_537_1166 209
1680 3300049704 Ga0501221_014348 Ga0501221_014348_428_1057 209
1681 3300049705 Ga0501225_0137206 Ga0501225_0137206_20_649 209
1682 3300049707 Ga0501234_039781 Ga0501234_039781_127_756 209
1683 3300049741 Ga0501079_0024961 Ga0501079_0024961_834_1475 209
1684 3300049741 Ga0501079_0339216 Ga0501079_0339216_193_834 209
1685 3300049741 Ga0501079_0403762 Ga0501079_0403762_339_968 209
1686 3300049742 Ga0501080_0043101 Ga0501080_0043101_702_1343 209
1687 3300049742 Ga0501080_0051362 Ga0501080_0051362_106_735 209
1688 3300049742 Ga0501080_0879896 Ga0501080_0879896_118_759 209
1689 3300049743 Ga0501081_0101801 Ga0501081_0101801_673_1314 209
1690 3300049744 Ga0501083_0113618 Ga0501083_0113618_1097_1726 209
1691 3300049772 Ga0501275_005800 Ga0501275_005800_15_644 209
1692 3300049822 Ga0501035_0179600 Ga0501035_0179600_927_1556 209
1693 3300049822 Ga0501035_0254019 Ga0501035_0254019_277_906 209
1694 3300049823 Ga0501044_0029662 Ga0501044_0029662_769_1398 209
1695 3300049823 Ga0501044_0121126 Ga0501044_0121126_751_1380 209
1696 3300049823 Ga0501044_0521824 Ga0501044_0521824_77_706 209
1697 3300049824 Ga0501045_0061565 Ga0501045_0061565_1390_2031 209
1698 3300050489 nmdc:mga03683_206046_c1 nmdc:mga03683_206046_c1_19_657 209
1699 3300050489 nmdc:mga03683_2387_c1 nmdc:mga03683_2387_c1_108_746 209
1700 3300050489 nmdc:mga03683_40737_c1 nmdc:mga03683_40737_c1_402_1040 209
1701 3300050490 nmdc:mga03n38_175383_c1 nmdc:mga03n38_175383_c1_28_666 209
1702 3300050490 nmdc:mga03n38_233742_c1 nmdc:mga03n38_233742_c1_230_865 209
1703 3300050490 nmdc:mga03n38_351494_c1 nmdc:mga03n38_351494_c1_15_653 209
1704 3300050491 nmdc:mga00v17_115272_c1 nmdc:mga00v17_115272_c1_1064_1696 209
1705 3300050491 nmdc:mga00v17_196424_c1 nmdc:mga00v17_196424_c1_146_781 209
1706 3300050492 nmdc:mga0yw44_104074_c1 nmdc:mga0yw44_104074_c1_372_1013 209
1707 3300050492 nmdc:mga0yw44_17493_c1 nmdc:mga0yw44_17493_c1_134_772 209
1708 3300050492 nmdc:mga0yw44_24969_c1 nmdc:mga0yw44_24969_c1_2052_2687 209
1709 3300050492 nmdc:mga0yw44_306479_c1 nmdc:mga0yw44_306479_c1_10_645 209
1710 3300050492 nmdc:mga0yw44_35725_c1 nmdc:mga0yw44_35725_c1_1556_2194 209
1711 3300050492 nmdc:mga0yw44_384153_c1 nmdc:mga0yw44_384153_c1_15_680 209
1712 3300050492 nmdc:mga0yw44_446360_c1 nmdc:mga0yw44_446360_c1_161_796 209
1713 3300050492 nmdc:mga0yw44_479903_c1 nmdc:mga0yw44_479903_c1_18_656 209
1714 3300050492 nmdc:mga0yw44_52947_c1 nmdc:mga0yw44_52947_c1_101_736 209
1715 3300050493 nmdc:mga0k408_121808_c1 nmdc:mga0k408_121808_c1_572_1201 209
1716 3300050493 nmdc:mga0k408_135362_c1 nmdc:mga0k408_135362_c1_376_1014 209
1717 3300050493 nmdc:mga0k408_19861_c1 nmdc:mga0k408_19861_c1_502_1137 209
1718 3300050493 nmdc:mga0k408_3517_c1 nmdc:mga0k408_3517_c1_28_666 209
1719 3300050493 nmdc:mga0k408_38074_c1 nmdc:mga0k408_38074_c1_1869_2504 209
1720 3300050494 nmdc:mga06z11_1558_c1 nmdc:mga06z11_1558_c1_6003_6632 209
1721 3300050494 nmdc:mga06z11_40602_c1 nmdc:mga06z11_40602_c1_1499_2137 209
1722 3300050495 nmdc:mga04h51_135745_c1 nmdc:mga04h51_135745_c1_167_805 209
1723 3300050495 nmdc:mga04h51_5029_c1 nmdc:mga04h51_5029_c1_972_1607 209
1724 3300050495 nmdc:mga04h51_591_c1 nmdc:mga04h51_591_c1_4628_5257 209
1725 3300050496 nmdc:mga07m45_146465_c1 nmdc:mga07m45_146465_c1_371_1006 209
1726 3300050496 nmdc:mga07m45_328766_c1 nmdc:mga07m45_328766_c1_153_794 209
1727 3300050496 nmdc:mga07m45_42731_c1 nmdc:mga07m45_42731_c1_1066_1695 209
