F495977
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1887 | 853 | 1650 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0110727|Ga0496126_0110727_35_808 |
| Length | 257 |
| Sequence | MQGGGVRAYREYVRRRQRSSAKKDTLAKLRFNLVKTLGYLFNKIWEWNSMQVKVINHPLIQHKLTLIRDKNTGPKEFRELLEEVAMLMGYELTRDLPLEEIEIETPVTKCTCKTLSGKKIGIVPILRAGLGMVSGFLRLIPAAKVGHVGVYRDPQTLKPVEYYCKLPTDVAERDFVVIDPMLATGGSSVAAISLLKQKGAKNIKLMCLVAAPEGIHLVNEQHPDVEVYTASVDERLNDHGYIVPGLGDAGDRIFGTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 8 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 9 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 14 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 15 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 16 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 17 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 18 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 19 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 20 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 21 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 22 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 23 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 24 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 28 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 29 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 30 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 31 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 32 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 33 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 34 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 35 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 36 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 37 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 38 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 39 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 40 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 41 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 42 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 43 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 44 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 45 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 46 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 47 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 48 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 49 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 50 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 51 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 52 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 53 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 54 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 55 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 56 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 57 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 58 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 59 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 60 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 61 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 62 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 63 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 64 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 65 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 66 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 67 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 68 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 69 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 70 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 71 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 72 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 73 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 74 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 75 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 76 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 77 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 78 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 79 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 80 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 81 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 82 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 83 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 84 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 85 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 86 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 87 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 88 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 89 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 90 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 91 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 92 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 93 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 94 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 95 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 96 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 97 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 98 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 99 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 100 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 101 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 102 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 103 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 104 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 105 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 106 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 107 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 108 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 109 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 110 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 111 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 112 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 113 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 114 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 115 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 116 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 117 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 118 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 119 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 120 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 121 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 122 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 123 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 124 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 125 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 126 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 127 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 128 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 129 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 130 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 131 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 132 | 2922368715 | |||
| 133 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 134 | 2922425934 | |||
| 135 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 136 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 137 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 138 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 139 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 140 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 141 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 142 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 143 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 144 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 145 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 146 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 147 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 148 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 149 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 150 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 151 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 152 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 153 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 154 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 155 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 156 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 157 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 158 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 159 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 160 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 161 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 162 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 163 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 164 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 165 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 166 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 167 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 168 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 169 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 170 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 171 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 172 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 173 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 174 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 175 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 176 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 177 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 178 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 179 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 180 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 181 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 182 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 183 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 184 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 185 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 186 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 187 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 188 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 189 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 190 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 191 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 192 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 193 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 194 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 195 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 196 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 197 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 198 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 199 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 200 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 201 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 202 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 203 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 204 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 205 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 206 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 207 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 208 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 209 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 210 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 211 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 212 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 213 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 214 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 215 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 216 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 217 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 218 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 219 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 220 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 221 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 222 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 223 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 224 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 225 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 226 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 227 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 228 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 231 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 233 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 235 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 237 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 238 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 246 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 249 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 251 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 252 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 253 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 256 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 257 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 261 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 262 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 263 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 264 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 265 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 266 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 268 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 269 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 270 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 271 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 273 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 274 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 275 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 276 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 278 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 279 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 280 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 281 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 282 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 283 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 284 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 285 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 286 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 287 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 288 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 289 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 290 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 291 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 292 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 293 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 294 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 295 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 296 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 297 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 298 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 299 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 300 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 301 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 302 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 303 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 304 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 305 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 306 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 307 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 309 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 310 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 311 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 312 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 313 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 314 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 315 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 316 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 318 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 319 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 320 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 321 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 323 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 324 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 326 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 327 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 329 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 330 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 331 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 332 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 333 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 334 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 335 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 336 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 337 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 338 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 339 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 340 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 341 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 342 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 343 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 344 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 345 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 346 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 347 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 348 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 349 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 350 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 351 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 352 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 353 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 354 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 355 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 356 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 357 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 358 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 359 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 360 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 361 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 362 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 363 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 364 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 365 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 366 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 367 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 368 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 369 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 370 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 371 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 372 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 373 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 374 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 375 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 376 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 377 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 378 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 379 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 380 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 381 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 382 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 383 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 384 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 385 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 386 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 387 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 388 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 389 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 458 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 459 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 460 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 461 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 464 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 465 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 469 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 470 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 471 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 472 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 473 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 474 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 475 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 476 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 477 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 478 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 479 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 480 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 481 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 482 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 483 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 484 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 485 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 486 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 487 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 488 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 489 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 490 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 491 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 492 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 493 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 494 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 495 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 496 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 497 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 498 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 499 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 500 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 501 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 502 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 503 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 504 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 505 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 506 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 508 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 509 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 510 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 511 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 512 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 513 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 514 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 515 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 516 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 517 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 518 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 519 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 520 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 521 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 522 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 523 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 524 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 525 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 526 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 527 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 528 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 529 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 530 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 531 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 532 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 533 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 534 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 535 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 536 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 537 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 538 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 539 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 540 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 541 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 542 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 543 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 544 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 545 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 546 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 547 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 548 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 549 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 550 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 551 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 552 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 553 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 554 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 555 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 556 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 557 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 558 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 559 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 560 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 561 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 562 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 563 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 564 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 565 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 566 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 567 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 568 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 658 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 659 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 660 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 661 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 662 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 663 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 664 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 665 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 666 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 667 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 668 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 669 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 670 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 671 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 672 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 673 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 674 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 675 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 676 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 677 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 678 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 679 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 680 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 681 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 682 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 683 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 684 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 685 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 686 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 687 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 688 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 689 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 691 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 692 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 693 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 694 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 695 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 696 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 697 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 698 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 699 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 700 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 701 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 702 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 703 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 704 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 705 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 706 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 707 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 708 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 709 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 710 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 711 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 712 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 713 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 714 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 715 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 716 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 717 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 718 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 719 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 720 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 721 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 722 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 723 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 724 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 725 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 726 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 727 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 728 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 729 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 730 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 731 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 732 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 733 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 734 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 735 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 736 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 737 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 738 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 739 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 740 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 741 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 742 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 743 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 744 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 745 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 746 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 747 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 748 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 749 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 750 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 751 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 752 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 753 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 754 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 755 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 756 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 757 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 758 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 759 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 760 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 761 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 762 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 763 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 764 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 765 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 766 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 767 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 770 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 773 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 774 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 775 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 776 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 777 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 778 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 779 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 780 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 781 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 782 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 783 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 784 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 785 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 786 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 787 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 788 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 789 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 790 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 791 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 792 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 793 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 794 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 795 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 796 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 797 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 798 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 799 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 800 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 801 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 802 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 803 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 804 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 805 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 806 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 807 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 808 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 809 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 810 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 811 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 812 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 813 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 814 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 815 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 816 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 817 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 818 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 819 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 820 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 821 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 822 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 823 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 824 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 825 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 826 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 827 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 828 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 829 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 830 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 831 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 832 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 833 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 834 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 835 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 836 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 837 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 838 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 839 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 840 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 841 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 842 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 843 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 844 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 845 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 846 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 847 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 848 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 849 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 850 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 851 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 852 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 853 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.62 |
| Metatranscriptomes | 1.91 |
| Isolates | 12.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.68 |
| Nodule | 8.21 |
| Rhizoplane | 4.4 |
| Rhizosphere | 61.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1009424 | 3300002987 | Bacteria | 2579 |
| 2 | JGI25151J46595_10001287 | 3300003187 | Bacteria | 17661 |
| 3 | JGI25151J46595_10037149 | 3300003187 | Bacteria | 1829 |
| 4 | JGI25151J46595_10074055 | 3300003187 | Bacteria | 1016 |
| 5 | JGI25151J46595_10074524 | 3300003187 | Bacteria | 1011 |
| 6 | JGI25406J46586_10076708 | 3300003203 | Bacteria | 1034 |
| 7 | JGI25153J46596_10002853 | 3300003215 | Bacteria | 9813 |
| 8 | JGI25153J46596_10017253 | 3300003215 | Bacteria | 2850 |
| 9 | JGI25153J46596_10037963 | 3300003215 | Bacteria | 1525 |
| 10 | rootH1_10001329 | 3300003316 | Bacteria | 28300 |
| 11 | rootH2_10173050 | 3300003320 | Bacteria | 2330 |
| 12 | rootH2_10273013 | 3300003320 | Bacteria | 1182 |
| 13 | rootL2_10029468 | 3300003322 | Bacteria | 15048 |
| 14 | rootL2_10179753 | 3300003322 | Bacteria | 1509 |
| 15 | rootH1_10048253 | 3300003323 | Bacteria | 5438 |
| 16 | JGI25160J50197_1000505 | 3300003354 | Bacteria | 23190 |
| 17 | JGI25160J50197_1009635 | 3300003354 | Bacteria | 3563 |
| 18 | Ga0006562J51391_1001388 | 3300003578 | Bacteria | 7230 |
| 19 | Ga0055538_1000128 | 3300003751 | Bacteria | 55980 |
| 20 | Ga0055532_1001176 | 3300003758 | Bacteria | 7896 |
| 21 | Ga0055535_1007751 | 3300003761 | Bacteria | 2011 |
| 22 | Ga0055542_1008160 | 3300003762 | Bacteria | 2066 |
| 23 | Ga0055526_1029905 | 3300003771 | Bacteria | 1602 |
| 24 | Ga0055537_1009257 | 3300003773 | Bacteria | 2191 |
| 25 | Ga0055536_1002036 | 3300003781 | Bacteria | 11580 |
| 26 | Ga0055536_1002279 | 3300003781 | Bacteria | 10895 |
| 27 | Ga0055528_1003018 | 3300003790 | Bacteria | 8692 |
| 28 | Ga0055528_1027876 | 3300003790 | Bacteria | 1574 |
| 29 | Ga0055530_10004426 | 3300003791 | Bacteria | 7228 |
| 30 | Ga0055530_10005947 | 3300003791 | Bacteria | 5616 |
| 31 | Ga0055531_10002251 | 3300003794 | Bacteria | 13060 |
| 32 | Ga0055531_10003247 | 3300003794 | Bacteria | 10438 |
| 33 | Ga0055531_10016299 | 3300003794 | Bacteria | 3213 |
| 34 | Ga0065165_1000254 | 3300005262 | Bacteria | 92762 |
| 35 | Ga0065165_1000376 | 3300005262 | Bacteria | 72908 |
| 36 | Ga0065165_1000749 | 3300005262 | Bacteria | 44604 |
| 37 | Ga0065165_1004727 | 3300005262 | Bacteria | 8175 |
| 38 | Ga0070658_10000029 | 3300005327 | Bacteria | 156910 |
| 39 | Ga0070658_10084816 | 3300005327 | Bacteria | 2605 |
| 40 | Ga0070658_10105279 | 3300005327 | Bacteria | 2334 |
| 41 | Ga0070658_10125909 | 3300005327 | Bacteria | 2132 |
| 42 | Ga0070676_10035897 | 3300005328 | Bacteria | 2853 |
| 43 | Ga0070683_100054819 | 3300005329 | Bacteria | 3697 |
| 44 | Ga0070683_100252526 | 3300005329 | Bacteria | 1677 |
| 45 | Ga0070670_100041824 | 3300005331 | Bacteria | 3938 |
| 46 | Ga0070670_100052926 | 3300005331 | Bacteria | 3487 |
| 47 | Ga0068869_100066713 | 3300005334 | Bacteria | 2652 |
| 48 | Ga0068869_100281367 | 3300005334 | Bacteria | 1338 |
| 49 | Ga0068869_100878402 | 3300005334 | Bacteria | 775 |
| 50 | Ga0070666_10007107 | 3300005335 | Bacteria | 6904 |
| 51 | Ga0070680_100004826 | 3300005336 | Bacteria | 10146 |
| 52 | Ga0070680_100039689 | 3300005336 | Bacteria | 3808 |
| 53 | Ga0070660_100007310 | 3300005339 | Bacteria | 7696 |
| 54 | Ga0070660_100043834 | 3300005339 | Bacteria | 3420 |
| 55 | Ga0070660_100237818 | 3300005339 | Bacteria | 1483 |
| 56 | Ga0070660_100351183 | 3300005339 | Bacteria | 1214 |
| 57 | Ga0070689_100124083 | 3300005340 | Bacteria | 2065 |
| 58 | Ga0070689_100157578 | 3300005340 | Bacteria | 1834 |
| 59 | Ga0070689_100425995 | 3300005340 | Bacteria | 1125 |
| 60 | Ga0070691_10005525 | 3300005341 | Bacteria | 5754 |
| 61 | Ga0070661_100013672 | 3300005344 | Bacteria | 5700 |
| 62 | Ga0070661_100020985 | 3300005344 | Bacteria | 4663 |
| 63 | Ga0070661_100084578 | 3300005344 | Bacteria | 2344 |
| 64 | Ga0070668_100010989 | 3300005347 | Bacteria | 6739 |
| 65 | Ga0070668_100110111 | 3300005347 | Bacteria | 2191 |
| 66 | Ga0070668_100457117 | 3300005347 | Bacteria | 1099 |
| 67 | Ga0070669_100010848 | 3300005353 | Bacteria | 6467 |
| 68 | Ga0070669_100053105 | 3300005353 | Bacteria | 2966 |
| 69 | Ga0070669_100074367 | 3300005353 | Bacteria | 2519 |
| 70 | Ga0070669_100323671 | 3300005353 | Bacteria | 1245 |
| 71 | Ga0070669_100367560 | 3300005353 | Bacteria | 1171 |
| 72 | Ga0070675_100301946 | 3300005354 | Bacteria | 1411 |
| 73 | Ga0070675_100400389 | 3300005354 | Bacteria | 1224 |
| 74 | Ga0070671_100022475 | 3300005355 | Bacteria | 5150 |
| 75 | Ga0070671_100034049 | 3300005355 | Bacteria | 4216 |
| 76 | Ga0070674_100140673 | 3300005356 | Bacteria | 1811 |
| 77 | Ga0070674_100262803 | 3300005356 | Bacteria | 1361 |
| 78 | Ga0070673_100189089 | 3300005364 | Bacteria | 1767 |
| 79 | Ga0070673_100369338 | 3300005364 | Bacteria | 1277 |
| 80 | Ga0070673_100470046 | 3300005364 | Bacteria | 1134 |
| 81 | Ga0070673_100818547 | 3300005364 | Bacteria | 861 |
| 82 | Ga0070688_100027531 | 3300005365 | Bacteria | 3386 |
| 83 | Ga0070688_100061005 | 3300005365 | Bacteria | 2383 |
| 84 | Ga0070659_100000968 | 3300005366 | Bacteria | 21135 |
| 85 | Ga0070659_100156073 | 3300005366 | Bacteria | 1864 |
| 86 | Ga0070659_100564360 | 3300005366 | Bacteria | 975 |
| 87 | Ga0070667_100116779 | 3300005367 | Bacteria | 2317 |
| 88 | Ga0070667_100146586 | 3300005367 | Bacteria | 2071 |
| 89 | Ga0070667_100232058 | 3300005367 | Bacteria | 1646 |
| 90 | Ga0070667_100285152 | 3300005367 | Bacteria | 1484 |
| 91 | Ga0070667_100291136 | 3300005367 | Bacteria | 1468 |
| 92 | Ga0070667_100661277 | 3300005367 | Bacteria | 965 |
| 93 | Ga0070709_10000102 | 3300005434 | Bacteria | 60511 |
| 94 | Ga0070709_10002668 | 3300005434 | Bacteria | 9636 |
| 95 | Ga0070709_10146800 | 3300005434 | Bacteria | 1626 |
| 96 | Ga0070709_10172951 | 3300005434 | Bacteria | 1511 |
| 97 | Ga0070709_10273246 | 3300005434 | Bacteria | 1225 |
| 98 | Ga0070714_100002572 | 3300005435 | Bacteria | 13368 |
| 99 | Ga0070714_100012241 | 3300005435 | Bacteria | 6843 |
| 100 | Ga0070714_100043830 | 3300005435 | Bacteria | 3786 |
| 101 | Ga0070714_100113074 | 3300005435 | Bacteria | 2407 |
| 102 | Ga0070714_100199734 | 3300005435 | Bacteria | 1829 |
| 103 | Ga0070714_100278628 | 3300005435 | Bacteria | 1553 |
| 104 | Ga0070713_100055744 | 3300005436 | Bacteria | 3286 |
| 105 | Ga0070713_100139806 | 3300005436 | Bacteria | 2143 |
| 106 | Ga0070713_100158262 | 3300005436 | Bacteria | 2020 |
| 107 | Ga0070713_100259853 | 3300005436 | Bacteria | 1586 |
| 108 | Ga0070713_100609120 | 3300005436 | Unclassified | 1038 |
| 109 | Ga0070710_10000246 | 3300005437 | Bacteria | 25491 |
| 110 | Ga0070710_10043267 | 3300005437 | Bacteria | 2493 |
| 111 | Ga0070710_10130490 | 3300005437 | Bacteria | 1532 |
| 112 | Ga0070710_10415642 | 3300005437 | Bacteria | 905 |
| 113 | Ga0070710_10780798 | 3300005437 | Bacteria | 681 |
| 114 | Ga0070701_10117330 | 3300005438 | Bacteria | 1495 |
| 115 | Ga0070711_100001950 | 3300005439 | Bacteria | 11571 |
| 116 | Ga0070711_100009139 | 3300005439 | Bacteria | 6091 |
| 117 | Ga0070711_100021023 | 3300005439 | Bacteria | 4215 |
| 118 | Ga0070711_100057145 | 3300005439 | Bacteria | 2701 |
| 119 | Ga0070711_100149799 | 3300005439 | Bacteria | 1758 |
| 120 | Ga0070705_100005393 | 3300005440 | Bacteria | 6230 |
| 121 | Ga0070700_100004393 | 3300005441 | Bacteria | 7360 |
| 122 | Ga0070700_100174861 | 3300005441 | Bacteria | 1489 |
| 123 | Ga0070700_100256182 | 3300005441 | Bacteria | 1258 |
| 124 | Ga0070694_100184113 | 3300005444 | Bacteria | 1546 |
| 125 | Ga0070708_100438825 | 3300005445 | Bacteria | 1231 |
| 126 | Ga0070678_100023432 | 3300005456 | Bacteria | 4113 |
| 127 | Ga0070678_100060424 | 3300005456 | Bacteria | 2790 |
| 128 | Ga0070678_100273035 | 3300005456 | Bacteria | 1427 |
| 129 | Ga0070678_100535734 | 3300005456 | Bacteria | 1038 |
| 130 | Ga0070662_100216351 | 3300005457 | Bacteria | 1527 |
| 131 | Ga0070681_10014331 | 3300005458 | Bacteria | 7889 |
| 132 | Ga0070681_10073996 | 3300005458 | Bacteria | 3368 |
| 133 | Ga0070681_10074121 | 3300005458 | Bacteria | 3365 |
| 134 | Ga0068867_100005155 | 3300005459 | Bacteria | 9226 |
| 135 | Ga0068867_100031126 | 3300005459 | Bacteria | 3852 |
| 136 | Ga0068867_100344861 | 3300005459 | Bacteria | 1241 |
| 137 | Ga0068867_100474525 | 3300005459 | Bacteria | 1070 |
| 138 | Ga0068867_100532561 | 3300005459 | Bacteria | 1015 |
| 139 | Ga0070685_10213074 | 3300005466 | Bacteria | 1262 |
| 140 | Ga0070685_10235950 | 3300005466 | Bacteria | 1205 |
| 141 | Ga0070706_100009262 | 3300005467 | Bacteria | 9172 |
| 142 | Ga0070706_100604505 | 3300005467 | Bacteria | 1019 |
| 143 | Ga0070707_100038744 | 3300005468 | Bacteria | 4553 |
| 144 | Ga0070707_100149343 | 3300005468 | Bacteria | 2275 |
| 145 | Ga0070707_100694312 | 3300005468 | Bacteria | 980 |
| 146 | Ga0070698_100001489 | 3300005471 | Bacteria | 26007 |
| 147 | Ga0070698_100001894 | 3300005471 | Bacteria | 23305 |
| 148 | Ga0070698_101065320 | 3300005471 | Unclassified | 756 |
| 149 | Ga0070699_100020158 | 3300005518 | Bacteria | 5747 |
| 150 | Ga0070699_100039020 | 3300005518 | Bacteria | 4111 |
| 151 | Ga0070699_100087255 | 3300005518 | Bacteria | 2723 |
| 152 | Ga0070699_100192282 | 3300005518 | Bacteria | 1813 |
| 153 | Ga0070679_100015211 | 3300005530 | Bacteria | 7391 |
| 154 | Ga0070679_100166416 | 3300005530 | Bacteria | 2178 |
| 155 | Ga0070679_100195382 | 3300005530 | Bacteria | 1991 |
| 156 | Ga0070679_100362827 | 3300005530 | Bacteria | 1396 |
| 157 | Ga0070679_100629788 | 3300005530 | Bacteria | 1016 |
| 158 | Ga0070684_100059203 | 3300005535 | Bacteria | 3348 |
| 159 | Ga0070684_100139063 | 3300005535 | Bacteria | 2195 |
| 160 | Ga0070697_100040877 | 3300005536 | Bacteria | 3752 |
| 161 | Ga0070697_100053626 | 3300005536 | Bacteria | 3277 |
| 162 | Ga0070697_100085917 | 3300005536 | Bacteria | 2595 |
| 163 | Ga0068853_100439525 | 3300005539 | Bacteria | 1226 |
| 164 | Ga0070672_100010425 | 3300005543 | Bacteria | 6449 |
| 165 | Ga0070672_100037975 | 3300005543 | Bacteria | 3677 |
| 166 | Ga0070672_100077938 | 3300005543 | Bacteria | 2651 |
| 167 | Ga0070672_100280783 | 3300005543 | Bacteria | 1408 |
| 168 | Ga0070672_100300343 | 3300005543 | Bacteria | 1361 |
| 169 | Ga0070696_100277204 | 3300005546 | Bacteria | 1277 |
| 170 | Ga0070665_100028600 | 3300005548 | Bacteria | 5613 |
| 171 | Ga0070665_100041857 | 3300005548 | Bacteria | 4605 |
| 172 | Ga0070665_100059744 | 3300005548 | Bacteria | 3822 |
| 173 | Ga0070665_100321285 | 3300005548 | Bacteria | 1552 |
| 174 | Ga0070665_100337936 | 3300005548 | Bacteria | 1510 |
| 175 | Ga0070665_100645488 | 3300005548 | Bacteria | 1071 |
| 176 | Ga0070665_100721904 | 3300005548 | Bacteria | 1009 |
| 177 | Ga0070704_100645549 | 3300005549 | Bacteria | 934 |
| 178 | Ga0068855_100006563 | 3300005563 | Bacteria | 14139 |
| 179 | Ga0068855_100197789 | 3300005563 | Bacteria | 2264 |
| 180 | Ga0068855_100285543 | 3300005563 | Bacteria | 1831 |
| 181 | Ga0068855_100453266 | 3300005563 | Bacteria | 1399 |
| 182 | Ga0070664_100181960 | 3300005564 | Bacteria | 1868 |
| 183 | Ga0070664_100222681 | 3300005564 | Bacteria | 1688 |
| 184 | Ga0068857_100068776 | 3300005577 | Bacteria | 3152 |
| 185 | Ga0068857_101355763 | 3300005577 | Bacteria | 691 |
| 186 | Ga0068854_101005385 | 3300005578 | Bacteria | 739 |
| 187 | Ga0068856_100007916 | 3300005614 | Bacteria | 10381 |
| 188 | Ga0068856_100407198 | 3300005614 | Bacteria | 1380 |
| 189 | Ga0068856_100529116 | 3300005614 | Bacteria | 1200 |
| 190 | Ga0068856_100710100 | 3300005614 | Bacteria | 1026 |
| 191 | Ga0068852_100016405 | 3300005616 | Bacteria | 5775 |
| 192 | Ga0068852_100090825 | 3300005616 | Bacteria | 2732 |
| 193 | Ga0068852_100394316 | 3300005616 | Bacteria | 1360 |
| 194 | Ga0068852_100445770 | 3300005616 | Bacteria | 1281 |
| 195 | Ga0068852_101014365 | 3300005616 | Bacteria | 849 |
| 196 | Ga0068852_101449423 | 3300005616 | Bacteria | 709 |
| 197 | Ga0068859_100295661 | 3300005617 | Bacteria | 1712 |
| 198 | Ga0068859_100462365 | 3300005617 | Bacteria | 1365 |
| 199 | Ga0068859_100772897 | 3300005617 | Bacteria | 1049 |
| 200 | Ga0068864_100024785 | 3300005618 | Bacteria | 5047 |
| 201 | Ga0068864_100473808 | 3300005618 | Bacteria | 1201 |
| 202 | Ga0068866_10055550 | 3300005718 | Bacteria | 2034 |
| 203 | Ga0068861_100002547 | 3300005719 | Bacteria | 11913 |
| 204 | Ga0068861_100025992 | 3300005719 | Bacteria | 4251 |
| 205 | Ga0068861_100051216 | 3300005719 | Bacteria | 3134 |
| 206 | Ga0068861_100490585 | 3300005719 | Bacteria | 1108 |
| 207 | Ga0068851_10272805 | 3300005834 | Bacteria | 965 |
| 208 | Ga0068870_10039834 | 3300005840 | Bacteria | 2433 |
| 209 | Ga0068863_100022184 | 3300005841 | Bacteria | 6061 |
| 210 | Ga0068863_100085916 | 3300005841 | Bacteria | 2981 |
| 211 | Ga0068863_100348030 | 3300005841 | Bacteria | 1443 |
| 212 | Ga0068858_100047990 | 3300005842 | Bacteria | 3958 |
| 213 | Ga0068858_100088380 | 3300005842 | Bacteria | 2883 |
| 214 | Ga0068858_100344058 | 3300005842 | Bacteria | 1428 |
| 215 | Ga0068860_100000515 | 3300005843 | Bacteria | 47393 |
| 216 | Ga0068860_100498547 | 3300005843 | Bacteria | 1215 |
| 217 | Ga0068860_100734056 | 3300005843 | Bacteria | 999 |
| 218 | Ga0068862_100017703 | 3300005844 | Bacteria | 5931 |
| 219 | Ga0068862_100023047 | 3300005844 | Bacteria | 5214 |
| 220 | Ga0081455_10000030 | 3300005937 | Bacteria | 148346 |
| 221 | Ga0081455_10000370 | 3300005937 | Bacteria | 59432 |
| 222 | Ga0081455_10048684 | 3300005937 | Bacteria | 3660 |
| 223 | Ga0081455_10062637 | 3300005937 | Bacteria | 3125 |
| 224 | Ga0081455_10129143 | 3300005937 | Bacteria | 1979 |
| 225 | Ga0081538_10058894 | 3300005981 | Bacteria | 2224 |
| 226 | Ga0081538_10096174 | 3300005981 | Bacteria | 1510 |
| 227 | Ga0081538_10211686 | 3300005981 | Bacteria | 781 |
| 228 | Ga0081540_1003913 | 3300005983 | Bacteria | 11600 |
| 229 | Ga0081540_1016777 | 3300005983 | Bacteria | 4564 |
| 230 | Ga0081540_1020037 | 3300005983 | Bacteria | 4038 |
| 231 | Ga0081540_1034549 | 3300005983 | Bacteria | 2724 |
| 232 | Ga0081540_1112218 | 3300005983 | Bacteria | 1149 |
| 233 | Ga0081539_10001490 | 3300005985 | Bacteria | 39594 |
| 234 | Ga0081539_10049141 | 3300005985 | Bacteria | 2396 |
| 235 | Ga0081539_10141583 | 3300005985 | Bacteria | 1168 |
| 236 | Ga0070717_10004346 | 3300006028 | Bacteria | 10219 |
| 237 | Ga0070717_10058852 | 3300006028 | Bacteria | 3178 |
| 238 | Ga0070717_10069419 | 3300006028 | Bacteria | 2935 |
| 239 | Ga0075365_10074563 | 3300006038 | Bacteria | 2289 |
| 240 | Ga0075365_10103729 | 3300006038 | Bacteria | 1949 |
| 241 | Ga0075365_10190548 | 3300006038 | Bacteria | 1435 |
| 242 | Ga0075365_10275615 | 3300006038 | Bacteria | 1183 |
| 243 | Ga0075365_10300052 | 3300006038 | Bacteria | 1130 |
| 244 | Ga0075368_10000871 | 3300006042 | Bacteria | 9345 |
| 245 | Ga0075368_10010300 | 3300006042 | Bacteria | 3378 |
| 246 | Ga0075363_100001442 | 3300006048 | Bacteria | 9008 |
| 247 | Ga0075363_100226462 | 3300006048 | Bacteria | 1072 |
| 248 | Ga0075364_10045122 | 3300006051 | Bacteria | 2868 |
| 249 | Ga0075364_10074105 | 3300006051 | Bacteria | 2244 |
| 250 | Ga0075364_10236471 | 3300006051 | Bacteria | 1241 |
| 251 | Ga0070715_10000170 | 3300006163 | Bacteria | 15093 |
| 252 | Ga0070715_10073621 | 3300006163 | Bacteria | 1532 |
| 253 | Ga0070716_100004867 | 3300006173 | Bacteria | 6456 |
| 254 | Ga0070716_100030369 | 3300006173 | Bacteria | 2930 |
| 255 | Ga0070716_100220603 | 3300006173 | Bacteria | 1274 |
| 256 | Ga0070716_100236410 | 3300006173 | Bacteria | 1236 |
| 257 | Ga0070716_100567026 | 3300006173 | Bacteria | 849 |
| 258 | Ga0070716_100617204 | 3300006173 | Bacteria | 818 |
| 259 | Ga0070712_100005583 | 3300006175 | Bacteria | 7780 |
| 260 | Ga0070712_100033573 | 3300006175 | Bacteria | 3473 |
| 261 | Ga0070712_100092117 | 3300006175 | Bacteria | 2222 |
| 262 | Ga0070712_100265388 | 3300006175 | Bacteria | 1377 |
| 263 | Ga0070712_100802617 | 3300006175 | Bacteria | 807 |
| 264 | Ga0075362_10009303 | 3300006177 | Bacteria | 3795 |
| 265 | Ga0075362_10036856 | 3300006177 | Bacteria | 2142 |
| 266 | Ga0075367_10010911 | 3300006178 | Bacteria | 4788 |
| 267 | Ga0075367_10013533 | 3300006178 | Bacteria | 4389 |
| 268 | Ga0075367_10017380 | 3300006178 | Bacteria | 3947 |
| 269 | Ga0075367_10102262 | 3300006178 | Bacteria | 1753 |
| 270 | Ga0075367_10183291 | 3300006178 | Bacteria | 1306 |
| 271 | Ga0075367_10195716 | 3300006178 | Bacteria | 1262 |
| 272 | Ga0075367_10323223 | 3300006178 | Bacteria | 972 |
| 273 | Ga0075369_10002311 | 3300006186 | Bacteria | 6779 |
| 274 | Ga0075369_10005323 | 3300006186 | Bacteria | 4798 |
| 275 | Ga0075369_10016536 | 3300006186 | Bacteria | 2979 |
| 276 | Ga0075366_10017413 | 3300006195 | Bacteria | 4135 |
| 277 | Ga0075366_10068034 | 3300006195 | Bacteria | 2120 |
| 278 | Ga0075366_10133996 | 3300006195 | Bacteria | 1496 |
| 279 | Ga0075366_10177373 | 3300006195 | Bacteria | 1294 |
| 280 | Ga0097621_100005209 | 3300006237 | Bacteria | 9138 |
| 281 | Ga0097621_100145696 | 3300006237 | Bacteria | 2027 |
| 282 | Ga0097621_100267705 | 3300006237 | Bacteria | 1501 |
| 283 | Ga0097621_100319132 | 3300006237 | Bacteria | 1376 |
| 284 | Ga0075370_10044744 | 3300006353 | Bacteria | 2503 |
| 285 | Ga0075370_10053029 | 3300006353 | Bacteria | 2302 |
| 286 | Ga0075370_10272471 | 3300006353 | Bacteria | 1005 |
| 287 | Ga0075370_10312223 | 3300006353 | Bacteria | 936 |
| 288 | Ga0068871_100005755 | 3300006358 | Bacteria | 8703 |
| 289 | Ga0068871_100053750 | 3300006358 | Bacteria | 3265 |
| 290 | Ga0068871_100188522 | 3300006358 | Bacteria | 1775 |
| 291 | Ga0068871_100819448 | 3300006358 | Bacteria | 859 |
| 292 | Ga0075428_100020774 | 3300006844 | Bacteria | 7270 |
| 293 | Ga0075428_100375906 | 3300006844 | Bacteria | 1523 |
| 294 | Ga0075428_101332140 | 3300006844 | Bacteria | 754 |
| 295 | Ga0075430_100011908 | 3300006846 | Bacteria | 7404 |
| 296 | Ga0075430_100175942 | 3300006846 | Bacteria | 1780 |
| 297 | Ga0075430_100331958 | 3300006846 | Bacteria | 1256 |
| 298 | Ga0075430_100346996 | 3300006846 | Bacteria | 1226 |
| 299 | Ga0075431_100017460 | 3300006847 | Bacteria | 7294 |
| 300 | Ga0075431_100021552 | 3300006847 | Bacteria | 6591 |
| 301 | Ga0075431_100161326 | 3300006847 | Bacteria | 2305 |
| 302 | Ga0075431_100212946 | 3300006847 | Bacteria | 1973 |
| 303 | Ga0075431_100433888 | 3300006847 | Bacteria | 1311 |
| 304 | Ga0075434_100091249 | 3300006871 | Bacteria | 3048 |
| 305 | Ga0075429_100194579 | 3300006880 | Bacteria | 1776 |
| 306 | Ga0075429_100203900 | 3300006880 | Bacteria | 1733 |
| 307 | Ga0075429_100268878 | 3300006880 | Bacteria | 1493 |
| 308 | Ga0068865_100003574 | 3300006881 | Bacteria | 9338 |
| 309 | Ga0068865_100460845 | 3300006881 | Bacteria | 1053 |
| 310 | Ga0097620_100295664 | 3300006931 | Bacteria | 1712 |
| 311 | Ga0097620_100462413 | 3300006931 | Bacteria | 1365 |
| 312 | Ga0097620_100772883 | 3300006931 | Bacteria | 1049 |
| 313 | Ga0075435_100040343 | 3300007076 | Bacteria | 3727 |
| 314 | Ga0099794_10005140 | 3300007265 | Bacteria | 5223 |
| 315 | Ga0099794_10013549 | 3300007265 | Bacteria | 3552 |
| 316 | Ga0099795_10019288 | 3300007788 | Bacteria | 2204 |
| 317 | Ga0099795_10020673 | 3300007788 | Bacteria | 2148 |
| 318 | Ga0105251_10032456 | 3300009011 | Bacteria | 2601 |
| 319 | Ga0105251_10202657 | 3300009011 | Bacteria | 894 |
| 320 | Ga0105251_10257219 | 3300009011 | Bacteria | 787 |
| 321 | Ga0105244_10023579 | 3300009036 | Bacteria | 3371 |
| 322 | Ga0105244_10154257 | 3300009036 | Bacteria | 1099 |
| 323 | Ga0105250_10021450 | 3300009092 | Bacteria | 2607 |
| 324 | Ga0105250_10023301 | 3300009092 | Bacteria | 2494 |
| 325 | Ga0105250_10051228 | 3300009092 | Bacteria | 1656 |
| 326 | Ga0105240_10002493 | 3300009093 | Bacteria | 29572 |
| 327 | Ga0105240_10012470 | 3300009093 | Bacteria | 11727 |
| 328 | Ga0105240_10041457 | 3300009093 | Bacteria | 5876 |
| 329 | Ga0105240_10172639 | 3300009093 | Bacteria | 2559 |
| 330 | Ga0105240_10650698 | 3300009093 | Bacteria | 1155 |
| 331 | Ga0111539_10029807 | 3300009094 | Bacteria | 6640 |
| 332 | Ga0111539_10427369 | 3300009094 | Bacteria | 1543 |
| 333 | Ga0111539_10568771 | 3300009094 | Bacteria | 1320 |
| 334 | Ga0111539_10909798 | 3300009094 | Bacteria | 1023 |
| 335 | Ga0111539_11077385 | 3300009094 | Bacteria | 934 |
| 336 | Ga0111539_11642481 | 3300009094 | Bacteria | 745 |
| 337 | Ga0105245_10008917 | 3300009098 | Bacteria | 8755 |
| 338 | Ga0105245_10416032 | 3300009098 | Bacteria | 1346 |
| 339 | Ga0105245_10611773 | 3300009098 | Bacteria | 1117 |
| 340 | Ga0105247_10004796 | 3300009101 | Bacteria | 8615 |
| 341 | Ga0105247_10012294 | 3300009101 | Bacteria | 5143 |
| 342 | Ga0105247_10013310 | 3300009101 | Bacteria | 4938 |
| 343 | Ga0114129_10068576 | 3300009147 | Bacteria | 4945 |
| 344 | Ga0114129_10103640 | 3300009147 | Bacteria | 3933 |
| 345 | Ga0114129_10106492 | 3300009147 | Bacteria | 3873 |
| 346 | Ga0114129_10200287 | 3300009147 | Bacteria | 2705 |
| 347 | Ga0114129_10336120 | 3300009147 | Bacteria | 2004 |
| 348 | Ga0105243_10000209 | 3300009148 | Bacteria | 68700 |
| 349 | Ga0105243_10061519 | 3300009148 | Bacteria | 3003 |
| 350 | Ga0105243_10400522 | 3300009148 | Bacteria | 1275 |
| 351 | Ga0105243_10874030 | 3300009148 | Bacteria | 892 |
| 352 | Ga0105241_10421269 | 3300009174 | Bacteria | 1175 |
| 353 | Ga0105241_10866776 | 3300009174 | Bacteria | 836 |
| 354 | Ga0105242_10002692 | 3300009176 | Bacteria | 13901 |
| 355 | Ga0105242_10075288 | 3300009176 | Bacteria | 2810 |
| 356 | Ga0105242_10101075 | 3300009176 | Bacteria | 2443 |
| 357 | Ga0105242_10364233 | 3300009176 | Bacteria | 1339 |
| 358 | Ga0105242_10929947 | 3300009176 | Bacteria | 872 |
| 359 | Ga0105248_10371195 | 3300009177 | Bacteria | 1611 |
| 360 | Ga0105248_10408807 | 3300009177 | Bacteria | 1528 |
| 361 | Ga0105248_10855041 | 3300009177 | Bacteria | 1027 |
| 362 | Ga0105237_10003531 | 3300009545 | Bacteria | 18527 |
| 363 | Ga0105237_10024701 | 3300009545 | Bacteria | 6147 |
| 364 | Ga0105237_10425600 | 3300009545 | Bacteria | 1333 |
| 365 | Ga0105237_10493410 | 3300009545 | Bacteria | 1231 |
| 366 | Ga0105237_10522458 | 3300009545 | Bacteria | 1194 |
| 367 | Ga0105238_10203143 | 3300009551 | Bacteria | 1957 |
| 368 | Ga0105238_10257014 | 3300009551 | Bacteria | 1726 |
| 369 | Ga0105238_10281676 | 3300009551 | Bacteria | 1644 |
| 370 | Ga0105238_10927943 | 3300009551 | Bacteria | 890 |
| 371 | Ga0105249_10009715 | 3300009553 | Bacteria | 8431 |
| 372 | Ga0105249_10338592 | 3300009553 | Bacteria | 1520 |
| 373 | Ga0105249_10620881 | 3300009553 | Bacteria | 1137 |
| 374 | Ga0105249_10633503 | 3300009553 | Bacteria | 1126 |
| 375 | Ga0105249_10770857 | 3300009553 | Bacteria | 1025 |
| 376 | Ga0105028_106674 | 3300009993 | Bacteria | 1205 |
| 377 | Ga0105239_10019175 | 3300010375 | Bacteria | 7556 |
| 378 | Ga0105239_10072092 | 3300010375 | Bacteria | 3796 |
| 379 | Ga0105239_10084759 | 3300010375 | Bacteria | 3491 |
| 380 | Ga0105239_10116418 | 3300010375 | Bacteria | 2966 |
| 381 | Ga0105239_10144007 | 3300010375 | Bacteria | 2657 |
| 382 | Ga0105239_10435836 | 3300010375 | Bacteria | 1486 |
| 383 | Ga0105239_10540923 | 3300010375 | Bacteria | 1326 |
| 384 | Ga0105246_10003085 | 3300011119 | Bacteria | 10112 |
| 385 | Ga0105246_10039338 | 3300011119 | Bacteria | 3185 |
| 386 | Ga0105246_10205094 | 3300011119 | Bacteria | 1535 |
| 387 | Ga0105246_10401504 | 3300011119 | Bacteria | 1138 |
| 388 | Ga0105246_10410100 | 3300011119 | Bacteria | 1127 |
| 389 | Ga0105246_10446953 | 3300011119 | Bacteria | 1085 |
| 390 | Ga0105246_10510512 | 3300011119 | Bacteria | 1022 |
| 391 | Ga0157373_10106549 | 3300013100 | Bacteria | 1971 |
| 392 | Ga0157371_10368724 | 3300013102 | Bacteria | 1047 |
| 393 | Ga0157370_10011426 | 3300013104 | Bacteria | 9285 |
| 394 | Ga0157370_10115568 | 3300013104 | Bacteria | 2506 |
| 395 | Ga0157370_10264351 | 3300013104 | Bacteria | 1590 |
| 396 | Ga0157370_10633477 | 3300013104 | Bacteria | 978 |
| 397 | Ga0157369_10039088 | 3300013105 | Bacteria | 5187 |
| 398 | Ga0157369_10064374 | 3300013105 | Bacteria | 3949 |
| 399 | Ga0157369_10133361 | 3300013105 | Bacteria | 2631 |
| 400 | Ga0157374_10052132 | 3300013296 | Bacteria | 3809 |
| 401 | Ga0157374_10113755 | 3300013296 | Bacteria | 2605 |
| 402 | Ga0157374_10996330 | 3300013296 | Bacteria | 857 |
| 403 | Ga0157378_10029475 | 3300013297 | Bacteria | 4845 |
| 404 | Ga0157378_10196836 | 3300013297 | Bacteria | 1904 |
| 405 | Ga0157378_10248316 | 3300013297 | Bacteria | 1703 |
| 406 | Ga0157378_10504365 | 3300013297 | Bacteria | 1209 |
| 407 | Ga0163162_10000043 | 3300013306 | Bacteria | 129324 |
| 408 | Ga0163162_10008437 | 3300013306 | Bacteria | 10048 |
| 409 | Ga0163162_10235517 | 3300013306 | Bacteria | 1961 |
| 410 | Ga0163162_10268551 | 3300013306 | Bacteria | 1837 |
| 411 | Ga0163162_10584023 | 3300013306 | Bacteria | 1244 |
| 412 | Ga0157372_10135433 | 3300013307 | Bacteria | 2836 |
| 413 | Ga0157375_10042199 | 3300013308 | Bacteria | 4413 |
| 414 | Ga0157375_10286068 | 3300013308 | Bacteria | 1812 |
| 415 | Ga0157375_10553907 | 3300013308 | Bacteria | 1311 |
| 416 | Ga0157375_10751337 | 3300013308 | Bacteria | 1126 |
| 417 | Ga0157375_10855511 | 3300013308 | Bacteria | 1056 |
| 418 | Ga0157375_11177937 | 3300013308 | Bacteria | 898 |
| 419 | Ga0163163_10010656 | 3300014325 | Bacteria | 8285 |
| 420 | Ga0163163_10011142 | 3300014325 | Bacteria | 8140 |
| 421 | Ga0163163_10580092 | 3300014325 | Bacteria | 1184 |
| 422 | Ga0163163_11397875 | 3300014325 | Bacteria | 762 |
| 423 | Ga0163163_11582014 | 3300014325 | Bacteria | 716 |
| 424 | Ga0157380_10032373 | 3300014326 | Bacteria | 4021 |
| 425 | Ga0157380_10053098 | 3300014326 | Bacteria | 3212 |
| 426 | Ga0157380_10073359 | 3300014326 | Bacteria | 2774 |
| 427 | Ga0157380_10133600 | 3300014326 | Bacteria | 2121 |
| 428 | Ga0157380_10156702 | 3300014326 | Bacteria | 1974 |
| 429 | Ga0157380_10709545 | 3300014326 | Bacteria | 1012 |
| 430 | Ga0182008_10054106 | 3300014497 | Bacteria | 1987 |
| 431 | Ga0182008_10148475 | 3300014497 | Bacteria | 1175 |
| 432 | Ga0157377_10000894 | 3300014745 | Bacteria | 12440 |
| 433 | Ga0157379_10077606 | 3300014968 | Bacteria | 2974 |
| 434 | Ga0157379_10084010 | 3300014968 | Bacteria | 2854 |
| 435 | Ga0157379_10171616 | 3300014968 | Bacteria | 1958 |
| 436 | Ga0157379_10232953 | 3300014968 | Bacteria | 1670 |
| 437 | Ga0157379_10296007 | 3300014968 | Bacteria | 1474 |
| 438 | Ga0157379_10408745 | 3300014968 | Bacteria | 1249 |
| 439 | Ga0157376_10087414 | 3300014969 | Bacteria | 2690 |
| 440 | Ga0157376_10105885 | 3300014969 | Bacteria | 2467 |
| 441 | Ga0157376_10134516 | 3300014969 | Bacteria | 2211 |
| 442 | Ga0157376_10413471 | 3300014969 | Bacteria | 1307 |
| 443 | Ga0157376_10455855 | 3300014969 | Bacteria | 1248 |
| 444 | Ga0157376_10569702 | 3300014969 | Bacteria | 1123 |
| 445 | Ga0182006_1095809 | 3300015261 | Bacteria | 1060 |
| 446 | Ga0182005_1073410 | 3300015265 | Bacteria | 940 |
| 447 | Ga0163161_10257439 | 3300017792 | Bacteria | 1362 |
| 448 | Ga0163161_10311656 | 3300017792 | Bacteria | 1242 |
| 449 | Ga0163161_10817341 | 3300017792 | Bacteria | 784 |
| 450 | Ga0206354_11440000 | 3300020081 | Bacteria | 6386 |
| 451 | Ga0206353_10040355 | 3300020082 | Bacteria | 7975 |
| 452 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 453 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 454 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 455 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 456 | Ga0214543_1022088 | 3300021327 | Bacteria | 4624 |
| 457 | Ga0213873_10000006 | 3300021358 | Bacteria | 408723 |
| 458 | Ga0213873_10028827 | 3300021358 | Bacteria | 1364 |
| 459 | Ga0213874_10032374 | 3300021377 | Bacteria | 1518 |
| 460 | Ga0213874_10097772 | 3300021377 | Bacteria | 972 |
| 461 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 462 | Ga0213876_10004040 | 3300021384 | Bacteria | 8257 |
| 463 | Ga0213876_10045989 | 3300021384 | Bacteria | 2308 |
| 464 | Ga0213875_10040547 | 3300021388 | Bacteria | 2192 |
| 465 | Ga0213875_10085645 | 3300021388 | Bacteria | 1470 |
| 466 | Ga0213871_10000281 | 3300021441 | Bacteria | 6322 |
| 467 | Ga0213871_10009471 | 3300021441 | Bacteria | 2183 |
| 468 | Ga0209784_100051 | 3300025224 | Bacteria | 183666 |
| 469 | Ga0209566_100112 | 3300025225 | Bacteria | 111585 |
| 470 | Ga0209566_100158 | 3300025225 | Bacteria | 76076 |
| 471 | Ga0209566_103510 | 3300025225 | Bacteria | 2385 |
| 472 | Ga0209147_100062 | 3300025229 | Bacteria | 242831 |
| 473 | Ga0209147_100101 | 3300025229 | Bacteria | 161976 |
| 474 | Ga0209147_100559 | 3300025229 | Bacteria | 20945 |
| 475 | Ga0209147_101819 | 3300025229 | Bacteria | 6631 |
| 476 | Ga0209563_101258 | 3300025230 | Bacteria | 6952 |
| 477 | Ga0209258_101869 | 3300025242 | Bacteria | 6333 |
| 478 | Ga0209677_100240 | 3300025253 | Bacteria | 37740 |
| 479 | Ga0209677_101553 | 3300025253 | Bacteria | 9774 |
| 480 | Ga0209148_1000849 | 3300025254 | Bacteria | 21522 |
| 481 | Ga0209148_1006744 | 3300025254 | Bacteria | 2456 |
| 482 | Ga0209233_1004289 | 3300025261 | Bacteria | 4877 |
| 483 | Ga0209233_1024415 | 3300025261 | Bacteria | 1512 |
| 484 | Ga0209233_1037347 | 3300025261 | Bacteria | 1080 |
| 485 | Ga0209233_1042303 | 3300025261 | Bacteria | 978 |
| 486 | Ga0209565_1000195 | 3300025263 | Bacteria | 72860 |
| 487 | Ga0209455_1001056 | 3300025272 | Bacteria | 13629 |
| 488 | Ga0209455_1001077 | 3300025272 | Bacteria | 13457 |
| 489 | Ga0209673_1001368 | 3300025273 | Bacteria | 24002 |
| 490 | Ga0209673_1002410 | 3300025273 | Bacteria | 13048 |
| 491 | Ga0209673_1033439 | 3300025273 | Bacteria | 1568 |
| 492 | Ga0209130_1006510 | 3300025284 | Bacteria | 3778 |
| 493 | Ga0209130_1011599 | 3300025284 | Bacteria | 2352 |
| 494 | Ga0209675_1006600 | 3300025291 | Bacteria | 4620 |
| 495 | Ga0209675_1023680 | 3300025291 | Bacteria | 1585 |
| 496 | Ga0209675_1035722 | 3300025291 | Bacteria | 1131 |
| 497 | Ga0209675_1053419 | 3300025291 | Bacteria | 824 |
| 498 | Ga0209676_1000082 | 3300025292 | Bacteria | 280400 |
| 499 | Ga0209676_1000224 | 3300025292 | Bacteria | 124160 |
| 500 | Ga0209676_1000374 | 3300025292 | Bacteria | 82896 |
| 501 | Ga0209676_1003709 | 3300025292 | Bacteria | 9117 |
| 502 | Ga0209676_1007483 | 3300025292 | Bacteria | 5109 |
| 503 | Ga0209676_1008567 | 3300025292 | Bacteria | 4539 |
| 504 | Ga0209676_1010333 | 3300025292 | Bacteria | 3906 |
| 505 | Ga0209676_1014012 | 3300025292 | Bacteria | 3045 |
| 506 | Ga0209676_1037468 | 3300025292 | Bacteria | 1399 |
| 507 | Ga0209676_1054824 | 3300025292 | Bacteria | 1025 |
| 508 | Ga0209025_1001531 | 3300025294 | Bacteria | 29557 |
| 509 | Ga0209025_1003426 | 3300025294 | Bacteria | 15043 |
| 510 | Ga0209025_1003576 | 3300025294 | Bacteria | 14532 |