1728 3300050496 nmdc:mga07m45_49433_c1 nmdc:mga07m45_49433_c1_921_1559 209
1729 3300050507 nmdc:mga05p37_121329_c1 nmdc:mga05p37_121329_c1_2252_2881 209
1730 3300050507 nmdc:mga05p37_426432_c1 nmdc:mga05p37_426432_c1_897_1526 209
1731 3300050507 nmdc:mga05p37_693088_c1 nmdc:mga05p37_693088_c1_464_1096 209
1732 3300050507 nmdc:mga05p37_735416_c1 nmdc:mga05p37_735416_c1_191_820 209
1733 3300050507 nmdc:mga05p37_78589_c1 nmdc:mga05p37_78589_c1_1483_2118 209
1734 3300050508 nmdc:mga09592_226571_c1 nmdc:mga09592_226571_c1_899_1534 209
1735 3300050508 nmdc:mga09592_500131_c1 nmdc:mga09592_500131_c1_333_962 209
1736 3300050509 nmdc:mga0qj67_218396_c1 nmdc:mga0qj67_218396_c1_727_1356 209
1737 3300050509 nmdc:mga0qj67_321467_c1 nmdc:mga0qj67_321467_c1_27_656 209
1738 3300050509 nmdc:mga0qj67_7671_c1 nmdc:mga0qj67_7671_c1_3456_4136 209
1739 3300050510 nmdc:mga06r32_238405_c1 nmdc:mga06r32_238405_c1_428_1057 209
1740 3300050510 nmdc:mga06r32_34913_c1 nmdc:mga06r32_34913_c1_1237_1917 209
1741 3300050510 nmdc:mga06r32_423381_c1 nmdc:mga06r32_423381_c1_608_1237 209
1742 3300050510 nmdc:mga06r32_873733_c1 nmdc:mga06r32_873733_c1_186_815 209
1743 3300050511 nmdc:mga08y16_333484_c1 nmdc:mga08y16_333484_c1_488_1126 209
1744 3300050511 nmdc:mga08y16_64120_c1 nmdc:mga08y16_64120_c1_849_1478 209
1745 3300050512 nmdc:mga0n895_479443_c1 nmdc:mga0n895_479443_c1_13_678 209
1746 3300050513 nmdc:mga0rr50_326390_c1 nmdc:mga0rr50_326390_c1_73_702 209
1747 3300050513 nmdc:mga0rr50_456314_c1 nmdc:mga0rr50_456314_c1_34_666 209
1748 3300050515 nmdc:mga0a205_137912_c1 nmdc:mga0a205_137912_c1_534_1166 209
1749 3300050515 nmdc:mga0a205_321426_c1 nmdc:mga0a205_321426_c1_248_877 209
1750 3300050516 nmdc:mga0sz30_151_c1 nmdc:mga0sz30_151_c1_2606_3244 209
1751 3300050516 nmdc:mga0sz30_23802_c1 nmdc:mga0sz30_23802_c1_816_1454 209
1752 3300050516 nmdc:mga0sz30_24447_c1 nmdc:mga0sz30_24447_c1_1505_2140 209
1753 3300050516 nmdc:mga0sz30_9764_c1 nmdc:mga0sz30_9764_c1_1967_2602 209
1754 3300053077 Ga0495601_0250123 Ga0495601_0250123_420_1055 209
1755 3300053077 Ga0495601_0487686 Ga0495601_0487686_78_716 209
1756 3300053078 Ga0495612_0017337 Ga0495612_0017337_1772_2410 209
1757 3300053078 Ga0495612_0138688 Ga0495612_0138688_182_817 209
1758 3300053080 Ga0500635_0176372 Ga0500635_0176372_109_744 209
1759 3300053084 Ga0495595_0122373 Ga0495595_0122373_47_682 209
1760 3300053085 Ga0495619_0051692 Ga0495619_0051692_571_1206 209
1761 3300053085 Ga0495619_0171202 Ga0495619_0171202_65_700 209
1762 3300053085 Ga0495619_0212571 Ga0495619_0212571_22_660 209
1763 3300053086 Ga0500578_0000809 Ga0500578_0000809_13570_14199 209
1764 3300053086 Ga0500578_0114986 Ga0500578_0114986_898_1533 209
1765 3300053086 Ga0500578_0186426 Ga0500578_0186426_572_1207 209
1766 3300053087 Ga0500643_000185 Ga0500643_000185_7308_7943 209
1767 3300053087 Ga0500643_044642 Ga0500643_044642_122_751 209
1768 3300053088 Ga0500644_0000046 Ga0500644_0000046_65749_66378 209
1769 3300053088 Ga0500644_0001130 Ga0500644_0001130_6917_7546 209
1770 3300053091 Ga0500647_0080260 Ga0500647_0080260_654_1286 209
1771 3300053092 Ga0500583_0008495 Ga0500583_0008495_741_1376 209
1772 3300053092 Ga0500583_0304967 Ga0500583_0304967_94_732 209
1773 3300053093 Ga0500651_0012726 Ga0500651_0012726_1870_2499 209
1774 3300053093 Ga0500651_0031021 Ga0500651_0031021_106_756 209
1775 3300053093 Ga0500651_0312749 Ga0500651_0312749_215_853 209
1776 3300053094 Ga0500566_0000352 Ga0500566_0000352_9660_10292 209
1777 3300053094 Ga0500566_0002819 Ga0500566_0002819_7171_7806 209
1778 3300053094 Ga0500566_0002995 Ga0500566_0002995_3827_4462 209
1779 3300053095 Ga0500640_014140 Ga0500640_014140_634_1266 209
1780 3300053095 Ga0500640_031872 Ga0500640_031872_70_705 209
1781 3300053096 Ga0500641_0002113 Ga0500641_0002113_3011_3655 209
1782 3300053102 Ga0500554_015008 Ga0500554_015008_1271_1900 209
1783 3300053104 Ga0500556_0015525 Ga0500556_0015525_962_1597 209
1784 3300053105 Ga0500557_000017 Ga0500557_000017_5386_6021 209
1785 3300053105 Ga0500557_015493 Ga0500557_015493_1288_1917 209
1786 3300053108 Ga0500562_000358 Ga0500562_000358_3336_3977 209
1787 3300053108 Ga0500562_069680 Ga0500562_069680_221_856 209
1788 3300053109 Ga0500569_066247 Ga0500569_066247_43_678 209
1789 3300053111 Ga0500572_000236 Ga0500572_000236_5420_6052 209
1790 3300053111 Ga0500572_001411 Ga0500572_001411_1688_2323 209
1791 3300053111 Ga0500572_077539 Ga0500572_077539_97_732 209
1792 3300053115 Ga0500591_048217 Ga0500591_048217_503_1135 209
1793 3300053118 Ga0500594_0000012 Ga0500594_0000012_29701_30330 209
1794 3300053118 Ga0500594_0104344 Ga0500594_0104344_86_721 209
1795 3300053119 Ga0500595_000003 Ga0500595_000003_406353_406982 209
1796 3300053119 Ga0500595_002159 Ga0500595_002159_7528_8163 209
1797 3300053119 Ga0500595_005559 Ga0500595_005559_4527_5162 209
1798 3300053119 Ga0500595_016779 Ga0500595_016779_38_667 209
1799 3300053119 Ga0500595_034990 Ga0500595_034990_771_1406 209
1800 3300053121 Ga0500607_054913 Ga0500607_054913_534_1169 209
1801 3300053122 Ga0500608_000012 Ga0500608_000012_74237_74866 209
1802 3300053122 Ga0500608_110921 Ga0500608_110921_456_1088 209
1803 3300053122 Ga0500608_141294 Ga0500608_141294_142_771 209
1804 3300053123 Ga0500614_002014 Ga0500614_002014_860_1492 209
1805 3300053125 Ga0500618_000493 Ga0500618_000493_24463_25092 209
1806 3300053125 Ga0500618_097150 Ga0500618_097150_13_648 209
1807 3300053130 Ga0500642_0000181 Ga0500642_0000181_24526_25161 209
1808 3300053130 Ga0500642_0010289 Ga0500642_0010289_1701_2336 209
1809 3300053133 Ga0500655_016438 Ga0500655_016438_533_1168 209
1810 3300053133 Ga0500655_034636 Ga0500655_034636_272_907 209
1811 3300053134 Ga0500658_0003891 Ga0500658_0003891_1253_1882 209
1812 3300053134 Ga0500658_0044644 Ga0500658_0044644_548_1222 209
1813 3300053136 Ga0500559_0000045 Ga0500559_0000045_93684_94313 209
1814 3300053136 Ga0500559_0000154 Ga0500559_0000154_53028_53663 209
1815 3300053136 Ga0500559_0002554 Ga0500559_0002554_2671_3300 209
1816 3300053136 Ga0500559_0003634 Ga0500559_0003634_442_1074 209
1817 3300053136 Ga0500559_0004656 Ga0500559_0004656_970_1599 209
1818 3300053136 Ga0500559_0008891 Ga0500559_0008891_2323_2958 209
1819 3300053138 Ga0500564_002954 Ga0500564_002954_5706_6335 209
1820 3300053140 Ga0500573_0020144 Ga0500573_0020144_2984_3619 209
1821 3300053140 Ga0500573_0226628 Ga0500573_0226628_247_876 209
1822 3300053142 Ga0500577_0006581 Ga0500577_0006581_1596_2225 209
1823 3300053147 Ga0500589_142113 Ga0500589_142113_40_675 209
1824 3300053148 Ga0500590_110123 Ga0500590_110123_285_917 209
1825 3300053150 Ga0500603_000776 Ga0500603_000776_6339_6971 209
1826 3300053151 Ga0500604_0031763 Ga0500604_0031763_630_1265 209
1827 3300053151 Ga0500604_0032434 Ga0500604_0032434_506_1141 209
1828 3300053153 Ga0500616_0000404 Ga0500616_0000404_20630_21268 209
1829 3300053153 Ga0500616_0135878 Ga0500616_0135878_445_1074 209