| 511 | Ga0209025_1004018 | 3300025294 | Bacteria | 13184 |
| 512 | Ga0209025_1004765 | 3300025294 | Bacteria | 11518 |
| 513 | Ga0209025_1004804 | 3300025294 | Bacteria | 11455 |
| 514 | Ga0209025_1006577 | 3300025294 | Bacteria | 8959 |
| 515 | Ga0209025_1007420 | 3300025294 | Bacteria | 8189 |
| 516 | Ga0209025_1008453 | 3300025294 | Bacteria | 7407 |
| 517 | Ga0209025_1010494 | 3300025294 | Bacteria | 6270 |
| 518 | Ga0209025_1014192 | 3300025294 | Bacteria | 4930 |
| 519 | Ga0209025_1027219 | 3300025294 | Bacteria | 2842 |
| 520 | Ga0209564_1001613 | 3300025295 | Bacteria | 21895 |
| 521 | Ga0209564_1014164 | 3300025295 | Bacteria | 3336 |
| 522 | Ga0209564_1022771 | 3300025295 | Bacteria | 2200 |
| 523 | Ga0209564_1040023 | 3300025295 | Bacteria | 1279 |
| 524 | Ga0209758_1000026 | 3300025297 | Bacteria | 582706 |
| 525 | Ga0209758_1000526 | 3300025297 | Bacteria | 61197 |
| 526 | Ga0209758_1001753 | 3300025297 | Bacteria | 24107 |
| 527 | Ga0209758_1002770 | 3300025297 | Bacteria | 17161 |
| 528 | Ga0209758_1004348 | 3300025297 | Bacteria | 11866 |
| 529 | Ga0209758_1009300 | 3300025297 | Bacteria | 6136 |
| 530 | Ga0209758_1015309 | 3300025297 | Bacteria | 3985 |
| 531 | Ga0209758_1025500 | 3300025297 | Bacteria | 2592 |
| 532 | Ga0209050_1000443 | 3300025298 | Bacteria | 75067 |
| 533 | Ga0209050_1000735 | 3300025298 | Bacteria | 47579 |
| 534 | Ga0209050_1012972 | 3300025298 | Bacteria | 3763 |
| 535 | Ga0209256_1000535 | 3300025299 | Bacteria | 55077 |
| 536 | Ga0209256_1022305 | 3300025299 | Bacteria | 1920 |
| 537 | Ga0207426_1000213 | 3300025302 | Bacteria | 137311 |
| 538 | Ga0207426_1001534 | 3300025302 | Bacteria | 18789 |
| 539 | Ga0207426_1024890 | 3300025302 | Bacteria | 2024 |
| 540 | Ga0209051_1002443 | 3300025303 | Bacteria | 13353 |
| 541 | Ga0209051_1057187 | 3300025303 | Bacteria | 1251 |
| 542 | Ga0209257_1000218 | 3300025304 | Bacteria | 135855 |
| 543 | Ga0209257_1000626 | 3300025304 | Bacteria | 56850 |
| 544 | Ga0209257_1000930 | 3300025304 | Bacteria | 40542 |
| 545 | Ga0209257_1001466 | 3300025304 | Bacteria | 27822 |
| 546 | Ga0209257_1001794 | 3300025304 | Bacteria | 23601 |
| 547 | Ga0209257_1014478 | 3300025304 | Bacteria | 3386 |
| 548 | Ga0207697_10096231 | 3300025315 | Bacteria | 1259 |
| 549 | Ga0207696_1001433 | 3300025711 | Bacteria | 12962 |
| 550 | Ga0207696_1003350 | 3300025711 | Bacteria | 7366 |
| 551 | Ga0207696_1004678 | 3300025711 | Bacteria | 5847 |
| 552 | Ga0207655_1004092 | 3300025728 | Bacteria | 10497 |
| 553 | Ga0207655_1009156 | 3300025728 | Bacteria | 6187 |
| 554 | Ga0207655_1016667 | 3300025728 | Bacteria | 4007 |
| 555 | Ga0207713_1004512 | 3300025735 | Bacteria | 9016 |
| 556 | Ga0207682_10026497 | 3300025893 | Bacteria | 2305 |
| 557 | Ga0207692_10001394 | 3300025898 | Bacteria | 9044 |
| 558 | Ga0207692_10003157 | 3300025898 | Bacteria | 6395 |
| 559 | Ga0207642_10414076 | 3300025899 | Bacteria | 809 |
| 560 | Ga0207710_10015614 | 3300025900 | Bacteria | 3212 |
| 561 | Ga0207710_10039499 | 3300025900 | Bacteria | 2089 |
| 562 | Ga0207710_10045167 | 3300025900 | Bacteria | 1964 |
| 563 | Ga0207710_10136919 | 3300025900 | Bacteria | 1180 |
| 564 | Ga0207688_10068259 | 3300025901 | Bacteria | 2013 |
| 565 | Ga0207688_10279814 | 3300025901 | Bacteria | 1016 |
| 566 | Ga0207680_10029511 | 3300025903 | Bacteria | 3082 |
| 567 | Ga0207680_10431147 | 3300025903 | Bacteria | 934 |
| 568 | Ga0207647_10004089 | 3300025904 | Bacteria | 10838 |
| 569 | Ga0207685_10092331 | 3300025905 | Bacteria | 1277 |
| 570 | Ga0207699_10004142 | 3300025906 | Bacteria | 6943 |
| 571 | Ga0207699_10019092 | 3300025906 | Bacteria | 3648 |
| 572 | Ga0207699_10127335 | 3300025906 | Bacteria | 1656 |
| 573 | Ga0207699_10182270 | 3300025906 | Bacteria | 1412 |
| 574 | Ga0207645_10063123 | 3300025907 | Bacteria | 2366 |
| 575 | Ga0207645_10081161 | 3300025907 | Bacteria | 2079 |
| 576 | Ga0207645_10129767 | 3300025907 | Bacteria | 1640 |
| 577 | Ga0207645_10490662 | 3300025907 | Bacteria | 831 |
| 578 | Ga0207643_10002912 | 3300025908 | Bacteria | 9244 |
| 579 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 580 | Ga0207705_10139390 | 3300025909 | Bacteria | 1810 |
| 581 | Ga0207705_10498140 | 3300025909 | Bacteria | 946 |
| 582 | Ga0207684_10001378 | 3300025910 | Bacteria | 26499 |
| 583 | Ga0207684_10135158 | 3300025910 | Bacteria | 2117 |
| 584 | Ga0207684_10492048 | 3300025910 | Bacteria | 1052 |
| 585 | Ga0207684_10847789 | 3300025910 | Bacteria | 770 |
| 586 | Ga0207654_10013939 | 3300025911 | Bacteria | 4143 |
| 587 | Ga0207654_10280216 | 3300025911 | Bacteria | 1127 |
| 588 | Ga0207654_10287127 | 3300025911 | Bacteria | 1114 |
| 589 | Ga0207707_10022121 | 3300025912 | Bacteria | 5558 |
| 590 | Ga0207707_10182199 | 3300025912 | Bacteria | 1833 |
| 591 | Ga0207707_10287734 | 3300025912 | Bacteria | 1422 |
| 592 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 593 | Ga0207695_10026360 | 3300025913 | Bacteria | 6487 |
| 594 | Ga0207695_10056087 | 3300025913 | Bacteria | 4102 |
| 595 | Ga0207695_10081179 | 3300025913 | Bacteria | 3282 |
| 596 | Ga0207695_10135160 | 3300025913 | Bacteria | 2420 |
| 597 | Ga0207695_10149781 | 3300025913 | Bacteria | 2273 |
| 598 | Ga0207695_10284512 | 3300025913 | Bacteria | 1547 |
| 599 | Ga0207695_10451293 | 3300025913 | Bacteria | 1169 |
| 600 | Ga0207671_10000774 | 3300025914 | Bacteria | 40531 |
| 601 | Ga0207671_10064265 | 3300025914 | Bacteria | 2728 |
| 602 | Ga0207671_10104187 | 3300025914 | Bacteria | 2152 |
| 603 | Ga0207693_10000095 | 3300025915 | Bacteria | 78764 |
| 604 | Ga0207693_10004244 | 3300025915 | Bacteria | 12153 |
| 605 | Ga0207693_10023789 | 3300025915 | Bacteria | 4862 |
| 606 | Ga0207693_10061212 | 3300025915 | Bacteria | 2948 |
| 607 | Ga0207693_10093094 | 3300025915 | Bacteria | 2362 |
| 608 | Ga0207693_10254467 | 3300025915 | Bacteria | 1378 |
| 609 | Ga0207693_10495713 | 3300025915 | Bacteria | 954 |
| 610 | Ga0207663_10005035 | 3300025916 | Bacteria | 6634 |
| 611 | Ga0207663_10005324 | 3300025916 | Bacteria | 6475 |
| 612 | Ga0207663_10010748 | 3300025916 | Bacteria | 4887 |
| 613 | Ga0207663_10050440 | 3300025916 | Bacteria | 2586 |
| 614 | Ga0207660_10005232 | 3300025917 | Bacteria | 8429 |
| 615 | Ga0207660_10107656 | 3300025917 | Bacteria | 2092 |
| 616 | Ga0207662_10143330 | 3300025918 | Bacteria | 1515 |
| 617 | Ga0207657_10013159 | 3300025919 | Bacteria | 8123 |
| 618 | Ga0207657_10087753 | 3300025919 | Bacteria | 2602 |
| 619 | Ga0207657_10325964 | 3300025919 | Bacteria | 1214 |
| 620 | Ga0207649_10026891 | 3300025920 | Bacteria | 3371 |
| 621 | Ga0207649_10433260 | 3300025920 | Bacteria | 989 |
| 622 | Ga0207649_10711568 | 3300025920 | Bacteria | 779 |
| 623 | Ga0207652_10049918 | 3300025921 | Bacteria | 3583 |
| 624 | Ga0207652_10291879 | 3300025921 | Bacteria | 1471 |
| 625 | Ga0207646_10002702 | 3300025922 | Bacteria | 20798 |
| 626 | Ga0207646_10003436 | 3300025922 | Bacteria | 17890 |
| 627 | Ga0207646_10592602 | 3300025922 | Bacteria | 995 |
| 628 | Ga0207646_10994197 | 3300025922 | Bacteria | 741 |
| 629 | Ga0207681_10007974 | 3300025923 | Bacteria | 6475 |
| 630 | Ga0207681_10067633 | 3300025923 | Bacteria | 2478 |
| 631 | Ga0207681_10077129 | 3300025923 | Bacteria | 2342 |
| 632 | Ga0207681_10082921 | 3300025923 | Bacteria | 2268 |
| 633 | Ga0207681_10329699 | 3300025923 | Bacteria | 1216 |
| 634 | Ga0207681_10847262 | 3300025923 | Bacteria | 764 |
| 635 | Ga0207694_10040691 | 3300025924 | Bacteria | 3580 |
| 636 | Ga0207694_10309862 | 3300025924 | Bacteria | 1301 |
| 637 | Ga0207694_10314326 | 3300025924 | Bacteria | 1292 |
| 638 | Ga0207650_10446591 | 3300025925 | Bacteria | 1076 |
| 639 | Ga0207659_10247417 | 3300025926 | Bacteria | 1445 |
| 640 | Ga0207659_10722854 | 3300025926 | Bacteria | 853 |
| 641 | Ga0207687_10130102 | 3300025927 | Bacteria | 1896 |
| 642 | Ga0207700_10113909 | 3300025928 | Bacteria | 2181 |
| 643 | Ga0207700_10398544 | 3300025928 | Unclassified | 1206 |
| 644 | Ga0207700_10536225 | 3300025928 | Unclassified | 1038 |
| 645 | Ga0207700_10657636 | 3300025928 | Bacteria | 934 |
| 646 | Ga0207664_10001459 | 3300025929 | Bacteria | 15529 |
| 647 | Ga0207664_10022969 | 3300025929 | Bacteria | 4667 |
| 648 | Ga0207664_10037596 | 3300025929 | Bacteria | 3748 |
| 649 | Ga0207664_10260319 | 3300025929 | Bacteria | 1517 |
| 650 | Ga0207664_10290736 | 3300025929 | Bacteria | 1436 |
| 651 | Ga0207644_10020240 | 3300025931 | Bacteria | 4522 |
| 652 | Ga0207644_10024786 | 3300025931 | Bacteria | 4121 |
| 653 | Ga0207690_10002077 | 3300025932 | Bacteria | 12273 |
| 654 | Ga0207690_10125035 | 3300025932 | Bacteria | 1874 |
| 655 | Ga0207690_10401242 | 3300025932 | Bacteria | 1093 |
| 656 | Ga0207706_10093957 | 3300025933 | Bacteria | 2638 |
| 657 | Ga0207709_10026143 | 3300025935 | Bacteria | 3350 |
| 658 | Ga0207709_10066606 | 3300025935 | Bacteria | 2269 |
| 659 | Ga0207709_10133158 | 3300025935 | Bacteria | 1697 |
| 660 | Ga0207709_10525710 | 3300025935 | Bacteria | 927 |
| 661 | Ga0207670_10147234 | 3300025936 | Bacteria | 1743 |
| 662 | Ga0207670_10223272 | 3300025936 | Bacteria | 1443 |
| 663 | Ga0207670_10648798 | 3300025936 | Bacteria | 870 |
| 664 | Ga0207669_10038820 | 3300025937 | Bacteria | 2746 |
| 665 | Ga0207669_10249923 | 3300025937 | Bacteria | 1320 |
| 666 | Ga0207704_10002133 | 3300025938 | Bacteria | 8872 |
| 667 | Ga0207704_10673391 | 3300025938 | Bacteria | 854 |
| 668 | Ga0207665_10003452 | 3300025939 | Bacteria | 10563 |
| 669 | Ga0207665_10008093 | 3300025939 | Bacteria | 6940 |
| 670 | Ga0207665_10042690 | 3300025939 | Bacteria | 3031 |
| 671 | Ga0207665_10169939 | 3300025939 | Bacteria | 1574 |
| 672 | Ga0207665_10247773 | 3300025939 | Bacteria | 1315 |
| 673 | Ga0207691_10005669 | 3300025940 | Bacteria | 12069 |
| 674 | Ga0207691_10098084 | 3300025940 | Bacteria | 2618 |
| 675 | Ga0207691_10256370 | 3300025940 | Bacteria | 1508 |
| 676 | Ga0207691_10383787 | 3300025940 | Bacteria | 1199 |
| 677 | Ga0207691_10965370 | 3300025940 | Bacteria | 712 |
| 678 | Ga0207711_10038629 | 3300025941 | Bacteria | 4060 |
| 679 | Ga0207711_10771177 | 3300025941 | Bacteria | 896 |
| 680 | Ga0207689_10009368 | 3300025942 | Bacteria | 8462 |
| 681 | Ga0207689_10725979 | 3300025942 | Bacteria | 838 |
| 682 | Ga0207661_10049557 | 3300025944 | Bacteria | 3343 |
| 683 | Ga0207661_10054953 | 3300025944 | Bacteria | 3191 |
| 684 | Ga0207661_10854058 | 3300025944 | Bacteria | 838 |
| 685 | Ga0207679_10274138 | 3300025945 | Bacteria | 1444 |
| 686 | Ga0207679_10363818 | 3300025945 | Bacteria | 1264 |
| 687 | Ga0207667_10023653 | 3300025949 | Bacteria | 6762 |
| 688 | Ga0207667_10107430 | 3300025949 | Bacteria | 2879 |
| 689 | Ga0207667_10118681 | 3300025949 | Bacteria | 2726 |
| 690 | Ga0207667_10177169 | 3300025949 | Bacteria | 2190 |
| 691 | Ga0207667_10986539 | 3300025949 | Bacteria | 830 |
| 692 | Ga0207651_10524926 | 3300025960 | Bacteria | 1026 |
| 693 | Ga0207712_10068208 | 3300025961 | Bacteria | 2548 |
| 694 | Ga0207712_10324111 | 3300025961 | Bacteria | 1272 |
| 695 | Ga0207712_10426204 | 3300025961 | Bacteria | 1120 |
| 696 | Ga0207668_10005444 | 3300025972 | Bacteria | 7496 |
| 697 | Ga0207668_10049565 | 3300025972 | Bacteria | 2888 |
| 698 | Ga0207668_10112239 | 3300025972 | Bacteria | 2047 |
| 699 | Ga0207668_10224535 | 3300025972 | Bacteria | 1510 |
| 700 | Ga0207668_10488248 | 3300025972 | Bacteria | 1057 |
| 701 | Ga0207668_10631345 | 3300025972 | Bacteria | 936 |
| 702 | Ga0207640_10307593 | 3300025981 | Bacteria | 1257 |
| 703 | Ga0207658_10035677 | 3300025986 | Bacteria | 3563 |
| 704 | Ga0207658_10826463 | 3300025986 | Bacteria | 842 |
| 705 | Ga0207677_10182474 | 3300026023 | Bacteria | 1652 |
| 706 | Ga0207677_10217399 | 3300026023 | Bacteria | 1530 |
| 707 | Ga0207677_10331415 | 3300026023 | Bacteria | 1268 |
| 708 | Ga0207703_10050438 | 3300026035 | Bacteria | 3368 |
| 709 | Ga0207703_10094542 | 3300026035 | Bacteria | 2520 |
| 710 | Ga0207703_10200510 | 3300026035 | Bacteria | 1773 |
| 711 | Ga0207703_10253516 | 3300026035 | Bacteria | 1587 |
| 712 | Ga0207639_10451984 | 3300026041 | Bacteria | 1166 |
| 713 | Ga0207639_10509021 | 3300026041 | Bacteria | 1101 |
| 714 | Ga0207678_10016716 | 3300026067 | Bacteria | 6444 |
| 715 | Ga0207678_10150623 | 3300026067 | Bacteria | 1986 |
| 716 | Ga0207708_10060761 | 3300026075 | Bacteria | 2885 |
| 717 | Ga0207708_10070386 | 3300026075 | Bacteria | 2678 |
| 718 | Ga0207708_10078649 | 3300026075 | Bacteria | 2533 |
| 719 | Ga0207708_10159293 | 3300026075 | Bacteria | 1782 |
| 720 | Ga0207702_10010788 | 3300026078 | Bacteria | 7625 |
| 721 | Ga0207702_10474379 | 3300026078 | Bacteria | 1217 |
| 722 | Ga0207702_10582698 | 3300026078 | Bacteria | 1097 |
| 723 | Ga0207702_10736657 | 3300026078 | Bacteria | 973 |
| 724 | Ga0207641_10065264 | 3300026088 | Bacteria | 3114 |
| 725 | Ga0207641_10093443 | 3300026088 | Bacteria | 2636 |
| 726 | Ga0207641_10250050 | 3300026088 | Bacteria | 1655 |
| 727 | Ga0207641_10337251 | 3300026088 | Bacteria | 1434 |
| 728 | Ga0207641_10557488 | 3300026088 | Bacteria | 1118 |
| 729 | Ga0207648_10010535 | 3300026089 | Bacteria | 8755 |
| 730 | Ga0207648_10010728 | 3300026089 | Bacteria | 8661 |
| 731 | Ga0207648_10017971 | 3300026089 | Bacteria | 6413 |
| 732 | Ga0207648_10538196 | 3300026089 | Bacteria | 1072 |
| 733 | Ga0207648_10708797 | 3300026089 | Bacteria | 933 |
| 734 | Ga0207676_10076218 | 3300026095 | Bacteria | 2709 |
| 735 | Ga0207676_10545478 | 3300026095 | Bacteria | 1107 |
| 736 | Ga0207674_10124239 | 3300026116 | Bacteria | 2547 |
| 737 | Ga0207674_10150717 | 3300026116 | Bacteria | 2283 |
| 738 | Ga0207674_10177820 | 3300026116 | Bacteria | 2080 |
| 739 | Ga0207674_10827632 | 3300026116 | Bacteria | 893 |
| 740 | Ga0207675_100007528 | 3300026118 | Bacteria | 10287 |
| 741 | Ga0207675_100008033 | 3300026118 | Bacteria | 9941 |
| 742 | Ga0207675_100030133 | 3300026118 | Bacteria | 5052 |
| 743 | Ga0207675_100050504 | 3300026118 | Bacteria | 3880 |
| 744 | Ga0207675_100187202 | 3300026118 | Bacteria | 1985 |
| 745 | Ga0207683_10000755 | 3300026121 | Bacteria | 29385 |
| 746 | Ga0207683_10056099 | 3300026121 | Bacteria | 3455 |
| 747 | Ga0207683_10095342 | 3300026121 | Bacteria | 2653 |
| 748 | Ga0207683_10309790 | 3300026121 | Bacteria | 1445 |
| 749 | Ga0207683_10516764 | 3300026121 | Bacteria | 1103 |
| 750 | Ga0207698_10074343 | 3300026142 | Bacteria | 2711 |
| 751 | Ga0207698_11196600 | 3300026142 | Bacteria | 774 |
| 752 | Ga0209389_1000057 | 3300027296 | Bacteria | 107632 |
| 753 | Ga0209389_1000083 | 3300027296 | Bacteria | 88461 |
| 754 | Ga0209589_1000097 | 3300027357 | Bacteria | 88461 |
| 755 | Ga0209489_100105 | 3300027361 | Bacteria | 118979 |
| 756 | Ga0209489_100226 | 3300027361 | Bacteria | 94384 |
| 757 | Ga0209700_100085 | 3300027363 | Bacteria | 128517 |
| 758 | Ga0209179_1043892 | 3300027512 | Bacteria | 946 |
| 759 | Ga0209588_1008313 | 3300027671 | Bacteria | 3074 |
| 760 | Ga0209588_1086926 | 3300027671 | Bacteria | 1008 |
| 761 | Ga0209813_10000296 | 3300027866 | Bacteria | 13724 |
| 762 | Ga0209813_10014453 | 3300027866 | Bacteria | 2125 |
| 763 | Ga0207428_10337634 | 3300027907 | Bacteria | 1110 |
| 764 | Ga0268266_10005077 | 3300028379 | Bacteria | 12414 |
| 765 | Ga0268266_10025505 | 3300028379 | Bacteria | 5029 |
| 766 | Ga0268266_10169497 | 3300028379 | Bacteria | 1981 |
| 767 | Ga0268266_10191908 | 3300028379 | Bacteria | 1865 |
| 768 | Ga0268266_10315252 | 3300028379 | Bacteria | 1462 |
| 769 | Ga0268266_10665923 | 3300028379 | Bacteria | 1002 |
| 770 | Ga0268265_10003922 | 3300028380 | Bacteria | 10479 |
| 771 | Ga0268265_10006606 | 3300028380 | Bacteria | 7850 |
| 772 | Ga0268265_10076812 | 3300028380 | Bacteria | 2621 |
| 773 | Ga0268265_10995459 | 3300028380 | Bacteria | 828 |
| 774 | Ga0268264_10000021 | 3300028381 | Bacteria | 481580 |
| 775 | Ga0268264_10000158 | 3300028381 | Bacteria | 153433 |
| 776 | Ga0268264_10000909 | 3300028381 | Bacteria | 31074 |
| 777 | Ga0268264_10138891 | 3300028381 | Bacteria | 2164 |
| 778 | Ga0268264_10642836 | 3300028381 | Bacteria | 1049 |
| 779 | Ga0265326_10002188 | 3300028558 | Bacteria | 6631 |
| 780 | Ga0265334_10002607 | 3300028573 | Bacteria | 8406 |
| 781 | Ga0265334_10093049 | 3300028573 | Bacteria | 1098 |
| 782 | Ga0265318_10002810 | 3300028577 | Bacteria | 9101 |
| 783 | Ga0265318_10022359 | 3300028577 | Bacteria | 2529 |
| 784 | Ga0265318_10050572 | 3300028577 | Bacteria | 1561 |
| 785 | Ga0265323_10006127 | 3300028653 | Bacteria | 5075 |
| 786 | Ga0265336_10001608 | 3300028666 | Bacteria | 10074 |
| 787 | Ga0307517_10000008 | 3300028786 | Bacteria | 243202 |
| 788 | Ga0307517_10140654 | 3300028786 | Bacteria | 1696 |
| 789 | Ga0307515_10025060 | 3300028794 | Bacteria | 10346 |
| 790 | Ga0265338_10000667 | 3300028800 | Bacteria | 59318 |
| 791 | Ga0265324_10009512 | 3300029957 | Bacteria | 3790 |
| 792 | Ga0237817_10071 | 3300030083 | Bacteria | 32381 |
| 793 | Ga0307511_10013403 | 3300030521 | Bacteria | 8012 |
| 794 | Ga0265330_10024167 | 3300031235 | Bacteria | 2757 |
| 795 | Ga0265330_10067445 | 3300031235 | Bacteria | 1550 |
| 796 | Ga0265330_10211412 | 3300031235 | Bacteria | 819 |
| 797 | Ga0265332_10096717 | 3300031238 | Bacteria | 1247 |
| 798 | Ga0265328_10016381 | 3300031239 | Bacteria | 2886 |
| 799 | Ga0265325_10020714 | 3300031241 | Bacteria | 3621 |
| 800 | Ga0265325_10253193 | 3300031241 | Bacteria | 797 |
| 801 | Ga0265340_10002126 | 3300031247 | Bacteria | 11354 |
| 802 | Ga0265340_10008012 | 3300031247 | Bacteria | 5725 |
| 803 | Ga0265340_10036882 | 3300031247 | Bacteria | 2422 |
| 804 | Ga0265340_10070901 | 3300031247 | Bacteria | 1652 |
| 805 | Ga0265340_10076407 | 3300031247 | Bacteria | 1582 |
| 806 | Ga0265340_10245991 | 3300031247 | Bacteria | 798 |
| 807 | Ga0265339_10003572 | 3300031249 | Bacteria | 10870 |
| 808 | Ga0265339_10034980 | 3300031249 | Bacteria | 2821 |
| 809 | Ga0265339_10092389 | 3300031249 | Bacteria | 1584 |
| 810 | Ga0265331_10003787 | 3300031250 | Bacteria | 9597 |
| 811 | Ga0265331_10006365 | 3300031250 | Bacteria | 6990 |
| 812 | Ga0265331_10085332 | 3300031250 | Bacteria | 1463 |
| 813 | Ga0265327_10000539 | 3300031251 | Bacteria | 64832 |
| 814 | Ga0265316_10020290 | 3300031344 | Bacteria | 5662 |
| 815 | Ga0265316_10075672 | 3300031344 | Bacteria | 2589 |
| 816 | Ga0265316_10682219 | 3300031344 | Bacteria | 725 |
| 817 | Ga0265316_10718282 | 3300031344 | Bacteria | 704 |
| 818 | Ga0307513_10099941 | 3300031456 | Bacteria | 2928 |
| 819 | Ga0307513_10547725 | 3300031456 | Bacteria | 870 |
| 820 | Ga0307509_10007761 | 3300031507 | Bacteria | 13905 |
| 821 | Ga0307509_10043851 | 3300031507 | Bacteria | 4836 |
| 822 | Ga0307408_100221688 | 3300031548 | Bacteria | 1543 |
| 823 | Ga0307408_100842309 | 3300031548 | Bacteria | 835 |
| 824 | Ga0265313_10001592 | 3300031595 | Bacteria | 21059 |
| 825 | Ga0265313_10006801 | 3300031595 | Bacteria | 7987 |
| 826 | Ga0265313_10018863 | 3300031595 | Bacteria | 3860 |
| 827 | Ga0265313_10041246 | 3300031595 | Bacteria | 2276 |
| 828 | Ga0265313_10050697 | 3300031595 | Bacteria | 1989 |
| 829 | Ga0265313_10064449 | 3300031595 | Bacteria | 1704 |
| 830 | Ga0307508_10000184 | 3300031616 | Bacteria | 75613 |
| 831 | Ga0307508_10013800 | 3300031616 | Bacteria | 7373 |
| 832 | Ga0307508_10024747 | 3300031616 | Bacteria | 5448 |
| 833 | Ga0307508_10216007 | 3300031616 | Bacteria | 1517 |
| 834 | Ga0316575_10066360 | 3300031665 | Bacteria | 1446 |
| 835 | Ga0265314_10003493 | 3300031711 | Bacteria | 15176 |
| 836 | Ga0265314_10008911 | 3300031711 | Bacteria | 8556 |
| 837 | Ga0265314_10010252 | 3300031711 | Bacteria | 7838 |
| 838 | Ga0265314_10026502 | 3300031711 | Bacteria | 4354 |
| 839 | Ga0265314_10044930 | 3300031711 | Bacteria | 3127 |
| 840 | Ga0265314_10132596 | 3300031711 | Bacteria | 1552 |
| 841 | Ga0265314_10137113 | 3300031711 | Bacteria | 1518 |
| 842 | Ga0265314_10140576 | 3300031711 | Bacteria | 1493 |
| 843 | Ga0265314_10172036 | 3300031711 | Bacteria | 1306 |
| 844 | Ga0265314_10189851 | 3300031711 | Bacteria | 1224 |
| 845 | Ga0265342_10003953 | 3300031712 | Bacteria | 11882 |
| 846 | Ga0265342_10013043 | 3300031712 | Bacteria | 5599 |
| 847 | Ga0265342_10026766 | 3300031712 | Bacteria | 3611 |
| 848 | Ga0265342_10292260 | 3300031712 | Bacteria | 860 |
| 849 | Ga0307516_10012710 | 3300031730 | Bacteria | 9049 |
| 850 | Ga0307516_10355250 | 3300031730 | Bacteria | 1130 |
| 851 | Ga0307410_10372605 | 3300031852 | Bacteria | 1146 |
| 852 | Ga0326468_10002461 | 3300031889 | Bacteria | 1546 |
| 853 | Ga0307406_10007985 | 3300031901 | Bacteria | 5895 |
| 854 | Ga0307406_10981947 | 3300031901 | Bacteria | 723 |
| 855 | Ga0307407_10031773 | 3300031903 | Bacteria | 2863 |
| 856 | Ga0307409_100363645 | 3300031995 | Bacteria | 1369 |
| 857 | Ga0307416_100041543 | 3300032002 | Bacteria | 3583 |
| 858 | Ga0307416_100061274 | 3300032002 | Bacteria | 3069 |
| 859 | Ga0307416_101346609 | 3300032002 | Bacteria | 820 |
| 860 | Ga0307414_10059903 | 3300032004 | Bacteria | 2690 |
| 861 | Ga0307414_10202858 | 3300032004 | Bacteria | 1614 |
| 862 | Ga0307414_10350682 | 3300032004 | Bacteria | 1267 |
| 863 | Ga0307415_100152714 | 3300032126 | Bacteria | 1779 |
| 864 | Ga0307415_100199571 | 3300032126 | Bacteria | 1586 |
| 865 | Ga0307415_100737647 | 3300032126 | Bacteria | 893 |
| 866 | Ga0316583_10060288 | 3300032133 | Bacteria | 1330 |
| 867 | Ga0316593_10040228 | 3300032168 | Bacteria | 1553 |
| 868 | Ga0307507_10063835 | 3300033179 | Bacteria | 3405 |
| 869 | Ga0307507_10255242 | 3300033179 | Bacteria | 1127 |
| 870 | Ga0307510_10003242 | 3300033180 | Bacteria | 18921 |
| 871 | Ga0307510_10003590 | 3300033180 | Bacteria | 18110 |
| 872 | Ga0307510_10099597 | 3300033180 | Bacteria | 2704 |
| 873 | Ga0316592_1016208 | 3300033524 | Bacteria | 1556 |
| 874 | Ga0373926_0005666 | 3300035083 | Bacteria | 4122 |
| 875 | Ga0373936_0053817 | 3300035113 | Bacteria | 1632 |
| 876 | Ga0373953_0132028 | 3300035117 | Bacteria | 1065 |
| 877 | Ga0373956_0062435 | 3300035119 | Bacteria | 1689 |
| 878 | Ga0373957_0003459 | 3300035120 | Bacteria | 4667 |
| 879 | Ga0373946_0360026 | 3300035171 | Bacteria | 729 |
| 880 | Ga0373955_0051120 | 3300035172 | Bacteria | 2250 |
| 881 | Ga0316574_0291335 | 3300035398 | Bacteria | 1039 |
| 882 | Ga0373924_0003807 | 3300035410 | Bacteria | 5220 |
| 883 | Ga0373931_0336080 | 3300035691 | Bacteria | 942 |
| 884 | Ga0373931_0361234 | 3300035691 | Bacteria | 911 |
| 885 | Ga0373931_0654474 | 3300035691 | Bacteria | 691 |
| 886 | Ga0373935_0083060 | 3300035692 | Bacteria | 2085 |
| 887 | Ga0373935_0153275 | 3300035692 | Bacteria | 1565 |
| 888 | Ga0373935_0325993 | 3300035692 | Bacteria | 1091 |
| 889 | Ga0373935_0485164 | 3300035692 | Bacteria | 896 |
| 890 | Ga0373927_0022539 | 3300035695 | Bacteria | 4126 |
| 891 | Ga0373927_0026045 | 3300035695 | Bacteria | 3823 |
| 892 | Ga0373927_0030308 | 3300035695 | Bacteria | 3529 |
| 893 | Ga0373927_0128707 | 3300035695 | Bacteria | 1653 |
| 894 | Ga0373927_0179436 | 3300035695 | Bacteria | 1389 |
| 895 | Ga0373933_0353323 | 3300035724 | Bacteria | 955 |
| 896 | Ga0373947_0531977 | 3300035725 | Bacteria | 800 |
| 897 | Ga0373937_0055118 | 3300036401 | Bacteria | 3649 |
| 898 | Ga0373937_0150953 | 3300036401 | Bacteria | 2176 |
| 899 | Ga0373937_0218966 | 3300036401 | Bacteria | 1792 |
| 900 | Ga0373937_0386260 | 3300036401 | Bacteria | 1328 |
| 901 | Ga0373937_0650628 | 3300036401 | Bacteria | 999 |
| 902 | Ga0373937_1218146 | 3300036401 | Bacteria | 701 |
| 903 | Ga0372808_002239 | 3300036459 | Bacteria | 2195 |
| 904 | Ga0316584_0208416 | 3300036712 | Bacteria | 1439 |
| 905 | Ga0373925_0110789 | 3300037068 | Bacteria | 2120 |
| 906 | Ga0373925_0142985 | 3300037068 | Bacteria | 1874 |
| 907 | Ga0373925_0283358 | 3300037068 | Bacteria | 1335 |
| 908 | Ga0373925_0473705 | 3300037068 | Bacteria | 1027 |
| 909 | Ga0373925_0680739 | 3300037068 | Bacteria | 848 |
| 910 | Ga0395899_0001159 | 3300037312 | Bacteria | 23305 |
| 911 | Ga0395899_0011006 | 3300037312 | Bacteria | 6929 |
| 912 | Ga0395899_0070194 | 3300037312 | Bacteria | 2564 |
| 913 | Ga0395899_0092039 | 3300037312 | Bacteria | 2196 |
| 914 | Ga0395899_0164827 | 3300037312 | Bacteria | 1564 |
| 915 | Ga0395899_0188373 | 3300037312 | Bacteria | 1445 |
| 916 | Ga0395900_0004505 | 3300037418 | Bacteria | 14743 |
| 917 | Ga0395900_0004870 | 3300037418 | Bacteria | 14149 |
| 918 | Ga0395900_0007092 | 3300037418 | Bacteria | 11611 |
| 919 | Ga0395900_0007882 | 3300037418 | Bacteria | 10969 |
| 920 | Ga0395900_0022962 | 3300037418 | Bacteria | 6384 |
| 921 | Ga0395900_0205599 | 3300037418 | Bacteria | 1990 |
| 922 | Ga0395900_0400546 | 3300037418 | Bacteria | 1337 |
| 923 | Ga0395898_0002205 | 3300037466 | Bacteria | 23788 |
| 924 | Ga0395898_0002340 | 3300037466 | Bacteria | 22604 |
| 925 | Ga0395898_0006553 | 3300037466 | Bacteria | 12425 |
| 926 | Ga0395898_0016065 | 3300037466 | Bacteria | 7669 |
| 927 | Ga0395905_0011090 | 3300037471 | Bacteria | 8721 |
| 928 | Ga0395905_0076407 | 3300037471 | Bacteria | 3139 |
| 929 | Ga0395905_0115269 | 3300037471 | Bacteria | 2525 |
| 930 | Ga0395905_0492751 | 3300037471 | Bacteria | 1125 |
| 931 | Ga0395905_1008018 | 3300037471 | Bacteria | 736 |
| 932 | Ga0436364_0025958 | 3300037853 | Bacteria | 795 |
| 933 | Ga0436364_0729208 | 3300037853 | Bacteria | 1474 |
| 934 | Ga0436364_0863831 | 3300037853 | Bacteria | 2033 |
| 935 | Ga0436364_1046819 | 3300037853 | Bacteria | 692 |
| 936 | Ga0436364_1211238 | 3300037853 | Bacteria | 2202 |
| 937 | Ga0395901_0001255 | 3300038443 | Bacteria | 26957 |
| 938 | Ga0395901_0002098 | 3300038443 | Bacteria | 20468 |
| 939 | Ga0395901_0004054 | 3300038443 | Bacteria | 14749 |
| 940 | Ga0395901_0017180 | 3300038443 | Bacteria | 7380 |
| 941 | Ga0395901_0025446 | 3300038443 | Bacteria | 6075 |
| 942 | Ga0395901_0159461 | 3300038443 | Bacteria | 2369 |
| 943 | Ga0395901_0234083 | 3300038443 | Bacteria | 1917 |
| 944 | Ga0237819_01648 | 3300038705 | Bacteria | 5487 |
| 945 | Ga0237819_03074 | 3300038705 | Bacteria | 3076 |
| 946 | Ga0400483_035464 | 3300039062 | Bacteria | 7353 |
| 947 | Ga0400483_162571 | 3300039062 | Bacteria | 1170 |
| 948 | Ga0400483_230547 | 3300039062 | Bacteria | 1338 |
| 949 | Ga0400483_232283 | 3300039062 | Bacteria | 2664 |
| 950 | Ga0436365_0297386 | 3300039437 | Bacteria | 1779 |
| 951 | Ga0436365_0850398 | 3300039437 | Bacteria | 3811 |
| 952 | Ga0436365_0862833 | 3300039437 | Bacteria | 88455 |
| 953 | Ga0436365_0904767 | 3300039437 | Bacteria | 1044 |
| 954 | Ga0436365_1259102 | 3300039437 | Bacteria | 59061 |
| 955 | Ga0436365_1361494 | 3300039437 | Bacteria | 15892 |
| 956 | Ga0436365_1399381 | 3300039437 | Bacteria | 1354 |
| 957 | Ga0436365_1412995 | 3300039437 | Bacteria | 975 |
| 958 | Ga0436365_1505352 | 3300039437 | Bacteria | 3854 |
| 959 | Ga0436360_0092664 | 3300039438 | Bacteria | 2317 |
| 960 | Ga0436360_0289993 | 3300039438 | Bacteria | 871 |
| 961 | Ga0436360_0314853 | 3300039438 | Bacteria | 6681 |
| 962 | Ga0436360_0751338 | 3300039438 | Bacteria | 15392 |
| 963 | Ga0436360_0800977 | 3300039438 | Bacteria | 1240 |
| 964 | Ga0436360_1276686 | 3300039438 | Bacteria | 985 |
| 965 | Ga0436361_0229945 | 3300039447 | Bacteria | 4611 |
| 966 | Ga0436361_0391251 | 3300039447 | Bacteria | 3624 |
| 967 | Ga0436361_0491334 | 3300039447 | Bacteria | 1304 |
| 968 | Ga0436361_0573255 | 3300039447 | Bacteria | 11361 |
| 969 | Ga0436361_0830107 | 3300039447 | Bacteria | 2406 |
| 970 | Ga0436363_0329632 | 3300039450 | Bacteria | 694 |
| 971 | Ga0436363_0643564 | 3300039450 | Bacteria | 1860 |
| 972 | Ga0436363_0877282 | 3300039450 | Bacteria | 993 |
| 973 | Ga0436363_1266422 | 3300039450 | Bacteria | 843 |
| 974 | Ga0436363_1291996 | 3300039450 | Bacteria | 5612 |
| 975 | Ga0436363_1400984 | 3300039450 | Bacteria | 4807 |
| 976 | Ga0436363_1409784 | 3300039450 | Bacteria | 1274 |
| 977 | Ga0436363_1420176 | 3300039450 | Bacteria | 778 |
| 978 | Ga0436362_0487773 | 3300039453 | Bacteria | 3231 |
| 979 | Ga0436362_0949954 | 3300039453 | Bacteria | 89092 |
| 980 | Ga0436362_1231252 | 3300039453 | Bacteria | 895 |
| 981 | Ga0439465_0039777 | 3300041413 | Bacteria | 1519 |
| 982 | Ga0451791_0196258 | 3300041451 | Bacteria | 1180 |
| 983 | Ga0451797_0142036 | 3300041453 | Bacteria | 1539 |
| 984 | Ga0451802_1663335 | 3300041460 | Bacteria | 878 |
| 985 | Ga0451841_0626317 | 3300041498 | Bacteria | 1782 |
| 986 | Ga0451855_0157495 | 3300041511 | Bacteria | 1789 |
| 987 | Ga0439442_025710 | 3300042002 | Bacteria | 1225 |
| 988 | Ga0439449_0003421 | 3300042007 | Bacteria | 6176 |
| 989 | Ga0439462_0130740 | 3300042015 | Bacteria | 701 |
| 990 | Ga0450898_011683 | 3300042134 | Bacteria | 1442 |
| 991 | Ga0439459_0003351 | 3300042438 | Bacteria | 2534 |
| 992 | Ga0451577_0264940 | 3300042876 | Bacteria | 1556 |
| 993 | Ga0466969_0012669 | 3300044656 | Bacteria | 4441 |
| 994 | Ga0466969_0022851 | 3300044656 | Bacteria | 3225 |
| 995 | Ga0466972_0000702 | 3300044658 | Bacteria | 16004 |
| 996 | Ga0466972_0020059 | 3300044658 | Bacteria | 3342 |
| 997 | Ga0466972_0028369 | 3300044658 | Bacteria | 2761 |
| 998 | Ga0453683_0068854 | 3300044673 | Bacteria | 2212 |
| 999 | Ga0466966_0257824 | 3300044684 | Bacteria | 1050 |
| 1000 | Ga0466961_0000359 | 3300044693 | Bacteria | 29797 |
| 1001 | Ga0466961_0452019 | 3300044693 | Bacteria | 777 |
| 1002 | Ga0466963_0007691 | 3300044694 | Bacteria | 6436 |
| 1003 | Ga0466963_0034178 | 3300044694 | Bacteria | 3307 |
| 1004 | Ga0466963_0378839 | 3300044694 | Bacteria | 997 |
| 1005 | Ga0466964_0146541 | 3300044706 | Bacteria | 1090 |
| 1006 | Ga0466964_0148531 | 3300044706 | Bacteria | 1084 |
| 1007 | Ga0466964_0350923 | 3300044706 | Bacteria | 758 |
| 1008 | Ga0453684_0005307 | 3300044712 | Bacteria | 25693 |
| 1009 | Ga0453684_0009814 | 3300044712 | Bacteria | 16591 |
| 1010 | Ga0453684_0015205 | 3300044712 | Bacteria | 12208 |
| 1011 | Ga0453684_0255034 | 3300044712 | Bacteria | 2012 |
| 1012 | Ga0466968_0073219 | 3300044735 | Bacteria | 1494 |
| 1013 | Ga0466968_0086161 | 3300044735 | Bacteria | 1386 |
| 1014 | Ga0466968_0111331 | 3300044735 | Bacteria | 1231 |
| 1015 | Ga0466970_0153259 | 3300044765 | Bacteria | 1273 |
| 1016 | Ga0466970_0355302 | 3300044765 | Bacteria | 832 |
| 1017 | Ga0466970_0389531 | 3300044765 | Bacteria | 794 |
| 1018 | Ga0466970_0394039 | 3300044765 | Bacteria | 790 |
| 1019 | Ga0466957_0158787 | 3300044842 | Bacteria | 1467 |
| 1020 | Ga0466957_0624444 | 3300044842 | Bacteria | 756 |
| 1021 | Ga0466959_0003116 | 3300045049 | Bacteria | 10755 |
| 1022 | Ga0466959_0010713 | 3300045049 | Bacteria | 6566 |
| 1023 | Ga0466959_0026644 | 3300045049 | Bacteria | 4285 |
| 1024 | Ga0466959_0061588 | 3300045049 | Bacteria | 2728 |
| 1025 | Ga0466959_0113172 | 3300045049 | Bacteria | 1935 |
| 1026 | Ga0451576_0004179 | 3300045051 | Bacteria | 19003 |
| 1027 | Ga0451576_0273966 | 3300045051 | Bacteria | 1764 |
| 1028 | Ga0466958_0064331 | 3300045836 | Bacteria | 2237 |
| 1029 | Ga0466958_0160788 | 3300045836 | Bacteria | 1419 |
| 1030 | Ga0466958_0236623 | 3300045836 | Bacteria | 1167 |
| 1031 | Ga0466958_0441706 | 3300045836 | Bacteria | 842 |
| 1032 | Ga0466967_0000079 | 3300045976 | Bacteria | 34795 |
| 1033 | Ga0466967_0282289 | 3300045976 | Bacteria | 1593 |
| 1034 | Ga0466967_0438093 | 3300045976 | Bacteria | 1276 |
| 1035 | Ga0495617_018456 | 3300046452 | Bacteria | 2359 |
| 1036 | Ga0495617_055985 | 3300046452 | Bacteria | 1308 |
| 1037 | Ga0495592_0358320 | 3300046454 | Bacteria | 933 |
| 1038 | Ga0495603_0009099 | 3300046455 | Bacteria | 6004 |
| 1039 | Ga0495603_0020396 | 3300046455 | Bacteria | 4017 |
| 1040 | Ga0495603_0180948 | 3300046455 | Bacteria | 1220 |
| 1041 | Ga0495590_0027387 | 3300046457 | Bacteria | 2000 |
| 1042 | Ga0495590_0192929 | 3300046457 | Bacteria | 747 |
| 1043 | Ga0495629_0099345 | 3300046459 | Bacteria | 2031 |
| 1044 | Ga0495638_0000413 | 3300046460 | Bacteria | 52033 |
| 1045 | Ga0495638_0000547 | 3300046460 | Bacteria | 42980 |
| 1046 | Ga0495638_0005379 | 3300046460 | Bacteria | 9546 |
| 1047 | Ga0495638_0009130 | 3300046460 | Bacteria | 6978 |
| 1048 | Ga0495638_0200613 | 3300046460 | Bacteria | 1126 |
| 1049 | Ga0495638_0315614 | 3300046460 | Bacteria | 837 |
| 1050 | Ga0495641_0099339 | 3300046461 | Bacteria | 1299 |
| 1051 | Ga0495651_0053435 | 3300046462 | Bacteria | 3110 |
| 1052 | Ga0495651_0089752 | 3300046462 | Bacteria | 2306 |
| 1053 | Ga0495651_0199099 | 3300046462 | Bacteria | 1403 |
| 1054 | Ga0495651_0331429 | 3300046462 | Bacteria | 1011 |
| 1055 | Ga0495653_0096827 | 3300046463 | Bacteria | 2145 |
| 1056 | Ga0495650_0000020 | 3300046471 | Bacteria | 533839 |
| 1057 | Ga0495580_0376078 | 3300046472 | Bacteria | 960 |
| 1058 | Ga0495582_0304869 | 3300046473 | Bacteria | 916 |
| 1059 | Ga0495605_0190260 | 3300046474 | Bacteria | 898 |
| 1060 | Ga0495639_0058838 | 3300046475 | Bacteria | 1759 |
| 1061 | Ga0495639_0090833 | 3300046475 | Bacteria | 1433 |
| 1062 | Ga0495662_0093608 | 3300046476 | Bacteria | 1467 |
| 1063 | Ga0495664_0017425 | 3300046477 | Bacteria | 4106 |
| 1064 | Ga0495664_0075557 | 3300046477 | Bacteria | 2016 |
| 1065 | Ga0495584_0102596 | 3300046491 | Bacteria | 1446 |
| 1066 | Ga0495584_0196399 | 3300046491 | Bacteria | 1026 |
| 1067 | Ga0495585_0043001 | 3300046492 | Bacteria | 2528 |
| 1068 | Ga0495585_0164099 | 3300046492 | Bacteria | 1151 |
| 1069 | Ga0495585_0194741 | 3300046492 | Bacteria | 1035 |
| 1070 | Ga0495594_0032506 | 3300046499 | Bacteria | 2833 |
| 1071 | Ga0495594_0182714 | 3300046499 | Bacteria | 1194 |
| 1072 | Ga0495596_0036246 | 3300046500 | Bacteria | 1954 |
| 1073 | Ga0495607_0047785 | 3300046501 | Bacteria | 2505 |
| 1074 | Ga0495583_0000001 | 3300046506 | Bacteria | 811973 |
| 1075 | Ga0495606_0010700 | 3300046507 | Bacteria | 7572 |
| 1076 | Ga0495608_0078112 | 3300046511 | Bacteria | 2154 |
| 1077 | Ga0495610_0000056 | 3300046512 | Bacteria | 138703 |
| 1078 | Ga0495610_0004429 | 3300046512 | Bacteria | 10387 |
| 1079 | Ga0495610_0005750 | 3300046512 | Bacteria | 8730 |
| 1080 | Ga0495616_0000254 | 3300046513 | Bacteria | 43310 |
| 1081 | Ga0495618_0110920 | 3300046514 | Bacteria | 1756 |
| 1082 | Ga0495618_0115264 | 3300046514 | Bacteria | 1720 |
| 1083 | Ga0495620_0066723 | 3300046515 | Bacteria | 1482 |
| 1084 | Ga0495620_0072441 | 3300046515 | Bacteria | 1407 |
| 1085 | Ga0495628_0162046 | 3300046516 | Bacteria | 1699 |
| 1086 | Ga0495630_0726175 | 3300046517 | Bacteria | 760 |
| 1087 | Ga0495631_0126324 | 3300046518 | Bacteria | 1099 |
| 1088 | Ga0495631_0287262 | 3300046518 | Bacteria | 700 |
| 1089 | Ga0495632_0001149 | 3300046519 | Bacteria | 22554 |
| 1090 | Ga0495632_0007628 | 3300046519 | Bacteria | 6765 |
| 1091 | Ga0495632_0175361 | 3300046519 | Bacteria | 983 |
| 1092 | Ga0495632_0202204 | 3300046519 | Bacteria | 904 |
| 1093 | Ga0495637_0070240 | 3300046520 | Bacteria | 1415 |
| 1094 | Ga0495643_0014223 | 3300046522 | Bacteria | 4738 |
| 1095 | Ga0495648_0000130 | 3300046524 | Bacteria | 88368 |
| 1096 | Ga0495648_0019710 | 3300046524 | Bacteria | 4730 |
| 1097 | Ga0495648_0266006 | 3300046524 | Bacteria | 820 |
| 1098 | Ga0495663_0034886 | 3300046525 | Bacteria | 1509 |
| 1099 | Ga0495663_0060364 | 3300046525 | Bacteria | 1191 |
| 1100 | Ga0495666_0163109 | 3300046526 | Bacteria | 1033 |
| 1101 | Ga0495652_0210660 | 3300046529 | Bacteria | 1467 |
| 1102 | Ga0495652_0287465 | 3300046529 | Bacteria | 1201 |
| 1103 | Ga0495654_0000010 | 3300046530 | Bacteria | 378481 |
| 1104 | Ga0495640_0368059 | 3300046533 | Bacteria | 885 |
| 1105 | Ga0495586_0014667 | 3300046535 | Bacteria | 4165 |
| 1106 | Ga0495586_0104772 | 3300046535 | Bacteria | 1572 |
| 1107 | Ga0495586_0152938 | 3300046535 | Bacteria | 1299 |
| 1108 | Ga0495587_0006206 | 3300046536 | Bacteria | 7799 |
| 1109 | Ga0495587_0031030 | 3300046536 | Bacteria | 3238 |
| 1110 | Ga0495598_0048538 | 3300046537 | Bacteria | 1270 |
| 1111 | Ga0495609_0087918 | 3300046538 | Bacteria | 1353 |
| 1112 | Ga0495621_0005934 | 3300046539 | Bacteria | 3540 |
| 1113 | Ga0495597_0137797 | 3300046542 | Bacteria | 1008 |
| 1114 | Ga0495645_0040795 | 3300046543 | Bacteria | 3385 |
| 1115 | Ga0495622_0005097 | 3300046557 | Bacteria | 6087 |
| 1116 | Ga0495622_0035148 | 3300046557 | Bacteria | 2337 |
| 1117 | Ga0495622_0149554 | 3300046557 | Bacteria | 1057 |
| 1118 | Ga0495667_0010326 | 3300046559 | Bacteria | 6316 |
| 1119 | Ga0495667_0080493 | 3300046559 | Bacteria | 2117 |
| 1120 | Ga0495656_0180597 | 3300046615 | Bacteria | 1037 |
| 1121 | Ga0495668_0000060 | 3300046616 | Bacteria | 193823 |
| 1122 | Ga0495668_0004514 | 3300046616 | Bacteria | 9850 |
| 1123 | Ga0495668_0033084 | 3300046616 | Bacteria | 2906 |
| 1124 | Ga0495634_0085375 | 3300046642 | Bacteria | 2057 |
| 1125 | Ga0495634_0270058 | 3300046642 | Bacteria | 1035 |
| 1126 | Ga0495625_0000165 | 3300046660 | Bacteria | 102988 |
| 1127 | Ga0495625_0001352 | 3300046660 | Bacteria | 30305 |
| 1128 | Ga0495625_0004210 | 3300046660 | Bacteria | 13708 |
| 1129 | Ga0495625_0016705 | 3300046660 | Bacteria | 5764 |
| 1130 | Ga0495625_0048877 | 3300046660 | Bacteria | 3042 |
| 1131 | Ga0495625_0427619 | 3300046660 | Bacteria | 822 |
| 1132 | Ga0495635_0013096 | 3300046663 | Bacteria | 5805 |
| 1133 | Ga0495661_0282195 | 3300046665 | Bacteria | 837 |
| 1134 | Ga0495588_0117184 | 3300046674 | Bacteria | 1404 |
| 1135 | Ga0495657_0025104 | 3300046675 | Bacteria | 4235 |
| 1136 | Ga0495657_0042461 | 3300046675 | Bacteria | 3104 |
| 1137 | Ga0495599_0009207 | 3300046678 | Bacteria | 6027 |
| 1138 | Ga0495623_0029108 | 3300046679 | Bacteria | 3555 |
| 1139 | Ga0495623_0069084 | 3300046679 | Bacteria | 2202 |
| 1140 | Ga0495646_0038536 | 3300046680 | Bacteria | 2951 |
| 1141 | Ga0495658_0149623 | 3300046683 | Bacteria | 1433 |
| 1142 | Ga0495658_0184829 | 3300046683 | Bacteria | 1294 |
| 1143 | Ga0495613_0058830 | 3300046689 | Bacteria | 2819 |
| 1144 | Ga0495613_0210780 | 3300046689 | Bacteria | 1367 |
| 1145 | Ga0495671_0149733 | 3300046692 | Bacteria | 1136 |
| 1146 | Ga0495649_0233491 | 3300046694 | Bacteria | 949 |
| 1147 | Ga0495589_0005117 | 3300046794 | Bacteria | 6938 |
| 1148 | Ga0495600_0014837 | 3300046809 | Bacteria | 4914 |
| 1149 | Ga0495660_0004395 | 3300046810 | Bacteria | 8538 |
| 1150 | Ga0495660_0025337 | 3300046810 | Bacteria | 3370 |
| 1151 | Ga0495660_0031813 | 3300046810 | Bacteria | 2965 |
| 1152 | Ga0495660_0173136 | 3300046810 | Bacteria | 1050 |
| 1153 | Ga0495581_0019611 | 3300047315 | Bacteria | 3925 |
| 1154 | Ga0495581_0084750 | 3300047315 | Bacteria | 1837 |
| 1155 | Ga0495604_0038890 | 3300047317 | Bacteria | 3742 |
| 1156 | Ga0495604_0097241 | 3300047317 | Bacteria | 2171 |
| 1157 | Ga0495604_0417937 | 3300047317 | Bacteria | 880 |
| 1158 | Ga0495604_0645215 | 3300047317 | Bacteria | 676 |
| 1159 | Ga0495636_0041867 | 3300047318 | Bacteria | 1902 |
| 1160 | Ga0495636_0103030 | 3300047318 | Bacteria | 1250 |
| 1161 | Ga0495674_0046939 | 3300047319 | Bacteria | 3832 |
| 1162 | Ga0495674_0072008 | 3300047319 | Bacteria | 2982 |
| 1163 | Ga0495674_0741919 | 3300047319 | Bacteria | 768 |
| 1164 | Ga0495672_0001149 | 3300047320 | Bacteria | 26745 |
| 1165 | Ga0495672_0018868 | 3300047320 | Bacteria | 4568 |
| 1166 | Ga0495676_0027294 | 3300047321 | Bacteria | 4897 |
| 1167 | Ga0495676_0139474 | 3300047321 | Bacteria | 1739 |
| 1168 | Ga0495676_0201161 | 3300047321 | Bacteria | 1384 |
| 1169 | Ga0495676_0400391 | 3300047321 | Bacteria | 911 |
| 1170 | Ga0495680_0029995 | 3300047322 | Bacteria | 4446 |
| 1171 | Ga0495680_0070345 | 3300047322 | Bacteria | 2668 |
| 1172 | Ga0495683_0006700 | 3300047323 | Bacteria | 6274 |
| 1173 | Ga0495683_0131317 | 3300047323 | Bacteria | 1181 |
| 1174 | Ga0495687_064312 | 3300047443 | Bacteria | 1498 |
| 1175 | Ga0495675_0002428 | 3300047444 | Bacteria | 11139 |
| 1176 | Ga0495675_0046076 | 3300047444 | Bacteria | 2776 |
| 1177 | Ga0495677_0133971 | 3300047445 | Bacteria | 949 |
| 1178 | Ga0495679_004273 | 3300047446 | Bacteria | 6631 |
| 1179 | Ga0495685_112874 | 3300047447 | Bacteria | 894 |
| 1180 | Ga0495673_0000301 | 3300047469 | Bacteria | 66146 |
| 1181 | Ga0495673_0000614 | 3300047469 | Bacteria | 35232 |
| 1182 | Ga0495673_0000701 | 3300047469 | Bacteria | 32560 |
| 1183 | Ga0495681_0013408 | 3300047470 | Bacteria | 4756 |
| 1184 | Ga0495681_0080744 | 3300047470 | Bacteria | 1452 |
| 1185 | Ga0495681_0112146 | 3300047470 | Bacteria | 1180 |
| 1186 | Ga0495684_0024863 | 3300047471 | Bacteria | 4606 |
| 1187 | Ga0495684_0146632 | 3300047471 | Bacteria | 1767 |
| 1188 | Ga0495686_0000376 | 3300047472 | Bacteria | 71769 |
| 1189 | Ga0495686_0033484 | 3300047472 | Bacteria | 3317 |
| 1190 | Ga0495686_0037745 | 3300047472 | Bacteria | 3093 |
| 1191 | Ga0495686_0046290 | 3300047472 | Bacteria | 2750 |
| 1192 | Ga0495686_0058044 | 3300047472 | Bacteria | 2414 |
| 1193 | Ga0495593_0051849 | 3300047673 | Bacteria | 2170 |
| 1194 | Ga0495602_0378351 | 3300048088 | Bacteria | 1015 |
| 1195 | Ga0495614_0033782 | 3300048089 | Bacteria | 2200 |
| 1196 | Ga0495615_0010168 | 3300048090 | Bacteria | 1873 |
| 1197 | Ga0495626_0049774 | 3300048091 | Bacteria | 1939 |
| 1198 | Ga0496100_0005212 | 3300048903 | Bacteria | 6978 |
| 1199 | Ga0496100_0100472 | 3300048903 | Bacteria | 1993 |
| 1200 | Ga0496101_0032741 | 3300048904 | Bacteria | 3662 |
| 1201 | Ga0496101_0051844 | 3300048904 | Bacteria | 2957 |
| 1202 | Ga0496101_0227337 | 3300048904 | Bacteria | 1450 |
| 1203 | Ga0496102_0017934 | 3300048905 | Bacteria | 6210 |
| 1204 | Ga0496102_0043607 | 3300048905 | Bacteria | 4068 |
| 1205 | Ga0496102_0078564 | 3300048905 | Bacteria | 3038 |
| 1206 | Ga0496102_0165696 | 3300048905 | Bacteria | 2079 |
| 1207 | Ga0496102_0326381 | 3300048905 | Bacteria | 1446 |
| 1208 | Ga0496102_0499299 | 3300048905 | Bacteria | 1139 |
| 1209 | Ga0496102_0591396 | 3300048905 | Bacteria | 1033 |
| 1210 | Ga0496103_0042185 | 3300048906 | Bacteria | 2806 |
| 1211 | Ga0496103_0056707 | 3300048906 | Bacteria | 2432 |
| 1212 | Ga0496104_0002560 | 3300048907 | Bacteria | 15667 |
| 1213 | Ga0496104_0006343 | 3300048907 | Bacteria | 10402 |
| 1214 | Ga0496104_0138564 | 3300048907 | Bacteria | 2338 |
| 1215 | Ga0496104_0216632 | 3300048907 | Bacteria | 1826 |
| 1216 | Ga0496104_0351819 | 3300048907 | Bacteria | 1386 |
| 1217 | Ga0496105_0002568 | 3300048908 | Bacteria | 13185 |
| 1218 | Ga0496105_0014413 | 3300048908 | Bacteria | 6293 |
| 1219 | Ga0496105_0031649 | 3300048908 | Bacteria | 4337 |
| 1220 | Ga0496105_0056895 | 3300048908 | Bacteria | 3229 |
| 1221 | Ga0496105_0065290 | 3300048908 | Bacteria | 3004 |
| 1222 | Ga0496105_0210113 | 3300048908 | Bacteria | 1586 |
| 1223 | Ga0496106_0004445 | 3300048909 | Bacteria | 10394 |
| 1224 | Ga0496106_0005448 | 3300048909 | Bacteria | 9418 |
| 1225 | Ga0496106_0033086 | 3300048909 | Bacteria | 3856 |
| 1226 | Ga0496106_0144770 | 3300048909 | Bacteria | 1871 |
| 1227 | Ga0496107_0000211 | 3300048910 | Bacteria | 30778 |
| 1228 | Ga0496107_0001182 | 3300048910 | Bacteria | 15862 |
| 1229 | Ga0496107_0196142 | 3300048910 | Bacteria | 1501 |
| 1230 | Ga0496108_0001556 | 3300048911 | Bacteria | 18160 |
| 1231 | Ga0496108_0100359 | 3300048911 | Bacteria | 2468 |
| 1232 | Ga0496108_0174987 | 3300048911 | Bacteria | 1858 |
| 1233 | Ga0496108_0474149 | 3300048911 | Bacteria | 1093 |
| 1234 | Ga0496109_0008140 | 3300048912 | Bacteria | 8890 |
| 1235 | Ga0496109_0046030 | 3300048912 | Bacteria | 3961 |
| 1236 | Ga0496109_0056714 | 3300048912 | Bacteria | 3574 |
| 1237 | Ga0496109_0072533 | 3300048912 | Bacteria | 3163 |
| 1238 | Ga0496109_0075064 | 3300048912 | Bacteria | 3109 |
| 1239 | Ga0496109_0871024 | 3300048912 | Bacteria | 838 |
| 1240 | Ga0496110_0027742 | 3300048913 | Bacteria | 4856 |
| 1241 | Ga0496110_0032238 | 3300048913 | Bacteria | 4524 |
| 1242 | Ga0496110_0081598 | 3300048913 | Bacteria | 2883 |
| 1243 | Ga0496110_0090518 | 3300048913 | Bacteria | 2735 |
| 1244 | Ga0496110_0129477 | 3300048913 | Bacteria | 2278 |
| 1245 | Ga0496110_0145899 | 3300048913 | Bacteria | 2140 |
| 1246 | Ga0496110_0234555 | 3300048913 | Bacteria | 1669 |
| 1247 | Ga0496110_0298129 | 3300048913 | Bacteria | 1468 |
| 1248 | Ga0496111_0017225 | 3300048914 | Bacteria | 4993 |
| 1249 | Ga0496111_0046620 | 3300048914 | Bacteria | 3121 |
| 1250 | Ga0496111_0076688 | 3300048914 | Bacteria | 2437 |
| 1251 | Ga0496111_0079711 | 3300048914 | Bacteria | 2389 |
| 1252 | Ga0496111_0210340 | 3300048914 | Bacteria | 1445 |
| 1253 | Ga0496112_0008955 | 3300048915 | Bacteria | 8988 |
| 1254 | Ga0496112_0035225 | 3300048915 | Bacteria | 4874 |
| 1255 | Ga0496112_0036828 | 3300048915 | Bacteria | 4773 |
| 1256 | Ga0496112_0067117 | 3300048915 | Bacteria | 3540 |
| 1257 | Ga0496112_0144015 | 3300048915 | Bacteria | 2352 |
| 1258 | Ga0496112_0195870 | 3300048915 | Bacteria | 1981 |
| 1259 | Ga0496113_0057299 | 3300048916 | Bacteria | 2928 |
| 1260 | Ga0496113_0170495 | 3300048916 | Bacteria | 1723 |
| 1261 | Ga0496113_0202783 | 3300048916 | Bacteria | 1577 |
| 1262 | Ga0496113_0258680 | 3300048916 | Bacteria | 1390 |
| 1263 | Ga0496114_0070196 | 3300048917 | Bacteria | 2942 |
| 1264 | Ga0496114_0196330 | 3300048917 | Bacteria | 1767 |
| 1265 | Ga0496114_1002146 | 3300048917 | Bacteria | 719 |
| 1266 | Ga0496115_0001558 | 3300048918 | Bacteria | 16481 |
| 1267 | Ga0496115_0017161 | 3300048918 | Bacteria | 5526 |
| 1268 | Ga0496115_0040034 | 3300048918 | Bacteria | 3724 |
| 1269 | Ga0496115_0069793 | 3300048918 | Bacteria | 2847 |
| 1270 | Ga0496115_0080322 | 3300048918 | Bacteria | 2655 |
| 1271 | Ga0496115_0112551 | 3300048918 | Bacteria | 2236 |
| 1272 | Ga0496115_0122480 | 3300048918 | Bacteria | 2141 |
| 1273 | Ga0496115_0157203 | 3300048918 | Bacteria | 1878 |
| 1274 | Ga0496115_0202159 | 3300048918 | Bacteria | 1641 |
| 1275 | Ga0496115_0525688 | 3300048918 | Bacteria | 948 |
| 1276 | Ga0496115_0786886 | 3300048918 | Bacteria | 741 |
| 1277 | Ga0496116_0002078 | 3300048919 | Bacteria | 21426 |
| 1278 | Ga0496116_0093850 | 3300048919 | Bacteria | 1815 |
| 1279 | Ga0496116_0164906 | 3300048919 | Bacteria | 1209 |
| 1280 | Ga0496116_0225997 | 3300048919 | Bacteria | 954 |
| 1281 | Ga0496117_0031706 | 3300048920 | Bacteria | 4030 |
| 1282 | Ga0496117_0042985 | 3300048920 | Bacteria | 3292 |
| 1283 | Ga0496117_0177496 | 3300048920 | Bacteria | 1229 |
| 1284 | Ga0496117_0232876 | 3300048920 | Bacteria | 1017 |
| 1285 | Ga0496117_0298802 | 3300048920 | Bacteria | 853 |
| 1286 | Ga0496118_0004424 | 3300048921 | Bacteria | 16676 |
| 1287 | Ga0496118_0047127 | 3300048921 | Bacteria | 3345 |
| 1288 | Ga0496118_0138954 | 3300048921 | Bacteria | 1544 |
| 1289 | Ga0496118_0243177 | 3300048921 | Bacteria | 1029 |
| 1290 | Ga0496119_0017095 | 3300048922 | Bacteria | 5481 |
| 1291 | Ga0496119_0034837 | 3300048922 | Bacteria | 3306 |
| 1292 | Ga0496119_0061238 | 3300048922 | Bacteria | 2249 |
| 1293 | Ga0496119_0074875 | 3300048922 | Bacteria | 1970 |
| 1294 | Ga0496119_0194523 | 3300048922 | Bacteria | 1054 |
| 1295 | Ga0496119_0198599 | 3300048922 | Bacteria | 1040 |
| 1296 | Ga0496120_0005339 | 3300048923 | Bacteria | 10289 |
| 1297 | Ga0496120_0098903 | 3300048923 | Bacteria | 1545 |
| 1298 | Ga0496121_0000595 | 3300048924 | Bacteria | 67907 |
| 1299 | Ga0496121_0005557 | 3300048924 | Bacteria | 16103 |
| 1300 | Ga0496121_0015876 | 3300048924 | Bacteria | 7828 |
| 1301 | Ga0496121_0019434 | 3300048924 | Bacteria | 6792 |
| 1302 | Ga0496121_0061191 | 3300048924 | Bacteria | 3091 |
| 1303 | Ga0496121_0095902 | 3300048924 | Bacteria | 2303 |
| 1304 | Ga0496121_0117010 | 3300048924 | Bacteria | 2020 |
| 1305 | Ga0496121_0147280 | 3300048924 | Bacteria | 1738 |
| 1306 | Ga0496121_0183519 | 3300048924 | Bacteria | 1507 |
| 1307 | Ga0496121_0340274 | 3300048924 | Bacteria | 1003 |
| 1308 | Ga0496121_0433533 | 3300048924 | Bacteria | 852 |
| 1309 | Ga0496121_0512225 | 3300048924 | Bacteria | 759 |
| 1310 | Ga0496122_0011522 | 3300048925 | Bacteria | 8943 |
| 1311 | Ga0496122_0068422 | 3300048925 | Bacteria | 2549 |
| 1312 | Ga0496122_0084950 | 3300048925 | Bacteria | 2186 |
| 1313 | Ga0496122_0145149 | 3300048925 | Bacteria | 1476 |
| 1314 | Ga0496123_0032828 | 3300048926 | Bacteria | 3748 |
| 1315 | Ga0496123_0169186 | 3300048926 | Bacteria | 1155 |
| 1316 | Ga0496124_0002134 | 3300048927 | Bacteria | 26572 |
| 1317 | Ga0496124_0014500 | 3300048927 | Bacteria | 7618 |
| 1318 | Ga0496124_0040801 | 3300048927 | Bacteria | 4011 |
| 1319 | Ga0496124_0077574 | 3300048927 | Bacteria | 2740 |
| 1320 | Ga0496124_0085904 | 3300048927 | Bacteria | 2577 |
| 1321 | Ga0496124_0218560 | 3300048927 | Bacteria | 1435 |
| 1322 | Ga0496125_0001068 | 3300048928 | Bacteria | 42349 |
| 1323 | Ga0496125_0001760 | 3300048928 | Bacteria | 30047 |
| 1324 | Ga0496125_0021562 | 3300048928 | Bacteria | 6005 |
| 1325 | Ga0496125_0022884 | 3300048928 | Bacteria | 5789 |
| 1326 | Ga0496125_0029375 | 3300048928 | Bacteria | 4941 |
| 1327 | Ga0496125_0033411 | 3300048928 | Bacteria | 4552 |
| 1328 | Ga0496125_0449983 | 3300048928 | Bacteria | 738 |
| 1329 | Ga0496126_0002896 | 3300048929 | Bacteria | 22378 |
| 1330 | Ga0496126_0003088 | 3300048929 | Bacteria | 21536 |
| 1331 | Ga0496126_0012315 | 3300048929 | Bacteria | 8775 |
| 1332 | Ga0496126_0014870 | 3300048929 | Bacteria | 7851 |
| 1333 | Ga0496126_0018069 | 3300048929 | Bacteria | 7004 |
| 1334 | Ga0496126_0024977 | 3300048929 | Bacteria | 5760 |
| 1335 | Ga0496126_0028712 | 3300048929 | Bacteria | 5297 |
| 1336 | Ga0496126_0035078 | 3300048929 | Bacteria | 4704 |
| 1337 | Ga0496126_0078078 | 3300048929 | Bacteria | 2934 |
| 1338 | Ga0496126_0100566 | 3300048929 | Bacteria | 2530 |
| 1339 | Ga0496126_0110727 | 3300048929 | Bacteria | 2392 |
| 1340 | Ga0496126_0232148 | 3300048929 | Bacteria | 1545 |
| 1341 | Ga0496126_0259281 | 3300048929 | Bacteria | 1446 |
| 1342 | Ga0496126_0276906 | 3300048929 | Bacteria | 1391 |
| 1343 | Ga0496126_0318425 | 3300048929 | Bacteria | 1279 |
| 1344 | Ga0496126_0394044 | 3300048929 | Bacteria | 1125 |
| 1345 | Ga0501306_002656 | 3300049127 | Bacteria | 1859 |
| 1346 | Ga0501306_015137 | 3300049127 | Bacteria | 1024 |
| 1347 | Ga0501309_003761 | 3300049129 | Bacteria | 1737 |
| 1348 | Ga0501310_023956 | 3300049130 | Bacteria | 778 |
| 1349 | Ga0501305_004290 | 3300049161 | Bacteria | 1669 |
| 1350 | Ga0501307_002313 | 3300049162 | Bacteria | 1759 |
| 1351 | Ga0495678_000623 | 3300049459 | Bacteria | 32947 |
| 1352 | Ga0501291_022338 | 3300049514 | Bacteria | 1015 |
| 1353 | Ga0501311_002113 | 3300049527 | Bacteria | 1858 |
| 1354 | Ga0501312_004273 | 3300049528 | Bacteria | 1673 |
| 1355 | Ga0501313_002650 | 3300049529 | Bacteria | 1713 |
| 1356 | Ga0501313_023568 | 3300049529 | Bacteria | 772 |
| 1357 | Ga0501314_001582 | 3300049530 | Bacteria | 1664 |
| 1358 | Ga0501315_002874 | 3300049531 | Bacteria | 1672 |
| 1359 | Ga0501316_002563 | 3300049532 | Bacteria | 1689 |
| 1360 | Ga0501316_011126 | 3300049532 | Bacteria | 1033 |
| 1361 | Ga0501316_025251 | 3300049532 | Bacteria | 772 |
| 1362 | Ga0501317_002615 | 3300049533 | Bacteria | 1720 |
| 1363 | Ga0501318_002206 | 3300049534 | Bacteria | 1657 |
| 1364 | Ga0501319_000753 | 3300049535 | Bacteria | 1665 |
| 1365 | Ga0501320_001493 | 3300049536 | Bacteria | 1733 |
| 1366 | Ga0501321_002190 | 3300049537 | Bacteria | 1664 |
| 1367 | Ga0501322_000622 | 3300049538 | Bacteria | 1736 |
| 1368 | Ga0501323_003195 | 3300049539 | Bacteria | 1660 |
| 1369 | Ga0501324_002767 | 3300049540 | Bacteria | 1297 |
| 1370 | Ga0501326_00418 | 3300049542 | Bacteria | 1669 |
| 1371 | Ga0501328_00536 | 3300049544 | Bacteria | 1310 |
| 1372 | Ga0501330_001178 | 3300049546 | Bacteria | 1308 |
| 1373 | Ga0501335_001915 | 3300049551 | Bacteria | 1650 |
| 1374 | Ga0501335_007363 | 3300049551 | Bacteria | 1017 |
| 1375 | Ga0501031_0017200 | 3300049568 | Bacteria | 4698 |
| 1376 | Ga0501031_0162521 | 3300049568 | Bacteria | 1460 |
| 1377 | Ga0501032_0013398 | 3300049569 | Bacteria | 5833 |
| 1378 | Ga0501032_0086860 | 3300049569 | Bacteria | 2078 |
| 1379 | Ga0501033_0020362 | 3300049570 | Bacteria | 5010 |
| 1380 | Ga0501033_0239388 | 3300049570 | Bacteria | 1288 |
| 1381 | Ga0501033_0510540 | 3300049570 | Bacteria | 831 |
| 1382 | Ga0501034_0004953 | 3300049571 | Bacteria | 14656 |
| 1383 | Ga0501034_0007894 | 3300049571 | Bacteria | 11307 |
| 1384 | Ga0501034_0008566 | 3300049571 | Bacteria | 10796 |
| 1385 | Ga0501034_0041632 | 3300049571 | Bacteria | 4648 |
| 1386 | Ga0501034_0075309 | 3300049571 | Bacteria | 3383 |
| 1387 | Ga0501034_0124591 | 3300049571 | Bacteria | 2562 |
| 1388 | Ga0501034_0409286 | 3300049571 | Bacteria | 1278 |
| 1389 | Ga0501034_0468117 | 3300049571 | Bacteria | 1176 |
| 1390 | Ga0501036_0020290 | 3300049572 | Bacteria | 5582 |
| 1391 | Ga0501036_0022138 | 3300049572 | Bacteria | 5346 |
| 1392 | Ga0501036_0134376 | 3300049572 | Bacteria | 2088 |
| 1393 | Ga0501037_0094135 | 3300049573 | Bacteria | 2166 |
| 1394 | Ga0501038_0008634 | 3300049574 | Bacteria | 9354 |
| 1395 | Ga0501038_0028009 | 3300049574 | Bacteria | 5006 |
| 1396 | Ga0501038_0524637 | 3300049574 | Bacteria | 903 |
| 1397 | Ga0501039_0014140 | 3300049575 | Bacteria | 6111 |
| 1398 | Ga0501039_0045132 | 3300049575 | Bacteria | 3404 |
| 1399 | Ga0501039_0372051 | 3300049575 | Bacteria | 1123 |
| 1400 | Ga0501040_0023343 | 3300049576 | Bacteria | 4147 |
| 1401 | Ga0501040_0577461 | 3300049576 | Bacteria | 812 |
| 1402 | Ga0501041_0022151 | 3300049577 | Bacteria | 3804 |
| 1403 | Ga0501041_0060877 | 3300049577 | Bacteria | 2311 |
| 1404 | Ga0501042_0018622 | 3300049578 | Bacteria | 4810 |
| 1405 | Ga0501043_0076813 | 3300049579 | Bacteria | 2624 |
| 1406 | Ga0501043_0406978 | 3300049579 | Bacteria | 1027 |
| 1407 | Ga0501046_0044421 | 3300049580 | Bacteria | 3534 |
| 1408 | Ga0501047_0016648 | 3300049581 | Bacteria | 7020 |
| 1409 | Ga0501047_0025791 | 3300049581 | Bacteria | 5652 |
| 1410 | Ga0501047_0098304 | 3300049581 | Bacteria | 2805 |
| 1411 | Ga0501047_0159512 | 3300049581 | Bacteria | 2128 |
| 1412 | Ga0501047_0760205 | 3300049581 | Bacteria | 785 |
| 1413 | Ga0501048_0005997 | 3300049582 | Bacteria | 9257 |
| 1414 | Ga0501048_0287926 | 3300049582 | Bacteria | 1168 |
| 1415 | Ga0501048_0404578 | 3300049582 | Bacteria | 976 |
| 1416 | Ga0501067_0035265 | 3300049583 | Bacteria | 2777 |
| 1417 | Ga0501068_0008913 | 3300049584 | Bacteria | 5599 |
| 1418 | Ga0501068_0029708 | 3300049584 | Bacteria | 3239 |
| 1419 | Ga0501068_0203967 | 3300049584 | Bacteria | 1254 |
| 1420 | Ga0501070_0042082 | 3300049586 | Bacteria | 3804 |
| 1421 | Ga0501070_0131811 | 3300049586 | Bacteria | 2064 |
| 1422 | Ga0501070_0164392 | 3300049586 | Bacteria | 1829 |
| 1423 | Ga0501070_0232842 | 3300049586 | Bacteria | 1509 |
| 1424 | Ga0501070_0326087 | 3300049586 | Bacteria | 1248 |
| 1425 | Ga0501071_0004678 | 3300049587 | Bacteria | 8697 |
| 1426 | Ga0501072_0028077 | 3300049588 | Bacteria | 4393 |
| 1427 | Ga0501072_0345439 | 3300049588 | Bacteria | 1182 |
| 1428 | Ga0501072_0703885 | 3300049588 | Bacteria | 794 |
| 1429 | Ga0501073_0003357 | 3300049589 | Bacteria | 12035 |
| 1430 | Ga0501073_0039463 | 3300049589 | Bacteria | 3344 |
| 1431 | Ga0501073_0165472 | 3300049589 | Bacteria | 1531 |
| 1432 | Ga0501073_0642518 | 3300049589 | Bacteria | 732 |
| 1433 | Ga0501074_0007721 | 3300049590 | Bacteria | 7791 |
| 1434 | Ga0501074_0082232 | 3300049590 | Bacteria | 2310 |
| 1435 | Ga0501074_0286036 | 3300049590 | Bacteria | 1172 |
| 1436 | Ga0501075_0030276 | 3300049591 | Bacteria | 4008 |
| 1437 | Ga0501075_0240906 | 3300049591 | Bacteria | 1379 |
| 1438 | Ga0501075_0417521 | 3300049591 | Bacteria | 1023 |
| 1439 | Ga0501076_0044414 | 3300049592 | Bacteria | 3504 |
| 1440 | Ga0501076_0100948 | 3300049592 | Bacteria | 2325 |
| 1441 | Ga0501076_0492937 | 3300049592 | Bacteria | 1010 |
| 1442 | Ga0501077_0034231 | 3300049593 | Bacteria | 3233 |
| 1443 | Ga0501077_0042563 | 3300049593 | Bacteria | 2887 |
| 1444 | Ga0501077_0098574 | 3300049593 | Bacteria | 1852 |
| 1445 | Ga0501077_0200672 | 3300049593 | Bacteria | 1267 |
| 1446 | Ga0501217_024948 | 3300049661 | Bacteria | 1435 |
| 1447 | Ga0501233_104893 | 3300049668 | Bacteria | 751 |
| 1448 | Ga0501238_000691 | 3300049671 | Bacteria | 3785 |
| 1449 | Ga0501252_005667 | 3300049682 | Bacteria | 1366 |
| 1450 | Ga0501257_009500 | 3300049686 | Bacteria | 2198 |
| 1451 | Ga0501221_014348 | 3300049704 | Bacteria | 1472 |
| 1452 | Ga0501225_0137206 | 3300049705 | Bacteria | 737 |
| 1453 | Ga0501234_039781 | 3300049707 | Bacteria | 768 |
| 1454 | Ga0501079_0024961 | 3300049741 | Bacteria | 4585 |
| 1455 | Ga0501079_0339216 | 3300049741 | Bacteria | 1177 |
| 1456 | Ga0501079_0368598 | 3300049741 | Bacteria | 1126 |
| 1457 | Ga0501079_0403762 | 3300049741 | Bacteria | 1072 |
| 1458 | Ga0501080_0043101 | 3300049742 | Bacteria | 4201 |
| 1459 | Ga0501080_0051362 | 3300049742 | Bacteria | 3836 |
| 1460 | Ga0501080_0073546 | 3300049742 | Bacteria | 3180 |
| 1461 | Ga0501080_0822946 | 3300049742 | Bacteria | 813 |
| 1462 | Ga0501080_0879896 | 3300049742 | Bacteria | 782 |
| 1463 | Ga0501081_0101801 | 3300049743 | Bacteria | 2031 |
| 1464 | Ga0501081_0243872 | 3300049743 | Bacteria | 1310 |
| 1465 | Ga0501081_0321787 | 3300049743 | Bacteria | 1137 |
| 1466 | Ga0501083_0102703 | 3300049744 | Bacteria | 1885 |
| 1467 | Ga0501083_0113618 | 3300049744 | Bacteria | 1779 |
| 1468 | Ga0501275_005800 | 3300049772 | Bacteria | 1195 |
| 1469 | Ga0501035_0179600 | 3300049822 | Bacteria | 1824 |
| 1470 | Ga0501035_0254019 | 3300049822 | Bacteria | 1492 |
| 1471 | Ga0501044_0029662 | 3300049823 | Bacteria | 5767 |
| 1472 | Ga0501044_0121126 | 3300049823 | Bacteria | 2617 |
| 1473 | Ga0501044_0521824 | 3300049823 | Bacteria | 1087 |
| 1474 | Ga0501045_0061565 | 3300049824 | Bacteria | 2753 |
| 1475 | nmdc:mga03683_206046_c1 | 3300050489 | Bacteria | 904 |
| 1476 | nmdc:mga03683_2387_c1 | 3300050489 | Bacteria | 4040 |
| 1477 | nmdc:mga03683_40737_c1 | 3300050489 | Bacteria | 1906 |
| 1478 | nmdc:mga03n38_175383_c1 | 3300050490 | Bacteria | 1095 |
| 1479 | nmdc:mga03n38_233742_c1 | 3300050490 | Bacteria | 965 |
| 1480 | nmdc:mga03n38_351494_c1 | 3300050490 | Bacteria | 802 |
| 1481 | nmdc:mga00v17_115272_c1 | 3300050491 | Bacteria | 1707 |
| 1482 | nmdc:mga00v17_196424_c1 | 3300050491 | Bacteria | 1304 |
| 1483 | nmdc:mga0yw44_104074_c1 | 3300050492 | Bacteria | 1811 |
| 1484 | nmdc:mga0yw44_17493_c1 | 3300050492 | Bacteria | 3902 |
| 1485 | nmdc:mga0yw44_24969_c1 | 3300050492 | Bacteria | 3391 |
| 1486 | nmdc:mga0yw44_306479_c1 | 3300050492 | Bacteria | 1065 |
| 1487 | nmdc:mga0yw44_35725_c1 | 3300050492 | Bacteria | 2923 |
| 1488 | nmdc:mga0yw44_384153_c1 | 3300050492 | Bacteria | 948 |
| 1489 | nmdc:mga0yw44_446360_c1 | 3300050492 | Bacteria | 876 |
| 1490 | nmdc:mga0yw44_479903_c1 | 3300050492 | Bacteria | 843 |
| 1491 | nmdc:mga0yw44_52947_c1 | 3300050492 | Bacteria | 2463 |
| 1492 | nmdc:mga0k408_121808_c1 | 3300050493 | Bacteria | 1545 |
| 1493 | nmdc:mga0k408_135362_c1 | 3300050493 | Bacteria | 1464 |
| 1494 | nmdc:mga0k408_19861_c1 | 3300050493 | Bacteria | 3760 |
| 1495 | nmdc:mga0k408_3517_c1 | 3300050493 | Bacteria | 8280 |
| 1496 | nmdc:mga0k408_38074_c1 | 3300050493 | Bacteria | 2761 |
| 1497 | nmdc:mga06z11_1558_c1 | 3300050494 | Bacteria | 8525 |
| 1498 | nmdc:mga06z11_40602_c1 | 3300050494 | Bacteria | 2323 |
| 1499 | nmdc:mga06z11_513382_c1 | 3300050494 | Bacteria | 726 |
| 1500 | nmdc:mga04h51_135745_c1 | 3300050495 | Bacteria | 929 |
| 1501 | nmdc:mga04h51_5029_c1 | 3300050495 | Bacteria | 3341 |
| 1502 | nmdc:mga04h51_591_c1 | 3300050495 | Bacteria | 8655 |
| 1503 | nmdc:mga07m45_146465_c1 | 3300050496 | Bacteria | 1369 |
| 1504 | nmdc:mga07m45_328766_c1 | 3300050496 | Bacteria | 888 |
| 1505 | nmdc:mga07m45_42731_c1 | 3300050496 | Bacteria | 2541 |
| 1506 | nmdc:mga07m45_49433_c1 | 3300050496 | Bacteria | 2367 |
| 1507 | nmdc:mga05p37_121329_c1 | 3300050507 | Bacteria | 3211 |
| 1508 | nmdc:mga05p37_426432_c1 | 3300050507 | Bacteria | 1542 |
| 1509 | nmdc:mga05p37_693088_c1 | 3300050507 | Bacteria | 1133 |
| 1510 | nmdc:mga05p37_735416_c1 | 3300050507 | Bacteria | 1090 |
| 1511 | nmdc:mga05p37_78589_c1 | 3300050507 | Bacteria | 4063 |
| 1512 | nmdc:mga09592_226571_c1 | 3300050508 | Bacteria | 1619 |
| 1513 | nmdc:mga09592_500131_c1 | 3300050508 | Bacteria | 1047 |
| 1514 | nmdc:mga0qj67_218396_c1 | 3300050509 | Bacteria | 1548 |
| 1515 | nmdc:mga0qj67_321467_c1 | 3300050509 | Bacteria | 1253 |
| 1516 | nmdc:mga0qj67_7671_c1 | 3300050509 | Bacteria | 7973 |
| 1517 | nmdc:mga06r32_238405_c1 | 3300050510 | Bacteria | 1807 |
| 1518 | nmdc:mga06r32_34913_c1 | 3300050510 | Bacteria | 4744 |
| 1519 | nmdc:mga06r32_423381_c1 | 3300050510 | Bacteria | 1313 |
| 1520 | nmdc:mga06r32_873733_c1 | 3300050510 | Bacteria | 857 |
| 1521 | nmdc:mga08y16_333484_c1 | 3300050511 | Bacteria | 1560 |
| 1522 | nmdc:mga08y16_64120_c1 | 3300050511 | Bacteria | 3837 |
| 1523 | nmdc:mga0n895_479443_c1 | 3300050512 | Bacteria | 1254 |
| 1524 | nmdc:mga0rr50_326390_c1 | 3300050513 | Bacteria | 1287 |
| 1525 | nmdc:mga0rr50_456314_c1 | 3300050513 | Bacteria | 1084 |
| 1526 | nmdc:mga0a205_137912_c1 | 3300050515 | Bacteria | 2339 |
| 1527 | nmdc:mga0a205_321426_c1 | 3300050515 | Bacteria | 1418 |
| 1528 | nmdc:mga0sz30_151_c1 | 3300050516 | Bacteria | 25783 |
| 1529 | nmdc:mga0sz30_23802_c1 | 3300050516 | Bacteria | 2495 |
| 1530 | nmdc:mga0sz30_24447_c1 | 3300050516 | Bacteria | 2465 |
| 1531 | nmdc:mga0sz30_9764_c1 | 3300050516 | Bacteria | 3659 |
| 1532 | Ga0495601_0250123 | 3300053077 | Bacteria | 1158 |
| 1533 | Ga0495601_0487686 | 3300053077 | Bacteria | 796 |
| 1534 | Ga0495612_0017337 | 3300053078 | Bacteria | 2884 |
| 1535 | Ga0495612_0138688 | 3300053078 | Bacteria | 1054 |
| 1536 | Ga0500635_0176372 | 3300053080 | Bacteria | 824 |
| 1537 | Ga0495595_0122373 | 3300053084 | Bacteria | 1268 |
| 1538 | Ga0495619_0051692 | 3300053085 | Bacteria | 2716 |
| 1539 | Ga0495619_0171202 | 3300053085 | Bacteria | 1502 |
| 1540 | Ga0495619_0212571 | 3300053085 | Bacteria | 1339 |
| 1541 | Ga0500578_0000809 | 3300053086 | Bacteria | 36418 |
| 1542 | Ga0500578_0114986 | 3300053086 | Bacteria | 1694 |
| 1543 | Ga0500578_0186426 | 3300053086 | Bacteria | 1276 |
| 1544 | Ga0500643_000185 | 3300053087 | Bacteria | 60228 |
| 1545 | Ga0500643_044642 | 3300053087 | Bacteria | 1287 |
| 1546 | Ga0500644_0000046 | 3300053088 | Bacteria | 73850 |
| 1547 | Ga0500644_0001130 | 3300053088 | Bacteria | 7816 |
| 1548 | Ga0500647_0080260 | 3300053091 | Bacteria | 1565 |
| 1549 | Ga0500583_0008495 | 3300053092 | Bacteria | 3688 |
| 1550 | Ga0500583_0304967 | 3300053092 | Bacteria | 779 |
| 1551 | Ga0500651_0012726 | 3300053093 | Bacteria | 5105 |
| 1552 | Ga0500651_0031021 | 3300053093 | Bacteria | 3365 |
| 1553 | Ga0500651_0312749 | 3300053093 | Bacteria | 899 |
| 1554 | Ga0500651_0395386 | 3300053093 | Bacteria | 777 |
| 1555 | Ga0500566_0000352 | 3300053094 | Bacteria | 24987 |
| 1556 | Ga0500566_0002819 | 3300053094 | Bacteria | 10353 |
| 1557 | Ga0500566_0002995 | 3300053094 | Bacteria | 10086 |
| 1558 | Ga0500640_014140 | 3300053095 | Bacteria | 3317 |
| 1559 | Ga0500640_031872 | 3300053095 | Bacteria | 2312 |
| 1560 | Ga0500641_0002113 | 3300053096 | Bacteria | 7042 |
| 1561 | Ga0500554_015008 | 3300053102 | Bacteria | 2012 |
| 1562 | Ga0500556_0015525 | 3300053104 | Bacteria | 2351 |
| 1563 | Ga0500557_000017 | 3300053105 | Bacteria | 96699 |
| 1564 | Ga0500557_015493 | 3300053105 | Bacteria | 2062 |
| 1565 | Ga0500562_000358 | 3300053108 | Bacteria | 10999 |
| 1566 | Ga0500562_069680 | 3300053108 | Bacteria | 948 |
| 1567 | Ga0500569_066247 | 3300053109 | Bacteria | 1127 |
| 1568 | Ga0500572_000236 | 3300053111 | Bacteria | 19616 |
| 1569 | Ga0500572_001411 | 3300053111 | Bacteria | 6595 |
| 1570 | Ga0500572_077539 | 3300053111 | Bacteria | 1036 |
| 1571 | Ga0500591_048217 | 3300053115 | Bacteria | 2003 |
| 1572 | Ga0500594_0000012 | 3300053118 | Bacteria | 81832 |
| 1573 | Ga0500594_0104344 | 3300053118 | Bacteria | 876 |
| 1574 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 1575 | Ga0500595_002159 | 3300053119 | Bacteria | 10004 |
| 1576 | Ga0500595_005559 | 3300053119 | Bacteria | 5492 |
| 1577 | Ga0500595_016779 | 3300053119 | Bacteria | 2720 |
| 1578 | Ga0500595_034990 | 3300053119 | Bacteria | 1658 |
| 1579 | Ga0500607_054913 | 3300053121 | Bacteria | 2107 |
| 1580 | Ga0500608_000012 | 3300053122 | Bacteria | 91378 |
| 1581 | Ga0500608_110921 | 3300053122 | Bacteria | 1257 |
| 1582 | Ga0500608_141294 | 3300053122 | Bacteria | 1067 |
| 1583 | Ga0500614_002014 | 3300053123 | Bacteria | 4647 |
| 1584 | Ga0500618_000493 | 3300053125 | Bacteria | 25278 |
| 1585 | Ga0500618_097150 | 3300053125 | Bacteria | 663 |
| 1586 | Ga0500642_0000181 | 3300053130 | Bacteria | 26074 |
| 1587 | Ga0500642_0010289 | 3300053130 | Bacteria | 3292 |
| 1588 | Ga0500655_016438 | 3300053133 | Bacteria | 1363 |
| 1589 | Ga0500655_034636 | 3300053133 | Bacteria | 980 |
| 1590 | Ga0500658_0003891 | 3300053134 | Bacteria | 5617 |
| 1591 | Ga0500658_0044644 | 3300053134 | Bacteria | 1789 |
| 1592 | Ga0500559_0000045 | 3300053136 | Bacteria | 99550 |
| 1593 | Ga0500559_0000154 | 3300053136 | Bacteria | 54106 |
| 1594 | Ga0500559_0002554 | 3300053136 | Bacteria | 9338 |
| 1595 | Ga0500559_0003634 | 3300053136 | Bacteria | 7545 |
| 1596 | Ga0500559_0004656 | 3300053136 | Bacteria | 6465 |
| 1597 | Ga0500559_0008891 | 3300053136 | Bacteria | 4374 |
| 1598 | Ga0500564_002954 | 3300053138 | Bacteria | 6452 |
| 1599 | Ga0500573_0020144 | 3300053140 | Bacteria | 3819 |
| 1600 | Ga0500573_0226628 | 3300053140 | Bacteria | 977 |
| 1601 | Ga0500577_0006581 | 3300053142 | Bacteria | 3216 |
| 1602 | Ga0500589_142113 | 3300053147 | Bacteria | 988 |
| 1603 | Ga0500590_110123 | 3300053148 | Bacteria | 1308 |
| 1604 | Ga0500603_000776 | 3300053150 | Bacteria | 7663 |
| 1605 | Ga0500604_0031763 | 3300053151 | Bacteria | 1552 |
| 1606 | Ga0500604_0032434 | 3300053151 | Bacteria | 1539 |
| 1607 | Ga0500616_0000404 | 3300053153 | Bacteria | 59183 |
| 1608 | Ga0500616_0135878 | 3300053153 | Bacteria | 1155 |
| 1609 | Ga0500622_0000516 | 3300053156 | Bacteria | 35933 |
| 1610 | Ga0500622_0011169 | 3300053156 | Bacteria | 4902 |
| 1611 | Ga0500622_0024238 | 3300053156 | Bacteria | 3209 |
| 1612 | Ga0500622_0028564 | 3300053156 | Bacteria | 2936 |
| 1613 | Ga0500622_0090340 | 3300053156 | Bacteria | 1520 |
| 1614 | Ga0500627_0011498 | 3300053158 | Bacteria | 3273 |
| 1615 | Ga0500627_0055449 | 3300053158 | Bacteria | 1735 |
| 1616 | Ga0500627_0166730 | 3300053158 | Bacteria | 993 |
| 1617 | Ga0500630_005483 | 3300053159 | Bacteria | 6193 |
| 1618 | Ga0500638_156108 | 3300053162 | Bacteria | 1009 |
| 1619 | Ga0500639_000014 | 3300053163 | Bacteria | 122926 |
| 1620 | Ga0500639_050399 | 3300053163 | Bacteria | 2169 |
| 1621 | Ga0500639_123797 | 3300053163 | Bacteria | 1237 |
| 1622 | Ga0500639_127709 | 3300053163 | Bacteria | 1210 |
| 1623 | Ga0500636_0000343 | 3300053177 | Bacteria | 25663 |
| 1624 | Ga0500636_0044785 | 3300053177 | Bacteria | 2609 |
| 1625 | Ga0500636_0192202 | 3300053177 | Bacteria | 1086 |
| 1626 | Ga0500637_0000189 | 3300053178 | Bacteria | 22957 |
| 1627 | Ga0500645_000226 | 3300053730 | Bacteria | 42982 |
| 1628 | Ga0500645_000517 | 3300053730 | Bacteria | 25761 |
| 1629 | Ga0500645_007179 | 3300053730 | Bacteria | 3905 |
| 1630 | Ga0500609_002886 | 3300053731 | Bacteria | 2448 |
| 1631 | Ga0500609_003154 | 3300053731 | Bacteria | 2335 |
| 1632 | Ga0500552_000284 | 3300053733 | Bacteria | 4613 |
| 1633 | Ga0500596_000316 | 3300053735 | Bacteria | 8629 |
| 1634 | Ga0500596_002168 | 3300053735 | Bacteria | 3895 |
| 1635 | Ga0500596_009060 | 3300053735 | Bacteria | 1565 |
| 1636 | Ga0500601_000248 | 3300053737 | Bacteria | 10437 |
| 1637 | Ga0501084_0003455 | 3300054114 | Bacteria | 12831 |
| 1638 | Ga0501084_0068639 | 3300054114 | Bacteria | 2967 |
| 1639 | Ga0501084_0130720 | 3300054114 | Bacteria | 2114 |
| 1640 | Ga0501084_0506416 | 3300054114 | Bacteria | 1020 |
| 1641 | Ga0500661_000533 | 3300055283 | Bacteria | 7073 |
| 1642 | Ga0587082_009854 | 3300059504 | Bacteria | 1365 |
| 1643 | Ga0587079_000097 | 3300059647 | Bacteria | 5387 |
| 1644 | Ga0501082_0030220 | 3300060353 | Bacteria | 4669 |
| 1645 | Ga0501082_0083794 | 3300060353 | Bacteria | 2750 |
| 1646 | Ga0501082_0355097 | 3300060353 | Bacteria | 1278 |
| 1647 | Ga0501082_0861408 | 3300060353 | Bacteria | 793 |
| 1648 | Ga0530510_0016121 | 3300061734 | Bacteria | 5284 |
| 1649 | Ga0530510_0151867 | 3300061734 | Bacteria | 1710 |
| 1650 | Ga0530510_0869168 | 3300061734 | Bacteria | 689 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_0329632 | Ga0436363_0329632_95_640 | 176 |