1830 3300053156 Ga0500622_0000516 Ga0500622_0000516_28626_29267 209
1831 3300053156 Ga0500622_0011169 Ga0500622_0011169_101_730 209
1832 3300053156 Ga0500622_0024238 Ga0500622_0024238_2007_2636 209
1833 3300053156 Ga0500622_0028564 Ga0500622_0028564_702_1331 209
1834 3300053156 Ga0500622_0090340 Ga0500622_0090340_610_1251 209
1835 3300053158 Ga0500627_0011498 Ga0500627_0011498_2623_3252 209
1836 3300053158 Ga0500627_0055449 Ga0500627_0055449_76_711 209
1837 3300053159 Ga0500630_005483 Ga0500630_005483_1707_2339 209
1838 3300053162 Ga0500638_156108 Ga0500638_156108_143_778 209
1839 3300053163 Ga0500639_000014 Ga0500639_000014_114951_115583 209
1840 3300053163 Ga0500639_050399 Ga0500639_050399_176_811 209
1841 3300053163 Ga0500639_123797 Ga0500639_123797_380_1015 209
1842 3300053163 Ga0500639_127709 Ga0500639_127709_76_711 209
1843 3300053177 Ga0500636_0000343 Ga0500636_0000343_12751_13386 209
1844 3300053177 Ga0500636_0044785 Ga0500636_0044785_1652_2299 209
1845 3300053177 Ga0500636_0192202 Ga0500636_0192202_235_870 209
1846 3300053178 Ga0500637_0000189 Ga0500637_0000189_20879_21514 209
1847 3300053730 Ga0500645_000226 Ga0500645_000226_18841_19470 209
1848 3300053730 Ga0500645_000517 Ga0500645_000517_11834_12463 209
1849 3300053730 Ga0500645_007179 Ga0500645_007179_2415_3086 209
1850 3300053731 Ga0500609_002886 Ga0500609_002886_1086_1715 209
1851 3300053731 Ga0500609_003154 Ga0500609_003154_391_1026 209
1852 3300053733 Ga0500552_000284 Ga0500552_000284_2191_2829 209
1853 3300053735 Ga0500596_000316 Ga0500596_000316_486_1118 209
1854 3300053735 Ga0500596_002168 Ga0500596_002168_171_806 209
1855 3300053735 Ga0500596_009060 Ga0500596_009060_416_1051 209
1856 3300053737 Ga0500601_000248 Ga0500601_000248_7576_8211 209
1857 3300054114 Ga0501084_0003455 Ga0501084_0003455_10550_11191 209
1858 3300054114 Ga0501084_0068639 Ga0501084_0068639_1682_2311 209
1859 3300054114 Ga0501084_0130720 Ga0501084_0130720_1074_1703 209
1860 3300055283 Ga0500661_000533 Ga0500661_000533_108_743 209
1861 3300059504 Ga0587082_009854 Ga0587082_009854_108_737 209
1862 3300059647 Ga0587079_000097 Ga0587079_000097_4346_4975 209
1863 3300060353 Ga0501082_0030220 Ga0501082_0030220_2663_3304 209
1864 3300060353 Ga0501082_0355097 Ga0501082_0355097_38_667 209
1865 3300060353 Ga0501082_0861408 Ga0501082_0861408_30_659 209
1866 3300061734 Ga0530510_0016121 Ga0530510_0016121_2146_2787 209
1867 3300061734 Ga0530510_0869168 Ga0530510_0869168_19_657 209
1868 iso_pu_bacteria 2585428106 2587917920 209
1869 iso_pu_bacteria 2643221574 2643882746 209
1870 iso_pu_bacteria 2643221584 2643929551 209
1871 iso_pu_bacteria 2643221640 2644224456 209
1872 iso_pu_bacteria 2643221642 2644234608 209
1873 iso_pu_bacteria 2643221699 2644549821 209
1874 iso_pu_bacteria 2643221699 2644550332 209
1875 iso_pu_bacteria 2738541281 2738743184 209
1876 iso_pu_bacteria 2738543032 2739352801 209
1877 iso_pu_bacteria 2791355048 2792459656 209
1878 iso_pu_bacteria 2829745981 2829746569 209
1879 iso_pu_bacteria 2835312727 2835319684 209
1880 iso_pu_bacteria 2842698319 2842700465 209
1881 iso_pu_bacteria 2843744320 2843747312 209
1882 iso_pu_bacteria 2849560528 2849563209 209
1883 iso_pu_bacteria 2849573788 2849575251 209
1884 iso_pu_bacteria 2851153111 2851158008 209
1885 iso_pu_bacteria 2882456835 2882457647 209
1886 iso_pu_bacteria 2884298095 2884301187 209
1887 iso_pu_bacteria 2898329390 2898333478 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14681