| 2 | 3300046519 | Ga0495632_0175361 | Ga0495632_0175361_359_958 | 199 |
| 3 | 3300053093 | Ga0500651_0395386 | Ga0500651_0395386_11_610 | 199 |
| 4 | iso_pu_bacteria | 2515154155 | 2515853698 | 203 |
| 5 | iso_pu_bacteria | 2675903058 | 2676474242 | 203 |
| 6 | iso_pu_bacteria | 2827628540 | 2827633289 | 203 |
| 7 | 3300005434 | Ga0070709_10273246 | Ga0070709_102732462 | 205 |
| 8 | 3300005435 | Ga0070714_100199734 | Ga0070714_1001997343 | 205 |
| 9 | 3300005436 | Ga0070713_100158262 | Ga0070713_1001582621 | 205 |
| 10 | 3300025929 | Ga0207664_10022969 | Ga0207664_100229696 | 205 |
| 11 | iso_pu_bacteria | 2510917020 | 2511120963 | 205 |
| 12 | iso_pu_bacteria | 2582581279 | 2585147041 | 205 |
| 13 | iso_pu_bacteria | 2582581280 | 2585150470 | 205 |
| 14 | iso_pu_bacteria | 2582581293 | 2585197661 | 205 |
| 15 | iso_pu_bacteria | 2643221545 | 2643750922 | 205 |
| 16 | iso_pu_bacteria | 2643221552 | 2643779023 | 205 |
| 17 | iso_pu_bacteria | 2643221583 | 2643925793 | 205 |
| 18 | iso_pu_bacteria | 2643221691 | 2644509995 | 205 |
| 19 | iso_pu_bacteria | 2818991435 | 2819539758 | 205 |
| 20 | iso_pu_bacteria | 2818991454 | 2819646943 | 205 |
| 21 | iso_pu_bacteria | 2857504554 | 2857504738 | 205 |
| 22 | iso_pu_bacteria | 2884960567 | 2884965258 | 205 |
| 23 | iso_pu_bacteria | 2928531327 | 2928532766 | 205 |
| 24 | 3300005327 | Ga0070658_10125909 | Ga0070658_101259093 | 206 |
| 25 | 3300005339 | Ga0070660_100043834 | Ga0070660_1000438342 | 206 |
| 26 | 3300005347 | Ga0070668_100457117 | Ga0070668_1004571172 | 206 |
| 27 | 3300005530 | Ga0070679_100362827 | Ga0070679_1003628271 | 206 |
| 28 | 3300005530 | Ga0070679_100629788 | Ga0070679_1006297881 | 206 |
| 29 | 3300005563 | Ga0068855_100006563 | Ga0068855_1000065632 | 206 |
| 30 | 3300005616 | Ga0068852_100090825 | Ga0068852_1000908252 | 206 |
| 31 | 3300005937 | Ga0081455_10000030 | Ga0081455_1000003074 | 206 |
| 32 | 3300009093 | Ga0105240_10041457 | Ga0105240_100414576 | 206 |
| 33 | 3300013104 | Ga0157370_10011426 | Ga0157370_1001142610 | 206 |
| 34 | 3300013105 | Ga0157369_10064374 | Ga0157369_100643746 | 206 |
| 35 | 3300021377 | Ga0213874_10097772 | Ga0213874_100977721 | 206 |
| 36 | 3300025913 | Ga0207695_10056087 | Ga0207695_100560876 | 206 |
| 37 | 3300025921 | Ga0207652_10049918 | Ga0207652_100499182 | 206 |
| 38 | 3300025921 | Ga0207652_10291879 | Ga0207652_102918792 | 206 |
| 39 | 3300025949 | Ga0207667_10118681 | Ga0207667_101186811 | 206 |
| 40 | 3300026142 | Ga0207698_10074343 | Ga0207698_100743432 | 206 |
| 41 | 3300032168 | Ga0316593_10040228 | Ga0316593_100402283 | 206 |
| 42 | 3300033524 | Ga0316592_1016208 | Ga0316592_10162083 | 206 |
| 43 | 3300037418 | Ga0395900_0022962 | Ga0395900_0022962_4088_4729 | 206 |
| 44 | 3300037466 | Ga0395898_0016065 | Ga0395898_0016065_797_1438 | 206 |
| 45 | 3300038443 | Ga0395901_0025446 | Ga0395901_0025446_366_1007 | 206 |
| 46 | 3300039062 | Ga0400483_035464 | Ga0400483_035464_2784_3404 | 206 |
| 47 | 3300039450 | Ga0436363_0643564 | Ga0436363_0643564_1196_1846 | 206 |
| 48 | 3300044712 | Ga0453684_0005307 | Ga0453684_0005307_17350_18000 | 206 |
| 49 | 3300046535 | Ga0495586_0014667 | Ga0495586_0014667_2789_3409 | 206 |
| 50 | 3300049586 | Ga0501070_0131811 | Ga0501070_0131811_478_1161 | 206 |
| 51 | 3300049586 | Ga0501070_0232842 | Ga0501070_0232842_473_1120 | 206 |
| 52 | 3300049590 | Ga0501074_0082232 | Ga0501074_0082232_63_746 | 206 |
| 53 | 3300049742 | Ga0501080_0073546 | Ga0501080_0073546_227_910 | 206 |
| 54 | 3300049742 | Ga0501080_0822946 | Ga0501080_0822946_15_656 | 206 |
| 55 | iso_pu_bacteria | 2508501128 | 2509147050 | 206 |
| 56 | iso_pu_bacteria | 2513237141 | 2513887562 | 206 |
| 57 | iso_pu_bacteria | 2857591370 | 2857595444 | 206 |
| 58 | iso_pu_bacteria | 2885374607 | 2885376627 | 206 |
| 59 | iso_pu_bacteria | 2922425934 | 2922433817 | 206 |
| 60 | iso_pu_bacteria | 3005506211 | 3005511331 | 206 |
| 61 | iso_pu_bacteria | 8019555841 | 8019562924 | 206 |
| 62 | iso_pu_bacteria | 8019565922 | 8019573003 | 206 |
| 63 | 3300014326 | Ga0157380_10032373 | Ga0157380_100323734 | 207 |
| 64 | 3300032133 | Ga0316583_10060288 | Ga0316583_100602881 | 207 |
| 65 | 3300035398 | Ga0316574_0291335 | Ga0316574_0291335_245_874 | 207 |
| 66 | 3300036712 | Ga0316584_0208416 | Ga0316584_0208416_647_1279 | 207 |
| 67 | iso_pu_bacteria | 2507262055 | 2507511202 | 207 |
| 68 | iso_pu_bacteria | 2508501009 | 2508545012 | 207 |
| 69 | iso_pu_bacteria | 2508501042 | 2508693749 | 207 |
| 70 | iso_pu_bacteria | 2511231028 | 2511394627 | 207 |
| 71 | iso_pu_bacteria | 2513237092 | 2513623644 | 207 |
| 72 | iso_pu_bacteria | 2513237094 | 2513637287 | 207 |
| 73 | iso_pu_bacteria | 2513237095 | 2513650839 | 207 |
| 74 | iso_pu_bacteria | 2513237102 | 2513704927 | 207 |
| 75 | iso_pu_bacteria | 2513237104 | 2513719668 | 207 |
| 76 | iso_pu_bacteria | 2513237139 | 2513874826 | 207 |
| 77 | iso_pu_bacteria | 2513237161 | 2514010451 | 207 |
| 78 | iso_pu_bacteria | 2515154112 | 2515625230 | 207 |
| 79 | iso_pu_bacteria | 2517093001 | 2517100784 | 207 |
| 80 | iso_pu_bacteria | 2524023205 | 2524438005 | 207 |
| 81 | iso_pu_bacteria | 2528768022 | 2528849189 | 207 |
| 82 | iso_pu_bacteria | 2595698237 | 2596373409 | 207 |
| 83 | iso_pu_bacteria | 2617270735 | 2617350548 | 207 |
| 84 | iso_pu_bacteria | 2617270741 | 2617373326 | 207 |
| 85 | iso_pu_bacteria | 2667528175 | 2671122013 | 207 |
| 86 | iso_pu_bacteria | 2744054633 | 2745081037 | 207 |
| 87 | iso_pu_bacteria | 2791355196 | 2793061848 | 207 |
| 88 | iso_pu_bacteria | 2791355197 | 2793068988 | 207 |
| 89 | iso_pu_bacteria | 2802429603 | 2805916827 | 207 |
| 90 | iso_pu_bacteria | 2816332527 | 2818238347 | 207 |
| 91 | iso_pu_bacteria | 2824600985 | 2824603939 | 207 |
| 92 | iso_pu_bacteria | 2824609381 | 2824611520 | 207 |
| 93 | iso_pu_bacteria | 2824617872 | 2824622518 | 207 |
| 94 | iso_pu_bacteria | 2824626560 | 2824630302 | 207 |
| 95 | iso_pu_bacteria | 2824635225 | 2824640034 | 207 |
| 96 | iso_pu_bacteria | 2824644064 | 2824652050 | 207 |
| 97 | iso_pu_bacteria | 2824653114 | 2824655456 | 207 |
| 98 | iso_pu_bacteria | 2824661429 | 2824663322 | 207 |
| 99 | iso_pu_bacteria | 2824671348 | 2824673592 | 207 |
| 100 | iso_pu_bacteria | 2824679649 | 2824680962 | 207 |
| 101 | iso_pu_bacteria | 2824687955 | 2824690285 | 207 |
| 102 | iso_pu_bacteria | 2824696289 | 2824698644 | 207 |
| 103 | iso_pu_bacteria | 2824704595 | 2824707134 | 207 |
| 104 | iso_pu_bacteria | 2824714736 | 2824722473 | 207 |
| 105 | iso_pu_bacteria | 2824723954 | 2824732144 | 207 |
| 106 | iso_pu_bacteria | 2824732956 | 2824737347 | 207 |
| 107 | iso_pu_bacteria | 2824746037 | 2824747658 | 207 |
| 108 | iso_pu_bacteria | 2824753945 | 2824754550 | 207 |
| 109 | iso_pu_bacteria | 2824763712 | 2824765404 | 207 |
| 110 | iso_pu_bacteria | 2824773399 | 2824773502 | 207 |
| 111 | iso_pu_bacteria | 2838122688 | 2838129107 | 207 |
| 112 | iso_pu_bacteria | 2841941048 | 2841943376 | 207 |
| 113 | iso_pu_bacteria | 2841949485 | 2841953896 | 207 |
| 114 | iso_pu_bacteria | 2841957949 | 2841962077 | 207 |
| 115 | iso_pu_bacteria | 2841966195 | 2841967987 | 207 |
| 116 | iso_pu_bacteria | 2841974524 | 2841981242 | 207 |
| 117 | iso_pu_bacteria | 2841983080 | 2841990350 | 207 |
| 118 | iso_pu_bacteria | 2842038055 | 2842042517 | 207 |
| 119 | iso_pu_bacteria | 2842045827 | 2842050560 | 207 |
| 120 | iso_pu_bacteria | 2844315083 | 2844316722 | 207 |
| 121 | iso_pu_bacteria | 2847930680 | 2847938745 | 207 |
| 122 | iso_pu_bacteria | 2847939898 | 2847944058 | 207 |
| 123 | iso_pu_bacteria | 2849076700 | 2849081727 | 207 |
| 124 | iso_pu_bacteria | 2857509624 | 2857512378 | 207 |
| 125 | iso_pu_bacteria | 2874590934 | 2874597937 | 207 |
| 126 | iso_pu_bacteria | 2874612657 | 2874619749 | 207 |
| 127 | iso_pu_bacteria | 2874620515 | 2874626219 | 207 |
| 128 | iso_pu_bacteria | 2874628541 | 2874631424 | 207 |
| 129 | iso_pu_bacteria | 2874645413 | 2874651465 | 207 |
| 130 | iso_pu_bacteria | 2876761206 | 2876763059 | 207 |
| 131 | iso_pu_bacteria | 2876771140 | 2876776537 | 207 |
| 132 | iso_pu_bacteria | 2876808645 | 2876817587 | 207 |
| 133 | iso_pu_bacteria | 2876818435 | 2876824873 | 207 |
| 134 | iso_pu_bacteria | 2879074833 | 2879081600 | 207 |
| 135 | iso_pu_bacteria | 2879083081 | 2879088281 | 207 |
| 136 | iso_pu_bacteria | 2879099564 | 2879109010 | 207 |
| 137 | iso_pu_bacteria | 2879110137 | 2879116255 | 207 |
| 138 | iso_pu_bacteria | 2879127579 | 2879134225 | 207 |
| 139 | iso_pu_bacteria | 2879142872 | 2879145863 | 207 |
| 140 | iso_pu_bacteria | 2881364244 | 2881365899 | 207 |
| 141 | iso_pu_bacteria | 2881665667 | 2881667455 | 207 |
| 142 | iso_pu_bacteria | 2885366525 | 2885366746 | 207 |
| 143 | iso_pu_bacteria | 2885409591 | 2885410560 | 207 |
| 144 | iso_pu_bacteria | 2888378607 | 2888381329 | 207 |
| 145 | iso_pu_bacteria | 2888388044 | 2888389311 | 207 |
| 146 | iso_pu_bacteria | 2888419890 | 2888421748 | 207 |
| 147 | iso_pu_bacteria | 2889306138 | 2889307853 | 207 |
| 148 | iso_pu_bacteria | 2902405164 | 2902406886 | 207 |
| 149 | iso_pu_bacteria | 2903727486 | 2903733777 | 207 |
| 150 | iso_pu_bacteria | 2903748898 | 2903750268 | 207 |
| 151 | iso_pu_bacteria | 2904666416 | 2904669237 | 207 |
| 152 | iso_pu_bacteria | 2904690495 | 2904691819 | 207 |
| 153 | iso_pu_bacteria | 2904711408 | 2904712544 | 207 |
| 154 | iso_pu_bacteria | 2906602504 | 2906608039 | 207 |
| 155 | iso_pu_bacteria | 2906626472 | 2906630741 | 207 |
| 156 | iso_pu_bacteria | 2906643746 | 2906648546 | 207 |
| 157 | iso_pu_bacteria | 2908739725 | 2908741366 | 207 |
| 158 | iso_pu_bacteria | 2908756301 | 2908763926 | 207 |
| 159 | iso_pu_bacteria | 2908775508 | 2908781784 | 207 |
| 160 | iso_pu_bacteria | 2922368715 | 2922370976 | 207 |
| 161 | iso_pu_bacteria | 2922393267 | 2922401188 | 207 |
| 162 | iso_pu_bacteria | 2928125067 | 2928127065 | 207 |
| 163 | iso_pu_bacteria | 2929615660 | 2929619373 | 207 |
| 164 | iso_pu_bacteria | 2929624759 | 2929628157 | 207 |
| 165 | iso_pu_bacteria | 2932784394 | 2932785672 | 207 |
| 166 | iso_pu_bacteria | 2932794094 | 2932799098 | 207 |
| 167 | iso_pu_bacteria | 2932801729 | 2932808486 | 207 |
| 168 | iso_pu_bacteria | 2932809354 | 2932813737 | 207 |
| 169 | iso_pu_bacteria | 2932818245 | 2932822295 | 207 |
| 170 | iso_pu_bacteria | 2932828146 | 2932830736 | 207 |
| 171 | iso_pu_bacteria | 2933577622 | 2933581293 | 207 |
| 172 | iso_pu_bacteria | 2935608549 | 2935612567 | 207 |
| 173 | iso_pu_bacteria | 2935616580 | 2935620783 | 207 |
| 174 | iso_pu_bacteria | 2935630451 | 2935635636 | 207 |
| 175 | iso_pu_bacteria | 2935638405 | 2935639862 | 207 |
| 176 | iso_pu_bacteria | 2935648319 | 2935653535 | 207 |
| 177 | iso_pu_bacteria | 2935656913 | 2935662284 | 207 |
| 178 | iso_pu_bacteria | 2935665750 | 2935667284 | 207 |
| 179 | iso_pu_bacteria | 2935675223 | 2935677638 | 207 |
| 180 | iso_pu_bacteria | 2935684952 | 2935690423 | 207 |
| 181 | iso_pu_bacteria | 2935694250 | 2935697253 | 207 |
| 182 | iso_pu_bacteria | 2935703347 | 2935705040 | 207 |
| 183 | iso_pu_bacteria | 2935713505 | 2935717881 | 207 |
| 184 | iso_pu_bacteria | 2935722832 | 2935726969 | 207 |
| 185 | iso_pu_bacteria | 2935732158 | 2935735739 | 207 |
| 186 | iso_pu_bacteria | 2935741537 | 2935744990 | 207 |
| 187 | iso_pu_bacteria | 2935750917 | 2935755433 | 207 |
| 188 | iso_pu_bacteria | 2935760218 | 2935762059 | 207 |
| 189 | iso_pu_bacteria | 2935769743 | 2935776125 | 207 |
| 190 | iso_pu_bacteria | 2935777560 | 2935781958 | 207 |
| 191 | iso_pu_bacteria | 2935785616 | 2935791982 | 207 |
| 192 | iso_pu_bacteria | 2935793552 | 2935800368 | 207 |
| 193 | iso_pu_bacteria | 2935801545 | 2935803558 | 207 |
| 194 | iso_pu_bacteria | 2935810662 | 2935811478 | 207 |
| 195 | iso_pu_bacteria | 2935819856 | 2935824056 | 207 |
| 196 | iso_pu_bacteria | 2935827899 | 2935829345 | 207 |
| 197 | iso_pu_bacteria | 2935837841 | 2935842677 | 207 |
| 198 | iso_pu_bacteria | 2935847175 | 2935852797 | 207 |
| 199 | iso_pu_bacteria | 2935855204 | 2935858591 | 207 |
| 200 | iso_pu_bacteria | 2935864058 | 2935866988 | 207 |
| 201 | iso_pu_bacteria | 2935873716 | 2935877118 | 207 |
| 202 | iso_pu_bacteria | 2935883170 | 2935884687 | 207 |
| 203 | iso_pu_bacteria | 2935908558 | 2935912052 | 207 |
| 204 | iso_pu_bacteria | 2935916978 | 2935922263 | 207 |
| 205 | iso_pu_bacteria | 2935926038 | 2935929081 | 207 |
| 206 | iso_pu_bacteria | 2935934488 | 2935935712 | 207 |
| 207 | iso_pu_bacteria | 2935942939 | 2935947278 | 207 |
| 208 | iso_pu_bacteria | 2935951376 | 2935953628 | 207 |
| 209 | iso_pu_bacteria | 2935967501 | 2935968654 | 207 |
| 210 | iso_pu_bacteria | 2935975950 | 2935976860 | 207 |
| 211 | iso_pu_bacteria | 2935984226 | 2935986178 | 207 |
| 212 | iso_pu_bacteria | 2935992306 | 2935995246 | 207 |
| 213 | iso_pu_bacteria | 2936002035 | 2936004133 | 207 |
| 214 | iso_pu_bacteria | 2936011229 | 2936016586 | 207 |
| 215 | iso_pu_bacteria | 2936019824 | 2936025100 | 207 |
| 216 | iso_pu_bacteria | 2936028420 | 2936034061 | 207 |
| 217 | iso_pu_bacteria | 2936037263 | 2936038060 | 207 |
| 218 | iso_pu_bacteria | 2936046547 | 2936051999 | 207 |
| 219 | iso_pu_bacteria | 2936055302 | 2936059772 | 207 |
| 220 | iso_pu_bacteria | 2940556831 | 2940561286 | 207 |
| 221 | iso_pu_bacteria | 2941507105 | 2941509285 | 207 |
| 222 | iso_pu_bacteria | 2941515067 | 2941517114 | 207 |
| 223 | iso_pu_bacteria | 2941523033 | 2941524791 | 207 |
| 224 | iso_pu_bacteria | 2941531003 | 2941533511 | 207 |
| 225 | iso_pu_bacteria | 2941538514 | 2941544476 | 207 |
| 226 | iso_pu_bacteria | 3005474847 | 3005475418 | 207 |
| 227 | iso_pu_bacteria | 3005483717 | 3005487535 | 207 |
| 228 | iso_pu_bacteria | 3005587118 | 3005592892 | 207 |
| 229 | iso_pu_bacteria | 3005594810 | 3005596335 | 207 |
| 230 | iso_pu_bacteria | 3005710791 | 3005712412 | 207 |
| 231 | iso_pu_bacteria | 3005718088 | 3005719489 | 207 |
| 232 | iso_pu_bacteria | 8006926726 | 8006927705 | 207 |
| 233 | iso_pu_bacteria | 8016511872 | 8016516669 | 207 |
| 234 | iso_pu_bacteria | 8016530956 | 8016537594 | 207 |
| 235 | iso_pu_bacteria | 8016539877 | 8016541864 | 207 |
| 236 | iso_pu_bacteria | 8016548790 | 8016551414 | 207 |
| 237 | iso_pu_bacteria | 8016557553 | 8016559798 | 207 |
| 238 | iso_pu_bacteria | 8016566248 | 8016567246 | 207 |
| 239 | iso_pu_bacteria | 8016575299 | 8016579962 | 207 |
| 240 | iso_pu_bacteria | 8016595262 | 8016597742 | 207 |
| 241 | iso_pu_bacteria | 8016603502 | 8016604571 | 207 |
| 242 | iso_pu_bacteria | 8016613128 | 8016620438 | 207 |
| 243 | iso_pu_bacteria | 8016622563 | 8016629534 | 207 |
| 244 | iso_pu_bacteria | 8016630954 | 8016637864 | 207 |
| 245 | iso_pu_bacteria | 8017057580 | 8017059886 | 207 |
| 246 | iso_pu_bacteria | 8019530166 | 8019537269 | 207 |
| 247 | iso_pu_bacteria | 8019538911 | 8019538982 | 207 |
| 248 | iso_pu_bacteria | 8019547302 | 8019548472 | 207 |
| 249 | iso_pu_bacteria | 8019576017 | 8019579376 | 207 |
| 250 | iso_pu_bacteria | 8019586578 | 8019597434 | 207 |
| 251 | iso_pu_bacteria | 8019597564 | 8019604252 | 207 |
| 252 | iso_pu_bacteria | 8019619141 | 8019624931 | 207 |
| 253 | iso_pu_bacteria | 8019629233 | 8019637255 | 207 |
| 254 | iso_pu_bacteria | 8019659431 | 8019665111 | 207 |
| 255 | iso_pu_bacteria | 8019668869 | 8019674643 | 207 |
| 256 | iso_pu_bacteria | 8019678201 | 8019681457 | 207 |
| 257 | iso_pu_bacteria | 8019687851 | 8019694323 | 207 |
| 258 | iso_pu_bacteria | 8055742211 | 8055749370 | 207 |
| 259 | iso_pu_bacteria | 8056967851 | 8056973619 | 207 |
| 260 | 3300005328 | Ga0070676_10035897 | Ga0070676_100358972 | 208 |
| 261 | 3300005334 | Ga0068869_100066713 | Ga0068869_1000667132 | 208 |
| 262 | 3300005340 | Ga0070689_100425995 | Ga0070689_1004259952 | 208 |
| 263 | 3300005353 | Ga0070669_100053105 | Ga0070669_1000531052 | 208 |
| 264 | 3300005355 | Ga0070671_100022475 | Ga0070671_1000224752 | 208 |
| 265 | 3300005356 | Ga0070674_100262803 | Ga0070674_1002628032 | 208 |
| 266 | 3300005364 | Ga0070673_100189089 | Ga0070673_1001890892 | 208 |
| 267 | 3300005365 | Ga0070688_100061005 | Ga0070688_1000610053 | 208 |
| 268 | 3300005367 | Ga0070667_100232058 | Ga0070667_1002320582 | 208 |
| 269 | 3300005435 | Ga0070714_100012241 | Ga0070714_1000122417 | 208 |
| 270 | 3300005436 | Ga0070713_100609120 | Ga0070713_1006091202 | 208 |
| 271 | 3300005441 | Ga0070700_100256182 | Ga0070700_1002561822 | 208 |
| 272 | 3300005456 | Ga0070678_100273035 | Ga0070678_1002730352 | 208 |
| 273 | 3300005456 | Ga0070678_100535734 | Ga0070678_1005357341 | 208 |
| 274 | 3300005459 | Ga0068867_100474525 | Ga0068867_1004745252 | 208 |
| 275 | 3300005466 | Ga0070685_10235950 | Ga0070685_102359501 | 208 |
| 276 | 3300005543 | Ga0070672_100010425 | Ga0070672_1000104253 | 208 |
| 277 | 3300005543 | Ga0070672_100300343 | Ga0070672_1003003431 | 208 |
| 278 | 3300005549 | Ga0070704_100645549 | Ga0070704_1006455491 | 208 |
| 279 | 3300005617 | Ga0068859_100295661 | Ga0068859_1002956611 | 208 |
| 280 | 3300005618 | Ga0068864_100024785 | Ga0068864_1000247852 | 208 |
| 281 | 3300005718 | Ga0068866_10055550 | Ga0068866_100555501 | 208 |
| 282 | 3300005719 | Ga0068861_100490585 | Ga0068861_1004905851 | 208 |
| 283 | 3300005840 | Ga0068870_10039834 | Ga0068870_100398342 | 208 |
| 284 | 3300005841 | Ga0068863_100022184 | Ga0068863_1000221842 | 208 |
| 285 | 3300005842 | Ga0068858_100047990 | Ga0068858_1000479903 | 208 |
| 286 | 3300005843 | Ga0068860_100498547 | Ga0068860_1004985471 | 208 |
| 287 | 3300006173 | Ga0070716_100567026 | Ga0070716_1005670262 | 208 |
| 288 | 3300006237 | Ga0097621_100005209 | Ga0097621_1000052091 | 208 |
| 289 | 3300006358 | Ga0068871_100005755 | Ga0068871_1000057555 | 208 |
| 290 | 3300006358 | Ga0068871_100053750 | Ga0068871_1000537502 | 208 |
| 291 | 3300006931 | Ga0097620_100295664 | Ga0097620_1002956642 | 208 |
| 292 | 3300009176 | Ga0105242_10075288 | Ga0105242_100752883 | 208 |
| 293 | 3300009177 | Ga0105248_10855041 | Ga0105248_108550411 | 208 |
| 294 | 3300013297 | Ga0157378_10248316 | Ga0157378_102483162 | 208 |
| 295 | 3300013306 | Ga0163162_10268551 | Ga0163162_102685512 | 208 |
| 296 | 3300013308 | Ga0157375_10751337 | Ga0157375_107513371 | 208 |
| 297 | 3300014325 | Ga0163163_10010656 | Ga0163163_100106565 | 208 |
| 298 | 3300014326 | Ga0157380_10156702 | Ga0157380_101567022 | 208 |
| 299 | 3300014968 | Ga0157379_10077606 | Ga0157379_100776062 | 208 |
| 300 | 3300014969 | Ga0157376_10413471 | Ga0157376_104134712 | 208 |
| 301 | 3300014969 | Ga0157376_10455855 | Ga0157376_104558551 | 208 |
| 302 | 3300017792 | Ga0163161_10257439 | Ga0163161_102574392 | 208 |
| 303 | 3300021358 | Ga0213873_10028827 | Ga0213873_100288272 | 208 |
| 304 | 3300021377 | Ga0213874_10032374 | Ga0213874_100323742 | 208 |
| 305 | 3300021384 | Ga0213876_10045989 | Ga0213876_100459893 | 208 |
| 306 | 3300021441 | Ga0213871_10009471 | Ga0213871_100094711 | 208 |
| 307 | 3300025253 | Ga0209677_100240 | Ga0209677_10024046 | 208 |
| 308 | 3300025254 | Ga0209148_1006744 | Ga0209148_10067442 | 208 |
| 309 | 3300025272 | Ga0209455_1001056 | Ga0209455_100105620 | 208 |
| 310 | 3300025907 | Ga0207645_10081161 | Ga0207645_100811612 | 208 |
| 311 | 3300025908 | Ga0207643_10002912 | Ga0207643_100029125 | 208 |
| 312 | 3300025911 | Ga0207654_10280216 | Ga0207654_102802162 | 208 |
| 313 | 3300025916 | Ga0207663_10050440 | Ga0207663_100504401 | 208 |
| 314 | 3300025923 | Ga0207681_10067633 | Ga0207681_100676332 | 208 |
| 315 | 3300025926 | Ga0207659_10247417 | Ga0207659_102474172 | 208 |
| 316 | 3300025928 | Ga0207700_10398544 | Ga0207700_103985442 | 208 |
| 317 | 3300025928 | Ga0207700_10536225 | Ga0207700_105362251 | 208 |
| 318 | 3300025929 | Ga0207664_10001459 | Ga0207664_1000145920 | 208 |
| 319 | 3300025931 | Ga0207644_10024786 | Ga0207644_100247862 | 208 |
| 320 | 3300025936 | Ga0207670_10223272 | Ga0207670_102232722 | 208 |
| 321 | 3300025937 | Ga0207669_10038820 | Ga0207669_100388201 | 208 |
| 322 | 3300025940 | Ga0207691_10256370 | Ga0207691_102563702 | 208 |
| 323 | 3300025942 | Ga0207689_10009368 | Ga0207689_100093687 | 208 |
| 324 | 3300026023 | Ga0207677_10217399 | Ga0207677_102173992 | 208 |
| 325 | 3300026075 | Ga0207708_10060761 | Ga0207708_100607612 | 208 |
| 326 | 3300026088 | Ga0207641_10093443 | Ga0207641_100934432 | 208 |
| 327 | 3300026088 | Ga0207641_10250050 | Ga0207641_102500502 | 208 |
| 328 | 3300026089 | Ga0207648_10010728 | Ga0207648_100107283 | 208 |
| 329 | 3300026095 | Ga0207676_10076218 | Ga0207676_100762183 | 208 |
| 330 | 3300026116 | Ga0207674_10827632 | Ga0207674_108276322 | 208 |
| 331 | 3300026118 | Ga0207675_100007528 | Ga0207675_1000075283 | 208 |
| 332 | 3300026121 | Ga0207683_10056099 | Ga0207683_100560991 | 208 |
| 333 | 3300026121 | Ga0207683_10516764 | Ga0207683_105167641 | 208 |
| 334 | 3300031247 | Ga0265340_10008012 | Ga0265340_100080125 | 208 |
| 335 | 3300037853 | Ga0436364_0025958 | Ga0436364_0025958_143_775 | 208 |
| 336 | 3300039437 | Ga0436365_0850398 | Ga0436365_0850398_492_1124 | 208 |
| 337 | 3300039438 | Ga0436360_0751338 | Ga0436360_0751338_12885_13622 | 208 |
| 338 | 3300039447 | Ga0436361_0573255 | Ga0436361_0573255_10549_11286 | 208 |
| 339 | 3300039450 | Ga0436363_1291996 | Ga0436363_1291996_2881_3513 | 208 |
| 340 | 3300039453 | Ga0436362_0487773 | Ga0436362_0487773_2380_3117 | 208 |
| 341 | 3300041413 | Ga0439465_0039777 | Ga0439465_0039777_866_1498 | 208 |
| 342 | 3300044694 | Ga0466963_0378839 | Ga0466963_0378839_108_740 | 208 |
| 343 | 3300044735 | Ga0466968_0086161 | Ga0466968_0086161_269_895 | 208 |
| 344 | 3300044842 | Ga0466957_0624444 | Ga0466957_0624444_14_646 | 208 |
| 345 | 3300046475 | Ga0495639_0090833 | Ga0495639_0090833_758_1390 | 208 |
| 346 | 3300046539 | Ga0495621_0005934 | Ga0495621_0005934_1600_2232 | 208 |
| 347 | 3300048905 | Ga0496102_0043607 | Ga0496102_0043607_1399_2031 | 208 |
| 348 | 3300048906 | Ga0496103_0056707 | Ga0496103_0056707_838_1470 | 208 |
| 349 | 3300048907 | Ga0496104_0351819 | Ga0496104_0351819_187_819 | 208 |
| 350 | 3300048908 | Ga0496105_0065290 | Ga0496105_0065290_1673_2305 | 208 |
| 351 | 3300048909 | Ga0496106_0144770 | Ga0496106_0144770_1126_1758 | 208 |
| 352 | 3300048911 | Ga0496108_0474149 | Ga0496108_0474149_291_923 | 208 |
| 353 | 3300048912 | Ga0496109_0046030 | Ga0496109_0046030_2159_2791 | 208 |
| 354 | 3300048913 | Ga0496110_0145899 | Ga0496110_0145899_1156_1788 | 208 |
| 355 | 3300048914 | Ga0496111_0017225 | Ga0496111_0017225_1289_1921 | 208 |
| 356 | 3300048920 | Ga0496117_0177496 | Ga0496117_0177496_112_744 | 208 |
| 357 | 3300048921 | Ga0496118_0047127 | Ga0496118_0047127_285_917 | 208 |
| 358 | 3300048924 | Ga0496121_0015876 | Ga0496121_0015876_7019_7651 | 208 |
| 359 | 3300048928 | Ga0496125_0001068 | Ga0496125_0001068_14468_15094 | 208 |
| 360 | 3300048928 | Ga0496125_0021562 | Ga0496125_0021562_5017_5643 | 208 |
| 361 | 3300049574 | Ga0501038_0524637 | Ga0501038_0524637_189_818 | 208 |
| 362 | 3300049575 | Ga0501039_0372051 | Ga0501039_0372051_109_738 | 208 |
| 363 | 3300049577 | Ga0501041_0060877 | Ga0501041_0060877_1324_1953 | 208 |
| 364 | 3300049582 | Ga0501048_0287926 | Ga0501048_0287926_379_1008 | 208 |
| 365 | 3300049584 | Ga0501068_0203967 | Ga0501068_0203967_594_1223 | 208 |
| 366 | 3300049593 | Ga0501077_0098574 | Ga0501077_0098574_282_911 | 208 |
| 367 | 3300049741 | Ga0501079_0368598 | Ga0501079_0368598_276_914 | 208 |
| 368 | 3300049743 | Ga0501081_0243872 | Ga0501081_0243872_280_909 | 208 |
| 369 | 3300049743 | Ga0501081_0321787 | Ga0501081_0321787_340_966 | 208 |
| 370 | 3300049744 | Ga0501083_0102703 | Ga0501083_0102703_320_949 | 208 |
| 371 | 3300050494 | nmdc:mga06z11_513382_c1 | nmdc:mga06z11_513382_c1_90_716 | 208 |
| 372 | 3300053158 | Ga0500627_0166730 | Ga0500627_0166730_76_702 | 208 |
| 373 | 3300054114 | Ga0501084_0506416 | Ga0501084_0506416_183_812 | 208 |
| 374 | 3300060353 | Ga0501082_0083794 | Ga0501082_0083794_1116_1745 | 208 |
| 375 | 3300061734 | Ga0530510_0151867 | Ga0530510_0151867_329_958 | 208 |
| 376 | 3300002987 | JGI25159J45721_1009424 | JGI25159J45721_10094242 | 209 |
| 377 | 3300003187 | JGI25151J46595_10001287 | JGI25151J46595_100012871 | 209 |
| 378 | 3300003187 | JGI25151J46595_10037149 | JGI25151J46595_100371492 | 209 |
| 379 | 3300003187 | JGI25151J46595_10074055 | JGI25151J46595_100740551 | 209 |
| 380 | 3300003187 | JGI25151J46595_10074524 | JGI25151J46595_100745241 | 209 |
| 381 | 3300003203 | JGI25406J46586_10076708 | JGI25406J46586_100767082 | 209 |
| 382 | 3300003215 | JGI25153J46596_10002853 | JGI25153J46596_100028538 | 209 |
| 383 | 3300003215 | JGI25153J46596_10017253 | JGI25153J46596_100172532 | 209 |
| 384 | 3300003215 | JGI25153J46596_10037963 | JGI25153J46596_100379631 | 209 |
| 385 | 3300003316 | rootH1_10001329 | rootH1_1000132926 | 209 |
| 386 | 3300003320 | rootH2_10173050 | rootH2_101730502 | 209 |
| 387 | 3300003320 | rootH2_10273013 | rootH2_102730132 | 209 |
| 388 | 3300003322 | rootL2_10029468 | rootL2_1002946811 | 209 |
| 389 | 3300003322 | rootL2_10179753 | rootL2_101797532 | 209 |
| 390 | 3300003323 | rootH1_10048253 | rootH1_100482533 | 209 |
| 391 | 3300003354 | JGI25160J50197_1000505 | JGI25160J50197_100050517 | 209 |
| 392 | 3300003354 | JGI25160J50197_1009635 | JGI25160J50197_10096355 | 209 |
| 393 | 3300003578 | Ga0006562J51391_1001388 | Ga0006562J51391_10013888 | 209 |
| 394 | 3300003751 | Ga0055538_1000128 | Ga0055538_10001282 | 209 |
| 395 | 3300003758 | Ga0055532_1001176 | Ga0055532_10011762 | 209 |
| 396 | 3300003761 | Ga0055535_1007751 | Ga0055535_10077512 | 209 |
| 397 | 3300003762 | Ga0055542_1008160 | Ga0055542_10081603 | 209 |
| 398 | 3300003771 | Ga0055526_1029905 | Ga0055526_10299052 | 209 |
| 399 | 3300003773 | Ga0055537_1009257 | Ga0055537_10092572 | 209 |
| 400 | 3300003781 | Ga0055536_1002036 | Ga0055536_10020365 | 209 |
| 401 | 3300003781 | Ga0055536_1002279 | Ga0055536_10022795 | 209 |
| 402 | 3300003790 | Ga0055528_1003018 | Ga0055528_100301810 | 209 |
| 403 | 3300003790 | Ga0055528_1027876 | Ga0055528_10278762 | 209 |
| 404 | 3300003791 | Ga0055530_10004426 | Ga0055530_100044265 | 209 |
| 405 | 3300003791 | Ga0055530_10005947 | Ga0055530_100059475 | 209 |
| 406 | 3300003794 | Ga0055531_10002251 | Ga0055531_100022519 | 209 |
| 407 | 3300003794 | Ga0055531_10003247 | Ga0055531_100032477 | 209 |
| 408 | 3300003794 | Ga0055531_10016299 | Ga0055531_100162995 | 209 |
| 409 | 3300005262 | Ga0065165_1000254 | Ga0065165_100025412 | 209 |
| 410 | 3300005262 | Ga0065165_1000376 | Ga0065165_100037626 | 209 |
| 411 | 3300005262 | Ga0065165_1000749 | Ga0065165_100074925 | 209 |
| 412 | 3300005262 | Ga0065165_1004727 | Ga0065165_100472713 | 209 |
| 413 | 3300005327 | Ga0070658_10000029 | Ga0070658_1000002972 | 209 |
| 414 | 3300005327 | Ga0070658_10084816 | Ga0070658_100848162 | 209 |
| 415 | 3300005327 | Ga0070658_10105279 | Ga0070658_101052792 | 209 |
| 416 | 3300005329 | Ga0070683_100054819 | Ga0070683_1000548194 | 209 |
| 417 | 3300005329 | Ga0070683_100252526 | Ga0070683_1002525262 | 209 |
| 418 | 3300005331 | Ga0070670_100041824 | Ga0070670_1000418243 | 209 |
| 419 | 3300005331 | Ga0070670_100052926 | Ga0070670_1000529264 | 209 |
| 420 | 3300005334 | Ga0068869_100281367 | Ga0068869_1002813672 | 209 |
| 421 | 3300005334 | Ga0068869_100878402 | Ga0068869_1008784021 | 209 |
| 422 | 3300005335 | Ga0070666_10007107 | Ga0070666_100071074 | 209 |
| 423 | 3300005336 | Ga0070680_100004826 | Ga0070680_1000048266 | 209 |
| 424 | 3300005336 | Ga0070680_100039689 | Ga0070680_1000396892 | 209 |
| 425 | 3300005339 | Ga0070660_100007310 | Ga0070660_1000073106 | 209 |
| 426 | 3300005339 | Ga0070660_100237818 | Ga0070660_1002378182 | 209 |
| 427 | 3300005339 | Ga0070660_100351183 | Ga0070660_1003511832 | 209 |
| 428 | 3300005340 | Ga0070689_100124083 | Ga0070689_1001240832 | 209 |
| 429 | 3300005340 | Ga0070689_100157578 | Ga0070689_1001575782 | 209 |
| 430 | 3300005341 | Ga0070691_10005525 | Ga0070691_100055253 | 209 |
| 431 | 3300005344 | Ga0070661_100013672 | Ga0070661_1000136722 | 209 |
| 432 | 3300005344 | Ga0070661_100020985 | Ga0070661_1000209852 | 209 |
| 433 | 3300005344 | Ga0070661_100084578 | Ga0070661_1000845782 | 209 |
| 434 | 3300005347 | Ga0070668_100010989 | Ga0070668_1000109892 | 209 |
| 435 | 3300005347 | Ga0070668_100110111 | Ga0070668_1001101113 | 209 |
| 436 | 3300005353 | Ga0070669_100010848 | Ga0070669_1000108487 | 209 |
| 437 | 3300005353 | Ga0070669_100074367 | Ga0070669_1000743672 | 209 |
| 438 | 3300005353 | Ga0070669_100323671 | Ga0070669_1003236712 | 209 |
| 439 | 3300005353 | Ga0070669_100367560 | Ga0070669_1003675601 | 209 |
| 440 | 3300005354 | Ga0070675_100301946 | Ga0070675_1003019462 | 209 |
| 441 | 3300005354 | Ga0070675_100400389 | Ga0070675_1004003892 | 209 |
| 442 | 3300005355 | Ga0070671_100034049 | Ga0070671_1000340493 | 209 |
| 443 | 3300005356 | Ga0070674_100140673 | Ga0070674_1001406732 | 209 |
| 444 | 3300005364 | Ga0070673_100369338 | Ga0070673_1003693381 | 209 |
| 445 | 3300005364 | Ga0070673_100470046 | Ga0070673_1004700462 | 209 |
| 446 | 3300005364 | Ga0070673_100818547 | Ga0070673_1008185471 | 209 |
| 447 | 3300005365 | Ga0070688_100027531 | Ga0070688_1000275313 | 209 |
| 448 | 3300005366 | Ga0070659_100000968 | Ga0070659_10000096814 | 209 |
| 449 | 3300005366 | Ga0070659_100156073 | Ga0070659_1001560732 | 209 |
| 450 | 3300005366 | Ga0070659_100564360 | Ga0070659_1005643601 | 209 |
| 451 | 3300005367 | Ga0070667_100116779 | Ga0070667_1001167792 | 209 |
| 452 | 3300005367 | Ga0070667_100146586 | Ga0070667_1001465862 | 209 |
| 453 | 3300005367 | Ga0070667_100285152 | Ga0070667_1002851521 | 209 |
| 454 | 3300005367 | Ga0070667_100291136 | Ga0070667_1002911362 | 209 |
| 455 | 3300005367 | Ga0070667_100661277 | Ga0070667_1006612771 | 209 |
| 456 | 3300005434 | Ga0070709_10000102 | Ga0070709_1000010247 | 209 |
| 457 | 3300005434 | Ga0070709_10002668 | Ga0070709_100026688 | 209 |
| 458 | 3300005434 | Ga0070709_10146800 | Ga0070709_101468002 | 209 |
| 459 | 3300005434 | Ga0070709_10172951 | Ga0070709_101729512 | 209 |
| 460 | 3300005435 | Ga0070714_100002572 | Ga0070714_10000257212 | 209 |
| 461 | 3300005435 | Ga0070714_100043830 | Ga0070714_1000438302 | 209 |
| 462 | 3300005435 | Ga0070714_100113074 | Ga0070714_1001130743 | 209 |
| 463 | 3300005435 | Ga0070714_100278628 | Ga0070714_1002786281 | 209 |
| 464 | 3300005436 | Ga0070713_100055744 | Ga0070713_1000557442 | 209 |
| 465 | 3300005436 | Ga0070713_100139806 | Ga0070713_1001398062 | 209 |
| 466 | 3300005436 | Ga0070713_100259853 | Ga0070713_1002598531 | 209 |
| 467 | 3300005437 | Ga0070710_10000246 | Ga0070710_100002463 | 209 |
| 468 | 3300005437 | Ga0070710_10043267 | Ga0070710_100432673 | 209 |
| 469 | 3300005437 | Ga0070710_10130490 | Ga0070710_101304903 | 209 |
| 470 | 3300005437 | Ga0070710_10415642 | Ga0070710_104156421 | 209 |
| 471 | 3300005437 | Ga0070710_10780798 | Ga0070710_107807981 | 209 |
| 472 | 3300005438 | Ga0070701_10117330 | Ga0070701_101173302 | 209 |
| 473 | 3300005439 | Ga0070711_100001950 | Ga0070711_1000019503 | 209 |
| 474 | 3300005439 | Ga0070711_100009139 | Ga0070711_1000091394 | 209 |
| 475 | 3300005439 | Ga0070711_100021023 | Ga0070711_1000210235 | 209 |
| 476 | 3300005439 | Ga0070711_100057145 | Ga0070711_1000571452 | 209 |
| 477 | 3300005439 | Ga0070711_100149799 | Ga0070711_1001497993 | 209 |
| 478 | 3300005440 | Ga0070705_100005393 | Ga0070705_1000053932 | 209 |
| 479 | 3300005441 | Ga0070700_100004393 | Ga0070700_1000043931 | 209 |
| 480 | 3300005441 | Ga0070700_100174861 | Ga0070700_1001748611 | 209 |
| 481 | 3300005444 | Ga0070694_100184113 | Ga0070694_1001841132 | 209 |
| 482 | 3300005445 | Ga0070708_100438825 | Ga0070708_1004388252 | 209 |
| 483 | 3300005456 | Ga0070678_100023432 | Ga0070678_1000234325 | 209 |
| 484 | 3300005456 | Ga0070678_100060424 | Ga0070678_1000604242 | 209 |
| 485 | 3300005457 | Ga0070662_100216351 | Ga0070662_1002163512 | 209 |
| 486 | 3300005458 | Ga0070681_10014331 | Ga0070681_100143314 | 209 |
| 487 | 3300005458 | Ga0070681_10073996 | Ga0070681_100739962 | 209 |
| 488 | 3300005458 | Ga0070681_10074121 | Ga0070681_100741211 | 209 |
| 489 | 3300005459 | Ga0068867_100005155 | Ga0068867_1000051552 | 209 |
| 490 | 3300005459 | Ga0068867_100031126 | Ga0068867_1000311263 | 209 |
| 491 | 3300005459 | Ga0068867_100344861 | Ga0068867_1003448612 | 209 |
| 492 | 3300005459 | Ga0068867_100532561 | Ga0068867_1005325611 | 209 |
| 493 | 3300005466 | Ga0070685_10213074 | Ga0070685_102130742 | 209 |
| 494 | 3300005467 | Ga0070706_100009262 | Ga0070706_1000092626 | 209 |
| 495 | 3300005467 | Ga0070706_100604505 | Ga0070706_1006045052 | 209 |
| 496 | 3300005468 | Ga0070707_100038744 | Ga0070707_1000387442 | 209 |
| 497 | 3300005468 | Ga0070707_100149343 | Ga0070707_1001493432 | 209 |
| 498 | 3300005468 | Ga0070707_100694312 | Ga0070707_1006943121 | 209 |
| 499 | 3300005471 | Ga0070698_100001489 | Ga0070698_10000148926 | 209 |
| 500 | 3300005471 | Ga0070698_100001894 | Ga0070698_10000189410 | 209 |
| 501 | 3300005471 | Ga0070698_101065320 | Ga0070698_1010653201 | 209 |
| 502 | 3300005518 | Ga0070699_100020158 | Ga0070699_1000201586 | 209 |
| 503 | 3300005518 | Ga0070699_100039020 | Ga0070699_1000390203 | 209 |
| 504 | 3300005518 | Ga0070699_100087255 | Ga0070699_1000872552 | 209 |
| 505 | 3300005518 | Ga0070699_100192282 | Ga0070699_1001922822 | 209 |
| 506 | 3300005530 | Ga0070679_100015211 | Ga0070679_1000152115 | 209 |
| 507 | 3300005530 | Ga0070679_100166416 | Ga0070679_1001664163 | 209 |
| 508 | 3300005530 | Ga0070679_100195382 | Ga0070679_1001953822 | 209 |
| 509 | 3300005535 | Ga0070684_100059203 | Ga0070684_1000592033 | 209 |
| 510 | 3300005535 | Ga0070684_100139063 | Ga0070684_1001390632 | 209 |
| 511 | 3300005536 | Ga0070697_100040877 | Ga0070697_1000408775 | 209 |
| 512 | 3300005536 | Ga0070697_100053626 | Ga0070697_1000536262 | 209 |
| 513 | 3300005536 | Ga0070697_100085917 | Ga0070697_1000859172 | 209 |
| 514 | 3300005539 | Ga0068853_100439525 | Ga0068853_1004395252 | 209 |
| 515 | 3300005543 | Ga0070672_100037975 | Ga0070672_1000379753 | 209 |
| 516 | 3300005543 | Ga0070672_100077938 | Ga0070672_1000779382 | 209 |
| 517 | 3300005543 | Ga0070672_100280783 | Ga0070672_1002807832 | 209 |
| 518 | 3300005546 | Ga0070696_100277204 | Ga0070696_1002772042 | 209 |
| 519 | 3300005548 | Ga0070665_100028600 | Ga0070665_1000286002 | 209 |
| 520 | 3300005548 | Ga0070665_100041857 | Ga0070665_1000418574 | 209 |
| 521 | 3300005548 | Ga0070665_100059744 | Ga0070665_1000597443 | 209 |
| 522 | 3300005548 | Ga0070665_100321285 | Ga0070665_1003212852 | 209 |
| 523 | 3300005548 | Ga0070665_100337936 | Ga0070665_1003379362 | 209 |
| 524 | 3300005548 | Ga0070665_100645488 | Ga0070665_1006454882 | 209 |
| 525 | 3300005548 | Ga0070665_100721904 | Ga0070665_1007219042 | 209 |
| 526 | 3300005563 | Ga0068855_100197789 | Ga0068855_1001977892 | 209 |
| 527 | 3300005563 | Ga0068855_100285543 | Ga0068855_1002855432 | 209 |
| 528 | 3300005563 | Ga0068855_100453266 | Ga0068855_1004532662 | 209 |
| 529 | 3300005564 | Ga0070664_100181960 | Ga0070664_1001819602 | 209 |
| 530 | 3300005564 | Ga0070664_100222681 | Ga0070664_1002226815 | 209 |
| 531 | 3300005577 | Ga0068857_100068776 | Ga0068857_1000687764 | 209 |
| 532 | 3300005577 | Ga0068857_101355763 | Ga0068857_1013557631 | 209 |
| 533 | 3300005578 | Ga0068854_101005385 | Ga0068854_1010053851 | 209 |
| 534 | 3300005614 | Ga0068856_100007916 | Ga0068856_1000079168 | 209 |
| 535 | 3300005614 | Ga0068856_100407198 | Ga0068856_1004071982 | 209 |
| 536 | 3300005614 | Ga0068856_100529116 | Ga0068856_1005291161 | 209 |
| 537 | 3300005614 | Ga0068856_100710100 | Ga0068856_1007101001 | 209 |
| 538 | 3300005616 | Ga0068852_100016405 | Ga0068852_1000164054 | 209 |
| 539 | 3300005616 | Ga0068852_100394316 | Ga0068852_1003943162 | 209 |
| 540 | 3300005616 | Ga0068852_100445770 | Ga0068852_1004457702 | 209 |
| 541 | 3300005616 | Ga0068852_101014365 | Ga0068852_1010143651 | 209 |
| 542 | 3300005616 | Ga0068852_101449423 | Ga0068852_1014494231 | 209 |
| 543 | 3300005617 | Ga0068859_100462365 | Ga0068859_1004623652 | 209 |
| 544 | 3300005617 | Ga0068859_100772897 | Ga0068859_1007728972 | 209 |
| 545 | 3300005618 | Ga0068864_100473808 | Ga0068864_1004738083 | 209 |
| 546 | 3300005719 | Ga0068861_100002547 | Ga0068861_1000025472 | 209 |
| 547 | 3300005719 | Ga0068861_100025992 | Ga0068861_1000259923 | 209 |
| 548 | 3300005719 | Ga0068861_100051216 | Ga0068861_1000512167 | 209 |
| 549 | 3300005834 | Ga0068851_10272805 | Ga0068851_102728051 | 209 |
| 550 | 3300005841 | Ga0068863_100085916 | Ga0068863_1000859163 | 209 |
| 551 | 3300005841 | Ga0068863_100348030 | Ga0068863_1003480302 | 209 |
| 552 | 3300005842 | Ga0068858_100088380 | Ga0068858_1000883802 | 209 |
| 553 | 3300005842 | Ga0068858_100344058 | Ga0068858_1003440581 | 209 |
| 554 | 3300005843 | Ga0068860_100000515 | Ga0068860_10000051514 | 209 |
| 555 | 3300005843 | Ga0068860_100734056 | Ga0068860_1007340562 | 209 |
| 556 | 3300005844 | Ga0068862_100017703 | Ga0068862_1000177035 | 209 |
| 557 | 3300005844 | Ga0068862_100023047 | Ga0068862_1000230473 | 209 |
| 558 | 3300005937 | Ga0081455_10000370 | Ga0081455_1000037035 | 209 |
| 559 | 3300005937 | Ga0081455_10048684 | Ga0081455_100486842 | 209 |
| 560 | 3300005937 | Ga0081455_10062637 | Ga0081455_100626372 | 209 |
| 561 | 3300005937 | Ga0081455_10129143 | Ga0081455_101291432 | 209 |
| 562 | 3300005981 | Ga0081538_10058894 | Ga0081538_100588942 | 209 |
| 563 | 3300005981 | Ga0081538_10096174 | Ga0081538_100961742 | 209 |
| 564 | 3300005981 | Ga0081538_10211686 | Ga0081538_102116862 | 209 |
| 565 | 3300005983 | Ga0081540_1003913 | Ga0081540_10039134 | 209 |
| 566 | 3300005983 | Ga0081540_1016777 | Ga0081540_10167776 | 209 |
| 567 | 3300005983 | Ga0081540_1020037 | Ga0081540_10200372 | 209 |
| 568 | 3300005983 | Ga0081540_1034549 | Ga0081540_10345493 | 209 |
| 569 | 3300005983 | Ga0081540_1112218 | Ga0081540_11122181 | 209 |
| 570 | 3300005985 | Ga0081539_10001490 | Ga0081539_1000149030 | 209 |
| 571 | 3300005985 | Ga0081539_10049141 | Ga0081539_100491413 | 209 |
| 572 | 3300005985 | Ga0081539_10141583 | Ga0081539_101415831 | 209 |
| 573 | 3300006028 | Ga0070717_10004346 | Ga0070717_100043464 | 209 |
| 574 | 3300006028 | Ga0070717_10058852 | Ga0070717_100588523 | 209 |
| 575 | 3300006028 | Ga0070717_10069419 | Ga0070717_100694192 | 209 |
| 576 | 3300006038 | Ga0075365_10074563 | Ga0075365_100745632 | 209 |
| 577 | 3300006038 | Ga0075365_10103729 | Ga0075365_101037292 | 209 |
| 578 | 3300006038 | Ga0075365_10190548 | Ga0075365_101905481 | 209 |
| 579 | 3300006038 | Ga0075365_10275615 | Ga0075365_102756152 | 209 |
| 580 | 3300006038 | Ga0075365_10300052 | Ga0075365_103000522 | 209 |
| 581 | 3300006042 | Ga0075368_10000871 | Ga0075368_100008717 | 209 |
| 582 | 3300006042 | Ga0075368_10010300 | Ga0075368_100103002 | 209 |
| 583 | 3300006048 | Ga0075363_100001442 | Ga0075363_10000144210 | 209 |
| 584 | 3300006048 | Ga0075363_100226462 | Ga0075363_1002264622 | 209 |
| 585 | 3300006051 | Ga0075364_10045122 | Ga0075364_100451222 | 209 |
| 586 | 3300006051 | Ga0075364_10074105 | Ga0075364_100741052 | 209 |
| 587 | 3300006051 | Ga0075364_10236471 | Ga0075364_102364712 | 209 |
| 588 | 3300006163 | Ga0070715_10000170 | Ga0070715_100001706 | 209 |
| 589 | 3300006163 | Ga0070715_10073621 | Ga0070715_100736212 | 209 |
| 590 | 3300006173 | Ga0070716_100004867 | Ga0070716_1000048675 | 209 |
| 591 | 3300006173 | Ga0070716_100030369 | Ga0070716_1000303693 | 209 |
| 592 | 3300006173 | Ga0070716_100220603 | Ga0070716_1002206032 | 209 |
| 593 | 3300006173 | Ga0070716_100236410 | Ga0070716_1002364101 | 209 |
| 594 | 3300006173 | Ga0070716_100617204 | Ga0070716_1006172041 | 209 |
| 595 | 3300006175 | Ga0070712_100005583 | Ga0070712_1000055837 | 209 |
| 596 | 3300006175 | Ga0070712_100033573 | Ga0070712_1000335733 | 209 |
| 597 | 3300006175 | Ga0070712_100092117 | Ga0070712_1000921173 | 209 |
| 598 | 3300006175 | Ga0070712_100265388 | Ga0070712_1002653883 | 209 |
| 599 | 3300006175 | Ga0070712_100802617 | Ga0070712_1008026171 | 209 |
| 600 | 3300006177 | Ga0075362_10009303 | Ga0075362_100093033 | 209 |
| 601 | 3300006177 | Ga0075362_10036856 | Ga0075362_100368562 | 209 |
| 602 | 3300006178 | Ga0075367_10010911 | Ga0075367_100109114 | 209 |
| 603 | 3300006178 | Ga0075367_10013533 | Ga0075367_100135332 | 209 |
| 604 | 3300006178 | Ga0075367_10017380 | Ga0075367_100173802 | 209 |
| 605 | 3300006178 | Ga0075367_10102262 | Ga0075367_101022623 | 209 |
| 606 | 3300006178 | Ga0075367_10183291 | Ga0075367_101832911 | 209 |
| 607 | 3300006178 | Ga0075367_10195716 | Ga0075367_101957162 | 209 |
| 608 | 3300006178 | Ga0075367_10323223 | Ga0075367_103232231 | 209 |
| 609 | 3300006186 | Ga0075369_10002311 | Ga0075369_100023113 | 209 |
| 610 | 3300006186 | Ga0075369_10005323 | Ga0075369_100053235 | 209 |
| 611 | 3300006186 | Ga0075369_10016536 | Ga0075369_100165362 | 209 |
| 612 | 3300006195 | Ga0075366_10017413 | Ga0075366_100174133 | 209 |
| 613 | 3300006195 | Ga0075366_10068034 | Ga0075366_100680343 | 209 |
| 614 | 3300006195 | Ga0075366_10133996 | Ga0075366_101339962 | 209 |
| 615 | 3300006195 | Ga0075366_10177373 | Ga0075366_101773732 | 209 |
| 616 | 3300006237 | Ga0097621_100145696 | Ga0097621_1001456962 | 209 |
| 617 | 3300006237 | Ga0097621_100267705 | Ga0097621_1002677052 | 209 |
| 618 | 3300006237 | Ga0097621_100319132 | Ga0097621_1003191322 | 209 |
| 619 | 3300006353 | Ga0075370_10044744 | Ga0075370_100447444 | 209 |
| 620 | 3300006353 | Ga0075370_10053029 | Ga0075370_100530294 | 209 |
| 621 | 3300006353 | Ga0075370_10272471 | Ga0075370_102724712 | 209 |
| 622 | 3300006353 | Ga0075370_10312223 | Ga0075370_103122231 | 209 |
| 623 | 3300006358 | Ga0068871_100188522 | Ga0068871_1001885222 | 209 |
| 624 | 3300006358 | Ga0068871_100819448 | Ga0068871_1008194482 | 209 |
| 625 | 3300006844 | Ga0075428_100020774 | Ga0075428_1000207747 | 209 |
| 626 | 3300006844 | Ga0075428_100375906 | Ga0075428_1003759062 | 209 |
| 627 | 3300006844 | Ga0075428_101332140 | Ga0075428_1013321401 | 209 |
| 628 | 3300006846 | Ga0075430_100011908 | Ga0075430_10001190812 | 209 |
| 629 | 3300006846 | Ga0075430_100175942 | Ga0075430_1001759422 | 209 |
| 630 | 3300006846 | Ga0075430_100331958 | Ga0075430_1003319581 | 209 |
| 631 | 3300006846 | Ga0075430_100346996 | Ga0075430_1003469961 | 209 |
| 632 | 3300006847 | Ga0075431_100017460 | Ga0075431_1000174604 | 209 |
| 633 | 3300006847 | Ga0075431_100021552 | Ga0075431_1000215522 | 209 |
| 634 | 3300006847 | Ga0075431_100161326 | Ga0075431_1001613263 | 209 |
| 635 | 3300006847 | Ga0075431_100212946 | Ga0075431_1002129462 | 209 |
| 636 | 3300006847 | Ga0075431_100433888 | Ga0075431_1004338881 | 209 |
| 637 | 3300006871 | Ga0075434_100091249 | Ga0075434_1000912492 | 209 |
| 638 | 3300006880 | Ga0075429_100194579 | Ga0075429_1001945792 | 209 |
| 639 | 3300006880 | Ga0075429_100203900 | Ga0075429_1002039002 | 209 |
| 640 | 3300006880 | Ga0075429_100268878 | Ga0075429_1002688782 | 209 |
| 641 | 3300006881 | Ga0068865_100003574 | Ga0068865_1000035743 | 209 |
| 642 | 3300006881 | Ga0068865_100460845 | Ga0068865_1004608452 | 209 |
| 643 | 3300006931 | Ga0097620_100462413 | Ga0097620_1004624132 | 209 |
| 644 | 3300006931 | Ga0097620_100772883 | Ga0097620_1007728832 | 209 |
| 645 | 3300007076 | Ga0075435_100040343 | Ga0075435_1000403432 | 209 |
| 646 | 3300007265 | Ga0099794_10005140 | Ga0099794_100051406 | 209 |
| 647 | 3300007265 | Ga0099794_10013549 | Ga0099794_100135492 | 209 |
| 648 | 3300007788 | Ga0099795_10019288 | Ga0099795_100192881 | 209 |
| 649 | 3300007788 | Ga0099795_10020673 | Ga0099795_100206732 | 209 |
| 650 | 3300009011 | Ga0105251_10032456 | Ga0105251_100324563 | 209 |
| 651 | 3300009011 | Ga0105251_10202657 | Ga0105251_102026572 | 209 |
| 652 | 3300009011 | Ga0105251_10257219 | Ga0105251_102572191 | 209 |
| 653 | 3300009036 | Ga0105244_10023579 | Ga0105244_100235793 | 209 |
| 654 | 3300009036 | Ga0105244_10154257 | Ga0105244_101542571 | 209 |
| 655 | 3300009092 | Ga0105250_10021450 | Ga0105250_100214502 | 209 |
| 656 | 3300009092 | Ga0105250_10023301 | Ga0105250_100233013 | 209 |
| 657 | 3300009092 | Ga0105250_10051228 | Ga0105250_100512283 | 209 |
| 658 | 3300009093 | Ga0105240_10002493 | Ga0105240_100024934 | 209 |
| 659 | 3300009093 | Ga0105240_10012470 | Ga0105240_100124709 | 209 |
| 660 | 3300009093 | Ga0105240_10172639 | Ga0105240_101726392 | 209 |
| 661 | 3300009093 | Ga0105240_10650698 | Ga0105240_106506981 | 209 |
| 662 | 3300009094 | Ga0111539_10029807 | Ga0111539_100298071 | 209 |
| 663 | 3300009094 | Ga0111539_10427369 | Ga0111539_104273692 | 209 |
| 664 | 3300009094 | Ga0111539_10568771 | Ga0111539_105687712 | 209 |
| 665 | 3300009094 | Ga0111539_10909798 | Ga0111539_109097982 | 209 |
| 666 | 3300009094 | Ga0111539_11077385 | Ga0111539_110773851 | 209 |
| 667 | 3300009094 | Ga0111539_11642481 | Ga0111539_116424811 | 209 |
| 668 | 3300009098 | Ga0105245_10008917 | Ga0105245_100089173 | 209 |
| 669 | 3300009098 | Ga0105245_10416032 | Ga0105245_104160322 | 209 |
| 670 | 3300009098 | Ga0105245_10611773 | Ga0105245_106117732 | 209 |
| 671 | 3300009101 | Ga0105247_10004796 | Ga0105247_1000479610 | 209 |
| 672 | 3300009101 | Ga0105247_10012294 | Ga0105247_100122942 | 209 |
| 673 | 3300009101 | Ga0105247_10013310 | Ga0105247_100133104 | 209 |
| 674 | 3300009147 | Ga0114129_10068576 | Ga0114129_100685763 | 209 |
| 675 | 3300009147 | Ga0114129_10103640 | Ga0114129_101036402 | 209 |
| 676 | 3300009147 | Ga0114129_10106492 | Ga0114129_101064924 | 209 |
| 677 | 3300009147 | Ga0114129_10200287 | Ga0114129_102002873 | 209 |
| 678 | 3300009147 | Ga0114129_10336120 | Ga0114129_103361203 | 209 |
| 679 | 3300009148 | Ga0105243_10000209 | Ga0105243_1000020920 | 209 |
| 680 | 3300009148 | Ga0105243_10061519 | Ga0105243_100615192 | 209 |
| 681 | 3300009148 | Ga0105243_10400522 | Ga0105243_104005222 | 209 |
| 682 | 3300009148 | Ga0105243_10874030 | Ga0105243_108740302 | 209 |
| 683 | 3300009174 | Ga0105241_10421269 | Ga0105241_104212692 | 209 |
| 684 | 3300009174 | Ga0105241_10866776 | Ga0105241_108667762 | 209 |
| 685 | 3300009176 | Ga0105242_10002692 | Ga0105242_1000269212 | 209 |
| 686 | 3300009176 | Ga0105242_10101075 | Ga0105242_101010752 | 209 |
| 687 | 3300009176 | Ga0105242_10364233 | Ga0105242_103642332 | 209 |
| 688 | 3300009176 | Ga0105242_10929947 | Ga0105242_109299472 | 209 |
| 689 | 3300009177 | Ga0105248_10371195 | Ga0105248_103711952 | 209 |
| 690 | 3300009177 | Ga0105248_10408807 | Ga0105248_104088073 | 209 |
| 691 | 3300009545 | Ga0105237_10003531 | Ga0105237_1000353112 | 209 |
| 692 | 3300009545 | Ga0105237_10024701 | Ga0105237_100247018 | 209 |
| 693 | 3300009545 | Ga0105237_10425600 | Ga0105237_104256002 | 209 |
| 694 | 3300009545 | Ga0105237_10493410 | Ga0105237_104934102 | 209 |
| 695 | 3300009545 | Ga0105237_10522458 | Ga0105237_105224582 | 209 |
| 696 | 3300009551 | Ga0105238_10203143 | Ga0105238_102031432 | 209 |
| 697 | 3300009551 | Ga0105238_10257014 | Ga0105238_102570142 | 209 |
| 698 | 3300009551 | Ga0105238_10281676 | Ga0105238_102816762 | 209 |
| 699 | 3300009551 | Ga0105238_10927943 | Ga0105238_109279431 | 209 |
| 700 | 3300009553 | Ga0105249_10009715 | Ga0105249_100097153 | 209 |
| 701 | 3300009553 | Ga0105249_10338592 | Ga0105249_103385922 | 209 |
| 702 | 3300009553 | Ga0105249_10620881 | Ga0105249_106208812 | 209 |
| 703 | 3300009553 | Ga0105249_10633503 | Ga0105249_106335031 | 209 |
| 704 | 3300009553 | Ga0105249_10770857 | Ga0105249_107708572 | 209 |
| 705 | 3300009993 | Ga0105028_106674 | Ga0105028_1066741 | 209 |
| 706 | 3300010375 | Ga0105239_10019175 | Ga0105239_100191757 | 209 |
| 707 | 3300010375 | Ga0105239_10072092 | Ga0105239_100720925 | 209 |
| 708 | 3300010375 | Ga0105239_10084759 | Ga0105239_100847594 | 209 |
| 709 | 3300010375 | Ga0105239_10116418 | Ga0105239_101164183 | 209 |
| 710 | 3300010375 | Ga0105239_10144007 | Ga0105239_101440073 | 209 |
| 711 | 3300010375 | Ga0105239_10435836 | Ga0105239_104358362 | 209 |
| 712 | 3300010375 | Ga0105239_10540923 | Ga0105239_105409232 | 209 |
| 713 | 3300011119 | Ga0105246_10003085 | Ga0105246_1000308510 | 209 |
| 714 | 3300011119 | Ga0105246_10039338 | Ga0105246_100393388 | 209 |
| 715 | 3300011119 | Ga0105246_10205094 | Ga0105246_102050942 | 209 |
| 716 | 3300011119 | Ga0105246_10401504 | Ga0105246_104015041 | 209 |
| 717 | 3300011119 | Ga0105246_10410100 | Ga0105246_104101002 | 209 |
| 718 | 3300011119 | Ga0105246_10446953 | Ga0105246_104469532 | 209 |
| 719 | 3300011119 | Ga0105246_10510512 | Ga0105246_105105121 | 209 |
| 720 | 3300013100 | Ga0157373_10106549 | Ga0157373_101065491 | 209 |
| 721 | 3300013102 | Ga0157371_10368724 | Ga0157371_103687241 | 209 |
| 722 | 3300013104 | Ga0157370_10115568 | Ga0157370_101155682 | 209 |
| 723 | 3300013104 | Ga0157370_10264351 | Ga0157370_102643512 | 209 |
| 724 | 3300013104 | Ga0157370_10633477 | Ga0157370_106334771 | 209 |
| 725 | 3300013105 | Ga0157369_10039088 | Ga0157369_100390884 | 209 |
| 726 | 3300013105 | Ga0157369_10133361 | Ga0157369_101333612 | 209 |
| 727 | 3300013296 | Ga0157374_10052132 | Ga0157374_100521322 | 209 |
| 728 | 3300013296 | Ga0157374_10113755 | Ga0157374_101137553 | 209 |
| 729 | 3300013296 | Ga0157374_10996330 | Ga0157374_109963301 | 209 |
| 730 | 3300013297 | Ga0157378_10029475 | Ga0157378_100294753 | 209 |
| 731 | 3300013297 | Ga0157378_10196836 | Ga0157378_101968362 | 209 |
| 732 | 3300013297 | Ga0157378_10504365 | Ga0157378_105043652 | 209 |
| 733 | 3300013306 | Ga0163162_10000043 | Ga0163162_10000043105 | 209 |
| 734 | 3300013306 | Ga0163162_10008437 | Ga0163162_100084379 | 209 |
| 735 | 3300013306 | Ga0163162_10235517 | Ga0163162_102355172 | 209 |
| 736 | 3300013306 | Ga0163162_10584023 | Ga0163162_105840232 | 209 |
| 737 | 3300013307 | Ga0157372_10135433 | Ga0157372_101354332 | 209 |
| 738 | 3300013308 | Ga0157375_10042199 | Ga0157375_100421993 | 209 |
| 739 | 3300013308 | Ga0157375_10286068 | Ga0157375_102860682 | 209 |
| 740 | 3300013308 | Ga0157375_10553907 | Ga0157375_105539072 | 209 |
| 741 | 3300013308 | Ga0157375_10855511 | Ga0157375_108555112 | 209 |
| 742 | 3300013308 | Ga0157375_11177937 | Ga0157375_111779371 | 209 |
| 743 | 3300014325 | Ga0163163_10011142 | Ga0163163_100111422 | 209 |
| 744 | 3300014325 | Ga0163163_10580092 | Ga0163163_105800921 | 209 |
| 745 | 3300014325 | Ga0163163_11397875 | Ga0163163_113978752 | 209 |
| 746 | 3300014325 | Ga0163163_11582014 | Ga0163163_115820141 | 209 |
| 747 | 3300014326 | Ga0157380_10053098 | Ga0157380_100530981 | 209 |
| 748 | 3300014326 | Ga0157380_10073359 | Ga0157380_100733592 | 209 |
| 749 | 3300014326 | Ga0157380_10133600 | Ga0157380_101336001 | 209 |
| 750 | 3300014326 | Ga0157380_10709545 | Ga0157380_107095452 | 209 |
| 751 | 3300014497 | Ga0182008_10054106 | Ga0182008_100541062 | 209 |
| 752 | 3300014497 | Ga0182008_10148475 | Ga0182008_101484752 | 209 |
| 753 | 3300014745 | Ga0157377_10000894 | Ga0157377_1000089415 | 209 |
| 754 | 3300014968 | Ga0157379_10084010 | Ga0157379_100840102 | 209 |
| 755 | 3300014968 | Ga0157379_10171616 | Ga0157379_101716162 | 209 |
| 756 | 3300014968 | Ga0157379_10232953 | Ga0157379_102329532 | 209 |
| 757 | 3300014968 | Ga0157379_10296007 | Ga0157379_102960071 | 209 |
| 758 | 3300014968 | Ga0157379_10408745 | Ga0157379_104087452 | 209 |
| 759 | 3300014969 | Ga0157376_10087414 | Ga0157376_100874143 | 209 |
| 760 | 3300014969 | Ga0157376_10105885 | Ga0157376_101058852 | 209 |
| 761 | 3300014969 | Ga0157376_10134516 | Ga0157376_101345163 | 209 |
| 762 | 3300014969 | Ga0157376_10569702 | Ga0157376_105697022 | 209 |
| 763 | 3300015261 | Ga0182006_1095809 | Ga0182006_10958091 | 209 |
| 764 | 3300015265 | Ga0182005_1073410 | Ga0182005_10734101 | 209 |
| 765 | 3300017792 | Ga0163161_10311656 | Ga0163161_103116562 | 209 |
| 766 | 3300017792 | Ga0163161_10817341 | Ga0163161_108173412 | 209 |
| 767 | 3300020081 | Ga0206354_11440000 | Ga0206354_114400009 | 209 |
| 768 | 3300020082 | Ga0206353_10040355 | Ga0206353_100403553 | 209 |
| 769 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001151 | 209 |
| 770 | 3300021321 | Ga0214542_1000005 | Ga0214542_1000005151 | 209 |
| 771 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003613 | 209 |
| 772 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002152 | 209 |
| 773 | 3300021327 | Ga0214543_1022088 | Ga0214543_10220883 | 209 |
| 774 | 3300021358 | Ga0213873_10000006 | Ga0213873_10000006168 | 209 |
| 775 | 3300021384 | Ga0213876_10000004 | Ga0213876_10000004674 | 209 |
| 776 | 3300021384 | Ga0213876_10004040 | Ga0213876_100040404 | 209 |
| 777 | 3300021388 | Ga0213875_10040547 | Ga0213875_100405472 | 209 |
| 778 | 3300021388 | Ga0213875_10085645 | Ga0213875_100856452 | 209 |
| 779 | 3300021441 | Ga0213871_10000281 | Ga0213871_100002813 | 209 |
| 780 | 3300025224 | Ga0209784_100051 | Ga0209784_10005157 | 209 |
| 781 | 3300025225 | Ga0209566_100112 | Ga0209566_10011248 | 209 |
| 782 | 3300025225 | Ga0209566_100158 | Ga0209566_10015833 | 209 |
| 783 | 3300025225 | Ga0209566_103510 | Ga0209566_1035103 | 209 |
| 784 | 3300025229 | Ga0209147_100062 | Ga0209147_100062160 | 209 |
| 785 | 3300025229 | Ga0209147_100101 | Ga0209147_100101151 | 209 |
| 786 | 3300025229 | Ga0209147_100559 | Ga0209147_10055921 | 209 |
| 787 | 3300025229 | Ga0209147_101819 | Ga0209147_1018199 | 209 |
| 788 | 3300025230 | Ga0209563_101258 | Ga0209563_1012587 | 209 |
| 789 | 3300025242 | Ga0209258_101869 | Ga0209258_1018692 | 209 |
| 790 | 3300025253 | Ga0209677_101553 | Ga0209677_1015537 | 209 |
| 791 | 3300025254 | Ga0209148_1000849 | Ga0209148_10008495 | 209 |
| 792 | 3300025261 | Ga0209233_1004289 | Ga0209233_10042891 | 209 |
| 793 | 3300025261 | Ga0209233_1024415 | Ga0209233_10244152 | 209 |
| 794 | 3300025261 | Ga0209233_1037347 | Ga0209233_10373471 | 209 |
| 795 | 3300025261 | Ga0209233_1042303 | Ga0209233_10423031 | 209 |
| 796 | 3300025263 | Ga0209565_1000195 | Ga0209565_100019522 | 209 |
| 797 | 3300025272 | Ga0209455_1001077 | Ga0209455_100107715 | 209 |
| 798 | 3300025273 | Ga0209673_1001368 | Ga0209673_100136813 | 209 |
| 799 | 3300025273 | Ga0209673_1002410 | Ga0209673_10024109 | 209 |
| 800 | 3300025273 | Ga0209673_1033439 | Ga0209673_10334392 | 209 |
| 801 | 3300025284 | Ga0209130_1006510 | Ga0209130_10065102 | 209 |
| 802 | 3300025284 | Ga0209130_1011599 | Ga0209130_10115993 | 209 |
| 803 | 3300025291 | Ga0209675_1006600 | Ga0209675_10066004 | 209 |
| 804 | 3300025291 | Ga0209675_1023680 | Ga0209675_10236802 | 209 |
| 805 | 3300025291 | Ga0209675_1035722 | Ga0209675_10357222 | 209 |
| 806 | 3300025291 | Ga0209675_1053419 | Ga0209675_10534191 | 209 |
| 807 | 3300025292 | Ga0209676_1000082 | Ga0209676_1000082143 | 209 |
| 808 | 3300025292 | Ga0209676_1000224 | Ga0209676_100022444 | 209 |
| 809 | 3300025292 | Ga0209676_1000374 | Ga0209676_100037472 | 209 |
| 810 | 3300025292 | Ga0209676_1003709 | Ga0209676_10037096 | 209 |
| 811 | 3300025292 | Ga0209676_1007483 | Ga0209676_10074832 | 209 |
| 812 | 3300025292 | Ga0209676_1008567 | Ga0209676_10085673 | 209 |
| 813 | 3300025292 | Ga0209676_1010333 | Ga0209676_10103332 | 209 |
| 814 | 3300025292 | Ga0209676_1014012 | Ga0209676_10140122 | 209 |
| 815 | 3300025292 | Ga0209676_1037468 | Ga0209676_10374682 | 209 |
| 816 | 3300025292 | Ga0209676_1054824 | Ga0209676_10548242 | 209 |
| 817 | 3300025294 | Ga0209025_1001531 | Ga0209025_100153112 | 209 |
| 818 | 3300025294 | Ga0209025_1003426 | Ga0209025_100342610 | 209 |
| 819 | 3300025294 | Ga0209025_1003576 | Ga0209025_100357617 | 209 |
| 820 | 3300025294 | Ga0209025_1004018 | Ga0209025_10040185 | 209 |
| 821 | 3300025294 | Ga0209025_1004765 | Ga0209025_100476510 | 209 |
| 822 | 3300025294 | Ga0209025_1004804 | Ga0209025_10048045 | 209 |
| 823 | 3300025294 | Ga0209025_1006577 | Ga0209025_10065776 | 209 |
| 824 | 3300025294 | Ga0209025_1007420 | Ga0209025_10074202 | 209 |
| 825 | 3300025294 | Ga0209025_1008453 | Ga0209025_10084534 | 209 |
| 826 | 3300025294 | Ga0209025_1010494 | Ga0209025_10104944 | 209 |
| 827 | 3300025294 | Ga0209025_1014192 | Ga0209025_10141921 | 209 |
| 828 | 3300025294 | Ga0209025_1027219 | Ga0209025_10272192 | 209 |
| 829 | 3300025295 | Ga0209564_1001613 | Ga0209564_100161324 | 209 |
| 830 | 3300025295 | Ga0209564_1014164 | Ga0209564_10141643 | 209 |
| 831 | 3300025295 | Ga0209564_1022771 | Ga0209564_10227713 | 209 |
| 832 | 3300025295 | Ga0209564_1040023 | Ga0209564_10400232 | 209 |
| 833 | 3300025297 | Ga0209758_1000026 | Ga0209758_1000026179 | 209 |
| 834 | 3300025297 | Ga0209758_1000526 | Ga0209758_100052619 | 209 |
| 835 | 3300025297 | Ga0209758_1001753 | Ga0209758_100175325 | 209 |
| 836 | 3300025297 | Ga0209758_1002770 | Ga0209758_100277016 | 209 |
| 837 | 3300025297 | Ga0209758_1004348 | Ga0209758_10043488 | 209 |
| 838 | 3300025297 | Ga0209758_1009300 | Ga0209758_10093005 | 209 |
| 839 | 3300025297 | Ga0209758_1015309 | Ga0209758_10153092 | 209 |
| 840 | 3300025297 | Ga0209758_1025500 | Ga0209758_10255002 | 209 |
| 841 | 3300025298 | Ga0209050_1000443 | Ga0209050_100044311 | 209 |
| 842 | 3300025298 | Ga0209050_1000735 | Ga0209050_100073544 | 209 |
| 843 | 3300025298 | Ga0209050_1012972 | Ga0209050_10129724 | 209 |
| 844 | 3300025299 | Ga0209256_1000535 | Ga0209256_100053525 | 209 |
| 845 | 3300025299 | Ga0209256_1022305 | Ga0209256_10223052 | 209 |
| 846 | 3300025302 | Ga0207426_1000213 | Ga0207426_100021392 | 209 |
| 847 | 3300025302 | Ga0207426_1001534 | Ga0207426_10015347 | 209 |
| 848 | 3300025302 | Ga0207426_1024890 | Ga0207426_10248902 | 209 |
| 849 | 3300025303 | Ga0209051_1002443 | Ga0209051_100244313 | 209 |
| 850 | 3300025303 | Ga0209051_1057187 | Ga0209051_10571873 | 209 |
| 851 | 3300025304 | Ga0209257_1000218 | Ga0209257_100021832 | 209 |
| 852 | 3300025304 | Ga0209257_1000626 | Ga0209257_100062644 | 209 |
| 853 | 3300025304 | Ga0209257_1000930 | Ga0209257_100093029 | 209 |
| 854 | 3300025304 | Ga0209257_1001466 | Ga0209257_100146623 | 209 |
| 855 | 3300025304 | Ga0209257_1001794 | Ga0209257_100179418 | 209 |
| 856 | 3300025304 | Ga0209257_1014478 | Ga0209257_10144781 | 209 |
| 857 | 3300025315 | Ga0207697_10096231 | Ga0207697_100962312 | 209 |
| 858 | 3300025711 | Ga0207696_1001433 | Ga0207696_100143316 | 209 |
| 859 | 3300025711 | Ga0207696_1003350 | Ga0207696_10033506 | 209 |
| 860 | 3300025711 | Ga0207696_1004678 | Ga0207696_10046784 | 209 |
| 861 | 3300025728 | Ga0207655_1004092 | Ga0207655_10040928 | 209 |
| 862 | 3300025728 | Ga0207655_1009156 | Ga0207655_10091569 | 209 |
| 863 | 3300025728 | Ga0207655_1016667 | Ga0207655_10166672 | 209 |
| 864 | 3300025735 | Ga0207713_1004512 | Ga0207713_10045123 | 209 |
| 865 | 3300025893 | Ga0207682_10026497 | Ga0207682_100264973 | 209 |
| 866 | 3300025898 | Ga0207692_10001394 | Ga0207692_100013947 | 209 |
| 867 | 3300025898 | Ga0207692_10003157 | Ga0207692_100031573 | 209 |
| 868 | 3300025899 | Ga0207642_10414076 | Ga0207642_104140761 | 209 |
| 869 | 3300025900 | Ga0207710_10015614 | Ga0207710_100156143 | 209 |
| 870 | 3300025900 | Ga0207710_10039499 | Ga0207710_100394993 | 209 |
| 871 | 3300025900 | Ga0207710_10045167 | Ga0207710_100451672 | 209 |
| 872 | 3300025900 | Ga0207710_10136919 | Ga0207710_101369192 | 209 |
| 873 | 3300025901 | Ga0207688_10068259 | Ga0207688_100682592 | 209 |
| 874 | 3300025901 | Ga0207688_10279814 | Ga0207688_102798141 | 209 |
| 875 | 3300025903 | Ga0207680_10029511 | Ga0207680_100295111 | 209 |
| 876 | 3300025903 | Ga0207680_10431147 | Ga0207680_104311471 | 209 |
| 877 | 3300025904 | Ga0207647_10004089 | Ga0207647_100040897 | 209 |
| 878 | 3300025905 | Ga0207685_10092331 | Ga0207685_100923311 | 209 |
| 879 | 3300025906 | Ga0207699_10004142 | Ga0207699_1000414210 | 209 |
| 880 | 3300025906 | Ga0207699_10019092 | Ga0207699_100190924 | 209 |
| 881 | 3300025906 | Ga0207699_10127335 | Ga0207699_101273351 | 209 |
| 882 | 3300025906 | Ga0207699_10182270 | Ga0207699_101822701 | 209 |
| 883 | 3300025907 | Ga0207645_10063123 | Ga0207645_100631234 | 209 |
| 884 | 3300025907 | Ga0207645_10129767 | Ga0207645_101297672 | 209 |
| 885 | 3300025907 | Ga0207645_10490662 | Ga0207645_104906621 | 209 |
| 886 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002805 | 209 |
| 887 | 3300025909 | Ga0207705_10139390 | Ga0207705_101393902 | 209 |
| 888 | 3300025909 | Ga0207705_10498140 | Ga0207705_104981402 | 209 |
| 889 | 3300025910 | Ga0207684_10001378 | Ga0207684_100013782 | 209 |
| 890 | 3300025910 | Ga0207684_10135158 | Ga0207684_101351582 | 209 |
| 891 | 3300025910 | Ga0207684_10492048 | Ga0207684_104920481 | 209 |
| 892 | 3300025910 | Ga0207684_10847789 | Ga0207684_108477891 | 209 |
| 893 | 3300025911 | Ga0207654_10013939 | Ga0207654_100139392 | 209 |
| 894 | 3300025911 | Ga0207654_10287127 | Ga0207654_102871272 | 209 |
| 895 | 3300025912 | Ga0207707_10022121 | Ga0207707_100221212 | 209 |
| 896 | 3300025912 | Ga0207707_10182199 | Ga0207707_101821991 | 209 |
| 897 | 3300025912 | Ga0207707_10287734 | Ga0207707_102877342 | 209 |
| 898 | 3300025913 | Ga0207695_10000006 | Ga0207695_100000061014 | 209 |
| 899 | 3300025913 | Ga0207695_10026360 | Ga0207695_100263608 | 209 |
| 900 | 3300025913 | Ga0207695_10081179 | Ga0207695_100811792 | 209 |
| 901 | 3300025913 | Ga0207695_10135160 | Ga0207695_101351604 | 209 |
| 902 | 3300025913 | Ga0207695_10149781 | Ga0207695_101497812 | 209 |
| 903 | 3300025913 | Ga0207695_10284512 | Ga0207695_102845122 | 209 |
| 904 | 3300025913 | Ga0207695_10451293 | Ga0207695_104512932 | 209 |
| 905 | 3300025914 | Ga0207671_10000774 | Ga0207671_1000077433 | 209 |
| 906 | 3300025914 | Ga0207671_10064265 | Ga0207671_100642652 | 209 |
| 907 | 3300025914 | Ga0207671_10104187 | Ga0207671_101041871 | 209 |
| 908 | 3300025915 | Ga0207693_10000095 | Ga0207693_1000009529 | 209 |
| 909 | 3300025915 | Ga0207693_10004244 | Ga0207693_100042444 | 209 |
| 910 | 3300025915 | Ga0207693_10023789 | Ga0207693_100237891 | 209 |
| 911 | 3300025915 | Ga0207693_10061212 | Ga0207693_100612124 | 209 |
| 912 | 3300025915 | Ga0207693_10093094 | Ga0207693_100930943 | 209 |
| 913 | 3300025915 | Ga0207693_10254467 | Ga0207693_102544672 | 209 |
| 914 | 3300025915 | Ga0207693_10495713 | Ga0207693_104957131 | 209 |
| 915 | 3300025916 | Ga0207663_10005035 | Ga0207663_100050354 | 209 |
| 916 | 3300025916 | Ga0207663_10005324 | Ga0207663_100053247 | 209 |
| 917 | 3300025916 | Ga0207663_10010748 | Ga0207663_100107483 | 209 |
| 918 | 3300025917 | Ga0207660_10005232 | Ga0207660_100052327 | 209 |
| 919 | 3300025917 | Ga0207660_10107656 | Ga0207660_101076562 | 209 |
| 920 | 3300025918 | Ga0207662_10143330 | Ga0207662_101433302 | 209 |
| 921 | 3300025919 | Ga0207657_10013159 | Ga0207657_100131596 | 209 |
| 922 | 3300025919 | Ga0207657_10087753 | Ga0207657_100877534 | 209 |
| 923 | 3300025919 | Ga0207657_10325964 | Ga0207657_103259642 | 209 |
| 924 | 3300025920 | Ga0207649_10026891 | Ga0207649_100268913 | 209 |
| 925 | 3300025920 | Ga0207649_10433260 | Ga0207649_104332601 | 209 |
| 926 | 3300025920 | Ga0207649_10711568 | Ga0207649_107115681 | 209 |
| 927 | 3300025922 | Ga0207646_10002702 | Ga0207646_1000270211 | 209 |
| 928 | 3300025922 | Ga0207646_10003436 | Ga0207646_1000343616 | 209 |
| 929 | 3300025922 | Ga0207646_10592602 | Ga0207646_105926022 | 209 |
| 930 | 3300025922 | Ga0207646_10994197 | Ga0207646_109941971 | 209 |
| 931 | 3300025923 | Ga0207681_10007974 | Ga0207681_100079742 | 209 |
| 932 | 3300025923 | Ga0207681_10077129 | Ga0207681_100771293 | 209 |
| 933 | 3300025923 | Ga0207681_10082921 | Ga0207681_100829212 | 209 |
| 934 | 3300025923 | Ga0207681_10329699 | Ga0207681_103296992 | 209 |
| 935 | 3300025923 | Ga0207681_10847262 | Ga0207681_108472621 | 209 |
| 936 | 3300025924 | Ga0207694_10040691 | Ga0207694_100406917 | 209 |
| 937 | 3300025924 | Ga0207694_10309862 | Ga0207694_103098622 | 209 |
| 938 | 3300025924 | Ga0207694_10314326 | Ga0207694_103143262 | 209 |
| 939 | 3300025925 | Ga0207650_10446591 | Ga0207650_104465912 | 209 |
| 940 | 3300025926 | Ga0207659_10722854 | Ga0207659_107228541 | 209 |
| 941 | 3300025927 | Ga0207687_10130102 | Ga0207687_101301022 | 209 |
| 942 | 3300025928 | Ga0207700_10113909 | Ga0207700_101139093 | 209 |
| 943 | 3300025928 | Ga0207700_10657636 | Ga0207700_106576361 | 209 |
| 944 | 3300025929 | Ga0207664_10037596 | Ga0207664_100375962 | 209 |
| 945 | 3300025929 | Ga0207664_10260319 | Ga0207664_102603192 | 209 |
| 946 | 3300025929 | Ga0207664_10290736 | Ga0207664_102907362 | 209 |
| 947 | 3300025931 | Ga0207644_10020240 | Ga0207644_100202403 | 209 |
| 948 | 3300025932 | Ga0207690_10002077 | Ga0207690_1000207712 | 209 |
| 949 | 3300025932 | Ga0207690_10125035 | Ga0207690_101250352 | 209 |
| 950 | 3300025932 | Ga0207690_10401242 | Ga0207690_104012421 | 209 |
| 951 | 3300025933 | Ga0207706_10093957 | Ga0207706_100939572 | 209 |
| 952 | 3300025935 | Ga0207709_10026143 | Ga0207709_100261432 | 209 |
| 953 | 3300025935 | Ga0207709_10066606 | Ga0207709_100666062 | 209 |
| 954 | 3300025935 | Ga0207709_10133158 | Ga0207709_101331582 | 209 |
| 955 | 3300025935 | Ga0207709_10525710 | Ga0207709_105257101 | 209 |
| 956 | 3300025936 | Ga0207670_10147234 | Ga0207670_101472342 | 209 |
| 957 | 3300025936 | Ga0207670_10648798 | Ga0207670_106487981 | 209 |
| 958 | 3300025937 | Ga0207669_10249923 | Ga0207669_102499232 | 209 |
| 959 | 3300025938 | Ga0207704_10002133 | Ga0207704_100021338 | 209 |
| 960 | 3300025938 | Ga0207704_10673391 | Ga0207704_106733911 | 209 |
| 961 | 3300025939 | Ga0207665_10003452 | Ga0207665_100034522 | 209 |
| 962 | 3300025939 | Ga0207665_10008093 | Ga0207665_100080932 | 209 |
| 963 | 3300025939 | Ga0207665_10042690 | Ga0207665_100426902 | 209 |
| 964 | 3300025939 | Ga0207665_10169939 | Ga0207665_101699392 | 209 |
| 965 | 3300025939 | Ga0207665_10247773 | Ga0207665_102477732 | 209 |
| 966 | 3300025940 | Ga0207691_10005669 | Ga0207691_100056698 | 209 |
| 967 | 3300025940 | Ga0207691_10098084 | Ga0207691_100980843 | 209 |
| 968 | 3300025940 | Ga0207691_10383787 | Ga0207691_103837871 | 209 |
| 969 | 3300025940 | Ga0207691_10965370 | Ga0207691_109653701 | 209 |
| 970 | 3300025941 | Ga0207711_10038629 | Ga0207711_100386294 | 209 |
| 971 | 3300025941 | Ga0207711_10771177 | Ga0207711_107711772 | 209 |
| 972 | 3300025942 | Ga0207689_10725979 | Ga0207689_107259792 | 209 |
| 973 | 3300025944 | Ga0207661_10049557 | Ga0207661_100495573 | 209 |
| 974 | 3300025944 | Ga0207661_10054953 | Ga0207661_100549532 | 209 |
| 975 | 3300025944 | Ga0207661_10854058 | Ga0207661_108540582 | 209 |
| 976 | 3300025945 | Ga0207679_10274138 | Ga0207679_102741383 | 209 |
| 977 | 3300025945 | Ga0207679_10363818 | Ga0207679_103638182 | 209 |
| 978 | 3300025949 | Ga0207667_10023653 | Ga0207667_100236533 | 209 |
| 979 | 3300025949 | Ga0207667_10107430 | Ga0207667_101074303 | 209 |
| 980 | 3300025949 | Ga0207667_10177169 | Ga0207667_101771692 | 209 |
| 981 | 3300025949 | Ga0207667_10986539 | Ga0207667_109865392 | 209 |
| 982 | 3300025960 | Ga0207651_10524926 | Ga0207651_105249262 | 209 |
| 983 | 3300025961 | Ga0207712_10068208 | Ga0207712_100682082 | 209 |
| 984 | 3300025961 | Ga0207712_10324111 | Ga0207712_103241112 | 209 |
| 985 | 3300025961 | Ga0207712_10426204 | Ga0207712_104262041 | 209 |
| 986 | 3300025972 | Ga0207668_10005444 | Ga0207668_100054444 | 209 |
| 987 | 3300025972 | Ga0207668_10049565 | Ga0207668_100495653 | 209 |
| 988 | 3300025972 | Ga0207668_10112239 | Ga0207668_101122392 | 209 |
| 989 | 3300025972 | Ga0207668_10224535 | Ga0207668_102245352 | 209 |
| 990 | 3300025972 | Ga0207668_10488248 | Ga0207668_104882482 | 209 |
| 991 | 3300025972 | Ga0207668_10631345 | Ga0207668_106313452 | 209 |
| 992 | 3300025981 | Ga0207640_10307593 | Ga0207640_103075931 | 209 |
| 993 | 3300025986 | Ga0207658_10035677 | Ga0207658_100356774 | 209 |
| 994 | 3300025986 | Ga0207658_10826463 | Ga0207658_108264631 | 209 |
| 995 | 3300026023 | Ga0207677_10182474 | Ga0207677_101824742 | 209 |
| 996 | 3300026023 | Ga0207677_10331415 | Ga0207677_103314152 | 209 |
| 997 | 3300026035 | Ga0207703_10050438 | Ga0207703_100504382 | 209 |
| 998 | 3300026035 | Ga0207703_10094542 | Ga0207703_100945422 | 209 |
| 999 | 3300026035 | Ga0207703_10200510 | Ga0207703_102005101 | 209 |
| 1000 | 3300026035 | Ga0207703_10253516 | Ga0207703_102535161 | 209 |
| 1001 | 3300026041 | Ga0207639_10451984 | Ga0207639_104519842 | 209 |
| 1002 | 3300026041 | Ga0207639_10509021 | Ga0207639_105090212 | 209 |
| 1003 | 3300026067 | Ga0207678_10016716 | Ga0207678_100167167 | 209 |
| 1004 | 3300026067 | Ga0207678_10150623 | Ga0207678_101506232 | 209 |
| 1005 | 3300026075 | Ga0207708_10070386 | Ga0207708_100703862 | 209 |
| 1006 | 3300026075 | Ga0207708_10078649 | Ga0207708_100786492 | 209 |
| 1007 | 3300026075 | Ga0207708_10159293 | Ga0207708_101592933 | 209 |
| 1008 | 3300026078 | Ga0207702_10010788 | Ga0207702_100107882 | 209 |
| 1009 | 3300026078 | Ga0207702_10474379 | Ga0207702_104743793 | 209 |