UPRTase

Uracil phosphoribosyltransferase

54

256

0.99

PF00156

Pribosyltran

Phosphoribosyl transferase domain

95

239

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v9s-assembly1.cif.gz_A crystal structure of tt0130 protein from thermus thermophilus hb8 0.9775 3 209
1v9s-assembly1.cif.gz_D crystal structure of tt0130 protein from thermus thermophilus hb8 0.976 3 209
6wn8-assembly1.cif.gz_B 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae 0.9751 2 209
2ehj-assembly1.cif.gz_A structure of uracil phosphoribosyl transferase 0.9729 2 209
6wn8-assembly1.cif.gz_D 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae 0.9712 2 209
ID Description Score Start End Superfamily
af_Q2FWE6_1_209_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9888 1 209 3.40.50.2020
af_O74449_1_266_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9757 12 44 1.25.40.10
5e38B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9564 5 206 3.40.50.2020
af_B6U5U2_13_228_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9537 2 208 3.40.50.2020
2e55D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9534 4 209 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A662F2M2-F1-model_v4 uracil phosphoribosyltransferase (EC 2.4.2.9) 0.9932 116 208 GO:0004845
GO:0005525
GO:0016020
AF-A0A7X6Z459-F1-model_v4 Uracil phosphoribosyltransferase (EC 2.4.2.9) 0.9923 5 98 GO:0004845
AF-A0A645IBZ4-F1-model_v4 Uracil phosphoribosyltransferase (EC 2.4.2.9) 0.9913 133 209 GO:0004845
AF-A0A379AD87-F1-model_v4 Uracil phosphoribosyltransferase (EC 2.4.2.9) 0.9905 133 209 GO:0004845
AF-A0A2S8MBG0-F1-model_v4 deleted 0.9879 125 209

Feature Viewer

pLDDT pTM Quality
93.79 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map