| 1010 | 3300026078 | Ga0207702_10582698 | Ga0207702_105826982 | 209 |
| 1011 | 3300026078 | Ga0207702_10736657 | Ga0207702_107366571 | 209 |
| 1012 | 3300026088 | Ga0207641_10065264 | Ga0207641_100652643 | 209 |
| 1013 | 3300026088 | Ga0207641_10337251 | Ga0207641_103372512 | 209 |
| 1014 | 3300026088 | Ga0207641_10557488 | Ga0207641_105574882 | 209 |
| 1015 | 3300026089 | Ga0207648_10010535 | Ga0207648_100105355 | 209 |
| 1016 | 3300026089 | Ga0207648_10017971 | Ga0207648_100179716 | 209 |
| 1017 | 3300026089 | Ga0207648_10538196 | Ga0207648_105381962 | 209 |
| 1018 | 3300026089 | Ga0207648_10708797 | Ga0207648_107087971 | 209 |
| 1019 | 3300026095 | Ga0207676_10545478 | Ga0207676_105454782 | 209 |
| 1020 | 3300026116 | Ga0207674_10124239 | Ga0207674_101242398 | 209 |
| 1021 | 3300026116 | Ga0207674_10150717 | Ga0207674_101507173 | 209 |
| 1022 | 3300026116 | Ga0207674_10177820 | Ga0207674_101778202 | 209 |
| 1023 | 3300026118 | Ga0207675_100008033 | Ga0207675_1000080331 | 209 |
| 1024 | 3300026118 | Ga0207675_100030133 | Ga0207675_1000301333 | 209 |
| 1025 | 3300026118 | Ga0207675_100050504 | Ga0207675_1000505043 | 209 |
| 1026 | 3300026118 | Ga0207675_100187202 | Ga0207675_1001872024 | 209 |
| 1027 | 3300026121 | Ga0207683_10000755 | Ga0207683_100007552 | 209 |
| 1028 | 3300026121 | Ga0207683_10095342 | Ga0207683_100953422 | 209 |
| 1029 | 3300026121 | Ga0207683_10309790 | Ga0207683_103097904 | 209 |
| 1030 | 3300026142 | Ga0207698_11196600 | Ga0207698_111966001 | 209 |
| 1031 | 3300027296 | Ga0209389_1000057 | Ga0209389_100005774 | 209 |
| 1032 | 3300027296 | Ga0209389_1000083 | Ga0209389_100008344 | 209 |
| 1033 | 3300027357 | Ga0209589_1000097 | Ga0209589_100009744 | 209 |
| 1034 | 3300027361 | Ga0209489_100105 | Ga0209489_10010570 | 209 |
| 1035 | 3300027361 | Ga0209489_100226 | Ga0209489_10022663 | 209 |
| 1036 | 3300027363 | Ga0209700_100085 | Ga0209700_10008591 | 209 |
| 1037 | 3300027512 | Ga0209179_1043892 | Ga0209179_10438921 | 209 |
| 1038 | 3300027671 | Ga0209588_1008313 | Ga0209588_10083133 | 209 |
| 1039 | 3300027671 | Ga0209588_1086926 | Ga0209588_10869262 | 209 |
| 1040 | 3300027866 | Ga0209813_10000296 | Ga0209813_1000029610 | 209 |
| 1041 | 3300027866 | Ga0209813_10014453 | Ga0209813_100144534 | 209 |
| 1042 | 3300027907 | Ga0207428_10337634 | Ga0207428_103376342 | 209 |
| 1043 | 3300028379 | Ga0268266_10005077 | Ga0268266_100050779 | 209 |
| 1044 | 3300028379 | Ga0268266_10025505 | Ga0268266_100255052 | 209 |
| 1045 | 3300028379 | Ga0268266_10169497 | Ga0268266_101694972 | 209 |
| 1046 | 3300028379 | Ga0268266_10191908 | Ga0268266_101919082 | 209 |
| 1047 | 3300028379 | Ga0268266_10315252 | Ga0268266_103152522 | 209 |
| 1048 | 3300028379 | Ga0268266_10665923 | Ga0268266_106659232 | 209 |
| 1049 | 3300028380 | Ga0268265_10003922 | Ga0268265_100039222 | 209 |
| 1050 | 3300028380 | Ga0268265_10006606 | Ga0268265_100066066 | 209 |
| 1051 | 3300028380 | Ga0268265_10076812 | Ga0268265_100768122 | 209 |
| 1052 | 3300028380 | Ga0268265_10995459 | Ga0268265_109954591 | 209 |
| 1053 | 3300028381 | Ga0268264_10000021 | Ga0268264_1000002175 | 209 |
| 1054 | 3300028381 | Ga0268264_10000158 | Ga0268264_10000158105 | 209 |
| 1055 | 3300028381 | Ga0268264_10000909 | Ga0268264_100009094 | 209 |
| 1056 | 3300028381 | Ga0268264_10138891 | Ga0268264_101388912 | 209 |
| 1057 | 3300028381 | Ga0268264_10642836 | Ga0268264_106428361 | 209 |
| 1058 | 3300028558 | Ga0265326_10002188 | Ga0265326_100021882 | 209 |
| 1059 | 3300028573 | Ga0265334_10002607 | Ga0265334_100026072 | 209 |
| 1060 | 3300028573 | Ga0265334_10093049 | Ga0265334_100930492 | 209 |
| 1061 | 3300028577 | Ga0265318_10002810 | Ga0265318_100028106 | 209 |
| 1062 | 3300028577 | Ga0265318_10022359 | Ga0265318_100223592 | 209 |
| 1063 | 3300028577 | Ga0265318_10050572 | Ga0265318_100505721 | 209 |
| 1064 | 3300028653 | Ga0265323_10006127 | Ga0265323_100061273 | 209 |
| 1065 | 3300028666 | Ga0265336_10001608 | Ga0265336_100016086 | 209 |
| 1066 | 3300028786 | Ga0307517_10000008 | Ga0307517_10000008143 | 209 |
| 1067 | 3300028786 | Ga0307517_10140654 | Ga0307517_101406544 | 209 |
| 1068 | 3300028794 | Ga0307515_10025060 | Ga0307515_1002506011 | 209 |
| 1069 | 3300028800 | Ga0265338_10000667 | Ga0265338_1000066729 | 209 |
| 1070 | 3300029957 | Ga0265324_10009512 | Ga0265324_100095124 | 209 |
| 1071 | 3300030083 | Ga0237817_10071 | Ga0237817_1007117 | 209 |
| 1072 | 3300030521 | Ga0307511_10013403 | Ga0307511_100134032 | 209 |
| 1073 | 3300031235 | Ga0265330_10024167 | Ga0265330_100241673 | 209 |
| 1074 | 3300031235 | Ga0265330_10067445 | Ga0265330_100674452 | 209 |
| 1075 | 3300031235 | Ga0265330_10211412 | Ga0265330_102114121 | 209 |
| 1076 | 3300031238 | Ga0265332_10096717 | Ga0265332_100967172 | 209 |
| 1077 | 3300031239 | Ga0265328_10016381 | Ga0265328_100163812 | 209 |
| 1078 | 3300031241 | Ga0265325_10020714 | Ga0265325_100207143 | 209 |
| 1079 | 3300031241 | Ga0265325_10253193 | Ga0265325_102531931 | 209 |
| 1080 | 3300031247 | Ga0265340_10002126 | Ga0265340_100021262 | 209 |
| 1081 | 3300031247 | Ga0265340_10036882 | Ga0265340_100368822 | 209 |
| 1082 | 3300031247 | Ga0265340_10070901 | Ga0265340_100709012 | 209 |
| 1083 | 3300031247 | Ga0265340_10076407 | Ga0265340_100764072 | 209 |
| 1084 | 3300031247 | Ga0265340_10245991 | Ga0265340_102459911 | 209 |
| 1085 | 3300031249 | Ga0265339_10003572 | Ga0265339_100035726 | 209 |
| 1086 | 3300031249 | Ga0265339_10034980 | Ga0265339_100349801 | 209 |
| 1087 | 3300031249 | Ga0265339_10092389 | Ga0265339_100923891 | 209 |
| 1088 | 3300031250 | Ga0265331_10003787 | Ga0265331_100037873 | 209 |
| 1089 | 3300031250 | Ga0265331_10006365 | Ga0265331_100063655 | 209 |
| 1090 | 3300031250 | Ga0265331_10085332 | Ga0265331_100853322 | 209 |
| 1091 | 3300031251 | Ga0265327_10000539 | Ga0265327_1000053942 | 209 |
| 1092 | 3300031344 | Ga0265316_10020290 | Ga0265316_100202905 | 209 |
| 1093 | 3300031344 | Ga0265316_10075672 | Ga0265316_100756722 | 209 |
| 1094 | 3300031344 | Ga0265316_10682219 | Ga0265316_106822191 | 209 |
| 1095 | 3300031344 | Ga0265316_10718282 | Ga0265316_107182821 | 209 |
| 1096 | 3300031456 | Ga0307513_10099941 | Ga0307513_100999411 | 209 |
| 1097 | 3300031456 | Ga0307513_10547725 | Ga0307513_105477251 | 209 |
| 1098 | 3300031507 | Ga0307509_10007761 | Ga0307509_100077614 | 209 |
| 1099 | 3300031507 | Ga0307509_10043851 | Ga0307509_100438512 | 209 |
| 1100 | 3300031548 | Ga0307408_100221688 | Ga0307408_1002216882 | 209 |
| 1101 | 3300031548 | Ga0307408_100842309 | Ga0307408_1008423091 | 209 |
| 1102 | 3300031595 | Ga0265313_10001592 | Ga0265313_100015928 | 209 |
| 1103 | 3300031595 | Ga0265313_10006801 | Ga0265313_100068013 | 209 |
| 1104 | 3300031595 | Ga0265313_10018863 | Ga0265313_100188633 | 209 |
| 1105 | 3300031595 | Ga0265313_10041246 | Ga0265313_100412462 | 209 |
| 1106 | 3300031595 | Ga0265313_10050697 | Ga0265313_100506973 | 209 |
| 1107 | 3300031595 | Ga0265313_10064449 | Ga0265313_100644491 | 209 |
| 1108 | 3300031616 | Ga0307508_10000184 | Ga0307508_1000018443 | 209 |
| 1109 | 3300031616 | Ga0307508_10013800 | Ga0307508_100138003 | 209 |
| 1110 | 3300031616 | Ga0307508_10024747 | Ga0307508_100247473 | 209 |
| 1111 | 3300031616 | Ga0307508_10216007 | Ga0307508_102160072 | 209 |
| 1112 | 3300031665 | Ga0316575_10066360 | Ga0316575_100663601 | 209 |
| 1113 | 3300031711 | Ga0265314_10003493 | Ga0265314_100034936 | 209 |
| 1114 | 3300031711 | Ga0265314_10008911 | Ga0265314_100089114 | 209 |
| 1115 | 3300031711 | Ga0265314_10010252 | Ga0265314_100102523 | 209 |
| 1116 | 3300031711 | Ga0265314_10026502 | Ga0265314_100265021 | 209 |
| 1117 | 3300031711 | Ga0265314_10044930 | Ga0265314_100449301 | 209 |
| 1118 | 3300031711 | Ga0265314_10132596 | Ga0265314_101325962 | 209 |
| 1119 | 3300031711 | Ga0265314_10137113 | Ga0265314_101371132 | 209 |
| 1120 | 3300031711 | Ga0265314_10140576 | Ga0265314_101405762 | 209 |
| 1121 | 3300031711 | Ga0265314_10172036 | Ga0265314_101720361 | 209 |
| 1122 | 3300031711 | Ga0265314_10189851 | Ga0265314_101898511 | 209 |
| 1123 | 3300031712 | Ga0265342_10003953 | Ga0265342_100039538 | 209 |
| 1124 | 3300031712 | Ga0265342_10013043 | Ga0265342_100130435 | 209 |
| 1125 | 3300031712 | Ga0265342_10026766 | Ga0265342_100267663 | 209 |
| 1126 | 3300031712 | Ga0265342_10292260 | Ga0265342_102922601 | 209 |
| 1127 | 3300031730 | Ga0307516_10012710 | Ga0307516_100127104 | 209 |
| 1128 | 3300031730 | Ga0307516_10355250 | Ga0307516_103552502 | 209 |
| 1129 | 3300031852 | Ga0307410_10372605 | Ga0307410_103726052 | 209 |
| 1130 | 3300031889 | Ga0326468_10002461 | Ga0326468_100024611 | 209 |
| 1131 | 3300031901 | Ga0307406_10007985 | Ga0307406_100079853 | 209 |
| 1132 | 3300031901 | Ga0307406_10981947 | Ga0307406_109819471 | 209 |
| 1133 | 3300031903 | Ga0307407_10031773 | Ga0307407_100317733 | 209 |
| 1134 | 3300031995 | Ga0307409_100363645 | Ga0307409_1003636452 | 209 |
| 1135 | 3300032002 | Ga0307416_100041543 | Ga0307416_1000415432 | 209 |
| 1136 | 3300032002 | Ga0307416_100061274 | Ga0307416_1000612742 | 209 |
| 1137 | 3300032002 | Ga0307416_101346609 | Ga0307416_1013466092 | 209 |
| 1138 | 3300032004 | Ga0307414_10059903 | Ga0307414_100599032 | 209 |
| 1139 | 3300032004 | Ga0307414_10202858 | Ga0307414_102028582 | 209 |
| 1140 | 3300032004 | Ga0307414_10350682 | Ga0307414_103506822 | 209 |
| 1141 | 3300032126 | Ga0307415_100152714 | Ga0307415_1001527142 | 209 |
| 1142 | 3300032126 | Ga0307415_100199571 | Ga0307415_1001995712 | 209 |
| 1143 | 3300032126 | Ga0307415_100737647 | Ga0307415_1007376471 | 209 |
| 1144 | 3300033179 | Ga0307507_10063835 | Ga0307507_100638352 | 209 |
| 1145 | 3300033179 | Ga0307507_10255242 | Ga0307507_102552422 | 209 |
| 1146 | 3300033180 | Ga0307510_10003242 | Ga0307510_1000324214 | 209 |
| 1147 | 3300033180 | Ga0307510_10003590 | Ga0307510_1000359019 | 209 |
| 1148 | 3300033180 | Ga0307510_10099597 | Ga0307510_100995975 | 209 |
| 1149 | 3300035083 | Ga0373926_0005666 | Ga0373926_0005666_894_1529 | 209 |
| 1150 | 3300035113 | Ga0373936_0053817 | Ga0373936_0053817_874_1515 | 209 |
| 1151 | 3300035117 | Ga0373953_0132028 | Ga0373953_0132028_45_683 | 209 |
| 1152 | 3300035119 | Ga0373956_0062435 | Ga0373956_0062435_127_765 | 209 |
| 1153 | 3300035120 | Ga0373957_0003459 | Ga0373957_0003459_2603_3241 | 209 |
| 1154 | 3300035171 | Ga0373946_0360026 | Ga0373946_0360026_56_694 | 209 |
| 1155 | 3300035172 | Ga0373955_0051120 | Ga0373955_0051120_177_815 | 209 |
| 1156 | 3300035410 | Ga0373924_0003807 | Ga0373924_0003807_139_777 | 209 |
| 1157 | 3300035691 | Ga0373931_0336080 | Ga0373931_0336080_66_701 | 209 |
| 1158 | 3300035691 | Ga0373931_0361234 | Ga0373931_0361234_47_685 | 209 |
| 1159 | 3300035691 | Ga0373931_0654474 | Ga0373931_0654474_22_651 | 209 |
| 1160 | 3300035692 | Ga0373935_0083060 | Ga0373935_0083060_580_1215 | 209 |
| 1161 | 3300035692 | Ga0373935_0153275 | Ga0373935_0153275_724_1359 | 209 |
| 1162 | 3300035692 | Ga0373935_0325993 | Ga0373935_0325993_257_895 | 209 |
| 1163 | 3300035692 | Ga0373935_0485164 | Ga0373935_0485164_94_723 | 209 |
| 1164 | 3300035695 | Ga0373927_0022539 | Ga0373927_0022539_2495_3127 | 209 |
| 1165 | 3300035695 | Ga0373927_0026045 | Ga0373927_0026045_2722_3363 | 209 |
| 1166 | 3300035695 | Ga0373927_0030308 | Ga0373927_0030308_2375_3010 | 209 |
| 1167 | 3300035695 | Ga0373927_0128707 | Ga0373927_0128707_388_1023 | 209 |
| 1168 | 3300035695 | Ga0373927_0179436 | Ga0373927_0179436_680_1315 | 209 |
| 1169 | 3300035724 | Ga0373933_0353323 | Ga0373933_0353323_109_747 | 209 |
| 1170 | 3300035725 | Ga0373947_0531977 | Ga0373947_0531977_48_686 | 209 |
| 1171 | 3300036401 | Ga0373937_0055118 | Ga0373937_0055118_781_1410 | 209 |
| 1172 | 3300036401 | Ga0373937_0150953 | Ga0373937_0150953_585_1220 | 209 |
| 1173 | 3300036401 | Ga0373937_0218966 | Ga0373937_0218966_732_1370 | 209 |
| 1174 | 3300036401 | Ga0373937_0386260 | Ga0373937_0386260_97_726 | 209 |
| 1175 | 3300036401 | Ga0373937_0650628 | Ga0373937_0650628_289_918 | 209 |
| 1176 | 3300036401 | Ga0373937_1218146 | Ga0373937_1218146_24_662 | 209 |
| 1177 | 3300036459 | Ga0372808_002239 | Ga0372808_002239_1187_1822 | 209 |
| 1178 | 3300037068 | Ga0373925_0110789 | Ga0373925_0110789_1009_1650 | 209 |
| 1179 | 3300037068 | Ga0373925_0142985 | Ga0373925_0142985_213_851 | 209 |
| 1180 | 3300037068 | Ga0373925_0283358 | Ga0373925_0283358_246_884 | 209 |
| 1181 | 3300037068 | Ga0373925_0473705 | Ga0373925_0473705_158_787 | 209 |
| 1182 | 3300037068 | Ga0373925_0680739 | Ga0373925_0680739_191_820 | 209 |
| 1183 | 3300037312 | Ga0395899_0001159 | Ga0395899_0001159_16342_16980 | 209 |
| 1184 | 3300037312 | Ga0395899_0011006 | Ga0395899_0011006_4481_5119 | 209 |
| 1185 | 3300037312 | Ga0395899_0070194 | Ga0395899_0070194_381_1010 | 209 |
| 1186 | 3300037312 | Ga0395899_0092039 | Ga0395899_0092039_1247_1885 | 209 |
| 1187 | 3300037312 | Ga0395899_0164827 | Ga0395899_0164827_615_1250 | 209 |
| 1188 | 3300037312 | Ga0395899_0188373 | Ga0395899_0188373_550_1191 | 209 |
| 1189 | 3300037418 | Ga0395900_0004505 | Ga0395900_0004505_2604_3239 | 209 |
| 1190 | 3300037418 | Ga0395900_0004870 | Ga0395900_0004870_9359_9997 | 209 |
| 1191 | 3300037418 | Ga0395900_0007092 | Ga0395900_0007092_7481_8119 | 209 |
| 1192 | 3300037418 | Ga0395900_0007882 | Ga0395900_0007882_9438_10076 | 209 |
| 1193 | 3300037418 | Ga0395900_0205599 | Ga0395900_0205599_309_950 | 209 |
| 1194 | 3300037418 | Ga0395900_0400546 | Ga0395900_0400546_95_724 | 209 |
| 1195 | 3300037466 | Ga0395898_0002205 | Ga0395898_0002205_9977_10615 | 209 |
| 1196 | 3300037466 | Ga0395898_0002340 | Ga0395898_0002340_13390_14028 | 209 |
| 1197 | 3300037466 | Ga0395898_0006553 | Ga0395898_0006553_306_941 | 209 |
| 1198 | 3300037471 | Ga0395905_0011090 | Ga0395905_0011090_4901_5536 | 209 |
| 1199 | 3300037471 | Ga0395905_0076407 | Ga0395905_0076407_1913_2548 | 209 |
| 1200 | 3300037471 | Ga0395905_0115269 | Ga0395905_0115269_258_887 | 209 |
| 1201 | 3300037471 | Ga0395905_0492751 | Ga0395905_0492751_243_878 | 209 |
| 1202 | 3300037471 | Ga0395905_1008018 | Ga0395905_1008018_16_654 | 209 |
| 1203 | 3300037853 | Ga0436364_0729208 | Ga0436364_0729208_105_734 | 209 |
| 1204 | 3300037853 | Ga0436364_0863831 | Ga0436364_0863831_12_641 | 209 |
| 1205 | 3300037853 | Ga0436364_1046819 | Ga0436364_1046819_17_658 | 209 |
| 1206 | 3300037853 | Ga0436364_1211238 | Ga0436364_1211238_388_1023 | 209 |
| 1207 | 3300038443 | Ga0395901_0001255 | Ga0395901_0001255_12458_13096 | 209 |
| 1208 | 3300038443 | Ga0395901_0002098 | Ga0395901_0002098_15526_16164 | 209 |
| 1209 | 3300038443 | Ga0395901_0004054 | Ga0395901_0004054_7727_8365 | 209 |
| 1210 | 3300038443 | Ga0395901_0017180 | Ga0395901_0017180_1900_2538 | 209 |
| 1211 | 3300038443 | Ga0395901_0159461 | Ga0395901_0159461_473_1108 | 209 |
| 1212 | 3300038443 | Ga0395901_0234083 | Ga0395901_0234083_44_679 | 209 |
| 1213 | 3300038705 | Ga0237819_01648 | Ga0237819_01648_805_1434 | 209 |
| 1214 | 3300038705 | Ga0237819_03074 | Ga0237819_03074_1639_2268 | 209 |
| 1215 | 3300039062 | Ga0400483_162571 | Ga0400483_162571_178_807 | 209 |
| 1216 | 3300039062 | Ga0400483_230547 | Ga0400483_230547_470_1099 | 209 |
| 1217 | 3300039062 | Ga0400483_232283 | Ga0400483_232283_1016_1666 | 209 |
| 1218 | 3300039437 | Ga0436365_0297386 | Ga0436365_0297386_464_1099 | 209 |
| 1219 | 3300039437 | Ga0436365_0862833 | Ga0436365_0862833_74806_75438 | 209 |
| 1220 | 3300039437 | Ga0436365_0904767 | Ga0436365_0904767_244_873 | 209 |
| 1221 | 3300039437 | Ga0436365_1259102 | Ga0436365_1259102_48021_48650 | 209 |
| 1222 | 3300039437 | Ga0436365_1361494 | Ga0436365_1361494_2406_3041 | 209 |
| 1223 | 3300039437 | Ga0436365_1399381 | Ga0436365_1399381_116_751 | 209 |
| 1224 | 3300039437 | Ga0436365_1412995 | Ga0436365_1412995_27_665 | 209 |
| 1225 | 3300039437 | Ga0436365_1505352 | Ga0436365_1505352_1714_2343 | 209 |
| 1226 | 3300039438 | Ga0436360_0092664 | Ga0436360_0092664_867_1502 | 209 |
| 1227 | 3300039438 | Ga0436360_0289993 | Ga0436360_0289993_189_821 | 209 |
| 1228 | 3300039438 | Ga0436360_0314853 | Ga0436360_0314853_4125_4757 | 209 |
| 1229 | 3300039438 | Ga0436360_0800977 | Ga0436360_0800977_248_883 | 209 |
| 1230 | 3300039438 | Ga0436360_1276686 | Ga0436360_1276686_100_729 | 209 |
| 1231 | 3300039447 | Ga0436361_0229945 | Ga0436361_0229945_1485_2117 | 209 |
| 1232 | 3300039447 | Ga0436361_0391251 | Ga0436361_0391251_451_1083 | 209 |
| 1233 | 3300039447 | Ga0436361_0491334 | Ga0436361_0491334_364_1002 | 209 |
| 1234 | 3300039447 | Ga0436361_0830107 | Ga0436361_0830107_1348_1977 | 209 |
| 1235 | 3300039450 | Ga0436363_0877282 | Ga0436363_0877282_272_910 | 209 |
| 1236 | 3300039450 | Ga0436363_1266422 | Ga0436363_1266422_132_761 | 209 |
| 1237 | 3300039450 | Ga0436363_1400984 | Ga0436363_1400984_2523_3158 | 209 |
| 1238 | 3300039450 | Ga0436363_1409784 | Ga0436363_1409784_123_752 | 209 |
| 1239 | 3300039450 | Ga0436363_1420176 | Ga0436363_1420176_75_710 | 209 |
| 1240 | 3300039453 | Ga0436362_0949954 | Ga0436362_0949954_28464_29096 | 209 |
| 1241 | 3300039453 | Ga0436362_1231252 | Ga0436362_1231252_175_807 | 209 |
| 1242 | 3300041451 | Ga0451791_0196258 | Ga0451791_0196258_502_1137 | 209 |
| 1243 | 3300041453 | Ga0451797_0142036 | Ga0451797_0142036_540_1175 | 209 |
| 1244 | 3300041460 | Ga0451802_1663335 | Ga0451802_1663335_216_851 | 209 |
| 1245 | 3300041498 | Ga0451841_0626317 | Ga0451841_0626317_41_676 | 209 |
| 1246 | 3300041511 | Ga0451855_0157495 | Ga0451855_0157495_374_1003 | 209 |
| 1247 | 3300042002 | Ga0439442_025710 | Ga0439442_025710_537_1175 | 209 |
| 1248 | 3300042007 | Ga0439449_0003421 | Ga0439449_0003421_4266_4895 | 209 |
| 1249 | 3300042015 | Ga0439462_0130740 | Ga0439462_0130740_38_667 | 209 |
| 1250 | 3300042134 | Ga0450898_011683 | Ga0450898_011683_511_1140 | 209 |
| 1251 | 3300042438 | Ga0439459_0003351 | Ga0439459_0003351_1771_2400 | 209 |
| 1252 | 3300042876 | Ga0451577_0264940 | Ga0451577_0264940_352_996 | 209 |
| 1253 | 3300044656 | Ga0466969_0012669 | Ga0466969_0012669_924_1553 | 209 |
| 1254 | 3300044656 | Ga0466969_0022851 | Ga0466969_0022851_1564_2199 | 209 |
| 1255 | 3300044658 | Ga0466972_0000702 | Ga0466972_0000702_3892_4527 | 209 |
| 1256 | 3300044658 | Ga0466972_0020059 | Ga0466972_0020059_718_1353 | 209 |
| 1257 | 3300044658 | Ga0466972_0028369 | Ga0466972_0028369_1327_1962 | 209 |
| 1258 | 3300044673 | Ga0453683_0068854 | Ga0453683_0068854_542_1240 | 209 |
| 1259 | 3300044684 | Ga0466966_0257824 | Ga0466966_0257824_343_978 | 209 |
| 1260 | 3300044693 | Ga0466961_0000359 | Ga0466961_0000359_24180_24815 | 209 |
| 1261 | 3300044693 | Ga0466961_0452019 | Ga0466961_0452019_79_714 | 209 |
| 1262 | 3300044694 | Ga0466963_0007691 | Ga0466963_0007691_1323_1961 | 209 |
| 1263 | 3300044694 | Ga0466963_0034178 | Ga0466963_0034178_1046_1681 | 209 |
| 1264 | 3300044706 | Ga0466964_0146541 | Ga0466964_0146541_30_665 | 209 |
| 1265 | 3300044706 | Ga0466964_0148531 | Ga0466964_0148531_174_803 | 209 |
| 1266 | 3300044706 | Ga0466964_0350923 | Ga0466964_0350923_13_681 | 209 |
| 1267 | 3300044712 | Ga0453684_0009814 | Ga0453684_0009814_5277_5921 | 209 |
| 1268 | 3300044712 | Ga0453684_0015205 | Ga0453684_0015205_3690_4334 | 209 |
| 1269 | 3300044712 | Ga0453684_0255034 | Ga0453684_0255034_917_1564 | 209 |
| 1270 | 3300044735 | Ga0466968_0073219 | Ga0466968_0073219_357_998 | 209 |
| 1271 | 3300044735 | Ga0466968_0111331 | Ga0466968_0111331_228_863 | 209 |
| 1272 | 3300044765 | Ga0466970_0153259 | Ga0466970_0153259_576_1241 | 209 |
| 1273 | 3300044765 | Ga0466970_0355302 | Ga0466970_0355302_79_708 | 209 |
| 1274 | 3300044765 | Ga0466970_0389531 | Ga0466970_0389531_54_689 | 209 |
| 1275 | 3300044765 | Ga0466970_0394039 | Ga0466970_0394039_99_728 | 209 |
| 1276 | 3300044842 | Ga0466957_0158787 | Ga0466957_0158787_818_1453 | 209 |
| 1277 | 3300045049 | Ga0466959_0003116 | Ga0466959_0003116_5015_5650 | 209 |
| 1278 | 3300045049 | Ga0466959_0010713 | Ga0466959_0010713_3502_4131 | 209 |
| 1279 | 3300045049 | Ga0466959_0026644 | Ga0466959_0026644_2534_3169 | 209 |
| 1280 | 3300045049 | Ga0466959_0061588 | Ga0466959_0061588_698_1327 | 209 |
| 1281 | 3300045049 | Ga0466959_0113172 | Ga0466959_0113172_41_673 | 209 |
| 1282 | 3300045051 | Ga0451576_0004179 | Ga0451576_0004179_7575_8222 | 209 |
| 1283 | 3300045051 | Ga0451576_0273966 | Ga0451576_0273966_839_1471 | 209 |
| 1284 | 3300045836 | Ga0466958_0064331 | Ga0466958_0064331_486_1115 | 209 |
| 1285 | 3300045836 | Ga0466958_0160788 | Ga0466958_0160788_485_1114 | 209 |
| 1286 | 3300045836 | Ga0466958_0236623 | Ga0466958_0236623_83_718 | 209 |
| 1287 | 3300045836 | Ga0466958_0441706 | Ga0466958_0441706_92_727 | 209 |
| 1288 | 3300045976 | Ga0466967_0000079 | Ga0466967_0000079_13905_14534 | 209 |
| 1289 | 3300045976 | Ga0466967_0282289 | Ga0466967_0282289_528_1163 | 209 |
| 1290 | 3300045976 | Ga0466967_0438093 | Ga0466967_0438093_637_1266 | 209 |
| 1291 | 3300046452 | Ga0495617_018456 | Ga0495617_018456_1177_1812 | 209 |
| 1292 | 3300046452 | Ga0495617_055985 | Ga0495617_055985_363_998 | 209 |
| 1293 | 3300046454 | Ga0495592_0358320 | Ga0495592_0358320_275_913 | 209 |
| 1294 | 3300046455 | Ga0495603_0009099 | Ga0495603_0009099_949_1623 | 209 |
| 1295 | 3300046455 | Ga0495603_0020396 | Ga0495603_0020396_1885_2514 | 209 |
| 1296 | 3300046455 | Ga0495603_0180948 | Ga0495603_0180948_350_985 | 209 |
| 1297 | 3300046457 | Ga0495590_0027387 | Ga0495590_0027387_370_1005 | 209 |
| 1298 | 3300046457 | Ga0495590_0192929 | Ga0495590_0192929_56_685 | 209 |
| 1299 | 3300046459 | Ga0495629_0099345 | Ga0495629_0099345_665_1339 | 209 |
| 1300 | 3300046460 | Ga0495638_0000413 | Ga0495638_0000413_3640_4269 | 209 |
| 1301 | 3300046460 | Ga0495638_0000547 | Ga0495638_0000547_7780_8409 | 209 |
| 1302 | 3300046460 | Ga0495638_0005379 | Ga0495638_0005379_4372_5001 | 209 |
| 1303 | 3300046460 | Ga0495638_0009130 | Ga0495638_0009130_3811_4446 | 209 |
| 1304 | 3300046460 | Ga0495638_0200613 | Ga0495638_0200613_446_1087 | 209 |
| 1305 | 3300046460 | Ga0495638_0315614 | Ga0495638_0315614_64_699 | 209 |
| 1306 | 3300046461 | Ga0495641_0099339 | Ga0495641_0099339_616_1251 | 209 |
| 1307 | 3300046462 | Ga0495651_0053435 | Ga0495651_0053435_1050_1685 | 209 |
| 1308 | 3300046462 | Ga0495651_0089752 | Ga0495651_0089752_1393_2031 | 209 |
| 1309 | 3300046462 | Ga0495651_0199099 | Ga0495651_0199099_175_810 | 209 |
| 1310 | 3300046462 | Ga0495651_0331429 | Ga0495651_0331429_171_800 | 209 |
| 1311 | 3300046463 | Ga0495653_0096827 | Ga0495653_0096827_1169_1807 | 209 |
| 1312 | 3300046471 | Ga0495650_0000020 | Ga0495650_0000020_312182_312811 | 209 |
| 1313 | 3300046472 | Ga0495580_0376078 | Ga0495580_0376078_227_856 | 209 |
| 1314 | 3300046473 | Ga0495582_0304869 | Ga0495582_0304869_171_806 | 209 |
| 1315 | 3300046474 | Ga0495605_0190260 | Ga0495605_0190260_123_758 | 209 |
| 1316 | 3300046475 | Ga0495639_0058838 | Ga0495639_0058838_838_1473 | 209 |
| 1317 | 3300046476 | Ga0495662_0093608 | Ga0495662_0093608_40_675 | 209 |
| 1318 | 3300046477 | Ga0495664_0017425 | Ga0495664_0017425_685_1320 | 209 |
| 1319 | 3300046477 | Ga0495664_0075557 | Ga0495664_0075557_50_688 | 209 |
| 1320 | 3300046491 | Ga0495584_0102596 | Ga0495584_0102596_226_861 | 209 |
| 1321 | 3300046491 | Ga0495584_0196399 | Ga0495584_0196399_328_963 | 209 |
| 1322 | 3300046492 | Ga0495585_0043001 | Ga0495585_0043001_58_687 | 209 |
| 1323 | 3300046492 | Ga0495585_0164099 | Ga0495585_0164099_303_977 | 209 |
| 1324 | 3300046492 | Ga0495585_0194741 | Ga0495585_0194741_214_843 | 209 |
| 1325 | 3300046499 | Ga0495594_0032506 | Ga0495594_0032506_809_1483 | 209 |
| 1326 | 3300046499 | Ga0495594_0182714 | Ga0495594_0182714_31_666 | 209 |
| 1327 | 3300046500 | Ga0495596_0036246 | Ga0495596_0036246_206_841 | 209 |
| 1328 | 3300046501 | Ga0495607_0047785 | Ga0495607_0047785_1723_2451 | 209 |
| 1329 | 3300046506 | Ga0495583_0000001 | Ga0495583_0000001_83479_84108 | 209 |
| 1330 | 3300046507 | Ga0495606_0010700 | Ga0495606_0010700_5078_5707 | 209 |
| 1331 | 3300046511 | Ga0495608_0078112 | Ga0495608_0078112_702_1337 | 209 |
| 1332 | 3300046512 | Ga0495610_0000056 | Ga0495610_0000056_97694_98323 | 209 |
| 1333 | 3300046512 | Ga0495610_0004429 | Ga0495610_0004429_572_1201 | 209 |
| 1334 | 3300046512 | Ga0495610_0005750 | Ga0495610_0005750_7074_7703 | 209 |
| 1335 | 3300046513 | Ga0495616_0000254 | Ga0495616_0000254_23099_23728 | 209 |
| 1336 | 3300046514 | Ga0495618_0110920 | Ga0495618_0110920_815_1450 | 209 |
| 1337 | 3300046514 | Ga0495618_0115264 | Ga0495618_0115264_1016_1654 | 209 |
| 1338 | 3300046515 | Ga0495620_0066723 | Ga0495620_0066723_159_788 | 209 |
| 1339 | 3300046515 | Ga0495620_0072441 | Ga0495620_0072441_207_842 | 209 |
| 1340 | 3300046516 | Ga0495628_0162046 | Ga0495628_0162046_889_1527 | 209 |
| 1341 | 3300046517 | Ga0495630_0726175 | Ga0495630_0726175_95_733 | 209 |
| 1342 | 3300046518 | Ga0495631_0126324 | Ga0495631_0126324_330_965 | 209 |
| 1343 | 3300046518 | Ga0495631_0287262 | Ga0495631_0287262_25_660 | 209 |
| 1344 | 3300046519 | Ga0495632_0001149 | Ga0495632_0001149_652_1281 | 209 |
| 1345 | 3300046519 | Ga0495632_0007628 | Ga0495632_0007628_255_884 | 209 |
| 1346 | 3300046519 | Ga0495632_0202204 | Ga0495632_0202204_154_789 | 209 |
| 1347 | 3300046520 | Ga0495637_0070240 | Ga0495637_0070240_677_1306 | 209 |
| 1348 | 3300046522 | Ga0495643_0014223 | Ga0495643_0014223_3565_4200 | 209 |
| 1349 | 3300046524 | Ga0495648_0000130 | Ga0495648_0000130_9162_9791 | 209 |
| 1350 | 3300046524 | Ga0495648_0019710 | Ga0495648_0019710_1187_1816 | 209 |
| 1351 | 3300046524 | Ga0495648_0266006 | Ga0495648_0266006_84_725 | 209 |
| 1352 | 3300046525 | Ga0495663_0034886 | Ga0495663_0034886_712_1341 | 209 |
| 1353 | 3300046525 | Ga0495663_0060364 | Ga0495663_0060364_160_789 | 209 |
| 1354 | 3300046526 | Ga0495666_0163109 | Ga0495666_0163109_316_990 | 209 |
| 1355 | 3300046529 | Ga0495652_0210660 | Ga0495652_0210660_46_684 | 209 |
| 1356 | 3300046529 | Ga0495652_0287465 | Ga0495652_0287465_115_744 | 209 |
| 1357 | 3300046530 | Ga0495654_0000010 | Ga0495654_0000010_36872_37501 | 209 |
| 1358 | 3300046533 | Ga0495640_0368059 | Ga0495640_0368059_24_662 | 209 |
| 1359 | 3300046535 | Ga0495586_0104772 | Ga0495586_0104772_551_1189 | 209 |
| 1360 | 3300046535 | Ga0495586_0152938 | Ga0495586_0152938_565_1200 | 209 |
| 1361 | 3300046536 | Ga0495587_0006206 | Ga0495587_0006206_3184_3819 | 209 |
| 1362 | 3300046536 | Ga0495587_0031030 | Ga0495587_0031030_2286_2924 | 209 |
| 1363 | 3300046537 | Ga0495598_0048538 | Ga0495598_0048538_288_962 | 209 |
| 1364 | 3300046538 | Ga0495609_0087918 | Ga0495609_0087918_153_788 | 209 |
| 1365 | 3300046542 | Ga0495597_0137797 | Ga0495597_0137797_14_655 | 209 |
| 1366 | 3300046543 | Ga0495645_0040795 | Ga0495645_0040795_1385_2020 | 209 |
| 1367 | 3300046557 | Ga0495622_0005097 | Ga0495622_0005097_5381_6016 | 209 |
| 1368 | 3300046557 | Ga0495622_0035148 | Ga0495622_0035148_1144_1779 | 209 |
| 1369 | 3300046557 | Ga0495622_0149554 | Ga0495622_0149554_97_726 | 209 |
| 1370 | 3300046559 | Ga0495667_0010326 | Ga0495667_0010326_1841_2476 | 209 |
| 1371 | 3300046559 | Ga0495667_0080493 | Ga0495667_0080493_13_651 | 209 |
| 1372 | 3300046615 | Ga0495656_0180597 | Ga0495656_0180597_100_729 | 209 |
| 1373 | 3300046616 | Ga0495668_0000060 | Ga0495668_0000060_121934_122563 | 209 |
| 1374 | 3300046616 | Ga0495668_0004514 | Ga0495668_0004514_3328_3957 | 209 |
| 1375 | 3300046616 | Ga0495668_0033084 | Ga0495668_0033084_1540_2169 | 209 |
| 1376 | 3300046642 | Ga0495634_0085375 | Ga0495634_0085375_1134_1769 | 209 |
| 1377 | 3300046642 | Ga0495634_0270058 | Ga0495634_0270058_172_810 | 209 |
| 1378 | 3300046660 | Ga0495625_0000165 | Ga0495625_0000165_75866_76495 | 209 |
| 1379 | 3300046660 | Ga0495625_0001352 | Ga0495625_0001352_8277_8906 | 209 |
| 1380 | 3300046660 | Ga0495625_0004210 | Ga0495625_0004210_9926_10555 | 209 |
| 1381 | 3300046660 | Ga0495625_0016705 | Ga0495625_0016705_4566_5195 | 209 |
| 1382 | 3300046660 | Ga0495625_0048877 | Ga0495625_0048877_2312_2953 | 209 |
| 1383 | 3300046660 | Ga0495625_0427619 | Ga0495625_0427619_145_786 | 209 |
| 1384 | 3300046663 | Ga0495635_0013096 | Ga0495635_0013096_1450_2085 | 209 |
| 1385 | 3300046665 | Ga0495661_0282195 | Ga0495661_0282195_59_688 | 209 |
| 1386 | 3300046674 | Ga0495588_0117184 | Ga0495588_0117184_584_1258 | 209 |
| 1387 | 3300046675 | Ga0495657_0025104 | Ga0495657_0025104_1448_2086 | 209 |
| 1388 | 3300046675 | Ga0495657_0042461 | Ga0495657_0042461_207_842 | 209 |
| 1389 | 3300046678 | Ga0495599_0009207 | Ga0495599_0009207_3470_4105 | 209 |
| 1390 | 3300046679 | Ga0495623_0029108 | Ga0495623_0029108_1607_2245 | 209 |
| 1391 | 3300046679 | Ga0495623_0069084 | Ga0495623_0069084_917_1552 | 209 |
| 1392 | 3300046680 | Ga0495646_0038536 | Ga0495646_0038536_1809_2444 | 209 |
| 1393 | 3300046683 | Ga0495658_0149623 | Ga0495658_0149623_68_709 | 209 |
| 1394 | 3300046683 | Ga0495658_0184829 | Ga0495658_0184829_377_1012 | 209 |
| 1395 | 3300046689 | Ga0495613_0058830 | Ga0495613_0058830_1714_2349 | 209 |
| 1396 | 3300046689 | Ga0495613_0210780 | Ga0495613_0210780_300_938 | 209 |
| 1397 | 3300046692 | Ga0495671_0149733 | Ga0495671_0149733_43_717 | 209 |
| 1398 | 3300046694 | Ga0495649_0233491 | Ga0495649_0233491_38_667 | 209 |
| 1399 | 3300046794 | Ga0495589_0005117 | Ga0495589_0005117_5904_6533 | 209 |
| 1400 | 3300046809 | Ga0495600_0014837 | Ga0495600_0014837_1222_1857 | 209 |
| 1401 | 3300046810 | Ga0495660_0004395 | Ga0495660_0004395_7354_7983 | 209 |
| 1402 | 3300046810 | Ga0495660_0025337 | Ga0495660_0025337_1904_2533 | 209 |
| 1403 | 3300046810 | Ga0495660_0031813 | Ga0495660_0031813_243_872 | 209 |
| 1404 | 3300046810 | Ga0495660_0173136 | Ga0495660_0173136_145_780 | 209 |
| 1405 | 3300047315 | Ga0495581_0019611 | Ga0495581_0019611_3170_3805 | 209 |
| 1406 | 3300047315 | Ga0495581_0084750 | Ga0495581_0084750_607_1242 | 209 |
| 1407 | 3300047317 | Ga0495604_0038890 | Ga0495604_0038890_2859_3494 | 209 |
| 1408 | 3300047317 | Ga0495604_0097241 | Ga0495604_0097241_1331_1969 | 209 |
| 1409 | 3300047317 | Ga0495604_0417937 | Ga0495604_0417937_200_835 | 209 |
| 1410 | 3300047317 | Ga0495604_0645215 | Ga0495604_0645215_30_665 | 209 |
| 1411 | 3300047318 | Ga0495636_0041867 | Ga0495636_0041867_937_1566 | 209 |
| 1412 | 3300047318 | Ga0495636_0103030 | Ga0495636_0103030_243_914 | 209 |
| 1413 | 3300047319 | Ga0495674_0046939 | Ga0495674_0046939_2875_3510 | 209 |
| 1414 | 3300047319 | Ga0495674_0072008 | Ga0495674_0072008_736_1482 | 209 |
| 1415 | 3300047319 | Ga0495674_0741919 | Ga0495674_0741919_89_724 | 209 |
| 1416 | 3300047320 | Ga0495672_0001149 | Ga0495672_0001149_4681_5310 | 209 |
| 1417 | 3300047320 | Ga0495672_0018868 | Ga0495672_0018868_1797_2432 | 209 |
| 1418 | 3300047321 | Ga0495676_0027294 | Ga0495676_0027294_1038_1673 | 209 |
| 1419 | 3300047321 | Ga0495676_0139474 | Ga0495676_0139474_533_1162 | 209 |
| 1420 | 3300047321 | Ga0495676_0201161 | Ga0495676_0201161_484_1119 | 209 |
| 1421 | 3300047321 | Ga0495676_0400391 | Ga0495676_0400391_135_809 | 209 |
| 1422 | 3300047322 | Ga0495680_0029995 | Ga0495680_0029995_1043_1678 | 209 |
| 1423 | 3300047322 | Ga0495680_0070345 | Ga0495680_0070345_1269_1907 | 209 |
| 1424 | 3300047323 | Ga0495683_0006700 | Ga0495683_0006700_1256_1885 | 209 |
| 1425 | 3300047323 | Ga0495683_0131317 | Ga0495683_0131317_522_1157 | 209 |
| 1426 | 3300047443 | Ga0495687_064312 | Ga0495687_064312_713_1348 | 209 |
| 1427 | 3300047444 | Ga0495675_0002428 | Ga0495675_0002428_2288_2923 | 209 |
| 1428 | 3300047444 | Ga0495675_0046076 | Ga0495675_0046076_1439_2077 | 209 |
| 1429 | 3300047445 | Ga0495677_0133971 | Ga0495677_0133971_197_832 | 209 |
| 1430 | 3300047446 | Ga0495679_004273 | Ga0495679_004273_3862_4491 | 209 |
| 1431 | 3300047447 | Ga0495685_112874 | Ga0495685_112874_41_676 | 209 |
| 1432 | 3300047469 | Ga0495673_0000301 | Ga0495673_0000301_14883_15512 | 209 |
| 1433 | 3300047469 | Ga0495673_0000614 | Ga0495673_0000614_30493_31122 | 209 |
| 1434 | 3300047469 | Ga0495673_0000701 | Ga0495673_0000701_24897_25526 | 209 |
| 1435 | 3300047470 | Ga0495681_0013408 | Ga0495681_0013408_2331_2960 | 209 |
| 1436 | 3300047470 | Ga0495681_0080744 | Ga0495681_0080744_730_1359 | 209 |
| 1437 | 3300047470 | Ga0495681_0112146 | Ga0495681_0112146_248_883 | 209 |
| 1438 | 3300047471 | Ga0495684_0024863 | Ga0495684_0024863_3075_3713 | 209 |
| 1439 | 3300047471 | Ga0495684_0146632 | Ga0495684_0146632_867_1502 | 209 |
| 1440 | 3300047472 | Ga0495686_0000376 | Ga0495686_0000376_61008_61649 | 209 |
| 1441 | 3300047472 | Ga0495686_0033484 | Ga0495686_0033484_796_1425 | 209 |
| 1442 | 3300047472 | Ga0495686_0037745 | Ga0495686_0037745_2014_2649 | 209 |
| 1443 | 3300047472 | Ga0495686_0046290 | Ga0495686_0046290_1263_1892 | 209 |
| 1444 | 3300047472 | Ga0495686_0058044 | Ga0495686_0058044_474_1109 | 209 |
| 1445 | 3300047673 | Ga0495593_0051849 | Ga0495593_0051849_1253_1888 | 209 |
| 1446 | 3300048088 | Ga0495602_0378351 | Ga0495602_0378351_215_853 | 209 |
| 1447 | 3300048089 | Ga0495614_0033782 | Ga0495614_0033782_1206_1841 | 209 |
| 1448 | 3300048090 | Ga0495615_0010168 | Ga0495615_0010168_964_1593 | 209 |
| 1449 | 3300048091 | Ga0495626_0049774 | Ga0495626_0049774_81_716 | 209 |
| 1450 | 3300048903 | Ga0496100_0005212 | Ga0496100_0005212_4412_5041 | 209 |
| 1451 | 3300048903 | Ga0496100_0100472 | Ga0496100_0100472_1269_1907 | 209 |
| 1452 | 3300048904 | Ga0496101_0032741 | Ga0496101_0032741_2095_2730 | 209 |
| 1453 | 3300048904 | Ga0496101_0051844 | Ga0496101_0051844_753_1388 | 209 |
| 1454 | 3300048904 | Ga0496101_0227337 | Ga0496101_0227337_111_740 | 209 |
| 1455 | 3300048905 | Ga0496102_0017934 | Ga0496102_0017934_944_1582 | 209 |
| 1456 | 3300048905 | Ga0496102_0078564 | Ga0496102_0078564_821_1456 | 209 |
| 1457 | 3300048905 | Ga0496102_0165696 | Ga0496102_0165696_477_1112 | 209 |
| 1458 | 3300048905 | Ga0496102_0326381 | Ga0496102_0326381_641_1315 | 209 |
| 1459 | 3300048905 | Ga0496102_0499299 | Ga0496102_0499299_104_733 | 209 |
| 1460 | 3300048905 | Ga0496102_0591396 | Ga0496102_0591396_208_837 | 209 |
| 1461 | 3300048906 | Ga0496103_0042185 | Ga0496103_0042185_1938_2567 | 209 |
| 1462 | 3300048907 | Ga0496104_0002560 | Ga0496104_0002560_6916_7545 | 209 |
| 1463 | 3300048907 | Ga0496104_0006343 | Ga0496104_0006343_841_1479 | 209 |
| 1464 | 3300048907 | Ga0496104_0138564 | Ga0496104_0138564_373_1002 | 209 |
| 1465 | 3300048907 | Ga0496104_0216632 | Ga0496104_0216632_312_947 | 209 |
| 1466 | 3300048908 | Ga0496105_0002568 | Ga0496105_0002568_6844_7473 | 209 |
| 1467 | 3300048908 | Ga0496105_0014413 | Ga0496105_0014413_1232_1867 | 209 |
| 1468 | 3300048908 | Ga0496105_0031649 | Ga0496105_0031649_1136_1771 | 209 |
| 1469 | 3300048908 | Ga0496105_0056895 | Ga0496105_0056895_2109_2747 | 209 |
| 1470 | 3300048908 | Ga0496105_0210113 | Ga0496105_0210113_745_1380 | 209 |
| 1471 | 3300048909 | Ga0496106_0004445 | Ga0496106_0004445_108_743 | 209 |
| 1472 | 3300048909 | Ga0496106_0005448 | Ga0496106_0005448_7995_8624 | 209 |
| 1473 | 3300048909 | Ga0496106_0033086 | Ga0496106_0033086_750_1379 | 209 |
| 1474 | 3300048910 | Ga0496107_0000211 | Ga0496107_0000211_18980_19609 | 209 |
| 1475 | 3300048910 | Ga0496107_0001182 | Ga0496107_0001182_8897_9526 | 209 |
| 1476 | 3300048910 | Ga0496107_0196142 | Ga0496107_0196142_675_1304 | 209 |
| 1477 | 3300048911 | Ga0496108_0001556 | Ga0496108_0001556_17174_17803 | 209 |
| 1478 | 3300048911 | Ga0496108_0100359 | Ga0496108_0100359_1279_1908 | 209 |
| 1479 | 3300048911 | Ga0496108_0174987 | Ga0496108_0174987_278_907 | 209 |
| 1480 | 3300048912 | Ga0496109_0008140 | Ga0496109_0008140_2421_3050 | 209 |
| 1481 | 3300048912 | Ga0496109_0056714 | Ga0496109_0056714_2335_2964 | 209 |
| 1482 | 3300048912 | Ga0496109_0072533 | Ga0496109_0072533_1678_2313 | 209 |
| 1483 | 3300048912 | Ga0496109_0075064 | Ga0496109_0075064_187_822 | 209 |
| 1484 | 3300048912 | Ga0496109_0871024 | Ga0496109_0871024_153_791 | 209 |
| 1485 | 3300048913 | Ga0496110_0027742 | Ga0496110_0027742_2247_2876 | 209 |
| 1486 | 3300048913 | Ga0496110_0032238 | Ga0496110_0032238_1958_2587 | 209 |
| 1487 | 3300048913 | Ga0496110_0081598 | Ga0496110_0081598_1895_2524 | 209 |
| 1488 | 3300048913 | Ga0496110_0090518 | Ga0496110_0090518_1836_2465 | 209 |
| 1489 | 3300048913 | Ga0496110_0129477 | Ga0496110_0129477_229_864 | 209 |
| 1490 | 3300048913 | Ga0496110_0234555 | Ga0496110_0234555_277_912 | 209 |
| 1491 | 3300048913 | Ga0496110_0298129 | Ga0496110_0298129_171_809 | 209 |
| 1492 | 3300048914 | Ga0496111_0046620 | Ga0496111_0046620_56_685 | 209 |
| 1493 | 3300048914 | Ga0496111_0076688 | Ga0496111_0076688_1437_2075 | 209 |
| 1494 | 3300048914 | Ga0496111_0079711 | Ga0496111_0079711_34_669 | 209 |
| 1495 | 3300048914 | Ga0496111_0210340 | Ga0496111_0210340_629_1258 | 209 |
| 1496 | 3300048915 | Ga0496112_0008955 | Ga0496112_0008955_2108_2737 | 209 |
| 1497 | 3300048915 | Ga0496112_0035225 | Ga0496112_0035225_3419_4099 | 209 |
| 1498 | 3300048915 | Ga0496112_0036828 | Ga0496112_0036828_2051_2689 | 209 |
| 1499 | 3300048915 | Ga0496112_0067117 | Ga0496112_0067117_2355_2984 | 209 |
| 1500 | 3300048915 | Ga0496112_0144015 | Ga0496112_0144015_465_1094 | 209 |
| 1501 | 3300048915 | Ga0496112_0195870 | Ga0496112_0195870_179_814 | 209 |
| 1502 | 3300048916 | Ga0496113_0057299 | Ga0496113_0057299_400_1038 | 209 |
| 1503 | 3300048916 | Ga0496113_0170495 | Ga0496113_0170495_417_1052 | 209 |
| 1504 | 3300048916 | Ga0496113_0202783 | Ga0496113_0202783_39_668 | 209 |
| 1505 | 3300048916 | Ga0496113_0258680 | Ga0496113_0258680_562_1197 | 209 |
| 1506 | 3300048917 | Ga0496114_0070196 | Ga0496114_0070196_2245_2883 | 209 |
| 1507 | 3300048917 | Ga0496114_0196330 | Ga0496114_0196330_1008_1643 | 209 |
| 1508 | 3300048917 | Ga0496114_1002146 | Ga0496114_1002146_49_687 | 209 |
| 1509 | 3300048918 | Ga0496115_0001558 | Ga0496115_0001558_6432_7061 | 209 |
| 1510 | 3300048918 | Ga0496115_0017161 | Ga0496115_0017161_3523_4152 | 209 |
| 1511 | 3300048918 | Ga0496115_0040034 | Ga0496115_0040034_1985_2620 | 209 |
| 1512 | 3300048918 | Ga0496115_0069793 | Ga0496115_0069793_1848_2486 | 209 |
| 1513 | 3300048918 | Ga0496115_0080322 | Ga0496115_0080322_289_918 | 209 |
| 1514 | 3300048918 | Ga0496115_0112551 | Ga0496115_0112551_795_1436 | 209 |
| 1515 | 3300048918 | Ga0496115_0122480 | Ga0496115_0122480_1126_1761 | 209 |
| 1516 | 3300048918 | Ga0496115_0157203 | Ga0496115_0157203_82_717 | 209 |
| 1517 | 3300048918 | Ga0496115_0202159 | Ga0496115_0202159_737_1375 | 209 |
| 1518 | 3300048918 | Ga0496115_0525688 | Ga0496115_0525688_245_883 | 209 |
| 1519 | 3300048918 | Ga0496115_0786886 | Ga0496115_0786886_17_646 | 209 |
| 1520 | 3300048919 | Ga0496116_0002078 | Ga0496116_0002078_15199_15828 | 209 |
| 1521 | 3300048919 | Ga0496116_0093850 | Ga0496116_0093850_233_868 | 209 |
| 1522 | 3300048919 | Ga0496116_0164906 | Ga0496116_0164906_258_887 | 209 |
| 1523 | 3300048919 | Ga0496116_0225997 | Ga0496116_0225997_116_745 | 209 |
| 1524 | 3300048920 | Ga0496117_0031706 | Ga0496117_0031706_2619_3248 | 209 |
| 1525 | 3300048920 | Ga0496117_0042985 | Ga0496117_0042985_1473_2102 | 209 |
| 1526 | 3300048920 | Ga0496117_0232876 | Ga0496117_0232876_70_705 | 209 |
| 1527 | 3300048920 | Ga0496117_0298802 | Ga0496117_0298802_80_715 | 209 |
| 1528 | 3300048921 | Ga0496118_0004424 | Ga0496118_0004424_11651_12286 | 209 |
| 1529 | 3300048921 | Ga0496118_0138954 | Ga0496118_0138954_16_645 | 209 |
| 1530 | 3300048921 | Ga0496118_0243177 | Ga0496118_0243177_189_818 | 209 |
| 1531 | 3300048922 | Ga0496119_0017095 | Ga0496119_0017095_2818_3447 | 209 |
| 1532 | 3300048922 | Ga0496119_0034837 | Ga0496119_0034837_27_656 | 209 |
| 1533 | 3300048922 | Ga0496119_0061238 | Ga0496119_0061238_626_1261 | 209 |
| 1534 | 3300048922 | Ga0496119_0074875 | Ga0496119_0074875_200_835 | 209 |
| 1535 | 3300048922 | Ga0496119_0194523 | Ga0496119_0194523_17_652 | 209 |
| 1536 | 3300048922 | Ga0496119_0198599 | Ga0496119_0198599_203_838 | 209 |
| 1537 | 3300048923 | Ga0496120_0005339 | Ga0496120_0005339_3907_4542 | 209 |
| 1538 | 3300048923 | Ga0496120_0098903 | Ga0496120_0098903_220_849 | 209 |
| 1539 | 3300048924 | Ga0496121_0000595 | Ga0496121_0000595_435_1070 | 209 |
| 1540 | 3300048924 | Ga0496121_0005557 | Ga0496121_0005557_3847_4476 | 209 |
| 1541 | 3300048924 | Ga0496121_0019434 | Ga0496121_0019434_375_1010 | 209 |
| 1542 | 3300048924 | Ga0496121_0061191 | Ga0496121_0061191_788_1423 | 209 |
| 1543 | 3300048924 | Ga0496121_0095902 | Ga0496121_0095902_848_1483 | 209 |
| 1544 | 3300048924 | Ga0496121_0117010 | Ga0496121_0117010_648_1283 | 209 |
| 1545 | 3300048924 | Ga0496121_0147280 | Ga0496121_0147280_580_1212 | 209 |
| 1546 | 3300048924 | Ga0496121_0183519 | Ga0496121_0183519_400_1074 | 209 |
| 1547 | 3300048924 | Ga0496121_0340274 | Ga0496121_0340274_14_643 | 209 |
| 1548 | 3300048924 | Ga0496121_0433533 | Ga0496121_0433533_172_801 | 209 |
| 1549 | 3300048924 | Ga0496121_0512225 | Ga0496121_0512225_38_673 | 209 |
| 1550 | 3300048925 | Ga0496122_0011522 | Ga0496122_0011522_5247_5876 | 209 |
| 1551 | 3300048925 | Ga0496122_0068422 | Ga0496122_0068422_50_679 | 209 |
| 1552 | 3300048925 | Ga0496122_0084950 | Ga0496122_0084950_709_1338 | 209 |
| 1553 | 3300048925 | Ga0496122_0145149 | Ga0496122_0145149_582_1211 | 209 |
| 1554 | 3300048926 | Ga0496123_0032828 | Ga0496123_0032828_2208_2837 | 209 |
| 1555 | 3300048926 | Ga0496123_0169186 | Ga0496123_0169186_72_701 | 209 |
| 1556 | 3300048927 | Ga0496124_0002134 | Ga0496124_0002134_21162_21797 | 209 |
| 1557 | 3300048927 | Ga0496124_0014500 | Ga0496124_0014500_2982_3611 | 209 |
| 1558 | 3300048927 | Ga0496124_0040801 | Ga0496124_0040801_78_713 | 209 |
| 1559 | 3300048927 | Ga0496124_0077574 | Ga0496124_0077574_717_1352 | 209 |
| 1560 | 3300048927 | Ga0496124_0085904 | Ga0496124_0085904_421_1050 | 209 |
| 1561 | 3300048927 | Ga0496124_0218560 | Ga0496124_0218560_32_661 | 209 |
| 1562 | 3300048928 | Ga0496125_0001760 | Ga0496125_0001760_26710_27339 | 209 |
| 1563 | 3300048928 | Ga0496125_0022884 | Ga0496125_0022884_1720_2355 | 209 |
| 1564 | 3300048928 | Ga0496125_0029375 | Ga0496125_0029375_3605_4234 | 209 |
| 1565 | 3300048928 | Ga0496125_0033411 | Ga0496125_0033411_2342_2971 | 209 |
| 1566 | 3300048928 | Ga0496125_0449983 | Ga0496125_0449983_13_648 | 209 |
| 1567 | 3300048929 | Ga0496126_0002896 | Ga0496126_0002896_4265_4894 | 209 |
| 1568 | 3300048929 | Ga0496126_0003088 | Ga0496126_0003088_8687_9316 | 209 |
| 1569 | 3300048929 | Ga0496126_0012315 | Ga0496126_0012315_86_721 | 209 |
| 1570 | 3300048929 | Ga0496126_0014870 | Ga0496126_0014870_3574_4209 | 209 |
| 1571 | 3300048929 | Ga0496126_0018069 | Ga0496126_0018069_4912_5583 | 209 |
| 1572 | 3300048929 | Ga0496126_0024977 | Ga0496126_0024977_2747_3385 | 209 |
| 1573 | 3300048929 | Ga0496126_0028712 | Ga0496126_0028712_585_1220 | 209 |
| 1574 | 3300048929 | Ga0496126_0035078 | Ga0496126_0035078_3494_4132 | 209 |
| 1575 | 3300048929 | Ga0496126_0078078 | Ga0496126_0078078_113_742 | 209 |
| 1576 | 3300048929 | Ga0496126_0100566 | Ga0496126_0100566_505_1140 | 209 |
| 1577 | 3300048929 | Ga0496126_0110727 | Ga0496126_0110727_35_808 | 209 |
| 1578 | 3300048929 | Ga0496126_0232148 | Ga0496126_0232148_799_1434 | 209 |
| 1579 | 3300048929 | Ga0496126_0259281 | Ga0496126_0259281_340_975 | 209 |
| 1580 | 3300048929 | Ga0496126_0276906 | Ga0496126_0276906_580_1209 | 209 |
| 1581 | 3300048929 | Ga0496126_0318425 | Ga0496126_0318425_303_938 | 209 |
| 1582 | 3300048929 | Ga0496126_0394044 | Ga0496126_0394044_388_1023 | 209 |
| 1583 | 3300049127 | Ga0501306_002656 | Ga0501306_002656_1139_1768 | 209 |
| 1584 | 3300049127 | Ga0501306_015137 | Ga0501306_015137_134_763 | 209 |
| 1585 | 3300049129 | Ga0501309_003761 | Ga0501309_003761_1018_1647 | 209 |
| 1586 | 3300049130 | Ga0501310_023956 | Ga0501310_023956_59_688 | 209 |
| 1587 | 3300049161 | Ga0501305_004290 | Ga0501305_004290_947_1576 | 209 |
| 1588 | 3300049162 | Ga0501307_002313 | Ga0501307_002313_183_812 | 209 |
| 1589 | 3300049459 | Ga0495678_000623 | Ga0495678_000623_3659_4288 | 209 |
| 1590 | 3300049514 | Ga0501291_022338 | Ga0501291_022338_150_788 | 209 |
| 1591 | 3300049527 | Ga0501311_002113 | Ga0501311_002113_90_719 | 209 |
| 1592 | 3300049528 | Ga0501312_004273 | Ga0501312_004273_93_722 | 209 |
| 1593 | 3300049529 | Ga0501313_002650 | Ga0501313_002650_996_1625 | 209 |
| 1594 | 3300049529 | Ga0501313_023568 | Ga0501313_023568_11_640 | 209 |
| 1595 | 3300049530 | Ga0501314_001582 | Ga0501314_001582_947_1576 | 209 |
| 1596 | 3300049531 | Ga0501315_002874 | Ga0501315_002874_92_721 | 209 |
| 1597 | 3300049532 | Ga0501316_002563 | Ga0501316_002563_970_1599 | 209 |
| 1598 | 3300049532 | Ga0501316_011126 | Ga0501316_011126_348_977 | 209 |
| 1599 | 3300049532 | Ga0501316_025251 | Ga0501316_025251_14_643 | 209 |
| 1600 | 3300049533 | Ga0501317_002615 | Ga0501317_002615_947_1576 | 209 |
| 1601 | 3300049534 | Ga0501318_002206 | Ga0501318_002206_938_1567 | 209 |
| 1602 | 3300049535 | Ga0501319_000753 | Ga0501319_000753_90_719 | 209 |
| 1603 | 3300049536 | Ga0501320_001493 | Ga0501320_001493_88_717 | 209 |
| 1604 | 3300049537 | Ga0501321_002190 | Ga0501321_002190_947_1576 | 209 |
| 1605 | 3300049538 | Ga0501322_000622 | Ga0501322_000622_90_719 | 209 |
| 1606 | 3300049539 | Ga0501323_003195 | Ga0501323_003195_83_712 | 209 |
| 1607 | 3300049540 | Ga0501324_002767 | Ga0501324_002767_82_711 | 209 |
| 1608 | 3300049542 | Ga0501326_00418 | Ga0501326_00418_951_1580 | 209 |
| 1609 | 3300049544 | Ga0501328_00536 | Ga0501328_00536_79_708 | 209 |
| 1610 | 3300049546 | Ga0501330_001178 | Ga0501330_001178_69_698 | 209 |
| 1611 | 3300049551 | Ga0501335_001915 | Ga0501335_001915_79_708 | 209 |
| 1612 | 3300049551 | Ga0501335_007363 | Ga0501335_007363_300_929 | 209 |
| 1613 | 3300049568 | Ga0501031_0017200 | Ga0501031_0017200_2911_3552 | 209 |
| 1614 | 3300049568 | Ga0501031_0162521 | Ga0501031_0162521_570_1199 | 209 |
| 1615 | 3300049569 | Ga0501032_0013398 | Ga0501032_0013398_3069_3698 | 209 |
| 1616 | 3300049569 | Ga0501032_0086860 | Ga0501032_0086860_615_1256 | 209 |
| 1617 | 3300049570 | Ga0501033_0020362 | Ga0501033_0020362_3187_3816 | 209 |
| 1618 | 3300049570 | Ga0501033_0239388 | Ga0501033_0239388_491_1129 | 209 |
| 1619 | 3300049570 | Ga0501033_0510540 | Ga0501033_0510540_26_655 | 209 |
| 1620 | 3300049571 | Ga0501034_0004953 | Ga0501034_0004953_1453_2091 | 209 |
| 1621 | 3300049571 | Ga0501034_0007894 | Ga0501034_0007894_352_981 | 209 |
| 1622 | 3300049571 | Ga0501034_0008566 | Ga0501034_0008566_1780_2418 | 209 |
| 1623 | 3300049571 | Ga0501034_0041632 | Ga0501034_0041632_1033_1662 | 209 |
| 1624 | 3300049571 | Ga0501034_0075309 | Ga0501034_0075309_37_666 | 209 |
| 1625 | 3300049571 | Ga0501034_0124591 | Ga0501034_0124591_835_1464 | 209 |
| 1626 | 3300049571 | Ga0501034_0409286 | Ga0501034_0409286_468_1097 | 209 |
| 1627 | 3300049571 | Ga0501034_0468117 | Ga0501034_0468117_269_898 | 209 |
| 1628 | 3300049572 | Ga0501036_0020290 | Ga0501036_0020290_1083_1712 | 209 |
| 1629 | 3300049572 | Ga0501036_0022138 | Ga0501036_0022138_3034_3675 | 209 |
| 1630 | 3300049572 | Ga0501036_0134376 | Ga0501036_0134376_491_1129 | 209 |
| 1631 | 3300049573 | Ga0501037_0094135 | Ga0501037_0094135_986_1615 | 209 |
| 1632 | 3300049574 | Ga0501038_0008634 | Ga0501038_0008634_5242_5871 | 209 |
| 1633 | 3300049574 | Ga0501038_0028009 | Ga0501038_0028009_3704_4345 | 209 |
| 1634 | 3300049575 | Ga0501039_0014140 | Ga0501039_0014140_2047_2688 | 209 |
| 1635 | 3300049575 | Ga0501039_0045132 | Ga0501039_0045132_2218_2847 | 209 |
| 1636 | 3300049576 | Ga0501040_0023343 | Ga0501040_0023343_2807_3448 | 209 |
| 1637 | 3300049576 | Ga0501040_0577461 | Ga0501040_0577461_80_721 | 209 |
| 1638 | 3300049577 | Ga0501041_0022151 | Ga0501041_0022151_1892_2533 | 209 |
| 1639 | 3300049578 | Ga0501042_0018622 | Ga0501042_0018622_1066_1707 | 209 |
| 1640 | 3300049579 | Ga0501043_0076813 | Ga0501043_0076813_901_1542 | 209 |
| 1641 | 3300049579 | Ga0501043_0406978 | Ga0501043_0406978_301_930 | 209 |
| 1642 | 3300049580 | Ga0501046_0044421 | Ga0501046_0044421_1472_2113 | 209 |
| 1643 | 3300049581 | Ga0501047_0016648 | Ga0501047_0016648_33_662 | 209 |
| 1644 | 3300049581 | Ga0501047_0025791 | Ga0501047_0025791_3915_4544 | 209 |
| 1645 | 3300049581 | Ga0501047_0098304 | Ga0501047_0098304_283_912 | 209 |
| 1646 | 3300049581 | Ga0501047_0159512 | Ga0501047_0159512_478_1107 | 209 |
| 1647 | 3300049581 | Ga0501047_0760205 | Ga0501047_0760205_78_707 | 209 |
| 1648 | 3300049582 | Ga0501048_0005997 | Ga0501048_0005997_5525_6166 | 209 |
| 1649 | 3300049582 | Ga0501048_0404578 | Ga0501048_0404578_244_885 | 209 |
| 1650 | 3300049583 | Ga0501067_0035265 | Ga0501067_0035265_1019_1648 | 209 |
| 1651 | 3300049584 | Ga0501068_0008913 | Ga0501068_0008913_1374_2012 | 209 |
| 1652 | 3300049584 | Ga0501068_0029708 | Ga0501068_0029708_1363_2004 | 209 |
| 1653 | 3300049586 | Ga0501070_0042082 | Ga0501070_0042082_3083_3712 | 209 |
| 1654 | 3300049586 | Ga0501070_0164392 | Ga0501070_0164392_982_1623 | 209 |
| 1655 | 3300049586 | Ga0501070_0326087 | Ga0501070_0326087_282_911 | 209 |
| 1656 | 3300049587 | Ga0501071_0004678 | Ga0501071_0004678_6007_6648 | 209 |
| 1657 | 3300049588 | Ga0501072_0028077 | Ga0501072_0028077_1991_2632 | 209 |
| 1658 | 3300049588 | Ga0501072_0345439 | Ga0501072_0345439_167_808 | 209 |
| 1659 | 3300049588 | Ga0501072_0703885 | Ga0501072_0703885_88_717 | 209 |
| 1660 | 3300049589 | Ga0501073_0003357 | Ga0501073_0003357_8266_8895 | 209 |
| 1661 | 3300049589 | Ga0501073_0039463 | Ga0501073_0039463_2655_3284 | 209 |
| 1662 | 3300049589 | Ga0501073_0165472 | Ga0501073_0165472_713_1342 | 209 |
| 1663 | 3300049589 | Ga0501073_0642518 | Ga0501073_0642518_25_654 | 209 |
| 1664 | 3300049590 | Ga0501074_0007721 | Ga0501074_0007721_4756_5385 | 209 |
| 1665 | 3300049590 | Ga0501074_0286036 | Ga0501074_0286036_478_1107 | 209 |
| 1666 | 3300049591 | Ga0501075_0030276 | Ga0501075_0030276_987_1628 | 209 |
| 1667 | 3300049591 | Ga0501075_0240906 | Ga0501075_0240906_81_722 | 209 |
| 1668 | 3300049591 | Ga0501075_0417521 | Ga0501075_0417521_204_845 | 209 |
| 1669 | 3300049592 | Ga0501076_0044414 | Ga0501076_0044414_1392_2033 | 209 |
| 1670 | 3300049592 | Ga0501076_0100948 | Ga0501076_0100948_1399_2040 | 209 |
| 1671 | 3300049592 | Ga0501076_0492937 | Ga0501076_0492937_279_941 | 209 |
| 1672 | 3300049593 | Ga0501077_0034231 | Ga0501077_0034231_2327_2956 | 209 |
| 1673 | 3300049593 | Ga0501077_0042563 | Ga0501077_0042563_1112_1753 | 209 |
| 1674 | 3300049593 | Ga0501077_0200672 | Ga0501077_0200672_12_653 | 209 |
| 1675 | 3300049661 | Ga0501217_024948 | Ga0501217_024948_587_1216 | 209 |
| 1676 | 3300049668 | Ga0501233_104893 | Ga0501233_104893_64_693 | 209 |
| 1677 | 3300049671 | Ga0501238_000691 | Ga0501238_000691_516_1145 | 209 |
| 1678 | 3300049682 | Ga0501252_005667 | Ga0501252_005667_59_712 | 209 |
| 1679 | 3300049686 | Ga0501257_009500 | Ga0501257_009500_537_1166 | 209 |
| 1680 | 3300049704 | Ga0501221_014348 | Ga0501221_014348_428_1057 | 209 |
| 1681 | 3300049705 | Ga0501225_0137206 | Ga0501225_0137206_20_649 | 209 |
| 1682 | 3300049707 | Ga0501234_039781 | Ga0501234_039781_127_756 | 209 |
| 1683 | 3300049741 | Ga0501079_0024961 | Ga0501079_0024961_834_1475 | 209 |
| 1684 | 3300049741 | Ga0501079_0339216 | Ga0501079_0339216_193_834 | 209 |
| 1685 | 3300049741 | Ga0501079_0403762 | Ga0501079_0403762_339_968 | 209 |
| 1686 | 3300049742 | Ga0501080_0043101 | Ga0501080_0043101_702_1343 | 209 |
| 1687 | 3300049742 | Ga0501080_0051362 | Ga0501080_0051362_106_735 | 209 |
| 1688 | 3300049742 | Ga0501080_0879896 | Ga0501080_0879896_118_759 | 209 |
| 1689 | 3300049743 | Ga0501081_0101801 | Ga0501081_0101801_673_1314 | 209 |
| 1690 | 3300049744 | Ga0501083_0113618 | Ga0501083_0113618_1097_1726 | 209 |
| 1691 | 3300049772 | Ga0501275_005800 | Ga0501275_005800_15_644 | 209 |
| 1692 | 3300049822 | Ga0501035_0179600 | Ga0501035_0179600_927_1556 | 209 |
| 1693 | 3300049822 | Ga0501035_0254019 | Ga0501035_0254019_277_906 | 209 |
| 1694 | 3300049823 | Ga0501044_0029662 | Ga0501044_0029662_769_1398 | 209 |
| 1695 | 3300049823 | Ga0501044_0121126 | Ga0501044_0121126_751_1380 | 209 |
| 1696 | 3300049823 | Ga0501044_0521824 | Ga0501044_0521824_77_706 | 209 |
| 1697 | 3300049824 | Ga0501045_0061565 | Ga0501045_0061565_1390_2031 | 209 |
| 1698 | 3300050489 | nmdc:mga03683_206046_c1 | nmdc:mga03683_206046_c1_19_657 | 209 |
| 1699 | 3300050489 | nmdc:mga03683_2387_c1 | nmdc:mga03683_2387_c1_108_746 | 209 |
| 1700 | 3300050489 | nmdc:mga03683_40737_c1 | nmdc:mga03683_40737_c1_402_1040 | 209 |
| 1701 | 3300050490 | nmdc:mga03n38_175383_c1 | nmdc:mga03n38_175383_c1_28_666 | 209 |
| 1702 | 3300050490 | nmdc:mga03n38_233742_c1 | nmdc:mga03n38_233742_c1_230_865 | 209 |
| 1703 | 3300050490 | nmdc:mga03n38_351494_c1 | nmdc:mga03n38_351494_c1_15_653 | 209 |
| 1704 | 3300050491 | nmdc:mga00v17_115272_c1 | nmdc:mga00v17_115272_c1_1064_1696 | 209 |
| 1705 | 3300050491 | nmdc:mga00v17_196424_c1 | nmdc:mga00v17_196424_c1_146_781 | 209 |
| 1706 | 3300050492 | nmdc:mga0yw44_104074_c1 | nmdc:mga0yw44_104074_c1_372_1013 | 209 |
| 1707 | 3300050492 | nmdc:mga0yw44_17493_c1 | nmdc:mga0yw44_17493_c1_134_772 | 209 |
| 1708 | 3300050492 | nmdc:mga0yw44_24969_c1 | nmdc:mga0yw44_24969_c1_2052_2687 | 209 |
| 1709 | 3300050492 | nmdc:mga0yw44_306479_c1 | nmdc:mga0yw44_306479_c1_10_645 | 209 |
| 1710 | 3300050492 | nmdc:mga0yw44_35725_c1 | nmdc:mga0yw44_35725_c1_1556_2194 | 209 |
| 1711 | 3300050492 | nmdc:mga0yw44_384153_c1 | nmdc:mga0yw44_384153_c1_15_680 | 209 |
| 1712 | 3300050492 | nmdc:mga0yw44_446360_c1 | nmdc:mga0yw44_446360_c1_161_796 | 209 |
| 1713 | 3300050492 | nmdc:mga0yw44_479903_c1 | nmdc:mga0yw44_479903_c1_18_656 | 209 |
| 1714 | 3300050492 | nmdc:mga0yw44_52947_c1 | nmdc:mga0yw44_52947_c1_101_736 | 209 |
| 1715 | 3300050493 | nmdc:mga0k408_121808_c1 | nmdc:mga0k408_121808_c1_572_1201 | 209 |
| 1716 | 3300050493 | nmdc:mga0k408_135362_c1 | nmdc:mga0k408_135362_c1_376_1014 | 209 |
| 1717 | 3300050493 | nmdc:mga0k408_19861_c1 | nmdc:mga0k408_19861_c1_502_1137 | 209 |
| 1718 | 3300050493 | nmdc:mga0k408_3517_c1 | nmdc:mga0k408_3517_c1_28_666 | 209 |
| 1719 | 3300050493 | nmdc:mga0k408_38074_c1 | nmdc:mga0k408_38074_c1_1869_2504 | 209 |
| 1720 | 3300050494 | nmdc:mga06z11_1558_c1 | nmdc:mga06z11_1558_c1_6003_6632 | 209 |
| 1721 | 3300050494 | nmdc:mga06z11_40602_c1 | nmdc:mga06z11_40602_c1_1499_2137 | 209 |
| 1722 | 3300050495 | nmdc:mga04h51_135745_c1 | nmdc:mga04h51_135745_c1_167_805 | 209 |
| 1723 | 3300050495 | nmdc:mga04h51_5029_c1 | nmdc:mga04h51_5029_c1_972_1607 | 209 |
| 1724 | 3300050495 | nmdc:mga04h51_591_c1 | nmdc:mga04h51_591_c1_4628_5257 | 209 |
| 1725 | 3300050496 | nmdc:mga07m45_146465_c1 | nmdc:mga07m45_146465_c1_371_1006 | 209 |
| 1726 | 3300050496 | nmdc:mga07m45_328766_c1 | nmdc:mga07m45_328766_c1_153_794 | 209 |
| 1727 | 3300050496 | nmdc:mga07m45_42731_c1 | nmdc:mga07m45_42731_c1_1066_1695 | 209 |
| 1728 | 3300050496 | nmdc:mga07m45_49433_c1 | nmdc:mga07m45_49433_c1_921_1559 | 209 |
| 1729 | 3300050507 | nmdc:mga05p37_121329_c1 | nmdc:mga05p37_121329_c1_2252_2881 | 209 |
| 1730 | 3300050507 | nmdc:mga05p37_426432_c1 | nmdc:mga05p37_426432_c1_897_1526 | 209 |
| 1731 | 3300050507 | nmdc:mga05p37_693088_c1 | nmdc:mga05p37_693088_c1_464_1096 | 209 |
| 1732 | 3300050507 | nmdc:mga05p37_735416_c1 | nmdc:mga05p37_735416_c1_191_820 | 209 |
| 1733 | 3300050507 | nmdc:mga05p37_78589_c1 | nmdc:mga05p37_78589_c1_1483_2118 | 209 |
| 1734 | 3300050508 | nmdc:mga09592_226571_c1 | nmdc:mga09592_226571_c1_899_1534 | 209 |
| 1735 | 3300050508 | nmdc:mga09592_500131_c1 | nmdc:mga09592_500131_c1_333_962 | 209 |
| 1736 | 3300050509 | nmdc:mga0qj67_218396_c1 | nmdc:mga0qj67_218396_c1_727_1356 | 209 |
| 1737 | 3300050509 | nmdc:mga0qj67_321467_c1 | nmdc:mga0qj67_321467_c1_27_656 | 209 |
| 1738 | 3300050509 | nmdc:mga0qj67_7671_c1 | nmdc:mga0qj67_7671_c1_3456_4136 | 209 |
| 1739 | 3300050510 | nmdc:mga06r32_238405_c1 | nmdc:mga06r32_238405_c1_428_1057 | 209 |
| 1740 | 3300050510 | nmdc:mga06r32_34913_c1 | nmdc:mga06r32_34913_c1_1237_1917 | 209 |
| 1741 | 3300050510 | nmdc:mga06r32_423381_c1 | nmdc:mga06r32_423381_c1_608_1237 | 209 |
| 1742 | 3300050510 | nmdc:mga06r32_873733_c1 | nmdc:mga06r32_873733_c1_186_815 | 209 |
| 1743 | 3300050511 | nmdc:mga08y16_333484_c1 | nmdc:mga08y16_333484_c1_488_1126 | 209 |
| 1744 | 3300050511 | nmdc:mga08y16_64120_c1 | nmdc:mga08y16_64120_c1_849_1478 | 209 |
| 1745 | 3300050512 | nmdc:mga0n895_479443_c1 | nmdc:mga0n895_479443_c1_13_678 | 209 |
| 1746 | 3300050513 | nmdc:mga0rr50_326390_c1 | nmdc:mga0rr50_326390_c1_73_702 | 209 |
| 1747 | 3300050513 | nmdc:mga0rr50_456314_c1 | nmdc:mga0rr50_456314_c1_34_666 | 209 |
| 1748 | 3300050515 | nmdc:mga0a205_137912_c1 | nmdc:mga0a205_137912_c1_534_1166 | 209 |
| 1749 | 3300050515 | nmdc:mga0a205_321426_c1 | nmdc:mga0a205_321426_c1_248_877 | 209 |
| 1750 | 3300050516 | nmdc:mga0sz30_151_c1 | nmdc:mga0sz30_151_c1_2606_3244 | 209 |
| 1751 | 3300050516 | nmdc:mga0sz30_23802_c1 | nmdc:mga0sz30_23802_c1_816_1454 | 209 |
| 1752 | 3300050516 | nmdc:mga0sz30_24447_c1 | nmdc:mga0sz30_24447_c1_1505_2140 | 209 |
| 1753 | 3300050516 | nmdc:mga0sz30_9764_c1 | nmdc:mga0sz30_9764_c1_1967_2602 | 209 |
| 1754 | 3300053077 | Ga0495601_0250123 | Ga0495601_0250123_420_1055 | 209 |
| 1755 | 3300053077 | Ga0495601_0487686 | Ga0495601_0487686_78_716 | 209 |
| 1756 | 3300053078 | Ga0495612_0017337 | Ga0495612_0017337_1772_2410 | 209 |
| 1757 | 3300053078 | Ga0495612_0138688 | Ga0495612_0138688_182_817 | 209 |
| 1758 | 3300053080 | Ga0500635_0176372 | Ga0500635_0176372_109_744 | 209 |
| 1759 | 3300053084 | Ga0495595_0122373 | Ga0495595_0122373_47_682 | 209 |
| 1760 | 3300053085 | Ga0495619_0051692 | Ga0495619_0051692_571_1206 | 209 |
| 1761 | 3300053085 | Ga0495619_0171202 | Ga0495619_0171202_65_700 | 209 |
| 1762 | 3300053085 | Ga0495619_0212571 | Ga0495619_0212571_22_660 | 209 |
| 1763 | 3300053086 | Ga0500578_0000809 | Ga0500578_0000809_13570_14199 | 209 |
| 1764 | 3300053086 | Ga0500578_0114986 | Ga0500578_0114986_898_1533 | 209 |
| 1765 | 3300053086 | Ga0500578_0186426 | Ga0500578_0186426_572_1207 | 209 |
| 1766 | 3300053087 | Ga0500643_000185 | Ga0500643_000185_7308_7943 | 209 |
| 1767 | 3300053087 | Ga0500643_044642 | Ga0500643_044642_122_751 | 209 |
| 1768 | 3300053088 | Ga0500644_0000046 | Ga0500644_0000046_65749_66378 | 209 |
| 1769 | 3300053088 | Ga0500644_0001130 | Ga0500644_0001130_6917_7546 | 209 |
| 1770 | 3300053091 | Ga0500647_0080260 | Ga0500647_0080260_654_1286 | 209 |
| 1771 | 3300053092 | Ga0500583_0008495 | Ga0500583_0008495_741_1376 | 209 |
| 1772 | 3300053092 | Ga0500583_0304967 | Ga0500583_0304967_94_732 | 209 |
| 1773 | 3300053093 | Ga0500651_0012726 | Ga0500651_0012726_1870_2499 | 209 |
| 1774 | 3300053093 | Ga0500651_0031021 | Ga0500651_0031021_106_756 | 209 |
| 1775 | 3300053093 | Ga0500651_0312749 | Ga0500651_0312749_215_853 | 209 |
| 1776 | 3300053094 | Ga0500566_0000352 | Ga0500566_0000352_9660_10292 | 209 |
| 1777 | 3300053094 | Ga0500566_0002819 | Ga0500566_0002819_7171_7806 | 209 |
| 1778 | 3300053094 | Ga0500566_0002995 | Ga0500566_0002995_3827_4462 | 209 |
| 1779 | 3300053095 | Ga0500640_014140 | Ga0500640_014140_634_1266 | 209 |
| 1780 | 3300053095 | Ga0500640_031872 | Ga0500640_031872_70_705 | 209 |
| 1781 | 3300053096 | Ga0500641_0002113 | Ga0500641_0002113_3011_3655 | 209 |
| 1782 | 3300053102 | Ga0500554_015008 | Ga0500554_015008_1271_1900 | 209 |
| 1783 | 3300053104 | Ga0500556_0015525 | Ga0500556_0015525_962_1597 | 209 |
| 1784 | 3300053105 | Ga0500557_000017 | Ga0500557_000017_5386_6021 | 209 |
| 1785 | 3300053105 | Ga0500557_015493 | Ga0500557_015493_1288_1917 | 209 |
| 1786 | 3300053108 | Ga0500562_000358 | Ga0500562_000358_3336_3977 | 209 |
| 1787 | 3300053108 | Ga0500562_069680 | Ga0500562_069680_221_856 | 209 |
| 1788 | 3300053109 | Ga0500569_066247 | Ga0500569_066247_43_678 | 209 |
| 1789 | 3300053111 | Ga0500572_000236 | Ga0500572_000236_5420_6052 | 209 |
| 1790 | 3300053111 | Ga0500572_001411 | Ga0500572_001411_1688_2323 | 209 |
| 1791 | 3300053111 | Ga0500572_077539 | Ga0500572_077539_97_732 | 209 |
| 1792 | 3300053115 | Ga0500591_048217 | Ga0500591_048217_503_1135 | 209 |
| 1793 | 3300053118 | Ga0500594_0000012 | Ga0500594_0000012_29701_30330 | 209 |
| 1794 | 3300053118 | Ga0500594_0104344 | Ga0500594_0104344_86_721 | 209 |
| 1795 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_406353_406982 | 209 |
| 1796 | 3300053119 | Ga0500595_002159 | Ga0500595_002159_7528_8163 | 209 |
| 1797 | 3300053119 | Ga0500595_005559 | Ga0500595_005559_4527_5162 | 209 |
| 1798 | 3300053119 | Ga0500595_016779 | Ga0500595_016779_38_667 | 209 |
| 1799 | 3300053119 | Ga0500595_034990 | Ga0500595_034990_771_1406 | 209 |
| 1800 | 3300053121 | Ga0500607_054913 | Ga0500607_054913_534_1169 | 209 |
| 1801 | 3300053122 | Ga0500608_000012 | Ga0500608_000012_74237_74866 | 209 |
| 1802 | 3300053122 | Ga0500608_110921 | Ga0500608_110921_456_1088 | 209 |
| 1803 | 3300053122 | Ga0500608_141294 | Ga0500608_141294_142_771 | 209 |
| 1804 | 3300053123 | Ga0500614_002014 | Ga0500614_002014_860_1492 | 209 |
| 1805 | 3300053125 | Ga0500618_000493 | Ga0500618_000493_24463_25092 | 209 |
| 1806 | 3300053125 | Ga0500618_097150 | Ga0500618_097150_13_648 | 209 |
| 1807 | 3300053130 | Ga0500642_0000181 | Ga0500642_0000181_24526_25161 | 209 |
| 1808 | 3300053130 | Ga0500642_0010289 | Ga0500642_0010289_1701_2336 | 209 |
| 1809 | 3300053133 | Ga0500655_016438 | Ga0500655_016438_533_1168 | 209 |
| 1810 | 3300053133 | Ga0500655_034636 | Ga0500655_034636_272_907 | 209 |
| 1811 | 3300053134 | Ga0500658_0003891 | Ga0500658_0003891_1253_1882 | 209 |
| 1812 | 3300053134 | Ga0500658_0044644 | Ga0500658_0044644_548_1222 | 209 |
| 1813 | 3300053136 | Ga0500559_0000045 | Ga0500559_0000045_93684_94313 | 209 |
| 1814 | 3300053136 | Ga0500559_0000154 | Ga0500559_0000154_53028_53663 | 209 |
| 1815 | 3300053136 | Ga0500559_0002554 | Ga0500559_0002554_2671_3300 | 209 |
| 1816 | 3300053136 | Ga0500559_0003634 | Ga0500559_0003634_442_1074 | 209 |
| 1817 | 3300053136 | Ga0500559_0004656 | Ga0500559_0004656_970_1599 | 209 |
| 1818 | 3300053136 | Ga0500559_0008891 | Ga0500559_0008891_2323_2958 | 209 |
| 1819 | 3300053138 | Ga0500564_002954 | Ga0500564_002954_5706_6335 | 209 |
| 1820 | 3300053140 | Ga0500573_0020144 | Ga0500573_0020144_2984_3619 | 209 |
| 1821 | 3300053140 | Ga0500573_0226628 | Ga0500573_0226628_247_876 | 209 |
| 1822 | 3300053142 | Ga0500577_0006581 | Ga0500577_0006581_1596_2225 | 209 |
| 1823 | 3300053147 | Ga0500589_142113 | Ga0500589_142113_40_675 | 209 |
| 1824 | 3300053148 | Ga0500590_110123 | Ga0500590_110123_285_917 | 209 |
| 1825 | 3300053150 | Ga0500603_000776 | Ga0500603_000776_6339_6971 | 209 |
| 1826 | 3300053151 | Ga0500604_0031763 | Ga0500604_0031763_630_1265 | 209 |
| 1827 | 3300053151 | Ga0500604_0032434 | Ga0500604_0032434_506_1141 | 209 |
| 1828 | 3300053153 | Ga0500616_0000404 | Ga0500616_0000404_20630_21268 | 209 |
| 1829 | 3300053153 | Ga0500616_0135878 | Ga0500616_0135878_445_1074 | 209 |
| 1830 | 3300053156 | Ga0500622_0000516 | Ga0500622_0000516_28626_29267 | 209 |
| 1831 | 3300053156 | Ga0500622_0011169 | Ga0500622_0011169_101_730 | 209 |
| 1832 | 3300053156 | Ga0500622_0024238 | Ga0500622_0024238_2007_2636 | 209 |
| 1833 | 3300053156 | Ga0500622_0028564 | Ga0500622_0028564_702_1331 | 209 |
| 1834 | 3300053156 | Ga0500622_0090340 | Ga0500622_0090340_610_1251 | 209 |
| 1835 | 3300053158 | Ga0500627_0011498 | Ga0500627_0011498_2623_3252 | 209 |
| 1836 | 3300053158 | Ga0500627_0055449 | Ga0500627_0055449_76_711 | 209 |
| 1837 | 3300053159 | Ga0500630_005483 | Ga0500630_005483_1707_2339 | 209 |
| 1838 | 3300053162 | Ga0500638_156108 | Ga0500638_156108_143_778 | 209 |
| 1839 | 3300053163 | Ga0500639_000014 | Ga0500639_000014_114951_115583 | 209 |
| 1840 | 3300053163 | Ga0500639_050399 | Ga0500639_050399_176_811 | 209 |
| 1841 | 3300053163 | Ga0500639_123797 | Ga0500639_123797_380_1015 | 209 |
| 1842 | 3300053163 | Ga0500639_127709 | Ga0500639_127709_76_711 | 209 |
| 1843 | 3300053177 | Ga0500636_0000343 | Ga0500636_0000343_12751_13386 | 209 |
| 1844 | 3300053177 | Ga0500636_0044785 | Ga0500636_0044785_1652_2299 | 209 |
| 1845 | 3300053177 | Ga0500636_0192202 | Ga0500636_0192202_235_870 | 209 |
| 1846 | 3300053178 | Ga0500637_0000189 | Ga0500637_0000189_20879_21514 | 209 |
| 1847 | 3300053730 | Ga0500645_000226 | Ga0500645_000226_18841_19470 | 209 |
| 1848 | 3300053730 | Ga0500645_000517 | Ga0500645_000517_11834_12463 | 209 |
| 1849 | 3300053730 | Ga0500645_007179 | Ga0500645_007179_2415_3086 | 209 |
| 1850 | 3300053731 | Ga0500609_002886 | Ga0500609_002886_1086_1715 | 209 |
| 1851 | 3300053731 | Ga0500609_003154 | Ga0500609_003154_391_1026 | 209 |
| 1852 | 3300053733 | Ga0500552_000284 | Ga0500552_000284_2191_2829 | 209 |
| 1853 | 3300053735 | Ga0500596_000316 | Ga0500596_000316_486_1118 | 209 |
| 1854 | 3300053735 | Ga0500596_002168 | Ga0500596_002168_171_806 | 209 |
| 1855 | 3300053735 | Ga0500596_009060 | Ga0500596_009060_416_1051 | 209 |
| 1856 | 3300053737 | Ga0500601_000248 | Ga0500601_000248_7576_8211 | 209 |
| 1857 | 3300054114 | Ga0501084_0003455 | Ga0501084_0003455_10550_11191 | 209 |
| 1858 | 3300054114 | Ga0501084_0068639 | Ga0501084_0068639_1682_2311 | 209 |
| 1859 | 3300054114 | Ga0501084_0130720 | Ga0501084_0130720_1074_1703 | 209 |
| 1860 | 3300055283 | Ga0500661_000533 | Ga0500661_000533_108_743 | 209 |
| 1861 | 3300059504 | Ga0587082_009854 | Ga0587082_009854_108_737 | 209 |
| 1862 | 3300059647 | Ga0587079_000097 | Ga0587079_000097_4346_4975 | 209 |
| 1863 | 3300060353 | Ga0501082_0030220 | Ga0501082_0030220_2663_3304 | 209 |
| 1864 | 3300060353 | Ga0501082_0355097 | Ga0501082_0355097_38_667 | 209 |
| 1865 | 3300060353 | Ga0501082_0861408 | Ga0501082_0861408_30_659 | 209 |
| 1866 | 3300061734 | Ga0530510_0016121 | Ga0530510_0016121_2146_2787 | 209 |
| 1867 | 3300061734 | Ga0530510_0869168 | Ga0530510_0869168_19_657 | 209 |
| 1868 | iso_pu_bacteria | 2585428106 | 2587917920 | 209 |
| 1869 | iso_pu_bacteria | 2643221574 | 2643882746 | 209 |
| 1870 | iso_pu_bacteria | 2643221584 | 2643929551 | 209 |
| 1871 | iso_pu_bacteria | 2643221640 | 2644224456 | 209 |
| 1872 | iso_pu_bacteria | 2643221642 | 2644234608 | 209 |
| 1873 | iso_pu_bacteria | 2643221699 | 2644549821 | 209 |
| 1874 | iso_pu_bacteria | 2643221699 | 2644550332 | 209 |
| 1875 | iso_pu_bacteria | 2738541281 | 2738743184 | 209 |
| 1876 | iso_pu_bacteria | 2738543032 | 2739352801 | 209 |
| 1877 | iso_pu_bacteria | 2791355048 | 2792459656 | 209 |
| 1878 | iso_pu_bacteria | 2829745981 | 2829746569 | 209 |
| 1879 | iso_pu_bacteria | 2835312727 | 2835319684 | 209 |
| 1880 | iso_pu_bacteria | 2842698319 | 2842700465 | 209 |
| 1881 | iso_pu_bacteria | 2843744320 | 2843747312 | 209 |
| 1882 | iso_pu_bacteria | 2849560528 | 2849563209 | 209 |
| 1883 | iso_pu_bacteria | 2849573788 | 2849575251 | 209 |
| 1884 | iso_pu_bacteria | 2851153111 | 2851158008 | 209 |
| 1885 | iso_pu_bacteria | 2882456835 | 2882457647 | 209 |
| 1886 | iso_pu_bacteria | 2884298095 | 2884301187 | 209 |
| 1887 | iso_pu_bacteria | 2898329390 | 2898333478 | 209 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v9s-assembly1.cif.gz_A | crystal structure of tt0130 protein from thermus thermophilus hb8 | 0.9775 | 3 | 209 |
| 1v9s-assembly1.cif.gz_D | crystal structure of tt0130 protein from thermus thermophilus hb8 | 0.976 | 3 | 209 |
| 6wn8-assembly1.cif.gz_B | 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae | 0.9751 | 2 | 209 |
| 2ehj-assembly1.cif.gz_A | structure of uracil phosphoribosyl transferase | 0.9729 | 2 | 209 |
| 6wn8-assembly1.cif.gz_D | 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae | 0.9712 | 2 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWE6_1_209_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9888 | 1 | 209 | 3.40.50.2020 |
| af_O74449_1_266_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9757 | 12 | 44 | 1.25.40.10 |
| 5e38B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9564 | 5 | 206 | 3.40.50.2020 |
| af_B6U5U2_13_228_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9537 | 2 | 208 | 3.40.50.2020 |
| 2e55D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9534 | 4 | 209 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A662F2M2-F1-model_v4 | uracil phosphoribosyltransferase (EC 2.4.2.9) | 0.9932 | 116 | 208 |
GO:0004845
GO:0005525 GO:0016020 |
| AF-A0A7X6Z459-F1-model_v4 | Uracil phosphoribosyltransferase (EC 2.4.2.9) | 0.9923 | 5 | 98 |
GO:0004845
|
| AF-A0A645IBZ4-F1-model_v4 | Uracil phosphoribosyltransferase (EC 2.4.2.9) | 0.9913 | 133 | 209 |
GO:0004845
|
| AF-A0A379AD87-F1-model_v4 | Uracil phosphoribosyltransferase (EC 2.4.2.9) | 0.9905 | 133 | 209 |
GO:0004845
|
| AF-A0A2S8MBG0-F1-model_v4 | deleted | 0.9879 | 125 | 209 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar