F495916

General Info

Members Datasets Scaffolds Average Seq Length
1862 626 1788 87

Family's Representative Sequence

Representative Sequence 3300003575|Ga0007409J51694_1081670|Ga0007409J51694_10816702
Length 98
Sequence MATLQQSASGKKDGDIRYLTPLNIETNKTKKYCRFKKSGIKYIDYKDADFLLKFVNEQGKILPRRLTGTSLKYQRKVSVAVKRARHLALMPYVADLLK

Samples

Sample ID Description Type Environment
1 2088090002 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA Metagenome Rhizosphere
2 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
3 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
4 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
5 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
6 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
7 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
8 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
9 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
10 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
11 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
12 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
13 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
14 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
15 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
16 2738541283 Pedobacter sp. OK701 Isolate Unclassified
17 2738541284 Pedobacter sp. YR016 Isolate Unclassified
18 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
19 2738541302 Pedobacter sp. CF074 Isolate Unclassified
20 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
21 2738543023 Pedobacter sp. OK628 Isolate Unclassified
22 2739367651 Pedobacter sp. OK291 Isolate Unclassified
23 2739367656 Pedobacter sp. CF523 Isolate Unclassified
24 2739367663 Pedobacter sp. YR510 Isolate Unclassified
25 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
26 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
27 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
28 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
29 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
30 2818991437 Pedobacter terrae 518 Isolate Unclassified
31 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
32 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
33 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
34 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
35 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
36 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
37 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
38 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
39 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
40 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
41 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
42 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
43 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
44 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
45 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
46 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
47 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
48 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
49 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
50 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
51 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
52 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
53 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
54 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
55 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
56 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
57 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
58 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
59 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
60 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
61 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
62 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
63 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
64 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
65 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
66 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
67 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
68 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
69 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
70 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
71 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
72 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
73 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
74 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
75 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
76 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
77 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
78 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
79 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
80 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
81 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
82 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
83 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
84 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
85 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
86 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
87 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
88 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
89 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
90 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
91 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
92 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
93 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
94 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
95 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
96 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
97 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
100 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
102 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
103 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
104 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
105 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
106 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
107 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
108 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
109 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
110 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
111 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
112 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
113 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
114 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
115 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
116 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
117 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
118 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
119 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
120 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
121 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
122 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
123 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
124 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
125 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
126 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
127 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
128 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
129 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
130 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
131 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
132 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
133 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
134 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
135 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
136 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
137 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
138 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
139 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
140 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
141 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
142 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
143 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
144 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
145 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
146 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
147 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
148 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
149 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
150 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
151 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
152 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
153 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
154 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
155 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
156 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
157 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
158 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
159 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
160 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
161 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
162 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
163 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
164 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
165 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
166 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
167 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
168 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
169 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
170 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
171 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
172 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
173 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
174 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
175 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
176 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
177 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
178 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
179 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
180 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
181 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
182 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
183 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
184 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
185 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
186 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
187 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
188 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
189 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
190 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
191 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
192 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
193 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
194 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
195 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
196 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
197 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
198 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
199 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
200 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
201 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
202 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
203 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
204 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
205 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
206 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
207 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
208 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
209 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
210 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
211 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
212 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
214 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
215 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
217 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
218 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
219 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
221 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
222 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
272 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
273 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
278 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
280 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
283 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
284 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
285 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
286 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
287 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
288 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
289 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
290 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
291 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
292 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
293 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
294 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
295 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
296 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
297 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
298 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
299 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
300 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
301 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
302 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
303 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
304 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
305 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
306 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
307 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
308 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
309 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
310 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
311 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
312 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
313 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
314 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
315 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
316 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
318 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
319 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
324 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
325 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
326 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
327 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
328 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
329 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
330 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
331 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
332 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
334 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
335 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
336 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
337 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
338 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
339 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
340 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
341 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
342 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
343 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
344 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
345 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
346 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
347 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
348 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
349 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
350 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
351 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
352 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
353 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
354 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
355 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
356 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
357 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
358 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
359 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
360 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
361 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
362 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
363 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
364 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
365 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
366 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
367 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
368 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
369 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
370 3300041500 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT Metatranscriptome Unclassified
371 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
372 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
373 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
374 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
375 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
376 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
377 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
378 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
379 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
380 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
381 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
382 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
383 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
384 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
385 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
386 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
387 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
388 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
389 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
390 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
391 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
392 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
393 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
394 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
395 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
396 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
397 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
398 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
399 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
400 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
401 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
402 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
403 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
404 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
405 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
406 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
407 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
408 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
409 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
410 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
411 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
412 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
413 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
414 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
415 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
416 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
417 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
418 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
419 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
420 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
421 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
422 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
423 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
424 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
425 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
426 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
427 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
428 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
429 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
430 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
431 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
432 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
433 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
434 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
435 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
436 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
437 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
438 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
439 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
440 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
441 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
442 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
443 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
444 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
445 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
446 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
447 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
448 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
449 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
450 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
451 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
452 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
453 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
454 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
455 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
456 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
457 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
458 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
459 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
460 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
461 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
462 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
463 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
464 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
465 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
466 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
467 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
468 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
481 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
482 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
483 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
484 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300049555 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
515 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
520 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
521 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
522 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
523 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
524 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
525 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
526 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
527 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
528 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
529 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
530 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
531 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
532 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
533 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
534 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
535 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
536 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
537 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
538 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
539 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
540 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
541 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
542 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
543 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
544 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
545 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
546 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
547 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
548 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
549 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
550 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
551 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
552 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
553 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
554 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
555 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
556 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
557 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
558 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
559 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
560 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
561 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
562 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
563 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
564 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
565 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
566 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
567 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
568 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
569 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
570 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
571 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
572 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
573 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
574 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
575 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
576 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
577 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
578 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
579 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
580 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
581 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
585 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
588 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
589 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
592 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
593 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
594 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
595 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
596 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
597 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
598 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
599 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
600 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
601 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
602 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
603 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
604 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
605 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
606 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
613 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
619 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
620 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
621 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
622 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
623 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
624 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
625 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
626 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 60.85
Metatranscriptomes 35.12
Isolates 4.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.59
Nodule 0.32
Rhizoplane 3.49
Rhizosphere 83.3
Stem 0
Stem Tuber 0
Unclassified 7.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNA_F7QKVOU01BZ0V1 2088090002 Bacteria 553
2 LJN_F7QKVOU01AKOKO 2088090003 Bacteria 520
3 MRS2a_Contig_10202 2124908027 Bacteria 1334
4 MRS2a_Contig_12950 2124908027 Bacteria 591
5 SwRhRL2b_contig_2515812 2162886007 Bacteria 1007
6 SwRhRL2b_contig_3886491 2162886007 Bacteria 7208
7 2214647731 2209111006 Bacteria 1081
8 JGI24741J21665_1008766 3300001915 Bacteria 1893
9 JGI24740J21852_10034372 3300001979 Bacteria 1597
10 JGI24740J21852_10046834 3300001979 Bacteria 1267
11 JGI24740J21852_10171649 3300001979 Bacteria 538
12 JGI24737J22298_10000807 3300001990 Bacteria 11118
13 JGI24737J22298_10004816 3300001990 Bacteria 4688
14 JGI24737J22298_10006134 3300001990 Bacteria 4117
15 JGI24743J22301_10010104 3300001991 Bacteria 1681
16 JGI24743J22301_10049357 3300001991 Bacteria 855
17 JGI24735J21928_10000038 3300002067 Bacteria 64134
18 JGI24735J21928_10004807 3300002067 Bacteria 4509
19 JGI24735J21928_10066298 3300002067 Bacteria 1036
20 JGI25162J39368_1000047 3300002737 Viruses 167507
21 JGI25162J39368_1003374 3300002737 Bacteria 4718
22 JGI25157J39369_1007858 3300002741 Bacteria 1515
23 JGI25164J39214_1001118 3300002772 Bacteria 7644
24 JGI25152J39213_1052719 3300002773 Bacteria 525
25 JGI25165J46597_1001696 3300003214 Bacteria 9921
26 rootH1_10002158 3300003316 Bacteria 20159
27 rootH1_10038160 3300003316 Bacteria 2958
28 rootH2_10002560 3300003320 Bacteria 75599
29 rootH2_10021928 3300003320 Bacteria 1003
30 rootH2_10029920 3300003320 Bacteria 8736
31 rootH2_10059229 3300003320 Bacteria 2705
32 rootH2_10217055 3300003320 Bacteria 1399
33 rootL2_10004680 3300003322 Bacteria 11172
34 rootL2_10041908 3300003322 Bacteria 2015
35 rootL2_10059006 3300003322 Bacteria 2180
36 rootL2_10070359 3300003322 Bacteria 12815
37 rootL2_10166768 3300003322 Bacteria 2296
38 rootL2_10343901 3300003322 Bacteria 2097
39 rootH1_10003207 3300003323 Bacteria 20304
40 rootH1_10013874 3300003316 Bacteria 3907
41 rootH1_10013874 3300003323 Bacteria 79495
42 rootH1_10105718 3300003323 Bacteria 5134
43 Ga0007417J51691_1045397 3300003544 Bacteria 880
44 Ga0007409J51694_1081670 3300003575 Bacteria 1130
45 Ga0006562J51391_1002434 3300003578 Bacteria 1435
46 Ga0055536_1000001 3300003781 Bacteria 630663
47 Ga0055530_10002952 3300003791 Bacteria 10266
48 Ga0055530_10081257 3300003791 Bacteria 680
49 Ga0055531_10000156 3300003794 Bacteria 78858
50 Ga0055543_1043250 3300004625 Bacteria 755
51 Ga0058859_11752864 3300004798 Bacteria 1094
52 Ga0058863_10038041 3300004799 Bacteria 1144
53 Ga0058861_11780625 3300004800 Bacteria 677
54 Ga0058861_11939172 3300004800 Bacteria 995
55 Ga0058860_10005542 3300004801 Bacteria 1173
56 Ga0058860_11665848 3300004801 Bacteria 669
57 Ga0058860_11931928 3300004801 Bacteria 750
58 Ga0058860_12076671 3300004801 Bacteria 828
59 Ga0058862_12669849 3300004803 Bacteria 592
60 Ga0058862_12785442 3300004803 Bacteria 1225
61 Ga0058862_12884397 3300004803 Bacteria 796
62 Ga0065165_1000638 3300005262 Bacteria 50713
63 Ga0065165_1002922 3300005262 Bacteria 13056
64 Ga0065717_1002794 3300005276 Bacteria 1602
65 Ga0065716_1004031 3300005277 Bacteria 1081
66 Ga0065714_10002300 3300005288 Bacteria 45006
67 Ga0065714_10004651 3300005288 Bacteria 9080
68 Ga0065714_10009315 3300005288 Bacteria 8418
69 Ga0065714_10012264 3300005288 Bacteria 2482
70 Ga0065714_10068619 3300005288 Bacteria 4625
71 Ga0065714_10094174 3300005288 Bacteria 1824
72 Ga0065714_10222060 3300005288 Bacteria 838
73 Ga0065714_10341620 3300005288 Bacteria 645
74 Ga0065704_10000842 3300005289 Bacteria 22344
75 Ga0065704_10001837 3300005289 Bacteria 6854
76 Ga0065704_10008773 3300005289 Bacteria 2756
77 Ga0065704_10150093 3300005289 Bacteria 1430
78 Ga0065704_10315007 3300005289 Bacteria 862
79 Ga0065704_10391739 3300005289 Bacteria 761
80 Ga0065704_10664588 3300005289 Bacteria 573
81 Ga0065704_10677499 3300005289 Bacteria 571
82 Ga0065715_10065773 3300005293 Bacteria 641
83 Ga0065715_10091540 3300005293 Bacteria 5717
84 Ga0065715_10138853 3300005293 Bacteria 1864
85 Ga0065715_10589834 3300005293 Bacteria 674
86 Ga0070658_10000014 3300005327 Bacteria 244978
87 Ga0070658_10538137 3300005327 Bacteria 1010
88 Ga0070658_10942879 3300005327 Bacteria 750
89 Ga0070658_11769466 3300005327 Bacteria 535
90 Ga0070676_10001097 3300005328 Bacteria 13523
91 Ga0070683_101340839 3300005329 Bacteria 688
92 Ga0070690_100889784 3300005330 Bacteria 696
93 Ga0070670_101237756 3300005331 Bacteria 683
94 Ga0068869_102039300 3300005334 Bacteria 515
95 Ga0070680_100012512 3300005336 Bacteria 6596
96 Ga0070682_100142426 3300005337 Bacteria 1636
97 Ga0070682_101313733 3300005337 Bacteria 615
98 Ga0068868_100010166 3300005338 Bacteria 6800
99 Ga0068868_100520239 3300005338 Bacteria 1044
100 Ga0068868_101095947 3300005338 Bacteria 732
101 Ga0070660_100039031 3300005339 Bacteria 3608
102 Ga0070660_100123384 3300005339 Bacteria 2068
103 Ga0070660_101447073 3300005339 Bacteria 584
104 Ga0070689_100265635 3300005340 Bacteria 1419
105 Ga0070661_100862834 3300005344 Bacteria 746
106 Ga0070692_10799036 3300005345 Bacteria 644
107 Ga0070692_10805219 3300005345 Bacteria 642
108 Ga0070671_100008871 3300005355 Bacteria 8069
109 Ga0070671_100264385 3300005355 Bacteria 1462
110 Ga0070671_100445354 3300005355 Bacteria 1111
111 Ga0070674_100342515 3300005356 Bacteria 1205
112 Ga0070674_100821457 3300005356 Bacteria 804
113 Ga0070674_102151954 3300005356 Bacteria 509
114 Ga0070673_100056909 3300005364 Bacteria 3087
115 Ga0070659_100000375 3300005366 Bacteria 33764
116 Ga0070659_100017936 3300005366 Bacteria 5333
117 Ga0070659_100021993 3300005366 Bacteria 4866
118 Ga0070659_101196034 3300005366 Bacteria 672
119 Ga0070667_101587567 3300005367 Bacteria 615
120 Ga0070667_101734516 3300005367 Bacteria 587
121 Ga0070714_101251517 3300005435 Bacteria 724
122 Ga0070714_102083723 3300005435 Bacteria 553
123 Ga0070663_100007251 3300005455 Bacteria 6739
124 Ga0070678_100007816 3300005456 Bacteria 6363
125 Ga0070678_100468296 3300005456 Bacteria 1107
126 Ga0070662_101621001 3300005457 Bacteria 558
127 Ga0070681_10027571 3300005458 Bacteria 5711
128 Ga0068867_100003167 3300005459 Bacteria 11603
129 Ga0068867_100630925 3300005459 Bacteria 938
130 Ga0070699_101069245 3300005518 Bacteria 740
131 Ga0070679_100006523 3300005530 Bacteria 10872
132 Ga0070679_100099567 3300005530 Bacteria 2894
133 Ga0070679_100411592 3300005530 Bacteria 1298
134 Ga0070684_102059242 3300005535 Bacteria 539
135 Ga0068853_100169013 3300005539 Bacteria 1977
136 Ga0068853_100466202 3300005539 Bacteria 1189
137 Ga0068853_100519507 3300005539 Bacteria 1125
138 Ga0068853_100902942 3300005539 Bacteria 848
139 Ga0070672_102142310 3300005543 Bacteria 504
140 Ga0070696_100583668 3300005546 Bacteria 899
141 Ga0070693_100595171 3300005547 Bacteria 798
142 Ga0070693_100665566 3300005547 Bacteria 759
143 Ga0070693_100670934 3300005547 Bacteria 756
144 Ga0070693_101291612 3300005547 Bacteria 564
145 Ga0070665_100000032 3300005548 Bacteria 333352
146 Ga0070665_100108085 3300005548 Bacteria 2784
147 Ga0068855_100000043 3300005563 Bacteria 149118
148 Ga0068855_100000097 3300005563 Bacteria 106474
149 Ga0068855_100035960 3300005563 Bacteria 5897
150 Ga0068855_100042941 3300005563 Bacteria 5357
151 Ga0068855_100110668 3300005563 Viruses 3153
152 Ga0068855_100313113 3300005563 Bacteria 1736
153 Ga0068855_100538656 3300005563 Bacteria 1265
154 Ga0068855_100773155 3300005563 Bacteria 1022
155 Ga0068855_100811537 3300005563 Bacteria 994
156 Ga0068855_101169979 3300005563 Bacteria 801
157 Ga0068855_101203960 3300005563 Bacteria 787
158 Ga0068857_100030465 3300005577 Bacteria 4764
159 Ga0068857_100087242 3300005577 Bacteria 2791
160 Ga0068857_100205904 3300005577 Bacteria 1794
161 Ga0068857_100398169 3300005577 Bacteria 1281
162 Ga0068857_100796051 3300005577 Bacteria 902
163 Ga0068857_101246693 3300005577 Bacteria 721
164 Ga0068854_100120009 3300005578 Bacteria 1995
165 Ga0068854_101772174 3300005578 Bacteria 566
166 Ga0068856_100000824 3300005614 Bacteria 33487
167 Ga0068856_100010810 3300005614 Bacteria 8866
168 Ga0068856_100024772 3300005614 Bacteria 5844
169 Ga0068856_100115577 3300005614 Bacteria 2683
170 Ga0068856_100209839 3300005614 Bacteria 1963
171 Ga0068856_100328731 3300005614 Bacteria 1546
172 Ga0068856_100401797 3300005614 Bacteria 1390
173 Ga0068852_100001916 3300005616 Bacteria 14171
174 Ga0068852_100027329 3300005616 Bacteria 4650
175 Ga0068852_100282387 3300005616 Bacteria 1601
176 Ga0068852_100326208 3300005616 Bacteria 1492
177 Ga0068852_100761312 3300005616 Bacteria 981
178 Ga0068852_100999040 3300005616 Bacteria 855
179 Ga0068852_102298004 3300005616 Bacteria 560
180 Ga0068852_102601282 3300005616 Bacteria 526
181 Ga0068859_101425464 3300005617 Bacteria 764
182 Ga0068864_100211981 3300005618 Bacteria 1784
183 Ga0068864_100855601 3300005618 Bacteria 896
184 Ga0068866_10257564 3300005718 Bacteria 1071
185 Ga0068861_100938283 3300005719 Bacteria 822
186 Ga0068861_101162508 3300005719 Bacteria 744
187 Ga0068851_10347716 3300005834 Bacteria 862
188 Ga0068870_10277472 3300005840 Bacteria 1049
189 Ga0068870_10559247 3300005840 Bacteria 771
190 Ga0068870_10812876 3300005840 Bacteria 654
191 Ga0068863_101321125 3300005841 Bacteria 728
192 Ga0068858_100297763 3300005842 Bacteria 1538
193 Ga0068860_100649232 3300005843 Bacteria 1063
194 Ga0068862_100475498 3300005844 Bacteria 1182
195 Ga0068862_102328860 3300005844 Bacteria 547
196 Ga0081455_10956036 3300005937 Bacteria 531
197 Ga0070717_10742563 3300006028 Bacteria 892
198 Ga0070717_12059381 3300006028 Bacteria 514
199 Ga0070716_100207226 3300006173 Bacteria 1307
200 Ga0070716_101362697 3300006173 Bacteria 575
201 Ga0075369_10199502 3300006186 Bacteria 923
202 Ga0075366_10003967 3300006195 Bacteria 7899
203 Ga0075366_10012055 3300006195 Bacteria 4896
204 Ga0075366_10641626 3300006195 Bacteria 659
205 Ga0075366_10722878 3300006195 Bacteria 619
206 Ga0075366_11050576 3300006195 Bacteria 509
207 Ga0097621_100000262 3300006237 Bacteria 35568
208 Ga0097621_100354465 3300006237 Bacteria 1305
209 Ga0075370_10357371 3300006353 Bacteria 873
210 Ga0075370_10369233 3300006353 Bacteria 859
211 Ga0075370_10374790 3300006353 Bacteria 852
212 Ga0068871_100000212 3300006358 Bacteria 40531
213 Ga0068871_100283028 3300006358 Bacteria 1451
214 Ga0075428_100047052 3300006844 Bacteria 4739
215 Ga0075430_100411202 3300006846 Bacteria 1117
216 Ga0075430_100445048 3300006846 Bacteria 1069
217 Ga0075431_100670479 3300006847 Bacteria 1016
218 Ga0075429_100806285 3300006880 Bacteria 822
219 Ga0068865_100000704 3300006881 Bacteria 18817
220 Ga0097620_101424857 3300006931 Bacteria 764
221 Ga0099824_1009973 3300006942 Bacteria 11447
222 Ga0079104_1000355 3300006946 Bacteria 55363
223 Ga0099826_10043578 3300006948 Bacteria 3087
224 Ga0105251_10512864 3300009011 Bacteria 561
225 Ga0105244_10000035 3300009036 Bacteria 168428
226 Ga0105244_10013492 3300009036 Bacteria 4774
227 Ga0105244_10261597 3300009036 Bacteria 805
228 Ga0105240_10000200 3300009093 Bacteria 121941
229 Ga0105240_10017293 3300009093 Bacteria 9721
230 Ga0105240_10024527 3300009093 Bacteria 7947
231 Ga0105240_10036528 3300009093 Bacteria 6318
232 Ga0105240_10154208 3300009093 Bacteria 2733
233 Ga0105240_10312539 3300009093 Bacteria 1794
234 Ga0105240_11057118 3300009093 Bacteria 866
235 Ga0105240_11255701 3300009093 Bacteria 783
236 Ga0105240_11584111 3300009093 Bacteria 686
237 Ga0105240_11795951 3300009093 Bacteria 639
238 Ga0105240_11972796 3300009093 Bacteria 607
239 Ga0105240_12740211 3300009093 Bacteria 508
240 Ga0111539_10002316 3300009094 Bacteria 25341
241 Ga0111539_10550062 3300009094 Bacteria 1344
242 Ga0111539_10951004 3300009094 Bacteria 999
243 Ga0105243_10000141 3300009148 Bacteria 82657
244 Ga0105243_10116015 3300009148 Bacteria 2249
245 Ga0105243_10924594 3300009148 Bacteria 869
246 Ga0105243_12796287 3300009148 Bacteria 528
247 Ga0105241_10003086 3300009174 Bacteria 12409
248 Ga0105241_10006234 3300009174 Bacteria 8792
249 Ga0105241_10103808 3300009174 Bacteria 2264
250 Ga0105241_10217964 3300009174 Bacteria 1602
251 Ga0105241_10456884 3300009174 Bacteria 1131
252 Ga0105241_10457868 3300009174 Bacteria 1130
253 Ga0105241_10509999 3300009174 Bacteria 1074
254 Ga0105241_11045652 3300009174 Bacteria 766
255 Ga0105241_11622525 3300009174 Bacteria 626
256 Ga0105242_10483661 3300009176 Bacteria 1174
257 Ga0105242_10687498 3300009176 Bacteria 999
258 Ga0105242_10804763 3300009176 Bacteria 931
259 Ga0105242_11371176 3300009176 Bacteria 733
260 Ga0105248_13101086 3300009177 Bacteria 529
261 Ga0105237_10000239 3300009545 Bacteria 78319
262 Ga0105237_10002047 3300009545 Bacteria 25648
263 Ga0105237_10002281 3300009545 Bacteria 23860
264 Ga0105237_10002383 3300009545 Bacteria 23326
265 Ga0105237_10002980 3300009545 Bacteria 20473
266 Ga0105237_10958884 3300009545 Bacteria 862
267 Ga0105237_11554589 3300009545 Bacteria 668
268 Ga0105237_11688966 3300009545 Bacteria 640
269 Ga0105237_12667647 3300009545 Bacteria 510
270 Ga0105238_10016221 3300009551 Bacteria 7539
271 Ga0105238_10146487 3300009551 Bacteria 2338
272 Ga0105238_10302519 3300009551 Bacteria 1583
273 Ga0105238_10611851 3300009551 Bacteria 1098
274 Ga0105238_10984611 3300009551 Bacteria 864
275 Ga0105249_10302782 3300009553 Bacteria 1604
276 Ga0105249_12556043 3300009553 Bacteria 583
277 Ga0130086_1031048 3300009829 Bacteria 592
278 Ga0105239_10000015 3300010375 Bacteria 319892
279 Ga0105239_10000059 3300010375 Bacteria 155685
280 Ga0105239_10027959 3300010375 Bacteria 6205
281 Ga0105239_10035292 3300010375 Bacteria 5492
282 Ga0105239_10099441 3300010375 Viruses 3216
283 Ga0105239_10107981 3300010375 Bacteria 3083
284 Ga0105239_10788939 3300010375 Bacteria 1088
285 Ga0105239_11664884 3300010375 Bacteria 738
286 Ga0105246_10110101 3300011119 Bacteria 2022
287 Ga0105246_11550233 3300011119 Bacteria 624
288 Ga0157373_10000403 3300013100 Bacteria 34709
289 Ga0157373_10000630 3300013100 Bacteria 27630
290 Ga0157373_10003250 3300013100 Bacteria 12286
291 Ga0157373_10052453 3300013100 Bacteria 2902
292 Ga0157373_10362596 3300013100 Bacteria 1035
293 Ga0157373_10407161 3300013100 Bacteria 975
294 Ga0157373_10415607 3300013100 Bacteria 965
295 Ga0157373_10497847 3300013100 Bacteria 880
296 Ga0157373_10612727 3300013100 Bacteria 793
297 Ga0157373_11239767 3300013100 Bacteria 563
298 Ga0157371_10000180 3300013102 Bacteria 92616
299 Ga0157371_10000342 3300013102 Bacteria 59948
300 Ga0157371_10002167 3300013102 Bacteria 19107
301 Ga0157371_10004232 3300013102 Bacteria 12620
302 Ga0157371_10021544 3300013102 Bacteria 4730
303 Ga0157371_10086671 3300013102 Bacteria 2217
304 Ga0157371_10174495 3300013102 Bacteria 1536
305 Ga0157371_11090974 3300013102 Bacteria 612
306 Ga0157370_10000403 3300013104 Bacteria 54542
307 Ga0157370_10001832 3300013104 Bacteria 26198
308 Ga0157370_10009126 3300013104 Bacteria 10636
309 Ga0157370_10011928 3300013104 Bacteria 9060
310 Ga0157370_10037507 3300013104 Bacteria 4698
311 Ga0157370_10055471 3300013104 Bacteria 3774
312 Ga0157370_10088150 3300013104 Bacteria 2914
313 Ga0157370_10105940 3300013104 Bacteria 2631
314 Ga0157370_10156292 3300013104 Bacteria 2121
315 Ga0157370_10171814 3300013104 Bacteria 2015
316 Ga0157370_10176759 3300013104 Bacteria 1984
317 Ga0157370_10201691 3300013104 Bacteria 1845
318 Ga0157370_10267619 3300013104 Bacteria 1579
319 Ga0157370_10275806 3300013104 Bacteria 1554
320 Ga0157370_10413030 3300013104 Bacteria 1242
321 Ga0157370_10413507 3300013104 Bacteria 1241
322 Ga0157370_10486104 3300013104 Bacteria 1134
323 Ga0157370_10553693 3300013104 Bacteria 1054
324 Ga0157370_10786439 3300013104 Bacteria 866
325 Ga0157370_10860543 3300013104 Bacteria 823
326 Ga0157370_10932914 3300013104 Bacteria 787
327 Ga0157370_11166761 3300013104 Bacteria 695
328 Ga0157370_11924738 3300013104 Bacteria 530
329 Ga0157370_11948044 3300013104 Bacteria 527
330 Ga0157369_10000040 3300013105 Bacteria 183469
331 Ga0157369_10000566 3300013105 Bacteria 48674
332 Ga0157369_10005719 3300013105 Bacteria 14446
333 Ga0157369_10110083 3300013105 Bacteria 2928
334 Ga0157369_10186725 3300013105 Bacteria 2180
335 Ga0157369_10504684 3300013105 Bacteria 1251
336 Ga0157369_10816465 3300013105 Bacteria 958
337 Ga0157369_11095009 3300013105 Bacteria 814
338 Ga0157369_11826887 3300013105 Bacteria 617
339 Ga0157374_10003064 3300013296 Bacteria 14013
340 Ga0157374_10040556 3300013296 Bacteria 4288
341 Ga0157374_10179245 3300013296 Bacteria 2069
342 Ga0157374_10186507 3300013296 Bacteria 2028
343 Ga0157374_10691094 3300013296 Bacteria 1033
344 Ga0157378_10028162 3300013297 Bacteria 4955
345 Ga0157378_10254511 3300013297 Bacteria 1682
346 Ga0157378_10668056 3300013297 Bacteria 1056
347 Ga0157378_10841131 3300013297 Bacteria 946
348 Ga0157378_11398070 3300013297 Bacteria 743
349 Ga0163162_10003004 3300013306 Bacteria 16119
350 Ga0163162_10005073 3300013306 Bacteria 12691
351 Ga0163162_10014253 3300013306 Bacteria 7766
352 Ga0163162_10033324 3300013306 Bacteria 5118
353 Ga0163162_10284267 3300013306 Bacteria 1786
354 Ga0163162_11165233 3300013306 Bacteria 874
355 Ga0163162_11951347 3300013306 Bacteria 672
356 Ga0163162_12260784 3300013306 Bacteria 624
357 Ga0157372_10000020 3300013307 Bacteria 208056
358 Ga0157372_10001496 3300013307 Bacteria 25392
359 Ga0157372_10002216 3300013307 Bacteria 21112
360 Ga0157372_10004009 3300013307 Bacteria 15799
361 Ga0157372_10040403 3300013307 Bacteria 5152
362 Ga0157372_10051680 3300013307 Bacteria 4574
363 Ga0157372_10679582 3300013307 Bacteria 1198
364 Ga0157372_10723637 3300013307 Bacteria 1158
365 Ga0157372_11054858 3300013307 Bacteria 941
366 Ga0157372_11145555 3300013307 Bacteria 899
367 Ga0157375_10046436 3300013308 Bacteria 4234
368 Ga0157375_10131450 3300013308 Bacteria 2623
369 Ga0157375_10192091 3300013308 Bacteria 2197
370 Ga0157375_10209374 3300013308 Bacteria 2107
371 Ga0157375_12063146 3300013308 Bacteria 678
372 Ga0157375_12349675 3300013308 Bacteria 636
373 Ga0157375_13639561 3300013308 Bacteria 513
374 Ga0157380_10065533 3300014326 Bacteria 2920
375 Ga0157380_10092070 3300014326 Bacteria 2504
376 Ga0157380_10131068 3300014326 Bacteria 2139
377 Ga0157380_10779123 3300014326 Bacteria 971
378 Ga0157380_11280886 3300014326 Bacteria 779
379 Ga0157380_12927662 3300014326 Unclassified 543
380 Ga0157380_13269258 3300014326 Bacteria 518
381 Ga0182008_10000034 3300014497 Bacteria 138235
382 Ga0182008_10000131 3300014497 Bacteria 56984
383 Ga0182008_10015727 3300014497 Bacteria 3944
384 Ga0157377_10010434 3300014745 Bacteria 4596
385 Ga0157377_10935142 3300014745 Bacteria 651
386 Ga0157379_10627177 3300014968 Bacteria 1005
387 Ga0157379_11139347 3300014968 Bacteria 748
388 Ga0157376_10131207 3300014969 Bacteria 2236
389 Ga0157376_10230581 3300014969 Bacteria 1720
390 Ga0157376_10552960 3300014969 Bacteria 1139
391 Ga0157376_10694796 3300014969 Bacteria 1022
392 Ga0157376_11920249 3300014969 Bacteria 629
393 Ga0157376_12563956 3300014969 Bacteria 550
394 Ga0182006_1002107 3300015261 Bacteria 11109
395 Ga0182006_1003410 3300015261 Bacteria 8130
396 Ga0182006_1003629 3300015261 Bacteria 7841
397 Ga0182006_1025537 3300015261 Bacteria 2426
398 Ga0182006_1166009 3300015261 Bacteria 742
399 Ga0182007_10000033 3300015262 Bacteria 139808
400 Ga0182007_10051916 3300015262 Bacteria 1351
401 Ga0182007_10070841 3300015262 Bacteria 1142
402 Ga0183373_1001 3300015682 Bacteria 1410374
403 Ga0163161_10000007 3300017792 Bacteria 301614
404 Ga0163161_10001494 3300017792 Bacteria 17277
405 Ga0163161_10004072 3300017792 Bacteria 10222
406 Ga0163161_10021927 3300017792 Bacteria 4491
407 Ga0163161_10059194 3300017792 Bacteria 2785
408 Ga0163161_10080069 3300017792 Bacteria 2403
409 Ga0163161_10370427 3300017792 Bacteria 1143
410 Ga0163161_10638602 3300017792 Bacteria 881
411 Ga0163161_10723060 3300017792 Bacteria 831
412 Ga0163161_10910497 3300017792 Bacteria 746
413 Ga0163161_11355458 3300017792 Bacteria 620
414 Ga0197907_11045547 3300020069 Bacteria 989
415 Ga0197907_11085579 3300020069 Bacteria 1071
416 Ga0197907_11104242 3300020069 Bacteria 850
417 Ga0206356_10186869 3300020070 Bacteria 1081
418 Ga0206356_10384334 3300020070 Bacteria 1118
419 Ga0206356_11672287 3300020070 Bacteria 768
420 Ga0206349_1401126 3300020075 Bacteria 885
421 Ga0206355_1078494 3300020076 Bacteria 647
422 Ga0206355_1494755 3300020076 Bacteria 1065
423 Ga0206351_10193117 3300020077 Bacteria 1202
424 Ga0206351_10433669 3300020077 Bacteria 1248
425 Ga0206351_10652014 3300020077 Bacteria 1295
426 Ga0206351_10858975 3300020077 Bacteria 1199
427 Ga0206352_10015830 3300020078 Bacteria 1288
428 Ga0206352_10033904 3300020078 Bacteria 1098
429 Ga0206352_10547937 3300020078 Bacteria 730
430 Ga0206352_10560570 3300020078 Bacteria 1174
431 Ga0206352_10852344 3300020078 Bacteria 1259
432 Ga0206352_10955506 3300020078 Bacteria 1210
433 Ga0206352_10996090 3300020078 Bacteria 1106
434 Ga0206352_11271164 3300020078 Bacteria 945
435 Ga0206352_11274103 3300020078 Bacteria 717
436 Ga0206350_10339450 3300020080 Bacteria 772
437 Ga0206350_11064187 3300020080 Bacteria 1236
438 Ga0206350_11448088 3300020080 Bacteria 1064
439 Ga0206350_11556821 3300020080 Bacteria 1015
440 Ga0206354_10423924 3300020081 Bacteria 1178
441 Ga0206354_10546343 3300020081 Bacteria 652
442 Ga0206354_10759203 3300020081 Bacteria 1064
443 Ga0206354_10952035 3300020081 Bacteria 858
444 Ga0206353_11493215 3300020082 Bacteria 564
445 Ga0154015_1103227 3300020610 Bacteria 1141
446 Ga0154015_1252578 3300020610 Bacteria 1135
447 Ga0154015_1476743 3300020610 Bacteria 972
448 Ga0213872_10125420 3300021361 Bacteria 1133
449 Ga0224712_10106337 3300022467 Bacteria 1197
450 Ga0224712_10124474 3300022467 Unclassified 1120
451 Ga0224712_10127284 3300022467 Bacteria 1109
452 Ga0224712_10203158 3300022467 Bacteria 901
453 Ga0224712_10306620 3300022467 Bacteria 743
454 Ga0209563_111486 3300025230 Bacteria 1248
455 Ga0207427_100025 3300025231 Bacteria 433726
456 Ga0209437_100010 3300025233 Bacteria 838447
457 Ga0209437_100089 3300025233 Bacteria 250476
458 Ga0209026_1000388 3300025250 Bacteria 39840
459 Ga0209026_1002027 3300025250 Bacteria 8022
460 Ga0209026_1005224 3300025250 Bacteria 3554
461 Ga0209026_1032053 3300025250 Bacteria 777
462 Ga0209026_1042062 3300025250 Bacteria 661
463 Ga0209148_1016389 3300025254 Bacteria 1278
464 Ga0209129_1007640 3300025258 Bacteria 3169
465 Ga0209233_1000017 3300025261 Bacteria 898076
466 Ga0209233_1006602 3300025261 Bacteria 3728
467 Ga0209233_1006682 3300025261 Bacteria 3699
468 Ga0209233_1089858 3300025261 Bacteria 529
469 Ga0209455_1003109 3300025272 Bacteria 6052
470 Ga0209676_1000008 3300025292 Bacteria 991778
471 Ga0209676_1000116 3300025292 Bacteria 203383
472 Ga0209050_1000055 3300025298 Bacteria 339254
473 Ga0209050_1012612 3300025298 Bacteria 3855
474 Ga0209050_1019352 3300025298 Bacteria 2590
475 Ga0209257_1000005 3300025304 Bacteria 1592528
476 Ga0209257_1044535 3300025304 Bacteria 1294
477 Ga0207656_10298963 3300025321 Bacteria 797
478 Ga0207656_10330703 3300025321 Bacteria 758
479 Ga0207655_1000008 3300025728 Bacteria 734289
480 Ga0207655_1056900 3300025728 Bacteria 1539
481 Ga0207713_1074258 3300025735 Bacteria 1245
482 Ga0207682_10109515 3300025893 Bacteria 1215
483 Ga0207692_10442652 3300025898 Bacteria 817
484 Ga0207642_10089570 3300025899 Bacteria 1516
485 Ga0207647_10000079 3300025904 Bacteria 72325
486 Ga0207647_10000169 3300025904 Bacteria 52146
487 Ga0207647_10189206 3300025904 Bacteria 1193
488 Ga0207647_10438660 3300025904 Bacteria 733
489 Ga0207647_10703771 3300025904 Bacteria 550
490 Ga0207685_10633900 3300025905 Bacteria 576
491 Ga0207645_10000672 3300025907 Bacteria 28332
492 Ga0207705_10000043 3300025909 Bacteria 181491
493 Ga0207705_10055803 3300025909 Bacteria 2848
494 Ga0207705_10059994 3300025909 Bacteria 2747
495 Ga0207654_10001248 3300025911 Bacteria 13546
496 Ga0207654_10057252 3300025911 Bacteria 2264
497 Ga0207654_10106665 3300025911 Bacteria 1736
498 Ga0207654_10174948 3300025911 Bacteria 1397
499 Ga0207654_10288611 3300025911 Bacteria 1112
500 Ga0207654_10584725 3300025911 Bacteria 796
501 Ga0207654_11379197 3300025911 Unclassified 514
502 Ga0207707_10003763 3300025912 Bacteria 13445
503 Ga0207695_10000055 3300025913 Bacteria 382776
504 Ga0207695_10008885 3300025913 Bacteria 12508
505 Ga0207695_10044132 3300025913 Bacteria 4744
506 Ga0207695_10057528 3300025913 Bacteria 4039
507 Ga0207695_10114076 3300025913 Bacteria 2678
508 Ga0207695_10142725 3300025913 Bacteria 2341
509 Ga0207695_10248838 3300025913 Viruses 1677
510 Ga0207695_10479951 3300025913 Bacteria 1125
511 Ga0207695_10623476 3300025913 Bacteria 960
512 Ga0207671_10000486 3300025914 Bacteria 53864
513 Ga0207671_10002797 3300025914 Bacteria 18193
514 Ga0207671_10007031 3300025914 Bacteria 9859
515 Ga0207671_10011297 3300025914 Bacteria 7279
516 Ga0207671_10030075 3300025914 Bacteria 4051
517 Ga0207671_10032943 3300025914 Viruses 3857
518 Ga0207671_10095806 3300025914 Bacteria 2241
519 Ga0207671_10326915 3300025914 Bacteria 1214
520 Ga0207671_10498717 3300025914 Bacteria 971
521 Ga0207663_10972136 3300025916 Bacteria 680
522 Ga0207657_10049264 3300025919 Bacteria 3673
523 Ga0207657_10086081 3300025919 Bacteria 2631
524 Ga0207657_11176357 3300025919 Bacteria 584
525 Ga0207652_10002224 3300025921 Bacteria 16555
526 Ga0207652_10396247 3300025921 Bacteria 1246
527 Ga0207652_11359734 3300025921 Bacteria 613
528 Ga0207694_10270699 3300025924 Bacteria 1393
529 Ga0207694_10333722 3300025924 Bacteria 1253
530 Ga0207694_11536799 3300025924 Bacteria 561
531 Ga0207644_10001419 3300025931 Bacteria 15446
532 Ga0207644_10534310 3300025931 Bacteria 970
533 Ga0207690_10024087 3300025932 Bacteria 3808
534 Ga0207690_10026901 3300025932 Bacteria 3629
535 Ga0207690_10036601 3300025932 Bacteria 3179
536 Ga0207690_10546725 3300025932 Bacteria 941
537 Ga0207706_10000167 3300025933 Bacteria 72622
538 Ga0207686_10027404 3300025934 Bacteria 3337
539 Ga0207686_10162090 3300025934 Bacteria 1568
540 Ga0207686_10406765 3300025934 Bacteria 1038
541 Ga0207709_10000072 3300025935 Bacteria 178084
542 Ga0207709_10136941 3300025935 Bacteria 1677
543 Ga0207669_10159243 3300025937 Bacteria 1592
544 Ga0207669_10290217 3300025937 Bacteria 1238
545 Ga0207669_11481274 3300025937 Bacteria 579
546 Ga0207669_11774093 3300025937 Bacteria 527
547 Ga0207704_10000042 3300025938 Bacteria 89683
548 Ga0207665_10311991 3300025939 Bacteria 1178
549 Ga0207691_10196394 3300025940 Bacteria 1758
550 Ga0207691_11341834 3300025940 Bacteria 589
551 Ga0207689_10651194 3300025942 Bacteria 887
552 Ga0207661_11744899 3300025944 Bacteria 568
553 Ga0207667_10000015 3300025949 Bacteria 417534
554 Ga0207667_10000190 3300025949 Bacteria 90197
555 Ga0207667_10051425 3300025949 Viruses 4344
556 Ga0207667_10100196 3300025949 Bacteria 2988
557 Ga0207667_10215447 3300025949 Bacteria 1968
558 Ga0207667_11011180 3300025949 Bacteria 818
559 Ga0207651_10011501 3300025960 Bacteria 4958
560 Ga0207651_10260641 3300025960 Bacteria 1423
561 Ga0207712_10181490 3300025961 Bacteria 1653
562 Ga0207640_10044474 3300025981 Viruses 2846
563 Ga0207640_10522500 3300025981 Bacteria 992
564 Ga0207640_10769742 3300025981 Bacteria 831
565 Ga0207640_11161701 3300025981 Bacteria 685
566 Ga0207658_10422882 3300025986 Bacteria 1175
567 Ga0207658_11103148 3300025986 Bacteria 725
568 Ga0207677_10017709 3300026023 Bacteria 4256
569 Ga0207677_11002960 3300026023 Bacteria 757
570 Ga0207703_10043084 3300026035 Bacteria 3621
571 Ga0207703_11318589 3300026035 Bacteria 694
572 Ga0207639_10027578 3300026041 Bacteria 4139
573 Ga0207639_10343918 3300026041 Bacteria 1330
574 Ga0207639_10381586 3300026041 Bacteria 1266
575 Ga0207639_10396705 3300026041 Bacteria 1242
576 Ga0207639_11844976 3300026041 Bacteria 565
577 Ga0207678_10016173 3300026067 Bacteria 6550
578 Ga0207702_10000165 3300026078 Bacteria 79066
579 Ga0207702_10066516 3300026078 Bacteria 3089
580 Ga0207702_10087163 3300026078 Bacteria 2724
581 Ga0207702_10091965 3300026078 Bacteria 2658
582 Ga0207702_10170920 3300026078 Bacteria 1993
583 Ga0207702_10222882 3300026078 Bacteria 1758
584 Ga0207702_10372316 3300026078 Bacteria 1372
585 Ga0207702_10613550 3300026078 Bacteria 1068
586 Ga0207702_11956522 3300026078 Bacteria 577
587 Ga0207641_10476602 3300026088 Bacteria 1209
588 Ga0207648_10008139 3300026089 Bacteria 10198
589 Ga0207648_10474076 3300026089 Bacteria 1142
590 Ga0207674_10029322 3300026116 Bacteria 5793
591 Ga0207674_10083748 3300026116 Bacteria 3188
592 Ga0207674_10120833 3300026116 Bacteria 2587
593 Ga0207674_10221852 3300026116 Bacteria 1839
594 Ga0207674_10725581 3300026116 Bacteria 959
595 Ga0207674_10967021 3300026116 Bacteria 820
596 Ga0207674_12247220 3300026116 Bacteria 508
597 Ga0207675_100473288 3300026118 Bacteria 1244
598 Ga0207683_10003832 3300026121 Bacteria 13030
599 Ga0207683_10415407 3300026121 Bacteria 1239
600 Ga0207698_10101808 3300026142 Bacteria 2383
601 Ga0207698_10142345 3300026142 Bacteria 2068
602 Ga0207698_10471206 3300026142 Bacteria 1216
603 Ga0207698_10698898 3300026142 Bacteria 1009
604 Ga0207698_10872400 3300026142 Bacteria 906
605 Ga0207698_11527375 3300026142 Bacteria 683
606 Ga0209281_1000116 3300027111 Bacteria 209707
607 Ga0209489_117456 3300027361 Bacteria 3252
608 Ga0209981_1078242 3300027378 Bacteria 514
609 Ga0209995_1007505 3300027471 Bacteria 1757
610 Ga0209968_1000567 3300027526 Bacteria 5722
611 Ga0209968_1006801 3300027526 Bacteria 1726
612 Ga0210002_1008982 3300027617 Bacteria 1525
613 Ga0209282_1034968 3300027666 Bacteria 3049
614 Ga0209974_10010090 3300027876 Bacteria 3192
615 Ga0209974_10136726 3300027876 Bacteria 877
616 Ga0207428_10135387 3300027907 Bacteria 1884
617 Ga0207428_10158793 3300027907 Bacteria 1718
618 Ga0268266_10000030 3300028379 Bacteria 417120
619 Ga0268266_10148744 3300028379 Bacteria 2109
620 Ga0268264_10978971 3300028381 Bacteria 852
621 Ga0307517_10094778 3300028786 Bacteria 2407
622 Ga0307515_10009260 3300028794 Bacteria 19062
623 Ga0307515_10023678 3300028794 Bacteria 10742
624 Ga0307515_10217054 3300028794 Bacteria 1741
625 Ga0307515_10587296 3300028794 Bacteria 724
626 Ga0307515_10755024 3300028794 Bacteria 592
627 Ga0265338_10000319 3300028800 Bacteria 87159
628 Ga0265338_10035130 3300028800 Bacteria 4826
629 Ga0265338_10307415 3300028800 Bacteria 1151
630 Ga0316177_1003116 3300030731 Bacteria 1302
631 Ga0316177_1025107 3300030731 Bacteria 6992
632 Ga0316177_1043475 3300030731 Bacteria 1075
633 Ga0316176_1055565 3300030732 Bacteria 2359
634 Ga0316179_1071760 3300030734 Bacteria 1581
635 Ga0316179_1112906 3300030734 Bacteria 1136
636 Ga0316183_1008515 3300030742 Bacteria 48760
637 Ga0316181_1155381 3300030744 Bacteria 2505
638 Ga0316181_1199869 3300030744 Bacteria 556
639 Ga0316181_1223835 3300030744 Bacteria 753
640 Ga0316181_1260471 3300030744 Bacteria 1914
641 Ga0316181_1274070 3300030744 Bacteria 1432
642 Ga0316182_1122312 3300030745 Bacteria 2478
643 Ga0316182_1170114 3300030745 Bacteria 813
644 Ga0265327_10000669 3300031251 Bacteria 54988
645 Ga0265327_10015237 3300031251 Bacteria 4978
646 Ga0265327_10017211 3300031251 Bacteria 4546
647 Ga0265327_10088057 3300031251 Bacteria 1520
648 Ga0265327_10212798 3300031251 Bacteria 872
649 Ga0307513_10091297 3300031456 Bacteria 3104
650 Ga0307513_10319532 3300031456 Bacteria 1311
651 Ga0307513_10714827 3300031456 Bacteria 707
652 Ga0307509_10026455 3300031507 Bacteria 6469
653 Ga0307509_10037726 3300031507 Bacteria 5280
654 Ga0307509_10055886 3300031507 Bacteria 4192
655 Ga0307509_10483320 3300031507 Bacteria 926
656 Ga0307509_10700987 3300031507 Bacteria 679
657 Ga0307408_100000984 3300031548 Bacteria 21994
658 Ga0307408_100001545 3300031548 Bacteria 17060
659 Ga0307408_100002868 3300031548 Bacteria 11941
660 Ga0307408_100003413 3300031548 Bacteria 10896
661 Ga0307408_100021162 3300031548 Bacteria 4399
662 Ga0307408_100074235 3300031548 Bacteria 2523
663 Ga0307408_100770218 3300031548 Bacteria 871
664 Ga0307408_100799745 3300031548 Bacteria 856
665 Ga0307408_101570665 3300031548 Bacteria 624
666 Ga0307408_101701276 3300031548 Bacteria 601
667 Ga0307508_10299229 3300031616 Bacteria 1202
668 Ga0307508_10875855 3300031616 Bacteria 522
669 Ga0307514_10528061 3300031649 Bacteria 552
670 Ga0316575_10115219 3300031665 Bacteria 1098
671 Ga0316579_10012511 3300031691 Bacteria 3633
672 Ga0316579_10215954 3300031691 Bacteria 927
673 Ga0316579_10283310 3300031691 Bacteria 801
674 Ga0316576_10036481 3300031727 Bacteria 3515
675 Ga0316576_10088429 3300031727 Bacteria 2306
676 Ga0316576_10175354 3300031727 Bacteria 1617
677 Ga0316576_10176590 3300031727 Bacteria 1611
678 Ga0316576_10778608 3300031727 Bacteria 690
679 Ga0316578_10061480 3300031728 Bacteria 2213
680 Ga0316578_10062341 3300031728 Bacteria 2198
681 Ga0316578_10174216 3300031728 Bacteria 1296
682 Ga0316578_10529796 3300031728 Unclassified 693
683 Ga0307516_10422442 3300031730 Bacteria 991
684 Ga0307516_10917600 3300031730 Bacteria 543
685 Ga0307405_10000002 3300031731 Bacteria 575196
686 Ga0307405_10000003 3300031731 Bacteria 569064
687 Ga0307405_10005530 3300031731 Bacteria 6105
688 Ga0307405_10020255 3300031731 Bacteria 3713
689 Ga0307405_10050937 3300031731 Bacteria 2567
690 Ga0307405_10904582 3300031731 Bacteria 747
691 Ga0307405_10921243 3300031731 Bacteria 740
692 Ga0316577_10063583 3300031733 Bacteria 2060
693 Ga0316577_10191417 3300031733 Bacteria 1156
694 Ga0316577_10254309 3300031733 Bacteria 994
695 Ga0307413_10005723 3300031824 Bacteria 5586
696 Ga0307413_10045688 3300031824 Bacteria 2598
697 Ga0307413_10059831 3300031824 Bacteria 2342
698 Ga0307413_10230379 3300031824 Bacteria 1360
699 Ga0307413_10753891 3300031824 Bacteria 814
700 Ga0307413_10921202 3300031824 Bacteria 744
701 Ga0307413_10991269 3300031824 Bacteria 720
702 Ga0307413_11078823 3300031824 Unclassified 692
703 Ga0307413_11756132 3300031824 Bacteria 554
704 Ga0307410_10000075 3300031852 Bacteria 34266
705 Ga0307406_10000038 3300031901 Bacteria 76386
706 Ga0307406_10042611 3300031901 Bacteria 2834
707 Ga0307406_11138214 3300031901 Bacteria 675
708 Ga0307406_11439215 3300031901 Bacteria 605
709 Ga0307406_11506537 3300031901 Bacteria 592
710 Ga0307407_10000010 3300031903 Bacteria 186970
711 Ga0307407_10002342 3300031903 Bacteria 7377
712 Ga0307407_10422244 3300031903 Bacteria 961
713 Ga0307407_11588788 3300031903 Bacteria 519
714 Ga0307412_10000049 3300031911 Bacteria 151588
715 Ga0307412_10002839 3300031911 Bacteria 9604
716 Ga0307412_10014212 3300031911 Bacteria 4690
717 Ga0307412_10032821 3300031911 Bacteria 3294
718 Ga0307412_10098671 3300031911 Bacteria 2060
719 Ga0307412_10313990 3300031911 Bacteria 1244
720 Ga0307412_10462477 3300031911 Bacteria 1048
721 Ga0307412_10809220 3300031911 Bacteria 814
722 Ga0307412_10973312 3300031911 Bacteria 748
723 Ga0307412_11114432 3300031911 Bacteria 703
724 Ga0307412_11513853 3300031911 Bacteria 610
725 Ga0307409_100099309 3300031995 Bacteria 2410
726 Ga0307409_100147093 3300031995 Bacteria 2039
727 Ga0307409_102895194 3300031995 Unclassified 507
728 Ga0307416_100000014 3300032002 Bacteria 249053
729 Ga0307416_100001768 3300032002 Bacteria 11970
730 Ga0307416_100037502 3300032002 Bacteria 3730
731 Ga0307416_100785574 3300032002 Bacteria 1047
732 Ga0307416_102375955 3300032002 Bacteria 630
733 Ga0307416_103101913 3300032002 Bacteria 556
734 Ga0307416_103316978 3300032002 Bacteria 539
735 Ga0307414_10000001 3300032004 Bacteria 1352954
736 Ga0307414_10000142 3300032004 Bacteria 48979
737 Ga0307414_10002670 3300032004 Bacteria 9377
738 Ga0307414_10004731 3300032004 Bacteria 7428
739 Ga0307414_10005109 3300032004 Bacteria 7198
740 Ga0307414_10018733 3300032004 Bacteria 4271
741 Ga0307414_10021506 3300032004 Bacteria 4049
742 Ga0307414_10033178 3300032004 Bacteria 3409
743 Ga0307414_10065932 3300032004 Bacteria 2586
744 Ga0307414_10104846 3300032004 Bacteria 2136
745 Ga0307414_10189258 3300032004 Bacteria 1663
746 Ga0307414_10257282 3300032004 Bacteria 1455
747 Ga0307414_10266997 3300032004 Bacteria 1431
748 Ga0307414_10280613 3300032004 Bacteria 1399
749 Ga0307414_10284003 3300032004 Bacteria 1392
750 Ga0307414_10328253 3300032004 Bacteria 1305
751 Ga0307414_10385975 3300032004 Bacteria 1212
752 Ga0307414_10553711 3300032004 Bacteria 1025
753 Ga0307414_10677300 3300032004 Bacteria 932
754 Ga0307414_10711146 3300032004 Bacteria 910
755 Ga0307414_10863571 3300032004 Bacteria 828
756 Ga0307414_10897694 3300032004 Bacteria 812
757 Ga0307414_10980081 3300032004 Bacteria 777
758 Ga0307414_11193099 3300032004 Bacteria 704
759 Ga0307414_11205998 3300032004 Bacteria 701
760 Ga0307414_11951514 3300032004 Bacteria 548
761 Ga0307414_11964037 3300032004 Bacteria 546
762 Ga0307414_12276698 3300032004 Unclassified 506
763 Ga0307411_10000013 3300032005 Bacteria 145335
764 Ga0307411_10065433 3300032005 Bacteria 2438
765 Ga0307411_10094212 3300032005 Bacteria 2099
766 Ga0307411_10159860 3300032005 Bacteria 1686
767 Ga0307411_10171212 3300032005 Bacteria 1638
768 Ga0307411_10419533 3300032005 Bacteria 1111
769 Ga0307411_10466613 3300032005 Bacteria 1060
770 Ga0307411_10517913 3300032005 Bacteria 1012
771 Ga0307411_10570230 3300032005 Bacteria 969
772 Ga0307415_100004007 3300032126 Bacteria 7591
773 Ga0307415_100170623 3300032126 Bacteria 1696
774 Ga0307415_100488519 3300032126 Bacteria 1074
775 Ga0316585_10068050 3300032137 Bacteria 1154
776 Ga0316585_10181158 3300032137 Bacteria 696
777 Ga0316580_10004937 3300032139 Bacteria 3879
778 Ga0316580_10021055 3300032139 Bacteria 2009
779 Ga0316593_10068701 3300032168 Bacteria 1223
780 Ga0316593_10075217 3300032168 Bacteria 1172
781 Ga0316593_10127242 3300032168 Bacteria 918
782 Ga0316593_10130323 3300032168 Bacteria 907
783 Ga0316593_10164912 3300032168 Bacteria 810
784 Ga0307507_10000184 3300033179 Bacteria 114646
785 Ga0307510_10012916 3300033180 Bacteria 9912
786 Ga0307510_10027298 3300033180 Bacteria 6543
787 Ga0316592_1031812 3300033524 Bacteria 1150
788 Ga0316592_1034730 3300033524 Bacteria 1104
789 Ga0316592_1055522 3300033524 Unclassified 886
790 Ga0316592_1057339 3300033524 Bacteria 872
791 Ga0316592_1058002 3300033524 Bacteria 868
792 Ga0316586_1019239 3300033527 Bacteria 1114
793 Ga0316586_1066090 3300033527 Bacteria 662
794 Ga0316588_1080731 3300033528 Bacteria 805
795 Ga0316588_1085715 3300033528 Bacteria 782
796 Ga0316596_1047991 3300033541 Bacteria 1128
797 Ga0316596_1048119 3300033541 Bacteria 1126
798 Ga0316596_1050649 3300033541 Bacteria 1099
799 Ga0316596_1052798 3300033541 Bacteria 1077
800 Ga0316596_1096663 3300033541 Bacteria 797
801 Ga0316596_1096821 3300033541 Bacteria 797
802 Ga0316596_1117249 3300033541 Bacteria 724
803 Ga0316596_1201375 3300033541 Bacteria 554
804 Ga0373949_0167091 3300035090 Bacteria 645
805 Ga0373932_0380096 3300035112 Bacteria 543
806 Ga0373957_0364288 3300035120 Bacteria 619
807 Ga0373943_0750357 3300035170 Bacteria 580
808 Ga0373946_0723673 3300035171 Bacteria 521
809 Ga0316574_0035409 3300035398 Bacteria 3051
810 Ga0316574_0036021 3300035398 Bacteria 3028
811 Ga0316574_0065389 3300035398 Bacteria 2289
812 Ga0316574_0126841 3300035398 Bacteria 1641
813 Ga0316574_0140133 3300035398 Bacteria 1558
814 Ga0316574_0147555 3300035398 Bacteria 1516
815 Ga0316574_0195621 3300035398 Bacteria 1300
816 Ga0316574_0438906 3300035398 Bacteria 819
817 Ga0316574_0583060 3300035398 Bacteria 692
818 Ga0373931_0732271 3300035691 Bacteria 655
819 Ga0373931_0902760 3300035691 Bacteria 594
820 Ga0373935_0514633 3300035692 Bacteria 870
821 Ga0373935_0520726 3300035692 Bacteria 865
822 Ga0373937_0538685 3300036401 Bacteria 1109
823 Ga0265778_012060 3300036457 Bacteria 1001
824 Ga0265778_027813 3300036457 Bacteria 722
825 Ga0316582_0029832 3300036647 Bacteria 3316
826 Ga0316582_0062598 3300036647 Bacteria 2389
827 Ga0316582_0129794 3300036647 Bacteria 1692
828 Ga0316582_0302548 3300036647 Bacteria 1099
829 Ga0316582_0916773 3300036647 Bacteria 599
830 Ga0316582_0934711 3300036647 Bacteria 593
831 Ga0316584_0004613 3300036712 Bacteria 9132
832 Ga0316584_0041514 3300036712 Bacteria 3429
833 Ga0316584_0080910 3300036712 Bacteria 2433
834 Ga0316584_0135153 3300036712 Unclassified 1841
835 Ga0316584_0153636 3300036712 Unclassified 1712
836 Ga0316584_0679220 3300036712 Bacteria 708
837 Ga0316584_0929679 3300036712 Bacteria 584
838 Ga0373925_0991909 3300037068 Unclassified 692
839 Ga0395899_0000002 3300037312 Bacteria 1324310
840 Ga0395899_0000136 3300037312 Bacteria 112112
841 Ga0395899_0001075 3300037312 Bacteria 24613
842 Ga0395899_0709277 3300037312 Bacteria 630
843 Ga0395900_0000115 3300037418 Bacteria 138474
844 Ga0395900_0000194 3300037418 Bacteria 97768
845 Ga0395900_0004186 3300037418 Bacteria 15318
846 Ga0395900_0232623 3300037418 Bacteria 1853
847 Ga0395900_0235955 3300037418 Bacteria 1837
848 Ga0395900_0417102 3300037418 Bacteria 1304
849 Ga0395898_0012085 3300037466 Bacteria 8940
850 Ga0395898_0238609 3300037466 Bacteria 1734
851 Ga0395898_0564051 3300037466 Bacteria 1081
852 Ga0395905_0000001 3300037471 Bacteria 2037079
853 Ga0395905_0000045 3300037471 Bacteria 241370
854 Ga0395905_0004409 3300037471 Bacteria 14639
855 Ga0395905_0454439 3300037471 Bacteria 1179
856 Ga0395905_0913274 3300037471 Bacteria 781
857 Ga0316581_0175238 3300037588 Bacteria 661
858 Ga0395901_0000254 3300038443 Bacteria 66508
859 Ga0395901_0194606 3300038443 Bacteria 2126
860 Ga0395901_0228295 3300038443 Bacteria 1944
861 Ga0395901_0535197 3300038443 Bacteria 1189
862 Ga0400489_08915 3300039093 Bacteria 1245
863 Ga0400489_12149 3300039093 Bacteria 4836
864 Ga0436361_0619622 3300039447 Bacteria 636
865 Ga0436361_1212167 3300039447 Bacteria 8568
866 Ga0439436_0121468 3300041404 Bacteria 731
867 Ga0439436_0204127 3300041404 Bacteria 566
868 Ga0439447_015952 3300041407 Bacteria 2072
869 Ga0439466_0001586 3300041411 Bacteria 8887
870 Ga0451787_399266 3300041441 Bacteria 529
871 Ga0451789_0083252 3300041443 Bacteria 678
872 Ga0451789_0608028 3300041443 Bacteria 1070
873 Ga0451790_01015 3300041444 Bacteria 637
874 Ga0451790_05708 3300041444 Bacteria 918
875 Ga0451790_07186 3300041444 Bacteria 699
876 Ga0451790_07707 3300041444 Bacteria 1178
877 Ga0451790_12354 3300041444 Bacteria 834
878 Ga0451790_18742 3300041444 Bacteria 949
879 Ga0451790_20881 3300041444 Bacteria 534
880 Ga0451790_26522 3300041444 Bacteria 1048
881 Ga0451790_28585 3300041444 Bacteria 875
882 Ga0451790_36522 3300041444 Bacteria 664
883 Ga0451790_37904 3300041444 Bacteria 730
884 Ga0451792_12716 3300041445 Bacteria 583
885 Ga0451792_15045 3300041445 Bacteria 778
886 Ga0451792_21275 3300041445 Bacteria 814
887 Ga0451792_22650 3300041445 Bacteria 811
888 Ga0451792_23085 3300041445 Bacteria 1168
889 Ga0451794_01862 3300041446 Eukaryota 537
890 Ga0451794_04048 3300041446 Bacteria 583
891 Ga0451794_11718 3300041446 Bacteria 649
892 Ga0451794_29390 3300041446 Bacteria 1191
893 Ga0451794_39496 3300041446 Bacteria 685
894 Ga0451794_43681 3300041446 Bacteria 1054
895 Ga0451794_43900 3300041446 Bacteria 901
896 Ga0451794_46214 3300041446 Bacteria 1107
897 Ga0451794_47763 3300041446 Bacteria 673
898 Ga0451794_54809 3300041446 Bacteria 872
899 Ga0451791_0720560 3300041451 Bacteria 1120
900 Ga0451791_1131336 3300041451 Bacteria 590
901 Ga0451791_1228747 3300041451 Bacteria 751
902 Ga0451791_1401627 3300041451 Bacteria 582
903 Ga0451791_1786408 3300041451 Bacteria 738
904 Ga0451793_0593804 3300041452 Bacteria 514
905 Ga0451793_1907281 3300041452 Bacteria 506
906 Ga0451797_0093093 3300041453 Bacteria 692
907 Ga0451797_1398792 3300041453 Bacteria 1069
908 Ga0451801_35217 3300041455 Bacteria 514
909 Ga0451798_0335166 3300041458 Bacteria 1025
910 Ga0451798_0494817 3300041458 Bacteria 935
911 Ga0451800_0728801 3300041459 Bacteria 1284
912 Ga0451800_0821904 3300041459 Bacteria 607
913 Ga0451800_1527829 3300041459 Bacteria 875
914 Ga0451800_1585948 3300041459 Bacteria 559
915 Ga0451802_0986309 3300041460 Bacteria 968
916 Ga0451805_000777 3300041461 Bacteria 829
917 Ga0451805_033283 3300041461 Bacteria 929
918 Ga0451805_090600 3300041461 Bacteria 603
919 Ga0451805_104840 3300041461 Bacteria 797
920 Ga0451805_105282 3300041461 Bacteria 872
921 Ga0451806_273099 3300041462 Bacteria 1068
922 Ga0451804_0672041 3300041463 Bacteria 765
923 Ga0451808_04453 3300041464 Bacteria 587
924 Ga0451807_0721014 3300041486 Bacteria 1454
925 Ga0451807_0922658 3300041486 Bacteria 703
926 Ga0451807_1381593 3300041486 Bacteria 606
927 Ga0451807_2187678 3300041486 Bacteria 515
928 Ga0451807_2241475 3300041486 Bacteria 1398
929 Ga0451807_2603249 3300041486 Bacteria 691
930 Ga0451833_0918318 3300041491 Bacteria 693
931 Ga0451835_0618806 3300041492 Bacteria 560
932 Ga0451837_0670671 3300041494 Bacteria 755
933 Ga0451837_0694855 3300041494 Bacteria 663
934 Ga0451837_0801724 3300041494 Bacteria 4759
935 Ga0451837_1312884 3300041494 Bacteria 528
936 Ga0451837_1859320 3300041494 Bacteria 1011
937 Ga0451839_0971585 3300041496 Bacteria 919
938 Ga0451840_17532 3300041497 Bacteria 649
939 Ga0451841_0204445 3300041498 Bacteria 843
940 Ga0451841_0372921 3300041498 Bacteria 1618
941 Ga0451844_13600 3300041500 Bacteria 944
942 Ga0451846_10133 3300041502 Bacteria 913
943 Ga0451847_0399665 3300041503 Bacteria 559
944 Ga0451847_0425781 3300041503 Bacteria 745
945 Ga0451849_0942038 3300041505 Bacteria 1248
946 Ga0451849_1204063 3300041505 Bacteria 803
947 Ga0451851_0418638 3300041507 Bacteria 715
948 Ga0451852_08582 3300041508 Bacteria 954
949 Ga0451843_0781574 3300041509 Bacteria 711
950 Ga0451855_0409812 3300041511 Bacteria 863
951 Ga0451853_1346926 3300041512 Bacteria 1220
952 Ga0452268_21347 3300041907 Bacteria 680
953 Ga0452268_21928 3300041907 Bacteria 703
954 Ga0452268_38768 3300041907 Bacteria 619
955 Ga0452271_25614 3300041916 Bacteria 616
956 Ga0452271_30878 3300041916 Bacteria 705
957 Ga0452271_52098 3300041916 Bacteria 853
958 Ga0439431_0174428 3300041997 Unclassified 619
959 Ga0439445_0025207 3300042004 Bacteria 1516
960 Ga0439445_0214960 3300042004 Bacteria 570
961 Ga0439448_0023965 3300042005 Bacteria 1907
962 Ga0439449_0126591 3300042007 Bacteria 949
963 Ga0439457_014141 3300042014 Bacteria 1789
964 Ga0439457_019991 3300042014 Bacteria 1487
965 Ga0439457_111295 3300042014 Bacteria 643
966 Ga0439462_0061923 3300042015 Bacteria 1013
967 Ga0439462_0145120 3300042015 Bacteria 666
968 Ga0439435_0042831 3300042436 Bacteria 1272
969 Ga0451577_0002121 3300042876 Bacteria 24379
970 Ga0451577_0078246 3300042876 Bacteria 2949
971 Ga0451577_0081748 3300042876 Bacteria 2882
972 Ga0451577_0297989 3300042876 Bacteria 1461
973 Ga0451577_0863964 3300042876 Bacteria 815
974 Ga0451577_1549191 3300042876 Unclassified 585
975 Ga0466969_0045320 3300044656 Bacteria 2184
976 Ga0466982_0214441 3300044672 Bacteria 1146
977 Ga0453683_0004138 3300044673 Bacteria 10405
978 Ga0453683_0048780 3300044673 Bacteria 2655
979 Ga0453683_0113897 3300044673 Bacteria 1701
980 Ga0453683_0874742 3300044673 Bacteria 593
981 Ga0466965_0881851 3300044683 Bacteria 521
982 Ga0466966_0088319 3300044684 Bacteria 1926
983 Ga0466966_0192121 3300044684 Bacteria 1237
984 Ga0466966_0332404 3300044684 Bacteria 913
985 Ga0466961_0058300 3300044693 Bacteria 2457
986 Ga0466964_0347321 3300044706 Bacteria 761
987 Ga0453684_0006725 3300044712 Bacteria 21664
988 Ga0453684_0013721 3300044712 Bacteria 13114
989 Ga0453684_0034416 3300044712 Bacteria 7032
990 Ga0453684_0041984 3300044712 Bacteria 6173
991 Ga0453684_0045232 3300044712 Bacteria 5876
992 Ga0453684_1050736 3300044712 Bacteria 863
993 Ga0453684_1484347 3300044712 Bacteria 700
994 Ga0466959_0055811 3300045049 Bacteria 2883
995 Ga0451576_0011523 3300045051 Bacteria 10037
996 Ga0451576_0025368 3300045051 Bacteria 6384
997 Ga0451576_0039109 3300045051 Bacteria 5021
998 Ga0451576_0191236 3300045051 Bacteria 2138
999 Ga0451576_0232225 3300045051 Bacteria 1927
1000 Ga0451576_0802579 3300045051 Bacteria 988
1001 Ga0451576_1293076 3300045051 Bacteria 760
1002 Ga0451576_2134558 3300045051 Bacteria 576
1003 Ga0466958_0103944 3300045836 Bacteria 1769
1004 Ga0495627_035052 3300046453 Bacteria 1565
1005 Ga0495627_064391 3300046453 Bacteria 1079
1006 Ga0495627_160732 3300046453 Bacteria 625
1007 Ga0495592_0248083 3300046454 Bacteria 1178
1008 Ga0495592_0403922 3300046454 Bacteria 865
1009 Ga0495592_0515942 3300046454 Bacteria 740
1010 Ga0495638_0000003 3300046460 Bacteria 888792
1011 Ga0495638_0625385 3300046460 Bacteria 526
1012 Ga0495651_0125167 3300046462 Bacteria 1883
1013 Ga0495653_0191509 3300046463 Bacteria 1395
1014 Ga0495650_0000198 3300046471 Bacteria 130455
1015 Ga0495650_0065434 3300046471 Bacteria 1443
1016 Ga0495650_0204530 3300046471 Bacteria 685
1017 Ga0495605_0028808 3300046474 Bacteria 2864
1018 Ga0495605_0287208 3300046474 Bacteria 698
1019 Ga0495585_0000037 3300046492 Bacteria 133335
1020 Ga0495585_0268735 3300046492 Bacteria 846
1021 Ga0495607_0023355 3300046501 Bacteria 3872
1022 Ga0495607_0109099 3300046501 Bacteria 1470
1023 Ga0495607_0124250 3300046501 Bacteria 1351
1024 Ga0495583_0083474 3300046506 Bacteria 1385
1025 Ga0495583_0099994 3300046506 Bacteria 1239
1026 Ga0495583_0294110 3300046506 Bacteria 646
1027 Ga0495606_0000060 3300046507 Bacteria 185907
1028 Ga0495606_0006519 3300046507 Bacteria 10741
1029 Ga0495606_0045259 3300046507 Bacteria 2918
1030 Ga0495606_0045808 3300046507 Bacteria 2895
1031 Ga0495606_0082387 3300046507 Bacteria 1997
1032 Ga0495606_0295421 3300046507 Bacteria 880
1033 Ga0495610_0000152 3300046512 Bacteria 76668
1034 Ga0495610_0000906 3300046512 Bacteria 27566
1035 Ga0495610_0268835 3300046512 Bacteria 668
1036 Ga0495616_0002139 3300046513 Bacteria 13226
1037 Ga0495616_0113271 3300046513 Bacteria 1258
1038 Ga0495618_0122221 3300046514 Bacteria 1668
1039 Ga0495618_0263927 3300046514 Bacteria 1078
1040 Ga0495628_0563179 3300046516 Bacteria 817
1041 Ga0495631_0022679 3300046518 Bacteria 2918
1042 Ga0495631_0051519 3300046518 Bacteria 1799
1043 Ga0495631_0260905 3300046518 Bacteria 738
1044 Ga0495632_0083663 3300046519 Bacteria 1519
1045 Ga0495632_0261323 3300046519 Bacteria 774
1046 Ga0495632_0393919 3300046519 Bacteria 605
1047 Ga0495637_0051701 3300046520 Bacteria 1718
1048 Ga0495643_0001123 3300046522 Bacteria 26415
1049 Ga0495643_0425458 3300046522 Bacteria 582
1050 Ga0495644_0014181 3300046523 Bacteria 3053
1051 Ga0495648_0006432 3300046524 Bacteria 9592
1052 Ga0495663_0287394 3300046525 Bacteria 590
1053 Ga0495663_0389278 3300046525 Bacteria 511
1054 Ga0495642_0090939 3300046528 Bacteria 1292
1055 Ga0495652_0174440 3300046529 Bacteria 1656
1056 Ga0495652_0213444 3300046529 Bacteria 1455
1057 Ga0495652_0487257 3300046529 Bacteria 857
1058 Ga0495654_0080675 3300046530 Bacteria 1526
1059 Ga0495586_0567569 3300046535 Bacteria 655
1060 Ga0495587_0289805 3300046536 Bacteria 917
1061 Ga0495587_0620968 3300046536 Bacteria 595
1062 Ga0495609_0009054 3300046538 Bacteria 4841
1063 Ga0495609_0020601 3300046538 Bacteria 3046
1064 Ga0495609_0042667 3300046538 Bacteria 2037
1065 Ga0495597_0313198 3300046542 Bacteria 607
1066 Ga0495645_0787223 3300046543 Bacteria 571
1067 Ga0495633_0000021 3300046558 Bacteria 227171
1068 Ga0495633_0021277 3300046558 Bacteria 3246
1069 Ga0495633_0144844 3300046558 Bacteria 1098
1070 Ga0495668_0000075 3300046616 Bacteria 163092
1071 Ga0495668_0331064 3300046616 Bacteria 835
1072 Ga0495611_0230525 3300046648 Bacteria 861
1073 Ga0495625_0000524 3300046660 Bacteria 56526
1074 Ga0495625_0001162 3300046660 Bacteria 33895
1075 Ga0495625_0053615 3300046660 Bacteria 2883
1076 Ga0495625_0076250 3300046660 Bacteria 2344
1077 Ga0495625_0154893 3300046660 Bacteria 1538
1078 Ga0495625_0349963 3300046660 Bacteria 934
1079 Ga0495625_0420427 3300046660 Bacteria 831
1080 Ga0495625_0475028 3300046660 Bacteria 768
1081 Ga0495635_0879141 3300046663 Bacteria 575
1082 Ga0495661_0000485 3300046665 Bacteria 41846
1083 Ga0495661_0021286 3300046665 Bacteria 4229
1084 Ga0495646_0360945 3300046680 Bacteria 760
1085 Ga0495647_0512859 3300046681 Bacteria 559
1086 Ga0495670_0114612 3300046691 Bacteria 1397
1087 Ga0495671_0361437 3300046692 Bacteria 696
1088 Ga0495671_0385072 3300046692 Bacteria 672
1089 Ga0495671_0564843 3300046692 Bacteria 541
1090 Ga0495649_0000168 3300046694 Bacteria 57053
1091 Ga0495589_0077133 3300046794 Bacteria 1624
1092 Ga0495600_0246110 3300046809 Bacteria 1138
1093 Ga0495660_0043141 3300046810 Bacteria 2489
1094 Ga0495660_0082379 3300046810 Bacteria 1685
1095 Ga0495660_0478787 3300046810 Bacteria 535
1096 Ga0495604_0510090 3300047317 Bacteria 779
1097 Ga0495674_0277468 3300047319 Bacteria 1374
1098 Ga0495674_0766408 3300047319 Bacteria 753
1099 Ga0495672_0366862 3300047320 Bacteria 665
1100 Ga0495683_0036132 3300047323 Bacteria 2509
1101 Ga0495683_0153634 3300047323 Bacteria 1069
1102 Ga0495687_014173 3300047443 Bacteria 4120
1103 Ga0495687_043861 3300047443 Bacteria 1946
1104 Ga0495679_097180 3300047446 Bacteria 821
1105 Ga0495685_011826 3300047447 Bacteria 2952
1106 Ga0495673_0035173 3300047469 Bacteria 2311
1107 Ga0495681_0045335 3300047470 Bacteria 2105
1108 Ga0495681_0089317 3300047470 Bacteria 1363
1109 Ga0495686_0000237 3300047472 Bacteria 100373
1110 Ga0495686_0001755 3300047472 Bacteria 22226
1111 Ga0495686_0068930 3300047472 Bacteria 2182
1112 Ga0495686_0200427 3300047472 Bacteria 1146
1113 Ga0495686_0307523 3300047472 Bacteria 873
1114 Ga0495593_0172556 3300047673 Bacteria 1090
1115 Ga0495614_0011515 3300048089 Bacteria 3893
1116 Ga0496102_1560216 3300048905 Bacteria 579
1117 Ga0496114_0209666 3300048917 Bacteria 1708
1118 Ga0496115_0576434 3300048918 Bacteria 897
1119 Ga0496115_1233899 3300048918 Bacteria 560
1120 Ga0496116_0000041 3300048919 Bacteria 343299
1121 Ga0496116_0002559 3300048919 Bacteria 18985
1122 Ga0496117_0000407 3300048920 Bacteria 72427
1123 Ga0496117_0084945 3300048920 Bacteria 2063
1124 Ga0496118_0058060 3300048921 Bacteria 2895
1125 Ga0496118_0135576 3300048921 Bacteria 1571
1126 Ga0496118_0543650 3300048921 Bacteria 568
1127 Ga0496121_0059029 3300048924 Bacteria 3166
1128 Ga0496122_0001781 3300048925 Bacteria 33009
1129 Ga0496122_0011839 3300048925 Bacteria 8768
1130 Ga0496123_0003360 3300048926 Bacteria 18097
1131 Ga0496123_0015493 3300048926 Bacteria 6250
1132 Ga0496124_0050873 3300048927 Bacteria 3527
1133 Ga0496124_0180835 3300048927 Bacteria 1623
1134 Ga0496125_0000026 3300048928 Bacteria 397380
1135 Ga0496125_0000286 3300048928 Bacteria 99915
1136 Ga0496125_0121769 3300048928 Bacteria 1859
1137 Ga0496125_0206882 3300048928 Bacteria 1279
1138 Ga0496125_0364324 3300048928 Bacteria 858
1139 Ga0496126_0005340 3300048929 Bacteria 14700
1140 Ga0496126_0021511 3300048929 Bacteria 6299
1141 Ga0501306_011248 3300049127 Bacteria 1139
1142 Ga0501306_012996 3300049127 Bacteria 1081
1143 Ga0501306_013243 3300049127 Bacteria 1073
1144 Ga0501306_014450 3300049127 Bacteria 1042
1145 Ga0501306_015295 3300049127 Bacteria 1020
1146 Ga0501306_016046 3300049127 Bacteria 1002
1147 Ga0501306_020337 3300049127 Bacteria 922
1148 Ga0501306_021083 3300049127 Bacteria 910
1149 Ga0501306_021913 3300049127 Bacteria 898
1150 Ga0501306_024806 3300049127 Bacteria 859
1151 Ga0501306_032761 3300049127 Bacteria 779
1152 Ga0501306_034399 3300049127 Bacteria 765
1153 Ga0501306_034627 3300049127 Bacteria 763
1154 Ga0501306_035574 3300049127 Bacteria 756
1155 Ga0501306_041626 3300049127 Bacteria 714
1156 Ga0501306_052727 3300049127 Bacteria 655
1157 Ga0501306_059320 3300049127 Bacteria 628
1158 Ga0501306_066244 3300049127 Bacteria 603
1159 Ga0501306_093047 3300049127 Bacteria 532
1160 Ga0501308_003772 3300049128 Bacteria 1425
1161 Ga0501308_008834 3300049128 Bacteria 1087
1162 Ga0501308_008962 3300049128 Bacteria 1083
1163 Ga0501308_009167 3300049128 Bacteria 1075
1164 Ga0501308_014409 3300049128 Bacteria 925
1165 Ga0501308_015919 3300049128 Bacteria 895
1166 Ga0501308_021450 3300049128 Unclassified 811
1167 Ga0501308_021558 3300049128 Bacteria 810
1168 Ga0501308_021634 3300049128 Bacteria 809
1169 Ga0501308_024752 3300049128 Bacteria 774
1170 Ga0501308_032292 3300049128 Bacteria 707
1171 Ga0501308_041439 3300049128 Bacteria 650
1172 Ga0501308_047650 3300049128 Bacteria 620
1173 Ga0501308_053416 3300049128 Bacteria 596
1174 Ga0501309_010261 3300049129 Bacteria 1206
1175 Ga0501309_013318 3300049129 Bacteria 1093
1176 Ga0501309_014129 3300049129 Bacteria 1069
1177 Ga0501309_015379 3300049129 Bacteria 1035
1178 Ga0501309_022613 3300049129 Bacteria 890
1179 Ga0501309_026348 3300049129 Bacteria 839
1180 Ga0501309_028354 3300049129 Bacteria 816
1181 Ga0501309_033070 3300049129 Bacteria 769
1182 Ga0501309_040952 3300049129 Bacteria 708
1183 Ga0501309_076775 3300049129 Bacteria 556
1184 Ga0501310_002922 3300049130 Bacteria 1650
1185 Ga0501310_006083 3300049130 Bacteria 1257
1186 Ga0501310_008631 3300049130 Bacteria 1109
1187 Ga0501310_010327 3300049130 Bacteria 1040
1188 Ga0501310_010345 3300049130 Bacteria 1040
1189 Ga0501310_010423 3300049130 Bacteria 1037
1190 Ga0501310_010793 3300049130 Bacteria 1025
1191 Ga0501310_010826 3300049130 Bacteria 1024
1192 Ga0501310_012814 3300049130 Bacteria 966
1193 Ga0501310_013017 3300049130 Bacteria 960
1194 Ga0501310_023606 3300049130 Bacteria 783
1195 Ga0501310_024098 3300049130 Bacteria 777
1196 Ga0501310_034290 3300049130 Bacteria 685
1197 Ga0501310_034717 3300049130 Bacteria 682
1198 Ga0501310_039100 3300049130 Bacteria 655
1199 Ga0501310_050316 3300049130 Bacteria 601
1200 Ga0501341_02973 3300049131 Bacteria 942
1201 Ga0501341_06434 3300049131 Bacteria 722
1202 Ga0501341_15504 3300049131 Bacteria 535
1203 Ga0501343_004394 3300049132 Bacteria 1060
1204 Ga0501343_006960 3300049132 Bacteria 888
1205 Ga0501343_007343 3300049132 Bacteria 869
1206 Ga0501343_008170 3300049132 Bacteria 833
1207 Ga0501343_009433 3300049132 Bacteria 789
1208 Ga0501343_009636 3300049132 Bacteria 782
1209 Ga0501343_009639 3300049132 Bacteria 782
1210 Ga0501343_010756 3300049132 Bacteria 749
1211 Ga0501343_011132 3300049132 Bacteria 739
1212 Ga0501343_012324 3300049132 Bacteria 710
1213 Ga0501343_012944 3300049132 Bacteria 696
1214 Ga0501343_015375 3300049132 Bacteria 651
1215 Ga0501343_017243 3300049132 Bacteria 623
1216 Ga0501344_02385 3300049133 Bacteria 966
1217 Ga0501344_02505 3300049133 Bacteria 950
1218 Ga0501344_07378 3300049133 Bacteria 645
1219 Ga0501344_11086 3300049133 Bacteria 556
1220 Ga0501345_02321 3300049134 Bacteria 781
1221 Ga0501345_03996 3300049134 Bacteria 651
1222 Ga0501345_05308 3300049134 Bacteria 589
1223 Ga0501304_003651 3300049160 Bacteria 1136
1224 Ga0501304_003806 3300049160 Bacteria 1120
1225 Ga0501304_004143 3300049160 Bacteria 1092
1226 Ga0501304_004998 3300049160 Bacteria 1025
1227 Ga0501304_006214 3300049160 Bacteria 958
1228 Ga0501304_009470 3300049160 Bacteria 837
1229 Ga0501304_010919 3300049160 Bacteria 800
1230 Ga0501304_014447 3300049160 Bacteria 732
1231 Ga0501304_017453 3300049160 Bacteria 687
1232 Ga0501304_017659 3300049160 Bacteria 684
1233 Ga0501304_024890 3300049160 Bacteria 611
1234 Ga0501304_025220 3300049160 Bacteria 608
1235 Ga0501305_013182 3300049161 Bacteria 1140
1236 Ga0501305_013847 3300049161 Bacteria 1121
1237 Ga0501305_014143 3300049161 Bacteria 1113
1238 Ga0501305_015557 3300049161 Bacteria 1076
1239 Ga0501305_016071 3300049161 Bacteria 1063
1240 Ga0501305_016351 3300049161 Bacteria 1057
1241 Ga0501305_017127 3300049161 Bacteria 1039
1242 Ga0501305_017503 3300049161 Bacteria 1030
1243 Ga0501305_020970 3300049161 Bacteria 964
1244 Ga0501305_023772 3300049161 Bacteria 919
1245 Ga0501305_026757 3300049161 Bacteria 882
1246 Ga0501305_033220 3300049161 Bacteria 813
1247 Ga0501305_034257 3300049161 Bacteria 804
1248 Ga0501305_036698 3300049161 Bacteria 784
1249 Ga0501305_037808 3300049161 Bacteria 776
1250 Ga0501305_049134 3300049161 Bacteria 704
1251 Ga0501305_049817 3300049161 Bacteria 700
1252 Ga0501305_055361 3300049161 Bacteria 673
1253 Ga0501305_058026 3300049161 Bacteria 662
1254 Ga0501305_059016 3300049161 Bacteria 657
1255 Ga0501305_060730 3300049161 Bacteria 650
1256 Ga0501305_090984 3300049161 Bacteria 558
1257 Ga0501307_009652 3300049162 Bacteria 1106
1258 Ga0501307_011130 3300049162 Bacteria 1052
1259 Ga0501307_012653 3300049162 Bacteria 1007
1260 Ga0501307_017539 3300049162 Bacteria 903
1261 Ga0501307_023192 3300049162 Bacteria 821
1262 Ga0501307_027688 3300049162 Bacteria 772
1263 Ga0501307_028976 3300049162 Bacteria 759
1264 Ga0501307_032831 3300049162 Bacteria 727
1265 Ga0501307_033029 3300049162 Bacteria 725
1266 Ga0501307_033396 3300049162 Bacteria 723
1267 Ga0501307_033948 3300049162 Bacteria 719
1268 Ga0501307_035447 3300049162 Bacteria 708
1269 Ga0501307_035591 3300049162 Bacteria 707
1270 Ga0501307_038844 3300049162 Bacteria 685
1271 Ga0501307_045348 3300049162 Bacteria 649
1272 Ga0501307_046093 3300049162 Bacteria 645
1273 Ga0501307_046142 3300049162 Bacteria 645
1274 Ga0501307_057264 3300049162 Bacteria 598
1275 Ga0501307_066933 3300049162 Bacteria 567
1276 Ga0501342_00520 3300049163 Bacteria 1051
1277 Ga0501342_02463 3300049163 Bacteria 629
1278 Ga0501342_02531 3300049163 Bacteria 623
1279 Ga0495678_004560 3300049459 Bacteria 7969
1280 Ga0495682_0072252 3300049460 Bacteria 1242
1281 Ga0495682_0129990 3300049460 Bacteria 901
1282 Ga0501291_169443 3300049514 Bacteria 504
1283 Ga0501297_012664 3300049520 Bacteria 983
1284 Ga0501311_012039 3300049527 Bacteria 1073
1285 Ga0501311_012110 3300049527 Bacteria 1071
1286 Ga0501311_012152 3300049527 Bacteria 1070
1287 Ga0501311_012262 3300049527 Bacteria 1067
1288 Ga0501311_014876 3300049527 Bacteria 998
1289 Ga0501311_020027 3300049527 Bacteria 902
1290 Ga0501311_020093 3300049527 Bacteria 901
1291 Ga0501311_026925 3300049527 Bacteria 813
1292 Ga0501311_030316 3300049527 Bacteria 780
1293 Ga0501311_031815 3300049527 Bacteria 767
1294 Ga0501311_035107 3300049527 Bacteria 741
1295 Ga0501311_041697 3300049527 Bacteria 698
1296 Ga0501311_050110 3300049527 Bacteria 653
1297 Ga0501311_055305 3300049527 Bacteria 630
1298 Ga0501311_094603 3300049527 Bacteria 522
1299 Ga0501312_012401 3300049528 Bacteria 1172
1300 Ga0501312_014985 3300049528 Bacteria 1095
1301 Ga0501312_015073 3300049528 Bacteria 1093
1302 Ga0501312_015858 3300049528 Bacteria 1072
1303 Ga0501312_016744 3300049528 Bacteria 1052
1304 Ga0501312_017231 3300049528 Bacteria 1041
1305 Ga0501312_019226 3300049528 Bacteria 1002
1306 Ga0501312_023576 3300049528 Bacteria 928
1307 Ga0501312_026869 3300049528 Bacteria 885
1308 Ga0501312_035087 3300049528 Bacteria 802
1309 Ga0501312_035477 3300049528 Bacteria 798
1310 Ga0501312_036492 3300049528 Bacteria 789
1311 Ga0501312_041030 3300049528 Bacteria 757
1312 Ga0501312_046111 3300049528 Bacteria 724
1313 Ga0501312_050266 3300049528 Bacteria 702
1314 Ga0501312_050804 3300049528 Bacteria 699
1315 Ga0501313_009507 3300049529 Bacteria 1096
1316 Ga0501313_010071 3300049529 Bacteria 1071
1317 Ga0501313_010511 3300049529 Bacteria 1056
1318 Ga0501313_011491 3300049529 Bacteria 1022
1319 Ga0501313_015783 3300049529 Bacteria 902
1320 Ga0501313_016931 3300049529 Bacteria 878
1321 Ga0501313_017089 3300049529 Bacteria 875
1322 Ga0501313_020841 3300049529 Bacteria 810
1323 Ga0501313_031425 3300049529 Bacteria 690
1324 Ga0501313_037098 3300049529 Bacteria 647
1325 Ga0501313_047592 3300049529 Bacteria 587
1326 Ga0501313_052869 3300049529 Bacteria 564
1327 Ga0501313_064177 3300049529 Bacteria 524
1328 Ga0501314_004302 3300049530 Bacteria 1177
1329 Ga0501314_004429 3300049530 Bacteria 1164
1330 Ga0501314_006227 3300049530 Bacteria 1035
1331 Ga0501314_008537 3300049530 Bacteria 928
1332 Ga0501314_008595 3300049530 Bacteria 926
1333 Ga0501314_008932 3300049530 Bacteria 913
1334 Ga0501314_010685 3300049530 Bacteria 858
1335 Ga0501315_002780 3300049531 Bacteria 1686
1336 Ga0501315_008829 3300049531 Bacteria 1180
1337 Ga0501315_009612 3300049531 Bacteria 1147
1338 Ga0501315_009739 3300049531 Bacteria 1141
1339 Ga0501315_012512 3300049531 Bacteria 1051
1340 Ga0501315_015880 3300049531 Bacteria 970
1341 Ga0501315_017791 3300049531 Bacteria 932
1342 Ga0501315_018691 3300049531 Bacteria 916
1343 Ga0501315_018738 3300049531 Bacteria 915
1344 Ga0501315_020775 3300049531 Bacteria 884
1345 Ga0501315_030238 3300049531 Bacteria 777
1346 Ga0501315_033397 3300049531 Bacteria 751
1347 Ga0501315_036644 3300049531 Bacteria 728
1348 Ga0501315_047085 3300049531 Bacteria 668
1349 Ga0501315_049508 3300049531 Bacteria 657
1350 Ga0501315_056338 3300049531 Bacteria 627
1351 Ga0501315_065794 3300049531 Bacteria 594
1352 Ga0501315_066120 3300049531 Bacteria 592
1353 Ga0501315_084592 3300049531 Bacteria 543
1354 Ga0501315_087967 3300049531 Bacteria 535
1355 Ga0501315_090886 3300049531 Bacteria 529
1356 Ga0501315_096687 3300049531 Bacteria 517
1357 Ga0501316_008863 3300049532 Bacteria 1119
1358 Ga0501316_009778 3300049532 Bacteria 1083
1359 Ga0501316_010502 3300049532 Bacteria 1055
1360 Ga0501316_011702 3300049532 Bacteria 1016
1361 Ga0501316_013791 3300049532 Bacteria 958
1362 Ga0501316_014090 3300049532 Bacteria 951
1363 Ga0501316_016037 3300049532 Bacteria 908
1364 Ga0501316_020354 3300049532 Bacteria 832
1365 Ga0501316_026707 3300049532 Bacteria 757
1366 Ga0501316_036793 3300049532 Bacteria 672
1367 Ga0501316_039608 3300049532 Bacteria 653
1368 Ga0501316_050630 3300049532 Bacteria 597
1369 Ga0501316_064111 3300049532 Bacteria 547
1370 Ga0501316_080049 3300049532 Bacteria 505
1371 Ga0501317_009666 3300049533 Bacteria 1138
1372 Ga0501317_010117 3300049533 Bacteria 1122
1373 Ga0501317_010966 3300049533 Bacteria 1093
1374 Ga0501317_015927 3300049533 Bacteria 969
1375 Ga0501317_029175 3300049533 Bacteria 792
1376 Ga0501317_032798 3300049533 Bacteria 762
1377 Ga0501317_041781 3300049533 Bacteria 702
1378 Ga0501317_042431 3300049533 Bacteria 699
1379 Ga0501317_052589 3300049533 Bacteria 651
1380 Ga0501317_063687 3300049533 Bacteria 610
1381 Ga0501317_078295 3300049533 Bacteria 568
1382 Ga0501317_078574 3300049533 Bacteria 567
1383 Ga0501317_080952 3300049533 Bacteria 562
1384 Ga0501318_012125 3300049534 Bacteria 983
1385 Ga0501318_012691 3300049534 Bacteria 970
1386 Ga0501318_026202 3300049534 Bacteria 768
1387 Ga0501318_040195 3300049534 Bacteria 666
1388 Ga0501318_041656 3300049534 Bacteria 658
1389 Ga0501319_001903 3300049535 Bacteria 1269
1390 Ga0501319_002523 3300049535 Bacteria 1165
1391 Ga0501319_002761 3300049535 Bacteria 1135
1392 Ga0501319_005039 3300049535 Bacteria 936
1393 Ga0501319_007990 3300049535 Bacteria 807
1394 Ga0501319_012612 3300049535 Bacteria 694
1395 Ga0501319_013539 3300049535 Bacteria 677
1396 Ga0501319_014389 3300049535 Bacteria 664
1397 Ga0501319_016364 3300049535 Bacteria 637
1398 Ga0501320_004749 3300049536 Bacteria 1210
1399 Ga0501320_006151 3300049536 Bacteria 1116
1400 Ga0501320_006613 3300049536 Bacteria 1092
1401 Ga0501320_007320 3300049536 Bacteria 1059
1402 Ga0501320_007955 3300049536 Bacteria 1033
1403 Ga0501320_011310 3300049536 Bacteria 923
1404 Ga0501320_012204 3300049536 Bacteria 900
1405 Ga0501320_020478 3300049536 Bacteria 762
1406 Ga0501320_023189 3300049536 Bacteria 732
1407 Ga0501320_024881 3300049536 Bacteria 715
1408 Ga0501320_026146 3300049536 Bacteria 703
1409 Ga0501320_027181 3300049536 Bacteria 695
1410 Ga0501320_034023 3300049536 Bacteria 645
1411 Ga0501320_039808 3300049536 Bacteria 612
1412 Ga0501320_050815 3300049536 Bacteria 564
1413 Ga0501320_064333 3300049536 Bacteria 521
1414 Ga0501321_007431 3300049537 Bacteria 1138
1415 Ga0501321_010249 3300049537 Bacteria 1025
1416 Ga0501321_013063 3300049537 Bacteria 949
1417 Ga0501321_016036 3300049537 Bacteria 888
1418 Ga0501321_035192 3300049537 Bacteria 685
1419 Ga0501321_039322 3300049537 Bacteria 660
1420 Ga0501321_059766 3300049537 Bacteria 573
1421 Ga0501321_062161 3300049537 Bacteria 566
1422 Ga0501321_066377 3300049537 Bacteria 554
1423 Ga0501322_007806 3300049538 Bacteria 785
1424 Ga0501322_011390 3300049538 Bacteria 696
1425 Ga0501322_022026 3300049538 Bacteria 565
1426 Ga0501323_005201 3300049539 Bacteria 1413
1427 Ga0501323_009489 3300049539 Bacteria 1148
1428 Ga0501323_009934 3300049539 Bacteria 1128
1429 Ga0501323_011435 3300049539 Bacteria 1071
1430 Ga0501323_017914 3300049539 Bacteria 913
1431 Ga0501323_019129 3300049539 Bacteria 891
1432 Ga0501323_019175 3300049539 Bacteria 890
1433 Ga0501323_021571 3300049539 Bacteria 852
1434 Ga0501323_022583 3300049539 Bacteria 839
1435 Ga0501323_022797 3300049539 Bacteria 837
1436 Ga0501323_034052 3300049539 Bacteria 726
1437 Ga0501323_036198 3300049539 Bacteria 710
1438 Ga0501323_036389 3300049539 Bacteria 708
1439 Ga0501323_043844 3300049539 Bacteria 663
1440 Ga0501323_049393 3300049539 Bacteria 635
1441 Ga0501323_055652 3300049539 Bacteria 608
1442 Ga0501324_004496 3300049540 Bacteria 1111
1443 Ga0501324_008273 3300049540 Bacteria 914
1444 Ga0501324_008640 3300049540 Bacteria 901
1445 Ga0501324_008708 3300049540 Bacteria 899
1446 Ga0501324_010366 3300049540 Bacteria 848
1447 Ga0501324_014967 3300049540 Bacteria 748
1448 Ga0501324_025882 3300049540 Bacteria 621
1449 Ga0501324_038506 3300049540 Bacteria 541
1450 Ga0501324_038574 3300049540 Bacteria 541
1451 Ga0501324_042776 3300049540 Bacteria 521
1452 Ga0501325_002694 3300049541 Bacteria 1236
1453 Ga0501325_004311 3300049541 Bacteria 1083
1454 Ga0501325_008635 3300049541 Bacteria 888
1455 Ga0501325_012622 3300049541 Bacteria 798
1456 Ga0501325_015155 3300049541 Bacteria 758
1457 Ga0501325_022953 3300049541 Bacteria 670
1458 Ga0501325_027155 3300049541 Bacteria 637
1459 Ga0501325_049306 3300049541 Bacteria 532
1460 Ga0501326_00555 3300049542 Bacteria 1510
1461 Ga0501326_02939 3300049542 Bacteria 858
1462 Ga0501326_04677 3300049542 Bacteria 730
1463 Ga0501326_06451 3300049542 Bacteria 655
1464 Ga0501326_13357 3300049542 Bacteria 512
1465 Ga0501327_02076 3300049543 Bacteria 1018
1466 Ga0501327_04128 3300049543 Bacteria 823
1467 Ga0501327_04732 3300049543 Bacteria 786
1468 Ga0501327_05620 3300049543 Bacteria 744
1469 Ga0501327_08142 3300049543 Bacteria 663
1470 Ga0501327_10277 3300049543 Bacteria 616
1471 Ga0501328_01300 3300049544 Bacteria 973
1472 Ga0501328_01626 3300049544 Bacteria 919
1473 Ga0501328_01697 3300049544 Bacteria 911
1474 Ga0501328_04723 3300049544 Bacteria 669
1475 Ga0501329_01513 3300049545 Bacteria 1026
1476 Ga0501329_01780 3300049545 Bacteria 981
1477 Ga0501329_02296 3300049545 Bacteria 909
1478 Ga0501329_02419 3300049545 Bacteria 895
1479 Ga0501329_02439 3300049545 Bacteria 892
1480 Ga0501329_03655 3300049545 Bacteria 791
1481 Ga0501329_05862 3300049545 Bacteria 689
1482 Ga0501329_16338 3300049545 Bacteria 508
1483 Ga0501330_001814 3300049546 Bacteria 1156
1484 Ga0501330_002417 3300049546 Bacteria 1058
1485 Ga0501330_007309 3300049546 Bacteria 738
1486 Ga0501330_008816 3300049546 Bacteria 697
1487 Ga0501330_011078 3300049546 Bacteria 646
1488 Ga0501330_019947 3300049546 Bacteria 534
1489 Ga0501331_01667 3300049547 Bacteria 1107
1490 Ga0501331_02426 3300049547 Bacteria 966
1491 Ga0501331_02589 3300049547 Bacteria 944
1492 Ga0501332_02240 3300049548 Bacteria 1070
1493 Ga0501332_02401 3300049548 Bacteria 1046
1494 Ga0501332_03871 3300049548 Bacteria 876
1495 Ga0501332_15050 3300049548 Bacteria 548
1496 Ga0501332_15721 3300049548 Bacteria 539
1497 Ga0501333_003787 3300049549 Bacteria 935
1498 Ga0501333_005070 3300049549 Bacteria 845
1499 Ga0501333_023046 3300049549 Bacteria 505
1500 Ga0501334_02507 3300049550 Bacteria 1094
1501 Ga0501334_03753 3300049550 Bacteria 954
1502 Ga0501334_04468 3300049550 Bacteria 898
1503 Ga0501334_04730 3300049550 Bacteria 881
1504 Ga0501334_06785 3300049550 Bacteria 779
1505 Ga0501334_13342 3300049550 Bacteria 616
1506 Ga0501334_21971 3300049550 Bacteria 517
1507 Ga0501335_006795 3300049551 Bacteria 1048
1508 Ga0501335_013600 3300049551 Bacteria 815
1509 Ga0501335_014990 3300049551 Bacteria 787
1510 Ga0501335_016920 3300049551 Bacteria 754
1511 Ga0501335_017490 3300049551 Bacteria 745
1512 Ga0501335_021736 3300049551 Bacteria 688
1513 Ga0501335_022244 3300049551 Bacteria 683
1514 Ga0501335_026723 3300049551 Bacteria 638
1515 Ga0501335_031660 3300049551 Bacteria 599
1516 Ga0501335_037517 3300049551 Bacteria 564
1517 Ga0501335_049727 3300049551 Bacteria 509
1518 Ga0501335_049734 3300049551 Bacteria 509
1519 Ga0501336_003441 3300049552 Bacteria 1070
1520 Ga0501336_003854 3300049552 Bacteria 1031
1521 Ga0501336_004582 3300049552 Bacteria 974
1522 Ga0501336_006073 3300049552 Bacteria 888
1523 Ga0501336_012216 3300049552 Bacteria 707
1524 Ga0501336_016948 3300049552 Bacteria 636
1525 Ga0501336_021581 3300049552 Bacteria 589
1526 Ga0501336_021644 3300049552 Bacteria 588
1527 Ga0501336_026837 3300049552 Bacteria 550
1528 Ga0501337_002518 3300049553 Bacteria 1124
1529 Ga0501337_003097 3300049553 Bacteria 1046
1530 Ga0501337_005054 3300049553 Bacteria 875
1531 Ga0501337_007968 3300049553 Bacteria 746
1532 Ga0501337_011868 3300049553 Bacteria 648
1533 Ga0501337_012159 3300049553 Bacteria 642
1534 Ga0501337_023641 3300049553 Bacteria 510
1535 Ga0501338_03556 3300049554 Bacteria 924
1536 Ga0501338_03833 3300049554 Bacteria 900
1537 Ga0501338_05744 3300049554 Bacteria 774
1538 Ga0501338_11971 3300049554 Bacteria 595
1539 Ga0501339_01530 3300049555 Bacteria 589
1540 Ga0501340_002966 3300049556 Bacteria 1007
1541 Ga0501340_003327 3300049556 Bacteria 971
1542 Ga0501340_003527 3300049556 Bacteria 953
1543 Ga0501340_005053 3300049556 Bacteria 849
1544 Ga0501340_013782 3300049556 Bacteria 625
1545 Ga0501340_014618 3300049556 Bacteria 614
1546 Ga0501340_016699 3300049556 Bacteria 588
1547 Ga0501033_0386566 3300049570 Bacteria 977
1548 Ga0501034_1416810 3300049571 Bacteria 570
1549 Ga0501036_0234323 3300049572 Bacteria 1540
1550 Ga0501038_0592943 3300049574 Bacteria 839
1551 Ga0501047_0948999 3300049581 Bacteria 673
1552 Ga0501069_0428636 3300049585 Bacteria 784
1553 Ga0501198_135825 3300049649 Bacteria 530
1554 Ga0501198_137148 3300049649 Bacteria 529
1555 Ga0501211_045580 3300049658 Bacteria 533
1556 Ga0501216_123992 3300049660 Bacteria 593
1557 Ga0501217_003293 3300049661 Bacteria 3254
1558 Ga0501217_017119 3300049661 Bacteria 1669
1559 Ga0501217_299355 3300049661 Unclassified 531
1560 Ga0501223_005071 3300049663 Bacteria 2786
1561 Ga0501227_093219 3300049665 Bacteria 796
1562 Ga0501227_158794 3300049665 Bacteria 627
1563 Ga0501238_000035 3300049671 Bacteria 23620
1564 Ga0501238_026083 3300049671 Bacteria 838
1565 Ga0501240_002046 3300049673 Bacteria 2077
1566 Ga0501249_000003 3300049679 Bacteria 242930
1567 Ga0501249_001982 3300049679 Bacteria 4167
1568 Ga0501249_059754 3300049679 Bacteria 882
1569 Ga0501252_005703 3300049682 Bacteria 1363
1570 Ga0501253_089371 3300049683 Bacteria 707
1571 Ga0501257_013424 3300049686 Bacteria 1878
1572 Ga0501257_228853 3300049686 Bacteria 544
1573 Ga0501261_133374 3300049690 Bacteria 503
1574 Ga0501225_0016689 3300049705 Bacteria 2041
1575 Ga0501225_0097734 3300049705 Bacteria 855
1576 Ga0501225_0103534 3300049705 Bacteria 834
1577 Ga0501080_0949285 3300049742 Bacteria 748
1578 Ga0501241_008960 3300049758 Bacteria 1825
1579 Ga0501241_027067 3300049758 Bacteria 1072
1580 Ga0501241_162418 3300049758 Bacteria 521
1581 Ga0501266_000007 3300049763 Bacteria 291751
1582 Ga0501266_002219 3300049763 Bacteria 2457
1583 Ga0501269_037978 3300049766 Bacteria 635
1584 Ga0501035_0077492 3300049822 Bacteria 2937
1585 Ga0501045_1052389 3300049824 Bacteria 596
1586 nmdc:mga03683_451284_c1 3300050489 Bacteria 619
1587 nmdc:mga0k408_294620_c1 3300050493 Bacteria 968
1588 nmdc:mga0k408_3935_c1 3300050493 Bacteria 7879
1589 nmdc:mga0k408_407926_c1 3300050493 Bacteria 808
1590 nmdc:mga0k408_44241_c1 3300050493 Bacteria 2567
1591 nmdc:mga0k408_542425_c1 3300050493 Bacteria 688
1592 nmdc:mga07m45_796292_c1 3300050496 Bacteria 542
1593 nmdc:mga07m45_838565_c1 3300050496 Bacteria 526
1594 nmdc:mga09592_599031_c1 3300050508 Bacteria 944
1595 nmdc:mga06r32_331316_c2 3300050510 Bacteria 1046
1596 nmdc:mga08y16_12267_c1 3300050511 Bacteria 9007
1597 nmdc:mga08y16_1470805_c1 3300050511 Bacteria 642
1598 nmdc:mga08y16_8157_c1 3300050511 Bacteria 10958
1599 Ga0500635_0000470 3300053080 Bacteria 11444
1600 Ga0495619_0495243 3300053085 Bacteria 841
1601 Ga0500578_0075845 3300053086 Bacteria 2142
1602 Ga0500578_0786473 3300053086 Bacteria 504
1603 Ga0500644_0376310 3300053088 Bacteria 617
1604 Ga0500646_0009457 3300053090 Bacteria 2496
1605 Ga0500646_0013189 3300053090 Bacteria 2139
1606 Ga0500646_0044072 3300053090 Bacteria 1265
1607 Ga0500651_0000202 3300053093 Bacteria 37847
1608 Ga0500651_0073787 3300053093 Bacteria 2121
1609 Ga0500651_0409870 3300053093 Bacteria 760
1610 Ga0500651_0607567 3300053093 Bacteria 593
1611 Ga0500641_0000006 3300053096 Bacteria 223991
1612 Ga0500641_0000092 3300053096 Bacteria 34933
1613 Ga0500641_0340748 3300053096 Bacteria 605
1614 Ga0500641_0341138 3300053096 Bacteria 605
1615 Ga0500556_0121854 3300053104 Bacteria 1018
1616 Ga0500557_001683 3300053105 Bacteria 3742
1617 Ga0500562_012872 3300053108 Bacteria 2129
1618 Ga0500572_255977 3300053111 Bacteria 569
1619 Ga0500594_0188206 3300053118 Bacteria 675
1620 Ga0500607_281385 3300053121 Bacteria 633
1621 Ga0500608_000470 3300053122 Bacteria 15087
1622 Ga0500608_164045 3300053122 Bacteria 960
1623 Ga0500608_297386 3300053122 Bacteria 601
1624 Ga0500618_000012 3300053125 Bacteria 185382
1625 Ga0500642_0335539 3300053130 Bacteria 674
1626 Ga0500652_159455 3300053131 Bacteria 933
1627 Ga0500655_002144 3300053133 Bacteria 3648
1628 Ga0500655_115513 3300053133 Bacteria 568
1629 Ga0500658_0000013 3300053134 Bacteria 153702
1630 Ga0500559_0005610 3300053136 Bacteria 5752
1631 Ga0500568_0071598 3300053139 Bacteria 1327
1632 Ga0500568_0078173 3300053139 Bacteria 1258
1633 Ga0500568_0084345 3300053139 Bacteria 1203
1634 Ga0500568_0150665 3300053139 Bacteria 861
1635 Ga0500573_0174476 3300053140 Bacteria 1160
1636 Ga0500573_0194042 3300053140 Bacteria 1083
1637 Ga0500577_0334420 3300053142 Bacteria 662
1638 Ga0500589_115807 3300053147 Bacteria 1143
1639 Ga0500590_144348 3300053148 Bacteria 1083
1640 Ga0500604_0001909 3300053151 Bacteria 5781
1641 Ga0500604_0117245 3300053151 Bacteria 888
1642 Ga0500616_0000007 3300053153 Bacteria 836875
1643 Ga0500616_0081035 3300053153 Bacteria 1631
1644 Ga0500616_0149921 3300053153 Bacteria 1080
1645 Ga0500619_265509 3300053154 Bacteria 562
1646 Ga0500622_0000006 3300053156 Bacteria 464021
1647 Ga0500622_0000007 3300053156 Bacteria 425621
1648 Ga0500622_0007051 3300053156 Bacteria 6427
1649 Ga0500622_0081684 3300053156 Bacteria 1617
1650 Ga0500622_0185621 3300053156 Bacteria 957
1651 Ga0500622_0221326 3300053156 Bacteria 848
1652 Ga0500624_000154 3300053157 Bacteria 28260
1653 Ga0500627_0317032 3300053158 Bacteria 678
1654 Ga0500634_0055583 3300053161 Bacteria 2117
1655 Ga0500584_130079 3300053726 Bacteria 981
1656 Ga0500645_029891 3300053730 Bacteria 1643
1657 Ga0587084_015261 3300059477 Bacteria 1082
1658 Ga0587093_014887 3300059478 Bacteria 976
1659 Ga0587093_015132 3300059478 Bacteria 971
1660 Ga0587093_024642 3300059478 Bacteria 830
1661 Ga0587093_027181 3300059478 Bacteria 804
1662 Ga0587093_078898 3300059478 Bacteria 565
1663 Ga0587066_020322 3300059490 Bacteria 1090
1664 Ga0587066_021540 3300059490 Bacteria 1070
1665 Ga0587066_024447 3300059490 Bacteria 1028
1666 Ga0587066_068764 3300059490 Bacteria 741
1667 Ga0587066_075787 3300059490 Bacteria 718
1668 Ga0587070_016228 3300059491 Bacteria 1191
1669 Ga0587070_016922 3300059491 Bacteria 1174
1670 Ga0587070_038673 3300059491 Bacteria 902
1671 Ga0587070_047857 3300059491 Bacteria 843
1672 Ga0587070_070306 3300059491 Bacteria 745
1673 Ga0587070_071574 3300059491 Bacteria 741
1674 Ga0587070_092190 3300059491 Bacteria 683
1675 Ga0587073_0084045 3300059492 Bacteria 796
1676 Ga0587073_0136583 3300059492 Bacteria 679
1677 Ga0587073_0295896 3300059492 Bacteria 525
1678 Ga0587073_0321877 3300059492 Bacteria 510
1679 Ga0587077_020853 3300059493 Bacteria 1156
1680 Ga0587077_020888 3300059493 Bacteria 1156
1681 Ga0587077_021160 3300059493 Bacteria 1151
1682 Ga0587077_031427 3300059493 Bacteria 1014
1683 Ga0587077_057917 3300059493 Bacteria 831
1684 Ga0587077_096880 3300059493 Bacteria 702
1685 Ga0587077_230363 3300059493 Bacteria 527
1686 Ga0587080_017291 3300059503 Bacteria 1147
1687 Ga0587080_023646 3300059503 Bacteria 1027
1688 Ga0587080_047744 3300059503 Bacteria 800
1689 Ga0587082_028699 3300059504 Bacteria 956
1690 Ga0587083_0024001 3300059505 Bacteria 1156
1691 Ga0587083_0036979 3300059505 Bacteria 1002
1692 Ga0587083_0097861 3300059505 Bacteria 726
1693 Ga0587083_0125128 3300059505 Bacteria 669
1694 Ga0587083_0179848 3300059505 Bacteria 591
1695 Ga0587083_0183797 3300059505 Bacteria 587
1696 Ga0587086_011640 3300059507 Bacteria 1082
1697 Ga0587086_024388 3300059507 Bacteria 849
1698 Ga0587086_059684 3300059507 Bacteria 633
1699 Ga0587086_081047 3300059507 Bacteria 572
1700 Ga0587088_035042 3300059508 Bacteria 918
1701 Ga0587088_055303 3300059508 Bacteria 789
1702 Ga0587088_068364 3300059508 Bacteria 735
1703 Ga0587088_075789 3300059508 Bacteria 710
1704 Ga0587088_089166 3300059508 Bacteria 673
1705 Ga0587089_010410 3300059509 Bacteria 1158
1706 Ga0587089_012498 3300059509 Bacteria 1085
1707 Ga0587089_013988 3300059509 Bacteria 1044
1708 Ga0587090_014162 3300059510 Bacteria 1163
1709 Ga0587090_017965 3300059510 Bacteria 1075
1710 Ga0587090_032249 3300059510 Bacteria 883
1711 Ga0587090_128458 3300059510 Bacteria 556
1712 Ga0587091_023112 3300059511 Bacteria 1104
1713 Ga0587091_038394 3300059511 Bacteria 933
1714 Ga0587091_048696 3300059511 Bacteria 863
1715 Ga0587091_062881 3300059511 Bacteria 793
1716 Ga0587091_074042 3300059511 Bacteria 751
1717 Ga0587091_084969 3300059511 Bacteria 717
1718 Ga0587092_014112 3300059512 Bacteria 1151
1719 Ga0587092_018549 3300059512 Bacteria 1051
1720 Ga0587092_018979 3300059512 Bacteria 1043
1721 Ga0587092_059847 3300059512 Bacteria 710
1722 Ga0587092_068463 3300059512 Bacteria 678
1723 Ga0587094_011702 3300059513 Bacteria 1159
1724 Ga0587094_011731 3300059513 Bacteria 1158
1725 Ga0587094_015062 3300059513 Bacteria 1063
1726 Ga0587094_042831 3300059513 Bacteria 743
1727 Ga0587094_048216 3300059513 Bacteria 714
1728 Ga0587106_016966 3300059605 Bacteria 1036
1729 Ga0587125_006222 3300059607 Bacteria 1122
1730 Ga0587099_052941 3300059622 Bacteria 545
1731 Ga0587101_010605 3300059623 Bacteria 1161
1732 Ga0587101_012756 3300059623 Bacteria 1097
1733 Ga0587101_016802 3300059623 Bacteria 1007
1734 Ga0587101_074705 3300059623 Bacteria 631
1735 Ga0587109_021646 3300059624 Bacteria 1151
1736 Ga0587109_026887 3300059624 Bacteria 1067
1737 Ga0587109_162062 3300059624 Bacteria 560
1738 Ga0587113_013642 3300059625 Bacteria 787
1739 Ga0587115_009841 3300059626 Bacteria 1180
1740 Ga0587115_024253 3300059626 Bacteria 865
1741 Ga0587117_012797 3300059627 Bacteria 1064
1742 Ga0587117_031748 3300059627 Bacteria 800
1743 Ga0587117_037718 3300059627 Bacteria 757
1744 Ga0587117_116841 3300059627 Bacteria 524
1745 Ga0587128_013125 3300059630 Bacteria 1164
1746 Ga0587128_062755 3300059630 Bacteria 706
1747 Ga0587062_010226 3300059639 Bacteria 1159
1748 Ga0587062_011037 3300059639 Bacteria 1132
1749 Ga0587062_014582 3300059639 Bacteria 1039
1750 Ga0587062_054262 3300059639 Bacteria 687
1751 Ga0587067_153745 3300059640 Bacteria 580
1752 Ga0587067_178204 3300059640 Bacteria 552
1753 Ga0587067_207238 3300059640 Bacteria 524
1754 Ga0587068_017065 3300059641 Bacteria 1156
1755 Ga0587068_020526 3300059641 Bacteria 1080
1756 Ga0587068_023389 3300059641 Bacteria 1029
1757 Ga0587068_031891 3300059641 Bacteria 918
1758 Ga0587068_038071 3300059641 Bacteria 861
1759 Ga0587068_134448 3300059641 Bacteria 547
1760 Ga0587068_146471 3300059641 Bacteria 531
1761 Ga0587069_035533 3300059642 Bacteria 827
1762 Ga0587069_036082 3300059642 Bacteria 823
1763 Ga0587069_049941 3300059642 Bacteria 741
1764 Ga0587069_070499 3300059642 Bacteria 663
1765 Ga0587072_019500 3300059643 Bacteria 1188
1766 Ga0587075_023790 3300059644 Bacteria 930
1767 Ga0587076_011742 3300059645 Bacteria 1294
1768 Ga0587076_020677 3300059645 Bacteria 1082
1769 Ga0587076_021299 3300059645 Bacteria 1072
1770 Ga0587076_026948 3300059645 Bacteria 992
1771 Ga0587076_073777 3300059645 Bacteria 714
1772 Ga0587076_143709 3300059645 Bacteria 573
1773 Ga0587078_039675 3300059646 Bacteria 662
1774 Ga0587079_027669 3300059647 Bacteria 1068
1775 Ga0587079_036081 3300059647 Bacteria 976
1776 Ga0587079_150577 3300059647 Bacteria 601
1777 Ga0587107_025126 3300059652 Bacteria 864
1778 Ga0587107_041014 3300059652 Bacteria 748
1779 Ga0587108_013609 3300059653 Bacteria 716
1780 Ga0587114_071116 3300059655 Bacteria 630
1781 Ga0587124_003559 3300059660 Bacteria 1163
1782 Ga0587124_007856 3300059660 Bacteria 904
1783 Ga0587081_03900 3300060246 Bacteria 951
1784 Ga0587071_029041 3300060344 Bacteria 1056
1785 Ga0587071_157343 3300060344 Bacteria 569
1786 Ga0587111_0023890 3300060346 Bacteria 1199
1787 Ga0587111_0080276 3300060346 Bacteria 778
1788 Ga0587111_0094347 3300060346 Bacteria 736

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10002158 rootH1_1000215817 78
2 3300003322 rootL2_10004680 rootL2_100046805 78
3 3300003323 rootH1_10003207 rootH1_1000320717 78
4 3300005840 Ga0068870_10559247 Ga0068870_105592472 78
5 3300025893 Ga0207682_10109515 Ga0207682_101095152 78
6 3300025940 Ga0207691_11341834 Ga0207691_113418342 78
7 3300031507 Ga0307509_10055886 Ga0307509_100558862 78
8 3300031995 Ga0307409_102895194 Ga0307409_1028951942 78
9 3300032004 Ga0307414_11951514 Ga0307414_119515142 78
10 3300035691 Ga0373931_0902760 Ga0373931_0902760_235_477 78
11 3300041452 Ga0451793_1907281 Ga0451793_1907281_44_286 78
12 3300041459 Ga0451800_1585948 Ga0451800_1585948_102_344 78
13 3300041460 Ga0451802_0986309 Ga0451802_0986309_334_576 78
14 3300041461 Ga0451805_033283 Ga0451805_033283_390_632 78
15 3300041486 Ga0451807_2241475 Ga0451807_2241475_185_427 78
16 3300041503 Ga0451847_0399665 Ga0451847_0399665_34_276 78
17 3300041997 Ga0439431_0174428 Ga0439431_0174428_193_435 78
18 3300044683 Ga0466965_0881851 Ga0466965_0881851_217_459 78
19 3300046454 Ga0495592_0515942 Ga0495592_0515942_269_511 78
20 3300046519 Ga0495632_0393919 Ga0495632_0393919_228_470 78
21 3300046536 Ga0495587_0620968 Ga0495587_0620968_228_470 78
22 3300046543 Ga0495645_0787223 Ga0495645_0787223_53_295 78
23 3300046810 Ga0495660_0478787 Ga0495660_0478787_260_502 78
24 3300047320 Ga0495672_0366862 Ga0495672_0366862_15_257 78
25 3300049127 Ga0501306_012996 Ga0501306_012996_395_637 78
26 3300049127 Ga0501306_021913 Ga0501306_021913_390_632 78
27 3300049127 Ga0501306_024806 Ga0501306_024806_215_457 78
28 3300049128 Ga0501308_003772 Ga0501308_003772_737_979 78
29 3300049128 Ga0501308_014409 Ga0501308_014409_189_431 78
30 3300049129 Ga0501309_022613 Ga0501309_022613_380_622 78
31 3300049129 Ga0501309_026348 Ga0501309_026348_205_447 78
32 3300049130 Ga0501310_010423 Ga0501310_010423_395_637 78
33 3300049130 Ga0501310_023606 Ga0501310_023606_160_402 78
34 3300049130 Ga0501310_039100 Ga0501310_039100_289_531 78
35 3300049130 Ga0501310_050316 Ga0501310_050316_339_581 78
36 3300049132 Ga0501343_009433 Ga0501343_009433_23_265 78
37 3300049160 Ga0501304_003651 Ga0501304_003651_397_639 78
38 3300049160 Ga0501304_004143 Ga0501304_004143_454_696 78
39 3300049160 Ga0501304_024890 Ga0501304_024890_103_345 78
40 3300049161 Ga0501305_014143 Ga0501305_014143_427_669 78
41 3300049161 Ga0501305_016351 Ga0501305_016351_536_778 78
42 3300049161 Ga0501305_036698 Ga0501305_036698_143_385 78
43 3300049161 Ga0501305_055361 Ga0501305_055361_218_460 78
44 3300049162 Ga0501307_023192 Ga0501307_023192_416_658 78
45 3300049162 Ga0501307_045348 Ga0501307_045348_390_632 78
46 3300049162 Ga0501307_046093 Ga0501307_046093_390_632 78
47 3300049527 Ga0501311_026925 Ga0501311_026925_402_644 78
48 3300049527 Ga0501311_050110 Ga0501311_050110_333_575 78
49 3300049528 Ga0501312_012401 Ga0501312_012401_444_686 78
50 3300049528 Ga0501312_041030 Ga0501312_041030_389_631 78
51 3300049529 Ga0501313_011491 Ga0501313_011491_402_644 78
52 3300049529 Ga0501313_047592 Ga0501313_047592_133_375 78
53 3300049530 Ga0501314_006227 Ga0501314_006227_392_634 78
54 3300049531 Ga0501315_012512 Ga0501315_012512_394_636 78
55 3300049531 Ga0501315_036644 Ga0501315_036644_391_633 78
56 3300049533 Ga0501317_032798 Ga0501317_032798_127_369 78
57 3300049536 Ga0501320_007955 Ga0501320_007955_393_635 78
58 3300049538 Ga0501322_011390 Ga0501322_011390_396_638 78
59 3300049539 Ga0501323_019129 Ga0501323_019129_388_630 78
60 3300049585 Ga0501069_0428636 Ga0501069_0428636_205_447 78
61 3300049661 Ga0501217_299355 Ga0501217_299355_226_468 78
62 3300049683 Ga0501253_089371 Ga0501253_089371_214_456 78
63 3300049686 Ga0501257_013424 Ga0501257_013424_1515_1757 78
64 3300049705 Ga0501225_0097734 Ga0501225_0097734_15_257 78
65 3300049742 Ga0501080_0949285 Ga0501080_0949285_51_293 78
66 3300050510 nmdc:mga06r32_331316_c2 nmdc:mga06r32_331316_c2_731_973 78
67 3300050511 nmdc:mga08y16_1470805_c1 nmdc:mga08y16_1470805_c1_237_479 78
68 3300053105 Ga0500557_001683 Ga0500557_001683_431_673 78
69 3300053108 Ga0500562_012872 Ga0500562_012872_522_764 78
70 3300053133 Ga0500655_115513 Ga0500655_115513_121_363 78
71 3300053151 Ga0500604_0117245 Ga0500604_0117245_26_268 78
72 3300053153 Ga0500616_0000007 Ga0500616_0000007_687281_687523 78
73 3300053153 Ga0500616_0149921 Ga0500616_0149921_684_926 78
74 3300053156 Ga0500622_0000006 Ga0500622_0000006_446619_446861 78
75 3300053156 Ga0500622_0000007 Ga0500622_0000007_390520_390762 78
76 3300053156 Ga0500622_0007051 Ga0500622_0007051_559_801 78
77 3300041446 Ga0451794_01862 Ga0451794_01862_40_285 79
78 3300003322 rootL2_10343901 rootL2_103439012 80
79 2088090003 LJN_F7QKVOU01AKOKO LJN_01623730 81
80 3300003320 rootH2_10021928 rootH2_100219282 81
81 3300003320 rootH2_10059229 rootH2_100592292 81
82 3300003322 rootL2_10041908 rootL2_100419083 81
83 3300003322 rootL2_10059006 rootL2_100590063 81
84 3300003322 rootL2_10070359 rootL2_100703599 81
85 3300003322 rootL2_10166768 rootL2_101667683 81
86 3300003323 rootH1_10013874 rootH1_100138745 81
87 3300003323 rootH1_10105718 rootH1_101057187 81
88 3300003544 Ga0007417J51691_1045397 Ga0007417J51691_10453972 81
89 3300003791 Ga0055530_10081257 Ga0055530_100812572 81
90 3300003794 Ga0055531_10000156 Ga0055531_1000015618 81
91 3300004625 Ga0055543_1043250 Ga0055543_10432501 81
92 3300004798 Ga0058859_11752864 Ga0058859_117528642 81
93 3300004801 Ga0058860_12076671 Ga0058860_120766712 81
94 3300005262 Ga0065165_1000638 Ga0065165_100063812 81
95 3300005262 Ga0065165_1002922 Ga0065165_10029227 81
96 3300005289 Ga0065704_10391739 Ga0065704_103917392 81
97 3300005293 Ga0065715_10091540 Ga0065715_100915402 81
98 3300005330 Ga0070690_100889784 Ga0070690_1008897842 81
99 3300005337 Ga0070682_101313733 Ga0070682_1013137332 81
100 3300005355 Ga0070671_100264385 Ga0070671_1002643853 81
101 3300005356 Ga0070674_102151954 Ga0070674_1021519542 81
102 3300005367 Ga0070667_101587567 Ga0070667_1015875672 81
103 3300005435 Ga0070714_101251517 Ga0070714_1012515171 81
104 3300005518 Ga0070699_101069245 Ga0070699_1010692452 81
105 3300005543 Ga0070672_102142310 Ga0070672_1021423102 81
106 3300005546 Ga0070696_100583668 Ga0070696_1005836682 81
107 3300005547 Ga0070693_100670934 Ga0070693_1006709341 81
108 3300005548 Ga0070665_100108085 Ga0070665_1001080853 81
109 3300005563 Ga0068855_100538656 Ga0068855_1005386562 81
110 3300005563 Ga0068855_101169979 Ga0068855_1011699792 81
111 3300005577 Ga0068857_100398169 Ga0068857_1003981692 81
112 3300005577 Ga0068857_101246693 Ga0068857_1012466932 81
113 3300005614 Ga0068856_100115577 Ga0068856_1001155772 81
114 3300005616 Ga0068852_100999040 Ga0068852_1009990402 81
115 3300005616 Ga0068852_102298004 Ga0068852_1022980041 81
116 3300005617 Ga0068859_101425464 Ga0068859_1014254642 81
117 3300005618 Ga0068864_100855601 Ga0068864_1008556012 81
118 3300005719 Ga0068861_100938283 Ga0068861_1009382832 81
119 3300005719 Ga0068861_101162508 Ga0068861_1011625082 81
120 3300005844 Ga0068862_102328860 Ga0068862_1023288601 81
121 3300005937 Ga0081455_10956036 Ga0081455_109560362 81
122 3300006028 Ga0070717_12059381 Ga0070717_120593812 81
123 3300006353 Ga0075370_10357371 Ga0075370_103573712 81
124 3300006353 Ga0075370_10374790 Ga0075370_103747902 81
125 3300006844 Ga0075428_100047052 Ga0075428_1000470523 81
126 3300006846 Ga0075430_100411202 Ga0075430_1004112021 81
127 3300006846 Ga0075430_100445048 Ga0075430_1004450482 81
128 3300006847 Ga0075431_100670479 Ga0075431_1006704794 81
129 3300006880 Ga0075429_100806285 Ga0075429_1008062852 81
130 3300006931 Ga0097620_101424857 Ga0097620_1014248571 81
131 3300009094 Ga0111539_10002316 Ga0111539_100023165 81
132 3300009094 Ga0111539_10550062 Ga0111539_105500622 81
133 3300013100 Ga0157373_10362596 Ga0157373_103625962 81
134 3300013100 Ga0157373_11239767 Ga0157373_112397672 81
135 3300013102 Ga0157371_10086671 Ga0157371_100866714 81
136 3300013102 Ga0157371_11090974 Ga0157371_110909742 81
137 3300013104 Ga0157370_10413030 Ga0157370_104130302 81
138 3300013104 Ga0157370_10786439 Ga0157370_107864392 81
139 3300013104 Ga0157370_10932914 Ga0157370_109329142 81
140 3300013104 Ga0157370_11166761 Ga0157370_111667611 81
141 3300013105 Ga0157369_11095009 Ga0157369_110950092 81
142 3300013307 Ga0157372_10679582 Ga0157372_106795822 81
143 3300013307 Ga0157372_11054858 Ga0157372_110548582 81
144 3300013308 Ga0157375_12349675 Ga0157375_123496752 81
145 3300014326 Ga0157380_10065533 Ga0157380_100655333 81
146 3300014326 Ga0157380_10092070 Ga0157380_100920703 81
147 3300014326 Ga0157380_10779123 Ga0157380_107791231 81
148 3300014326 Ga0157380_11280886 Ga0157380_112808862 81
149 3300014326 Ga0157380_13269258 Ga0157380_132692582 81
150 3300014969 Ga0157376_10694796 Ga0157376_106947962 81
151 3300014969 Ga0157376_11920249 Ga0157376_119202492 81
152 3300014969 Ga0157376_12563956 Ga0157376_125639562 81
153 3300017792 Ga0163161_10370427 Ga0163161_103704272 81
154 3300020078 Ga0206352_10033904 Ga0206352_100339042 81
155 3300020078 Ga0206352_10547937 Ga0206352_105479371 81
156 3300020082 Ga0206353_11493215 Ga0206353_114932152 81
157 3300022467 Ga0224712_10124474 Ga0224712_101244742 81
158 3300022467 Ga0224712_10306620 Ga0224712_103066202 81
159 3300025292 Ga0209676_1000116 Ga0209676_10001168 81
160 3300025298 Ga0209050_1012612 Ga0209050_10126124 81
161 3300025298 Ga0209050_1019352 Ga0209050_10193523 81
162 3300025304 Ga0209257_1000005 Ga0209257_10000051224 81
163 3300025304 Ga0209257_1044535 Ga0209257_10445353 81
164 3300025937 Ga0207669_11774093 Ga0207669_117740932 81
165 3300025986 Ga0207658_11103148 Ga0207658_111031481 81
166 3300026041 Ga0207639_11844976 Ga0207639_118449762 81
167 3300026078 Ga0207702_10091965 Ga0207702_100919652 81
168 3300026088 Ga0207641_10476602 Ga0207641_104766022 81
169 3300026116 Ga0207674_10967021 Ga0207674_109670212 81
170 3300026118 Ga0207675_100473288 Ga0207675_1004732882 81
171 3300026142 Ga0207698_10872400 Ga0207698_108724002 81
172 3300027378 Ga0209981_1078242 Ga0209981_10782421 81
173 3300027526 Ga0209968_1006801 Ga0209968_10068013 81
174 3300027876 Ga0209974_10136726 Ga0209974_101367262 81
175 3300027907 Ga0207428_10135387 Ga0207428_101353872 81
176 3300027907 Ga0207428_10158793 Ga0207428_101587933 81
177 3300028379 Ga0268266_10148744 Ga0268266_101487443 81
178 3300028794 Ga0307515_10755024 Ga0307515_107550241 81
179 3300031456 Ga0307513_10091297 Ga0307513_100912974 81
180 3300031456 Ga0307513_10319532 Ga0307513_103195322 81
181 3300031456 Ga0307513_10714827 Ga0307513_107148272 81
182 3300031507 Ga0307509_10026455 Ga0307509_100264555 81
183 3300031507 Ga0307509_10483320 Ga0307509_104833202 81
184 3300031548 Ga0307408_100021162 Ga0307408_1000211623 81
185 3300031548 Ga0307408_100074235 Ga0307408_1000742352 81
186 3300031548 Ga0307408_100799745 Ga0307408_1007997452 81
187 3300031548 Ga0307408_101701276 Ga0307408_1017012762 81
188 3300031728 Ga0316578_10529796 Ga0316578_105297961 81
189 3300031730 Ga0307516_10422442 Ga0307516_104224423 81
190 3300031731 Ga0307405_10005530 Ga0307405_100055305 81
191 3300031731 Ga0307405_10904582 Ga0307405_109045822 81
192 3300031731 Ga0307405_10921243 Ga0307405_109212431 81
193 3300031733 Ga0316577_10191417 Ga0316577_101914172 81
194 3300031824 Ga0307413_10230379 Ga0307413_102303792 81
195 3300031824 Ga0307413_10921202 Ga0307413_109212022 81
196 3300031824 Ga0307413_10991269 Ga0307413_109912692 81
197 3300031824 Ga0307413_11078823 Ga0307413_110788231 81
198 3300031824 Ga0307413_11756132 Ga0307413_117561322 81
199 3300031901 Ga0307406_11138214 Ga0307406_111382142 81
200 3300031901 Ga0307406_11506537 Ga0307406_115065371 81
201 3300031903 Ga0307407_10422244 Ga0307407_104222442 81
202 3300031903 Ga0307407_11588788 Ga0307407_115887882 81
203 3300031911 Ga0307412_10032821 Ga0307412_100328214 81
204 3300031995 Ga0307409_100147093 Ga0307409_1001470932 81
205 3300032002 Ga0307416_100001768 Ga0307416_1000017688 81
206 3300032002 Ga0307416_100785574 Ga0307416_1007855742 81
207 3300032002 Ga0307416_102375955 Ga0307416_1023759552 81
208 3300032002 Ga0307416_103101913 Ga0307416_1031019131 81
209 3300032002 Ga0307416_103316978 Ga0307416_1033169782 81
210 3300032004 Ga0307414_10018733 Ga0307414_100187335 81
211 3300032004 Ga0307414_10257282 Ga0307414_102572823 81
212 3300032004 Ga0307414_10266997 Ga0307414_102669972 81
213 3300032004 Ga0307414_10711146 Ga0307414_107111462 81
214 3300032004 Ga0307414_10897694 Ga0307414_108976941 81
215 3300032004 Ga0307414_11964037 Ga0307414_119640372 81
216 3300032004 Ga0307414_12276698 Ga0307414_122766982 81
217 3300032005 Ga0307411_10159860 Ga0307411_101598603 81
218 3300032005 Ga0307411_10466613 Ga0307411_104666131 81
219 3300032005 Ga0307411_10570230 Ga0307411_105702302 81
220 3300032126 Ga0307415_100004007 Ga0307415_1000040073 81
221 3300032126 Ga0307415_100488519 Ga0307415_1004885192 81
222 3300032168 Ga0316593_10164912 Ga0316593_101649122 81
223 3300033541 Ga0316596_1050649 Ga0316596_10506492 81
224 3300033541 Ga0316596_1052798 Ga0316596_10527982 81
225 3300035090 Ga0373949_0167091 Ga0373949_0167091_117_368 81
226 3300035112 Ga0373932_0380096 Ga0373932_0380096_31_282 81
227 3300035120 Ga0373957_0364288 Ga0373957_0364288_98_349 81
228 3300035170 Ga0373943_0750357 Ga0373943_0750357_38_289 81
229 3300035171 Ga0373946_0723673 Ga0373946_0723673_189_440 81
230 3300035691 Ga0373931_0732271 Ga0373931_0732271_389_640 81
231 3300035692 Ga0373935_0514633 Ga0373935_0514633_155_406 81
232 3300035692 Ga0373935_0520726 Ga0373935_0520726_103_354 81
233 3300036401 Ga0373937_0538685 Ga0373937_0538685_260_511 81
234 3300036647 Ga0316582_0129794 Ga0316582_0129794_789_1040 81
235 3300036712 Ga0316584_0135153 Ga0316584_0135153_1337_1588 81
236 3300037068 Ga0373925_0991909 Ga0373925_0991909_391_642 81
237 3300037312 Ga0395899_0709277 Ga0395899_0709277_105_356 81
238 3300037418 Ga0395900_0232623 Ga0395900_0232623_1006_1257 81
239 3300037466 Ga0395898_0564051 Ga0395898_0564051_767_1018 81
240 3300041404 Ga0439436_0121468 Ga0439436_0121468_207_458 81
241 3300041444 Ga0451790_07707 Ga0451790_07707_431_682 81
242 3300041444 Ga0451790_18742 Ga0451790_18742_303_554 81
243 3300041444 Ga0451790_20881 Ga0451790_20881_273_524 81
244 3300041444 Ga0451790_36522 Ga0451790_36522_390_641 81
245 3300041444 Ga0451790_37904 Ga0451790_37904_285_536 81
246 3300041446 Ga0451794_11718 Ga0451794_11718_378_629 81
247 3300041446 Ga0451794_43681 Ga0451794_43681_458_709 81
248 3300041446 Ga0451794_43900 Ga0451794_43900_264_515 81
249 3300041446 Ga0451794_54809 Ga0451794_54809_458_709 81
250 3300041451 Ga0451791_1228747 Ga0451791_1228747_448_699 81
251 3300041451 Ga0451791_1401627 Ga0451791_1401627_14_265 81
252 3300041458 Ga0451798_0494817 Ga0451798_0494817_575_826 81
253 3300041459 Ga0451800_0821904 Ga0451800_0821904_212_463 81
254 3300041459 Ga0451800_1527829 Ga0451800_1527829_378_629 81
255 3300041461 Ga0451805_090600 Ga0451805_090600_162_413 81
256 3300041463 Ga0451804_0672041 Ga0451804_0672041_138_389 81
257 3300041486 Ga0451807_2603249 Ga0451807_2603249_90_341 81
258 3300041494 Ga0451837_0694855 Ga0451837_0694855_138_389 81
259 3300041512 Ga0451853_1346926 Ga0451853_1346926_103_354 81
260 3300041907 Ga0452268_38768 Ga0452268_38768_179_430 81
261 3300042004 Ga0439445_0214960 Ga0439445_0214960_205_456 81
262 3300042007 Ga0439449_0126591 Ga0439449_0126591_88_339 81
263 3300042014 Ga0439457_019991 Ga0439457_019991_470_721 81
264 3300042014 Ga0439457_111295 Ga0439457_111295_370_621 81
265 3300042015 Ga0439462_0061923 Ga0439462_0061923_692_943 81
266 3300044672 Ga0466982_0214441 Ga0466982_0214441_619_870 81
267 3300044706 Ga0466964_0347321 Ga0466964_0347321_326_577 81
268 3300045051 Ga0451576_0191236 Ga0451576_0191236_516_767 81
269 3300045051 Ga0451576_1293076 Ga0451576_1293076_223_477 81
270 3300046460 Ga0495638_0000003 Ga0495638_0000003_60627_60878 81
271 3300046514 Ga0495618_0263927 Ga0495618_0263927_676_927 81
272 3300046535 Ga0495586_0567569 Ga0495586_0567569_168_419 81
273 3300046660 Ga0495625_0420427 Ga0495625_0420427_205_456 81
274 3300046681 Ga0495647_0512859 Ga0495647_0512859_196_447 81
275 3300047319 Ga0495674_0277468 Ga0495674_0277468_801_1052 81
276 3300048905 Ga0496102_1560216 Ga0496102_1560216_102_353 81
277 3300049127 Ga0501306_014450 Ga0501306_014450_380_631 81
278 3300049127 Ga0501306_015295 Ga0501306_015295_373_624 81
279 3300049127 Ga0501306_020337 Ga0501306_020337_430_681 81
280 3300049127 Ga0501306_021083 Ga0501306_021083_358_609 81
281 3300049127 Ga0501306_032761 Ga0501306_032761_74_325 81
282 3300049127 Ga0501306_034399 Ga0501306_034399_128_379 81
283 3300049127 Ga0501306_034627 Ga0501306_034627_447_698 81
284 3300049127 Ga0501306_035574 Ga0501306_035574_248_499 81
285 3300049127 Ga0501306_041626 Ga0501306_041626_396_647 81
286 3300049127 Ga0501306_052727 Ga0501306_052727_386_637 81
287 3300049127 Ga0501306_059320 Ga0501306_059320_72_323 81
288 3300049127 Ga0501306_093047 Ga0501306_093047_48_299 81
289 3300049128 Ga0501308_008834 Ga0501308_008834_401_652 81
290 3300049128 Ga0501308_008962 Ga0501308_008962_381_632 81
291 3300049128 Ga0501308_009167 Ga0501308_009167_463_714 81
292 3300049128 Ga0501308_015919 Ga0501308_015919_472_723 81
293 3300049128 Ga0501308_021558 Ga0501308_021558_411_662 81
294 3300049128 Ga0501308_021634 Ga0501308_021634_253_504 81
295 3300049128 Ga0501308_024752 Ga0501308_024752_351_602 81
296 3300049128 Ga0501308_032292 Ga0501308_032292_221_472 81
297 3300049128 Ga0501308_041439 Ga0501308_041439_372_623 81
298 3300049128 Ga0501308_047650 Ga0501308_047650_29_280 81
299 3300049128 Ga0501308_053416 Ga0501308_053416_301_552 81
300 3300049129 Ga0501309_010261 Ga0501309_010261_567_818 81
301 3300049129 Ga0501309_013318 Ga0501309_013318_391_642 81
302 3300049129 Ga0501309_014129 Ga0501309_014129_429_680 81
303 3300049129 Ga0501309_015379 Ga0501309_015379_335_586 81
304 3300049129 Ga0501309_028354 Ga0501309_028354_186_437 81
305 3300049129 Ga0501309_033070 Ga0501309_033070_100_351 81
306 3300049129 Ga0501309_040952 Ga0501309_040952_75_326 81
307 3300049129 Ga0501309_076775 Ga0501309_076775_76_327 81
308 3300049130 Ga0501310_002922 Ga0501310_002922_433_684 81
309 3300049130 Ga0501310_008631 Ga0501310_008631_388_639 81
310 3300049130 Ga0501310_010345 Ga0501310_010345_379_630 81
311 3300049130 Ga0501310_010793 Ga0501310_010793_386_637 81
312 3300049130 Ga0501310_010826 Ga0501310_010826_386_637 81
313 3300049130 Ga0501310_024098 Ga0501310_024098_413_664 81
314 3300049130 Ga0501310_034290 Ga0501310_034290_365_616 81
315 3300049130 Ga0501310_034717 Ga0501310_034717_27_278 81
316 3300049131 Ga0501341_06434 Ga0501341_06434_214_465 81
317 3300049132 Ga0501343_004394 Ga0501343_004394_501_752 81
318 3300049132 Ga0501343_008170 Ga0501343_008170_386_637 81
319 3300049132 Ga0501343_009636 Ga0501343_009636_68_319 81
320 3300049132 Ga0501343_011132 Ga0501343_011132_122_373 81
321 3300049132 Ga0501343_015375 Ga0501343_015375_339_590 81
322 3300049132 Ga0501343_017243 Ga0501343_017243_45_296 81
323 3300049133 Ga0501344_02385 Ga0501344_02385_429_680 81
324 3300049133 Ga0501344_02505 Ga0501344_02505_388_639 81
325 3300049133 Ga0501344_07378 Ga0501344_07378_358_609 81
326 3300049133 Ga0501344_11086 Ga0501344_11086_126_377 81
327 3300049134 Ga0501345_02321 Ga0501345_02321_356_607 81
328 3300049134 Ga0501345_03996 Ga0501345_03996_376_627 81
329 3300049160 Ga0501304_003806 Ga0501304_003806_459_710 81
330 3300049160 Ga0501304_004998 Ga0501304_004998_387_638 81
331 3300049160 Ga0501304_006214 Ga0501304_006214_379_630 81
332 3300049160 Ga0501304_009470 Ga0501304_009470_149_400 81
333 3300049160 Ga0501304_010919 Ga0501304_010919_370_621 81
334 3300049160 Ga0501304_014447 Ga0501304_014447_384_635 81
335 3300049160 Ga0501304_017453 Ga0501304_017453_387_638 81
336 3300049160 Ga0501304_017659 Ga0501304_017659_51_302 81
337 3300049160 Ga0501304_025220 Ga0501304_025220_47_298 81
338 3300049161 Ga0501305_013182 Ga0501305_013182_383_634 81
339 3300049161 Ga0501305_013847 Ga0501305_013847_506_757 81
340 3300049161 Ga0501305_015557 Ga0501305_015557_438_689 81
341 3300049161 Ga0501305_016071 Ga0501305_016071_429_680 81
342 3300049161 Ga0501305_017127 Ga0501305_017127_383_634 81
343 3300049161 Ga0501305_017503 Ga0501305_017503_401_652 81
344 3300049161 Ga0501305_023772 Ga0501305_023772_256_507 81
345 3300049161 Ga0501305_026757 Ga0501305_026757_367_618 81
346 3300049161 Ga0501305_033220 Ga0501305_033220_382_633 81
347 3300049161 Ga0501305_034257 Ga0501305_034257_173_424 81
348 3300049161 Ga0501305_037808 Ga0501305_037808_224_475 81
349 3300049161 Ga0501305_049134 Ga0501305_049134_18_269 81
350 3300049161 Ga0501305_049817 Ga0501305_049817_78_329 81
351 3300049161 Ga0501305_058026 Ga0501305_058026_387_638 81
352 3300049161 Ga0501305_059016 Ga0501305_059016_388_639 81
353 3300049161 Ga0501305_060730 Ga0501305_060730_380_631 81
354 3300049161 Ga0501305_090984 Ga0501305_090984_76_327 81
355 3300049162 Ga0501307_009652 Ga0501307_009652_461_712 81
356 3300049162 Ga0501307_011130 Ga0501307_011130_377_628 81
357 3300049162 Ga0501307_012653 Ga0501307_012653_303_554 81
358 3300049162 Ga0501307_017539 Ga0501307_017539_399_650 81
359 3300049162 Ga0501307_027688 Ga0501307_027688_386_637 81
360 3300049162 Ga0501307_028976 Ga0501307_028976_386_637 81
361 3300049162 Ga0501307_032831 Ga0501307_032831_94_345 81
362 3300049162 Ga0501307_033029 Ga0501307_033029_227_478 81
363 3300049162 Ga0501307_033396 Ga0501307_033396_388_639 81
364 3300049162 Ga0501307_033948 Ga0501307_033948_388_639 81
365 3300049162 Ga0501307_035447 Ga0501307_035447_128_379 81
366 3300049162 Ga0501307_035591 Ga0501307_035591_125_376 81
367 3300049163 Ga0501342_00520 Ga0501342_00520_388_639 81
368 3300049163 Ga0501342_02463 Ga0501342_02463_342_593 81
369 3300049163 Ga0501342_02531 Ga0501342_02531_133_384 81
370 3300049514 Ga0501291_169443 Ga0501291_169443_99_350 81
371 3300049520 Ga0501297_012664 Ga0501297_012664_170_421 81
372 3300049527 Ga0501311_012039 Ga0501311_012039_357_608 81
373 3300049527 Ga0501311_012152 Ga0501311_012152_454_705 81
374 3300049527 Ga0501311_012262 Ga0501311_012262_388_639 81
375 3300049527 Ga0501311_014876 Ga0501311_014876_353_604 81
376 3300049527 Ga0501311_020093 Ga0501311_020093_381_632 81
377 3300049527 Ga0501311_030316 Ga0501311_030316_221_472 81
378 3300049527 Ga0501311_035107 Ga0501311_035107_440_691 81
379 3300049527 Ga0501311_041697 Ga0501311_041697_79_330 81
380 3300049527 Ga0501311_055305 Ga0501311_055305_368_619 81
381 3300049527 Ga0501311_094603 Ga0501311_094603_164_415 81
382 3300049528 Ga0501312_014985 Ga0501312_014985_461_712 81
383 3300049528 Ga0501312_015073 Ga0501312_015073_394_645 81
384 3300049528 Ga0501312_015858 Ga0501312_015858_383_634 81
385 3300049528 Ga0501312_016744 Ga0501312_016744_430_681 81
386 3300049528 Ga0501312_019226 Ga0501312_019226_384_635 81
387 3300049528 Ga0501312_023576 Ga0501312_023576_381_632 81
388 3300049528 Ga0501312_026869 Ga0501312_026869_390_641 81
389 3300049528 Ga0501312_035087 Ga0501312_035087_69_320 81
390 3300049528 Ga0501312_035477 Ga0501312_035477_391_642 81
391 3300049528 Ga0501312_036492 Ga0501312_036492_358_609 81
392 3300049528 Ga0501312_046111 Ga0501312_046111_98_349 81
393 3300049528 Ga0501312_050266 Ga0501312_050266_75_326 81
394 3300049528 Ga0501312_050804 Ga0501312_050804_379_630 81
395 3300049529 Ga0501313_009507 Ga0501313_009507_384_635 81
396 3300049529 Ga0501313_010071 Ga0501313_010071_370_621 81
397 3300049529 Ga0501313_010511 Ga0501313_010511_333_584 81
398 3300049529 Ga0501313_015783 Ga0501313_015783_372_623 81
399 3300049529 Ga0501313_016931 Ga0501313_016931_382_633 81
400 3300049529 Ga0501313_017089 Ga0501313_017089_256_507 81
401 3300049529 Ga0501313_020841 Ga0501313_020841_250_501 81
402 3300049529 Ga0501313_031425 Ga0501313_031425_381_632 81
403 3300049529 Ga0501313_037098 Ga0501313_037098_377_628 81
404 3300049529 Ga0501313_052869 Ga0501313_052869_240_491 81
405 3300049529 Ga0501313_064177 Ga0501313_064177_126_377 81
406 3300049530 Ga0501314_004302 Ga0501314_004302_431_682 81
407 3300049530 Ga0501314_008595 Ga0501314_008595_235_486 81
408 3300049530 Ga0501314_008932 Ga0501314_008932_166_417 81
409 3300049531 Ga0501315_002780 Ga0501315_002780_491_742 81
410 3300049531 Ga0501315_008829 Ga0501315_008829_503_754 81
411 3300049531 Ga0501315_009612 Ga0501315_009612_414_665 81
412 3300049531 Ga0501315_009739 Ga0501315_009739_523_774 81
413 3300049531 Ga0501315_015880 Ga0501315_015880_464_715 81
414 3300049531 Ga0501315_017791 Ga0501315_017791_383_634 81
415 3300049531 Ga0501315_018691 Ga0501315_018691_392_643 81
416 3300049531 Ga0501315_018738 Ga0501315_018738_386_637 81
417 3300049531 Ga0501315_020775 Ga0501315_020775_388_639 81
418 3300049531 Ga0501315_047085 Ga0501315_047085_73_324 81
419 3300049531 Ga0501315_049508 Ga0501315_049508_379_630 81
420 3300049531 Ga0501315_056338 Ga0501315_056338_110_361 81
421 3300049531 Ga0501315_066120 Ga0501315_066120_214_465 81
422 3300049531 Ga0501315_084592 Ga0501315_084592_26_277 81
423 3300049531 Ga0501315_087967 Ga0501315_087967_10_261 81
424 3300049531 Ga0501315_090886 Ga0501315_090886_233_484 81
425 3300049531 Ga0501315_096687 Ga0501315_096687_68_319 81
426 3300049532 Ga0501316_008863 Ga0501316_008863_387_638 81
427 3300049532 Ga0501316_010502 Ga0501316_010502_382_633 81
428 3300049532 Ga0501316_011702 Ga0501316_011702_388_639 81
429 3300049532 Ga0501316_013791 Ga0501316_013791_371_622 81
430 3300049532 Ga0501316_016037 Ga0501316_016037_279_530 81
431 3300049532 Ga0501316_020354 Ga0501316_020354_386_637 81
432 3300049532 Ga0501316_026707 Ga0501316_026707_373_624 81
433 3300049532 Ga0501316_036793 Ga0501316_036793_142_393 81
434 3300049532 Ga0501316_039608 Ga0501316_039608_386_637 81
435 3300049532 Ga0501316_050630 Ga0501316_050630_13_264 81
436 3300049532 Ga0501316_080049 Ga0501316_080049_205_456 81
437 3300049533 Ga0501317_009666 Ga0501317_009666_430_681 81
438 3300049533 Ga0501317_010117 Ga0501317_010117_425_676 81
439 3300049533 Ga0501317_010966 Ga0501317_010966_388_639 81
440 3300049533 Ga0501317_015927 Ga0501317_015927_282_533 81
441 3300049533 Ga0501317_029175 Ga0501317_029175_95_346 81
442 3300049533 Ga0501317_042431 Ga0501317_042431_72_323 81
443 3300049533 Ga0501317_052589 Ga0501317_052589_316_567 81
444 3300049533 Ga0501317_063687 Ga0501317_063687_127_378 81
445 3300049533 Ga0501317_078295 Ga0501317_078295_61_312 81
446 3300049533 Ga0501317_078574 Ga0501317_078574_203_454 81
447 3300049533 Ga0501317_080952 Ga0501317_080952_63_314 81
448 3300049534 Ga0501318_012125 Ga0501318_012125_375_626 81
449 3300049534 Ga0501318_012691 Ga0501318_012691_328_579 81
450 3300049534 Ga0501318_026202 Ga0501318_026202_214_465 81
451 3300049534 Ga0501318_040195 Ga0501318_040195_11_262 81
452 3300049534 Ga0501318_041656 Ga0501318_041656_371_622 81
453 3300049535 Ga0501319_007990 Ga0501319_007990_229_480 81
454 3300049535 Ga0501319_016364 Ga0501319_016364_245_496 81
455 3300049536 Ga0501320_006151 Ga0501320_006151_396_647 81
456 3300049536 Ga0501320_006613 Ga0501320_006613_430_681 81
457 3300049536 Ga0501320_007320 Ga0501320_007320_483_734 81
458 3300049536 Ga0501320_012204 Ga0501320_012204_346_597 81
459 3300049536 Ga0501320_020478 Ga0501320_020478_126_377 81
460 3300049536 Ga0501320_024881 Ga0501320_024881_393_644 81
461 3300049536 Ga0501320_034023 Ga0501320_034023_183_434 81
462 3300049536 Ga0501320_039808 Ga0501320_039808_23_274 81
463 3300049537 Ga0501321_007431 Ga0501321_007431_388_639 81
464 3300049537 Ga0501321_010249 Ga0501321_010249_404_655 81
465 3300049537 Ga0501321_016036 Ga0501321_016036_383_634 81
466 3300049537 Ga0501321_035192 Ga0501321_035192_318_569 81
467 3300049537 Ga0501321_059766 Ga0501321_059766_161_412 81
468 3300049537 Ga0501321_066377 Ga0501321_066377_273_524 81
469 3300049538 Ga0501322_007806 Ga0501322_007806_345_596 81
470 3300049538 Ga0501322_022026 Ga0501322_022026_81_332 81
471 3300049539 Ga0501323_009489 Ga0501323_009489_510_761 81
472 3300049539 Ga0501323_009934 Ga0501323_009934_495_746 81
473 3300049539 Ga0501323_011435 Ga0501323_011435_379_630 81
474 3300049539 Ga0501323_017914 Ga0501323_017914_393_638 81
475 3300049539 Ga0501323_021571 Ga0501323_021571_367_618 81
476 3300049539 Ga0501323_022583 Ga0501323_022583_225_476 81
477 3300049539 Ga0501323_034052 Ga0501323_034052_221_472 81
478 3300049539 Ga0501323_043844 Ga0501323_043844_399_650 81
479 3300049540 Ga0501324_008640 Ga0501324_008640_365_616 81
480 3300049540 Ga0501324_008708 Ga0501324_008708_327_578 81
481 3300049540 Ga0501324_025882 Ga0501324_025882_43_294 81
482 3300049541 Ga0501325_002694 Ga0501325_002694_503_754 81
483 3300049541 Ga0501325_004311 Ga0501325_004311_388_639 81
484 3300049541 Ga0501325_012622 Ga0501325_012622_94_345 81
485 3300049541 Ga0501325_027155 Ga0501325_027155_215_466 81
486 3300049541 Ga0501325_049306 Ga0501325_049306_33_284 81
487 3300049542 Ga0501326_02939 Ga0501326_02939_377_631 81
488 3300049542 Ga0501326_04677 Ga0501326_04677_430_681 81
489 3300049542 Ga0501326_06451 Ga0501326_06451_149_400 81
490 3300049543 Ga0501327_04732 Ga0501327_04732_214_465 81
491 3300049543 Ga0501327_05620 Ga0501327_05620_481_732 81
492 3300049543 Ga0501327_08142 Ga0501327_08142_370_621 81
493 3300049544 Ga0501328_01626 Ga0501328_01626_376_627 81
494 3300049544 Ga0501328_01697 Ga0501328_01697_221_472 81
495 3300049544 Ga0501328_04723 Ga0501328_04723_246_497 81
496 3300049545 Ga0501329_02419 Ga0501329_02419_287_538 81
497 3300049545 Ga0501329_02439 Ga0501329_02439_253_504 81
498 3300049545 Ga0501329_03655 Ga0501329_03655_256_507 81
499 3300049546 Ga0501330_002417 Ga0501330_002417_363_614 81
500 3300049546 Ga0501330_008816 Ga0501330_008816_198_449 81
501 3300049546 Ga0501330_019947 Ga0501330_019947_78_329 81
502 3300049547 Ga0501331_01667 Ga0501331_01667_480_731 81
503 3300049547 Ga0501331_02426 Ga0501331_02426_413_664 81
504 3300049548 Ga0501332_02240 Ga0501332_02240_454_705 81
505 3300049548 Ga0501332_02401 Ga0501332_02401_408_659 81
506 3300049548 Ga0501332_03871 Ga0501332_03871_231_482 81
507 3300049548 Ga0501332_15050 Ga0501332_15050_257_508 81
508 3300049549 Ga0501333_003787 Ga0501333_003787_378_629 81
509 3300049549 Ga0501333_005070 Ga0501333_005070_483_734 81
510 3300049550 Ga0501334_04468 Ga0501334_04468_410_661 81
511 3300049550 Ga0501334_04730 Ga0501334_04730_365_616 81
512 3300049550 Ga0501334_13342 Ga0501334_13342_129_380 81
513 3300049550 Ga0501334_21971 Ga0501334_21971_133_384 81
514 3300049551 Ga0501335_006795 Ga0501335_006795_371_622 81
515 3300049551 Ga0501335_013600 Ga0501335_013600_286_537 81
516 3300049551 Ga0501335_016920 Ga0501335_016920_52_303 81
517 3300049551 Ga0501335_022244 Ga0501335_022244_417_668 81
518 3300049551 Ga0501335_026723 Ga0501335_026723_356_607 81
519 3300049552 Ga0501336_003441 Ga0501336_003441_454_705 81
520 3300049552 Ga0501336_003854 Ga0501336_003854_376_627 81
521 3300049552 Ga0501336_004582 Ga0501336_004582_437_688 81
522 3300049552 Ga0501336_012216 Ga0501336_012216_221_472 81
523 3300049552 Ga0501336_021581 Ga0501336_021581_48_299 81
524 3300049553 Ga0501337_002518 Ga0501337_002518_433_684 81
525 3300049553 Ga0501337_005054 Ga0501337_005054_141_392 81
526 3300049553 Ga0501337_007968 Ga0501337_007968_244_495 81
527 3300049553 Ga0501337_011868 Ga0501337_011868_370_621 81
528 3300049553 Ga0501337_023641 Ga0501337_023641_28_279 81
529 3300049554 Ga0501338_03556 Ga0501338_03556_430_681 81
530 3300049554 Ga0501338_05744 Ga0501338_05744_416_667 81
531 3300049554 Ga0501338_11971 Ga0501338_11971_108_359 81
532 3300049555 Ga0501339_01530 Ga0501339_01530_42_293 81
533 3300049556 Ga0501340_002966 Ga0501340_002966_315_566 81
534 3300049556 Ga0501340_003527 Ga0501340_003527_365_616 81
535 3300049556 Ga0501340_005053 Ga0501340_005053_287_538 81
536 3300049556 Ga0501340_013782 Ga0501340_013782_339_590 81
537 3300049556 Ga0501340_016699 Ga0501340_016699_204_455 81
538 3300049649 Ga0501198_137148 Ga0501198_137148_113_364 81
539 3300049658 Ga0501211_045580 Ga0501211_045580_88_339 81
540 3300049660 Ga0501216_123992 Ga0501216_123992_29_280 81
541 3300049661 Ga0501217_003293 Ga0501217_003293_1948_2199 81
542 3300049665 Ga0501227_093219 Ga0501227_093219_95_346 81
543 3300049665 Ga0501227_158794 Ga0501227_158794_317_568 81
544 3300049686 Ga0501257_228853 Ga0501257_228853_83_334 81
545 3300049690 Ga0501261_133374 Ga0501261_133374_208_459 81
546 3300049705 Ga0501225_0016689 Ga0501225_0016689_695_946 81
547 3300049824 Ga0501045_1052389 Ga0501045_1052389_303_554 81
548 3300050493 nmdc:mga0k408_407926_c1 nmdc:mga0k408_407926_c1_20_271 81
549 3300050496 nmdc:mga07m45_796292_c1 nmdc:mga07m45_796292_c1_176_427 81
550 3300050496 nmdc:mga07m45_838565_c1 nmdc:mga07m45_838565_c1_118_369 81
551 3300050508 nmdc:mga09592_599031_c1 nmdc:mga09592_599031_c1_389_640 81
552 3300050511 nmdc:mga08y16_12267_c1 nmdc:mga08y16_12267_c1_5084_5335 81
553 3300050511 nmdc:mga08y16_8157_c1 nmdc:mga08y16_8157_c1_10029_10280 81
554 3300053088 Ga0500644_0376310 Ga0500644_0376310_105_356 81
555 3300053090 Ga0500646_0044072 Ga0500646_0044072_556_807 81
556 3300053093 Ga0500651_0073787 Ga0500651_0073787_759_1010 81
557 3300053104 Ga0500556_0121854 Ga0500556_0121854_323_574 81
558 3300053118 Ga0500594_0188206 Ga0500594_0188206_241_492 81
559 3300053133 Ga0500655_002144 Ga0500655_002144_1683_1934 81
560 3300053139 Ga0500568_0071598 Ga0500568_0071598_421_672 81
561 3300053151 Ga0500604_0001909 Ga0500604_0001909_2988_3239 81
562 3300053153 Ga0500616_0081035 Ga0500616_0081035_427_678 81
563 3300053158 Ga0500627_0317032 Ga0500627_0317032_64_315 81
564 3300053730 Ga0500645_029891 Ga0500645_029891_1130_1381 81
565 3300059478 Ga0587093_015132 Ga0587093_015132_431_682 81
566 3300059491 Ga0587070_016228 Ga0587070_016228_389_640 81
567 3300059491 Ga0587070_038673 Ga0587070_038673_177_428 81
568 3300059493 Ga0587077_021160 Ga0587077_021160_417_668 81
569 3300059493 Ga0587077_230363 Ga0587077_230363_78_329 81
570 3300059507 Ga0587086_059684 Ga0587086_059684_168_419 81
571 3300059507 Ga0587086_081047 Ga0587086_081047_10_261 81
572 3300059510 Ga0587090_014162 Ga0587090_014162_430_681 81
573 3300059511 Ga0587091_048696 Ga0587091_048696_430_681 81
574 3300059607 Ga0587125_006222 Ga0587125_006222_479_730 81
575 3300059623 Ga0587101_010605 Ga0587101_010605_430_681 81
576 3300059624 Ga0587109_162062 Ga0587109_162062_242_493 81
577 3300059626 Ga0587115_009841 Ga0587115_009841_513_764 81
578 3300059626 Ga0587115_024253 Ga0587115_024253_374_625 81
579 3300059627 Ga0587117_031748 Ga0587117_031748_385_636 81
580 3300059630 Ga0587128_013125 Ga0587128_013125_430_681 81
581 3300059639 Ga0587062_011037 Ga0587062_011037_447_698 81
582 3300059641 Ga0587068_020526 Ga0587068_020526_386_637 81
583 3300059641 Ga0587068_031891 Ga0587068_031891_393_644 81
584 3300059643 Ga0587072_019500 Ga0587072_019500_386_637 81
585 3300059645 Ga0587076_073777 Ga0587076_073777_114_365 81
586 3300059652 Ga0587107_041014 Ga0587107_041014_11_262 81
587 3300059653 Ga0587108_013609 Ga0587108_013609_432_683 81
588 3300059660 Ga0587124_003559 Ga0587124_003559_430_681 81
589 3300059660 Ga0587124_007856 Ga0587124_007856_370_621 81
590 3300060246 Ga0587081_03900 Ga0587081_03900_324_575 81
591 3300060346 Ga0587111_0023890 Ga0587111_0023890_402_671 81
592 3300060346 Ga0587111_0080276 Ga0587111_0080276_104_355 81
593 iso_pu_bacteria 2585427687 2586209202 83
594 iso_pu_bacteria 2599185184 2599479105 83
595 iso_pu_bacteria 2721755487 2722730250 83
596 iso_pu_bacteria 2738541283 2738755552 83
597 iso_pu_bacteria 2738541284 2738762203 83
598 iso_pu_bacteria 2738541302 2738852022 83
599 iso_pu_bacteria 2738543023 2739303513 83
600 iso_pu_bacteria 2739367651 2739590907 83
601 iso_pu_bacteria 2739367656 2739616886 83
602 iso_pu_bacteria 2739367663 2739647233 83
603 iso_pu_bacteria 2775506987 2776615174 83
604 iso_pu_bacteria 2818991437 2819546571 83
605 iso_pu_bacteria 2842722452 2842725270 83
606 iso_pu_bacteria 2842903701 2842905937 83
607 iso_pu_bacteria 2842909656 2842912542 83
608 iso_pu_bacteria 2849281842 2849286243 83
609 iso_pu_bacteria 2852623160 2852625146 83
610 iso_pu_bacteria 2852627209 2852631592 83
611 iso_pu_bacteria 2857627736 2857629673 83
612 iso_pu_bacteria 2884933994 2884934162 83
613 iso_pu_bacteria 2887375801 2887380596 83
614 iso_pu_bacteria 2890737413 2890737969 83
615 iso_pu_bacteria 2895498888 2895501622 83
616 iso_pu_bacteria 2896317667 2896321583 83
617 iso_pu_bacteria 2896344016 2896344986 83
618 iso_pu_bacteria 2898713307 2898716705 83
619 iso_pu_bacteria 2902048731 2902051151 83
620 iso_pu_bacteria 2904445276 2904446719 83
621 iso_pu_bacteria 2904780799 2904783893 83
622 iso_pu_bacteria 2919177583 2919181831 83
623 iso_pu_bacteria 2919186247 2919190520 83
624 iso_pu_bacteria 2919437846 2919442773 83
625 iso_pu_bacteria 2928078545 2928082579 83
626 iso_pu_bacteria 2928147474 2928148832 83
627 iso_pu_bacteria 2932082852 2932086369 83
628 iso_pu_bacteria 2939664404 2939668801 83
629 iso_pu_bacteria 2945997725 2946002184 83
630 iso_pu_bacteria 2954016120 2954019087 83
631 iso_pu_bacteria 2977232053 2977235935 83
632 iso_pu_bacteria 3003233435 3003236823 83
633 iso_pu_bacteria 8055588893 8055589347 83
634 iso_pu_bacteria 2513020052 2513235765 84
635 iso_pu_bacteria 2519899754 2520878779 84
636 iso_pu_bacteria 2643221600 2644011518 84
637 iso_pu_bacteria 2643221667 2644369916 84
638 iso_pu_bacteria 2643221716 2644642239 84
639 iso_pu_bacteria 2643221725 2644685307 84
640 iso_pu_bacteria 2738541279 2738731894 84
641 iso_pu_bacteria 2738541285 2738764459 84
642 iso_pu_bacteria 2738543007 2739213474 84
643 iso_pu_bacteria 2739367857 2740000740 84
644 iso_pu_bacteria 2739367858 2740005556 84
645 iso_pu_bacteria 2802428842 2802654222 84
646 iso_pu_bacteria 2816332280 2817415752 84
647 iso_pu_bacteria 2833640130 2833643080 84
648 iso_pu_bacteria 2857613821 2857614495 84
649 iso_pu_bacteria 2857618242 2857619128 84
650 iso_pu_bacteria 2881247448 2881248447 84
651 iso_pu_bacteria 2881359912 2881362565 84
652 iso_pu_bacteria 2903895155 2903898542 84
653 iso_pu_bacteria 2904419702 2904419782 84
654 iso_pu_bacteria 2904555929 2904556570 84
655 iso_pu_bacteria 2919191525 2919193024 84
656 iso_pu_bacteria 2919509842 2919511960 84
657 iso_pu_bacteria 2919683626 2919688054 84
658 iso_pu_bacteria 2929150217 2929152999 84
659 iso_pu_bacteria 2958458903 2958463321 84
660 iso_pu_bacteria 2958512119 2958513477 84
661 iso_pu_bacteria 2965320100 2965323422 84
662 iso_pu_bacteria 2977268062 2977269662 84
663 iso_pu_bacteria 8036736890 8036737802 84
664 iso_pu_bacteria 8054307821 8054308271 84
665 iso_pu_bacteria 8055419101 8055421428 84
666 iso_pu_bacteria 8055592153 8055594101 84
667 iso_pu_bacteria 8056440228 8056442180 84
668 3300003320 rootH2_10217055 rootH2_102170554 85
669 3300005340 Ga0070689_100265635 Ga0070689_1002656353 85
670 3300005844 Ga0068862_100475498 Ga0068862_1004754982 85
671 3300009176 Ga0105242_10483661 Ga0105242_104836613 85
672 3300014326 Ga0157380_12927662 Ga0157380_129276622 85
673 3300025905 Ga0207685_10633900 Ga0207685_106339002 85
674 3300025934 Ga0207686_10406765 Ga0207686_104067653 85
675 3300031901 Ga0307406_11439215 Ga0307406_114392151 85
676 3300042876 Ga0451577_0002121 Ga0451577_0002121_11195_11455 85
677 3300005338 Ga0068868_101095947 Ga0068868_1010959472 86
678 3300005366 Ga0070659_101196034 Ga0070659_1011960342 86
679 3300005563 Ga0068855_100042941 Ga0068855_1000429414 86
680 3300005577 Ga0068857_100087242 Ga0068857_1000872423 86
681 3300005577 Ga0068857_100796051 Ga0068857_1007960512 86
682 3300005614 Ga0068856_100010810 Ga0068856_1000108104 86
683 3300005614 Ga0068856_100328731 Ga0068856_1003287313 86
684 3300005616 Ga0068852_100326208 Ga0068852_1003262082 86
685 3300006353 Ga0075370_10369233 Ga0075370_103692333 86
686 3300009551 Ga0105238_10984611 Ga0105238_109846112 86
687 3300013297 Ga0157378_10254511 Ga0157378_102545113 86
688 3300025911 Ga0207654_11379197 Ga0207654_113791971 86
689 3300025932 Ga0207690_10546725 Ga0207690_105467253 86
690 3300025949 Ga0207667_10100196 Ga0207667_101001963 86
691 3300026023 Ga0207677_11002960 Ga0207677_110029602 86
692 3300026078 Ga0207702_10222882 Ga0207702_102228823 86
693 3300026116 Ga0207674_10083748 Ga0207674_100837483 86
694 3300026116 Ga0207674_10725581 Ga0207674_107255812 86
695 3300030731 Ga0316177_1043475 Ga0316177_10434752 86
696 3300031251 Ga0265327_10015237 Ga0265327_100152375 86
697 3300031251 Ga0265327_10212798 Ga0265327_102127982 86
698 3300031911 Ga0307412_10809220 Ga0307412_108092202 86
699 3300037418 Ga0395900_0417102 Ga0395900_0417102_633_899 86
700 3300037471 Ga0395905_0000001 Ga0395905_0000001_494378_494644 86
701 3300041461 Ga0451805_105282 Ga0451805_105282_216_476 86
702 3300041503 Ga0451847_0425781 Ga0451847_0425781_348_608 86
703 2088090002 CNA_F7QKVOU01BZ0V1 CNA_00101410 87
704 2124908027 MRS2a_Contig_10202 MRS2a_00104550 87
705 2124908027 MRS2a_Contig_12950 MRS2a_00790650 87
706 2162886007 SwRhRL2b_contig_2515812 SwRhRL2b_0566.00005130 87
707 2162886007 SwRhRL2b_contig_3886491 SwRhRL2b_0072.00002970 87
708 2209111006 2214647731 2213674811 87
709 3300001915 JGI24741J21665_1008766 JGI24741J21665_10087663 87
710 3300001979 JGI24740J21852_10034372 JGI24740J21852_100343723 87
711 3300001979 JGI24740J21852_10046834 JGI24740J21852_100468343 87
712 3300001979 JGI24740J21852_10171649 JGI24740J21852_101716492 87
713 3300001990 JGI24737J22298_10000807 JGI24737J22298_100008078 87
714 3300001990 JGI24737J22298_10004816 JGI24737J22298_100048165 87
715 3300001990 JGI24737J22298_10006134 JGI24737J22298_100061343 87
716 3300001991 JGI24743J22301_10010104 JGI24743J22301_100101042 87
717 3300001991 JGI24743J22301_10049357 JGI24743J22301_100493572 87
718 3300002067 JGI24735J21928_10000038 JGI24735J21928_1000003854 87
719 3300002067 JGI24735J21928_10004807 JGI24735J21928_100048075 87
720 3300002067 JGI24735J21928_10066298 JGI24735J21928_100662982 87
721 3300002737 JGI25162J39368_1000047 JGI25162J39368_1000047117 87
722 3300002737 JGI25162J39368_1003374 JGI25162J39368_10033743 87
723 3300002741 JGI25157J39369_1007858 JGI25157J39369_10078584 87
724 3300002772 JGI25164J39214_1001118 JGI25164J39214_10011188 87
725 3300002773 JGI25152J39213_1052719 JGI25152J39213_10527192 87
726 3300003214 JGI25165J46597_1001696 JGI25165J46597_10016969 87
727 3300003316 rootH1_10038160 rootH1_100381604 87
728 3300003320 rootH2_10002560 rootH2_100025604 87
729 3300003320 rootH2_10029920 rootH2_1002992011 87
730 3300003575 Ga0007409J51694_1081670 Ga0007409J51694_10816702 87
731 3300003578 Ga0006562J51391_1002434 Ga0006562J51391_10024342 87
732 3300003781 Ga0055536_1000001 Ga0055536_1000001510 87
733 3300003791 Ga0055530_10002952 Ga0055530_100029526 87
734 3300004799 Ga0058863_10038041 Ga0058863_100380412 87
735 3300004800 Ga0058861_11780625 Ga0058861_117806251 87
736 3300004800 Ga0058861_11939172 Ga0058861_119391722 87
737 3300004801 Ga0058860_10005542 Ga0058860_100055422 87
738 3300004801 Ga0058860_11665848 Ga0058860_116658482 87
739 3300004801 Ga0058860_11931928 Ga0058860_119319282 87
740 3300004803 Ga0058862_12669849 Ga0058862_126698492 87
741 3300004803 Ga0058862_12785442 Ga0058862_127854422 87
742 3300004803 Ga0058862_12884397 Ga0058862_128843972 87
743 3300005276 Ga0065717_1002794 Ga0065717_10027942 87
744 3300005277 Ga0065716_1004031 Ga0065716_10040312 87
745 3300005288 Ga0065714_10002300 Ga0065714_1000230038 87
746 3300005288 Ga0065714_10004651 Ga0065714_100046518 87
747 3300005288 Ga0065714_10009315 Ga0065714_100093154 87
748 3300005288 Ga0065714_10012264 Ga0065714_100122644 87
749 3300005288 Ga0065714_10068619 Ga0065714_100686191 87
750 3300005288 Ga0065714_10094174 Ga0065714_100941742 87
751 3300005288 Ga0065714_10222060 Ga0065714_102220602 87
752 3300005288 Ga0065714_10341620 Ga0065714_103416202 87
753 3300005289 Ga0065704_10000842 Ga0065704_100008421 87
754 3300005289 Ga0065704_10001837 Ga0065704_100018372 87
755 3300005289 Ga0065704_10008773 Ga0065704_100087732 87
756 3300005289 Ga0065704_10150093 Ga0065704_101500933 87
757 3300005289 Ga0065704_10315007 Ga0065704_103150072 87
758 3300005289 Ga0065704_10664588 Ga0065704_106645882 87
759 3300005289 Ga0065704_10677499 Ga0065704_106774992 87
760 3300005293 Ga0065715_10065773 Ga0065715_100657732 87
761 3300005293 Ga0065715_10138853 Ga0065715_101388533 87
762 3300005293 Ga0065715_10589834 Ga0065715_105898342 87
763 3300005327 Ga0070658_10000014 Ga0070658_100000142 87
764 3300005327 Ga0070658_10538137 Ga0070658_105381372 87
765 3300005327 Ga0070658_10942879 Ga0070658_109428792 87
766 3300005327 Ga0070658_11769466 Ga0070658_117694662 87
767 3300005328 Ga0070676_10001097 Ga0070676_1000109711 87
768 3300005329 Ga0070683_101340839 Ga0070683_1013408392 87
769 3300005331 Ga0070670_101237756 Ga0070670_1012377561 87
770 3300005334 Ga0068869_102039300 Ga0068869_1020393002 87
771 3300005336 Ga0070680_100012512 Ga0070680_1000125128 87
772 3300005337 Ga0070682_100142426 Ga0070682_1001424263 87
773 3300005338 Ga0068868_100010166 Ga0068868_10001016610 87
774 3300005338 Ga0068868_100520239 Ga0068868_1005202391 87
775 3300005339 Ga0070660_100039031 Ga0070660_1000390316 87
776 3300005339 Ga0070660_100123384 Ga0070660_1001233845 87
777 3300005339 Ga0070660_101447073 Ga0070660_1014470732 87
778 3300005344 Ga0070661_100862834 Ga0070661_1008628342 87
779 3300005345 Ga0070692_10799036 Ga0070692_107990362 87
780 3300005345 Ga0070692_10805219 Ga0070692_108052191 87
781 3300005355 Ga0070671_100008871 Ga0070671_1000088715 87
782 3300005355 Ga0070671_100445354 Ga0070671_1004453542 87
783 3300005356 Ga0070674_100342515 Ga0070674_1003425152 87
784 3300005356 Ga0070674_100821457 Ga0070674_1008214571 87
785 3300005364 Ga0070673_100056909 Ga0070673_1000569095 87
786 3300005366 Ga0070659_100000375 Ga0070659_10000037547 87
787 3300005366 Ga0070659_100017936 Ga0070659_1000179362 87
788 3300005366 Ga0070659_100021993 Ga0070659_1000219935 87
789 3300005367 Ga0070667_101734516 Ga0070667_1017345161 87
790 3300005435 Ga0070714_102083723 Ga0070714_1020837231 87
791 3300005455 Ga0070663_100007251 Ga0070663_1000072515 87
792 3300005456 Ga0070678_100007816 Ga0070678_1000078168 87
793 3300005456 Ga0070678_100468296 Ga0070678_1004682962 87
794 3300005457 Ga0070662_101621001 Ga0070662_1016210012 87
795 3300005458 Ga0070681_10027571 Ga0070681_100275716 87
796 3300005459 Ga0068867_100003167 Ga0068867_1000031679 87
797 3300005459 Ga0068867_100630925 Ga0068867_1006309252 87
798 3300005530 Ga0070679_100006523 Ga0070679_1000065238 87
799 3300005530 Ga0070679_100099567 Ga0070679_1000995672 87
800 3300005530 Ga0070679_100411592 Ga0070679_1004115922 87
801 3300005535 Ga0070684_102059242 Ga0070684_1020592421 87
802 3300005539 Ga0068853_100169013 Ga0068853_1001690133 87
803 3300005539 Ga0068853_100466202 Ga0068853_1004662022 87
804 3300005539 Ga0068853_100519507 Ga0068853_1005195072 87
805 3300005539 Ga0068853_100902942 Ga0068853_1009029422 87
806 3300005547 Ga0070693_100595171 Ga0070693_1005951712 87
807 3300005547 Ga0070693_100665566 Ga0070693_1006655662 87
808 3300005547 Ga0070693_101291612 Ga0070693_1012916121 87
809 3300005548 Ga0070665_100000032 Ga0070665_10000003226 87
810 3300005563 Ga0068855_100000043 Ga0068855_10000004341 87
811 3300005563 Ga0068855_100000097 Ga0068855_10000009714 87
812 3300005563 Ga0068855_100035960 Ga0068855_1000359601 87
813 3300005563 Ga0068855_100110668 Ga0068855_1001106682 87
814 3300005563 Ga0068855_100313113 Ga0068855_1003131131 87
815 3300005563 Ga0068855_100773155 Ga0068855_1007731551 87
816 3300005563 Ga0068855_100811537 Ga0068855_1008115372 87
817 3300005563 Ga0068855_101203960 Ga0068855_1012039602 87
818 3300005577 Ga0068857_100030465 Ga0068857_1000304655 87
819 3300005577 Ga0068857_100205904 Ga0068857_1002059042 87
820 3300005578 Ga0068854_100120009 Ga0068854_1001200092 87
821 3300005578 Ga0068854_101772174 Ga0068854_1017721742 87
822 3300005614 Ga0068856_100000824 Ga0068856_10000082433 87
823 3300005614 Ga0068856_100024772 Ga0068856_1000247726 87
824 3300005614 Ga0068856_100209839 Ga0068856_1002098393 87
825 3300005614 Ga0068856_100401797 Ga0068856_1004017972 87
826 3300005616 Ga0068852_100001916 Ga0068852_10000191615 87
827 3300005616 Ga0068852_100027329 Ga0068852_1000273298 87
828 3300005616 Ga0068852_100282387 Ga0068852_1002823871 87
829 3300005616 Ga0068852_100761312 Ga0068852_1007613122 87
830 3300005616 Ga0068852_102601282 Ga0068852_1026012821 87
831 3300005618 Ga0068864_100211981 Ga0068864_1002119814 87
832 3300005718 Ga0068866_10257564 Ga0068866_102575642 87
833 3300005834 Ga0068851_10347716 Ga0068851_103477162 87
834 3300005840 Ga0068870_10277472 Ga0068870_102774722 87
835 3300005840 Ga0068870_10812876 Ga0068870_108128762 87
836 3300005841 Ga0068863_101321125 Ga0068863_1013211252 87
837 3300005842 Ga0068858_100297763 Ga0068858_1002977632 87
838 3300005843 Ga0068860_100649232 Ga0068860_1006492322 87
839 3300006028 Ga0070717_10742563 Ga0070717_107425632 87
840 3300006173 Ga0070716_100207226 Ga0070716_1002072262 87
841 3300006173 Ga0070716_101362697 Ga0070716_1013626972 87
842 3300006186 Ga0075369_10199502 Ga0075369_101995021 87
843 3300006195 Ga0075366_10003967 Ga0075366_100039675 87
844 3300006195 Ga0075366_10012055 Ga0075366_100120551 87
845 3300006195 Ga0075366_10641626 Ga0075366_106416262 87
846 3300006195 Ga0075366_10722878 Ga0075366_107228781 87
847 3300006195 Ga0075366_11050576 Ga0075366_110505762 87
848 3300006237 Ga0097621_100000262 Ga0097621_10000026215 87
849 3300006237 Ga0097621_100354465 Ga0097621_1003544652 87
850 3300006358 Ga0068871_100000212 Ga0068871_1000002129 87
851 3300006358 Ga0068871_100283028 Ga0068871_1002830284 87
852 3300006881 Ga0068865_100000704 Ga0068865_10000070410 87
853 3300006942 Ga0099824_1009973 Ga0099824_10099734 87
854 3300006946 Ga0079104_1000355 Ga0079104_100035535 87
855 3300006948 Ga0099826_10043578 Ga0099826_100435783 87
856 3300009011 Ga0105251_10512864 Ga0105251_105128641 87
857 3300009036 Ga0105244_10000035 Ga0105244_100000355 87
858 3300009036 Ga0105244_10013492 Ga0105244_100134923 87
859 3300009036 Ga0105244_10261597 Ga0105244_102615971 87
860 3300009093 Ga0105240_10000200 Ga0105240_1000020054 87
861 3300009093 Ga0105240_10017293 Ga0105240_1001729310 87
862 3300009093 Ga0105240_10024527 Ga0105240_100245273 87
863 3300009093 Ga0105240_10036528 Ga0105240_100365286 87
864 3300009093 Ga0105240_10154208 Ga0105240_101542083 87
865 3300009093 Ga0105240_10312539 Ga0105240_103125392 87
866 3300009093 Ga0105240_11057118 Ga0105240_110571182 87
867 3300009093 Ga0105240_11255701 Ga0105240_112557012 87
868 3300009093 Ga0105240_11584111 Ga0105240_115841111 87
869 3300009093 Ga0105240_11795951 Ga0105240_117959512 87
870 3300009093 Ga0105240_11972796 Ga0105240_119727962 87
871 3300009093 Ga0105240_12740211 Ga0105240_127402111 87
872 3300009094 Ga0111539_10951004 Ga0111539_109510042 87
873 3300009148 Ga0105243_10000141 Ga0105243_1000014111 87
874 3300009148 Ga0105243_10116015 Ga0105243_101160153 87
875 3300009148 Ga0105243_10924594 Ga0105243_109245942 87
876 3300009148 Ga0105243_12796287 Ga0105243_127962872 87
877 3300009174 Ga0105241_10003086 Ga0105241_1000308614 87
878 3300009174 Ga0105241_10006234 Ga0105241_100062344 87
879 3300009174 Ga0105241_10103808 Ga0105241_101038081 87
880 3300009174 Ga0105241_10217964 Ga0105241_102179642 87
881 3300009174 Ga0105241_10456884 Ga0105241_104568842 87
882 3300009174 Ga0105241_10457868 Ga0105241_104578682 87
883 3300009174 Ga0105241_10509999 Ga0105241_105099992 87
884 3300009174 Ga0105241_11045652 Ga0105241_110456522 87
885 3300009174 Ga0105241_11622525 Ga0105241_116225251 87
886 3300009176 Ga0105242_10687498 Ga0105242_106874981 87
887 3300009176 Ga0105242_10804763 Ga0105242_108047632 87
888 3300009176 Ga0105242_11371176 Ga0105242_113711762 87
889 3300009177 Ga0105248_13101086 Ga0105248_131010861 87
890 3300009545 Ga0105237_10000239 Ga0105237_100002392 87
891 3300009545 Ga0105237_10002047 Ga0105237_1000204716 87
892 3300009545 Ga0105237_10002281 Ga0105237_1000228110 87
893 3300009545 Ga0105237_10002383 Ga0105237_100023836 87
894 3300009545 Ga0105237_10002980 Ga0105237_100029803 87
895 3300009545 Ga0105237_10958884 Ga0105237_109588842 87
896 3300009545 Ga0105237_11554589 Ga0105237_115545892 87
897 3300009545 Ga0105237_11688966 Ga0105237_116889662 87
898 3300009545 Ga0105237_12667647 Ga0105237_126676471 87
899 3300009551 Ga0105238_10016221 Ga0105238_100162212 87
900 3300009551 Ga0105238_10146487 Ga0105238_101464873 87
901 3300009551 Ga0105238_10302519 Ga0105238_103025193 87
902 3300009551 Ga0105238_10611851 Ga0105238_106118512 87
903 3300009553 Ga0105249_10302782 Ga0105249_103027822 87
904 3300009553 Ga0105249_12556043 Ga0105249_125560431 87
905 3300009829 Ga0130086_1031048 Ga0130086_10310482 87
906 3300010375 Ga0105239_10000015 Ga0105239_100000159 87
907 3300010375 Ga0105239_10000059 Ga0105239_10000059151 87
908 3300010375 Ga0105239_10027959 Ga0105239_1002795911 87
909 3300010375 Ga0105239_10035292 Ga0105239_100352928 87
910 3300010375 Ga0105239_10099441 Ga0105239_100994411 87
911 3300010375 Ga0105239_10107981 Ga0105239_101079811 87
912 3300010375 Ga0105239_10788939 Ga0105239_107889393 87
913 3300010375 Ga0105239_11664884 Ga0105239_116648842 87
914 3300011119 Ga0105246_10110101 Ga0105246_101101012 87
915 3300011119 Ga0105246_11550233 Ga0105246_115502332 87
916 3300013100 Ga0157373_10000403 Ga0157373_1000040329 87
917 3300013100 Ga0157373_10000630 Ga0157373_1000063021 87
918 3300013100 Ga0157373_10003250 Ga0157373_100032507 87
919 3300013100 Ga0157373_10052453 Ga0157373_100524534 87
920 3300013100 Ga0157373_10407161 Ga0157373_104071612 87
921 3300013100 Ga0157373_10415607 Ga0157373_104156071 87
922 3300013100 Ga0157373_10497847 Ga0157373_104978472 87
923 3300013100 Ga0157373_10612727 Ga0157373_106127271 87
924 3300013102 Ga0157371_10000180 Ga0157371_1000018010 87
925 3300013102 Ga0157371_10000342 Ga0157371_1000034239 87
926 3300013102 Ga0157371_10002167 Ga0157371_100021679 87
927 3300013102 Ga0157371_10004232 Ga0157371_100042326 87
928 3300013102 Ga0157371_10021544 Ga0157371_100215444 87
929 3300013102 Ga0157371_10174495 Ga0157371_101744952 87
930 3300013104 Ga0157370_10000403 Ga0157370_1000040338 87
931 3300013104 Ga0157370_10001832 Ga0157370_100018324 87
932 3300013104 Ga0157370_10009126 Ga0157370_1000912610 87
933 3300013104 Ga0157370_10011928 Ga0157370_100119289 87
934 3300013104 Ga0157370_10037507 Ga0157370_100375075 87
935 3300013104 Ga0157370_10055471 Ga0157370_100554716 87
936 3300013104 Ga0157370_10088150 Ga0157370_100881504 87
937 3300013104 Ga0157370_10105940 Ga0157370_101059403 87
938 3300013104 Ga0157370_10156292 Ga0157370_101562923 87
939 3300013104 Ga0157370_10171814 Ga0157370_101718142 87
940 3300013104 Ga0157370_10176759 Ga0157370_101767592 87
941 3300013104 Ga0157370_10201691 Ga0157370_102016913 87
942 3300013104 Ga0157370_10267619 Ga0157370_102676192 87
943 3300013104 Ga0157370_10275806 Ga0157370_102758062 87
944 3300013104 Ga0157370_10413507 Ga0157370_104135073 87
945 3300013104 Ga0157370_10486104 Ga0157370_104861042 87
946 3300013104 Ga0157370_10553693 Ga0157370_105536932 87
947 3300013104 Ga0157370_10860543 Ga0157370_108605432 87
948 3300013104 Ga0157370_11924738 Ga0157370_119247382 87
949 3300013104 Ga0157370_11948044 Ga0157370_119480441 87
950 3300013105 Ga0157369_10000040 Ga0157369_1000004094 87
951 3300013105 Ga0157369_10000566 Ga0157369_1000056616 87
952 3300013105 Ga0157369_10005719 Ga0157369_100057195 87
953 3300013105 Ga0157369_10110083 Ga0157369_101100832 87
954 3300013105 Ga0157369_10186725 Ga0157369_101867252 87
955 3300013105 Ga0157369_10504684 Ga0157369_105046843 87
956 3300013105 Ga0157369_10816465 Ga0157369_108164652 87
957 3300013105 Ga0157369_11826887 Ga0157369_118268871 87
958 3300013296 Ga0157374_10003064 Ga0157374_100030641 87
959 3300013296 Ga0157374_10040556 Ga0157374_100405565 87
960 3300013296 Ga0157374_10179245 Ga0157374_101792452 87
961 3300013296 Ga0157374_10186507 Ga0157374_101865071 87
962 3300013296 Ga0157374_10691094 Ga0157374_106910942 87
963 3300013297 Ga0157378_10028162 Ga0157378_100281624 87
964 3300013297 Ga0157378_10668056 Ga0157378_106680562 87
965 3300013297 Ga0157378_10841131 Ga0157378_108411312 87
966 3300013297 Ga0157378_11398070 Ga0157378_113980701 87
967 3300013306 Ga0163162_10003004 Ga0163162_1000300410 87
968 3300013306 Ga0163162_10005073 Ga0163162_1000507313 87
969 3300013306 Ga0163162_10014253 Ga0163162_1001425312 87
970 3300013306 Ga0163162_10033324 Ga0163162_100333244 87
971 3300013306 Ga0163162_10284267 Ga0163162_102842672 87
972 3300013306 Ga0163162_11165233 Ga0163162_111652331 87
973 3300013306 Ga0163162_11951347 Ga0163162_119513471 87
974 3300013306 Ga0163162_12260784 Ga0163162_122607842 87
975 3300013307 Ga0157372_10000020 Ga0157372_1000002093 87
976 3300013307 Ga0157372_10001496 Ga0157372_1000149621 87
977 3300013307 Ga0157372_10002216 Ga0157372_1000221618 87
978 3300013307 Ga0157372_10004009 Ga0157372_100040093 87
979 3300013307 Ga0157372_10040403 Ga0157372_100404037 87
980 3300013307 Ga0157372_10051680 Ga0157372_100516802 87
981 3300013307 Ga0157372_10723637 Ga0157372_107236373 87
982 3300013307 Ga0157372_11145555 Ga0157372_111455552 87
983 3300013308 Ga0157375_10046436 Ga0157375_100464362 87
984 3300013308 Ga0157375_10131450 Ga0157375_101314502 87
985 3300013308 Ga0157375_10192091 Ga0157375_101920913 87
986 3300013308 Ga0157375_10209374 Ga0157375_102093742 87
987 3300013308 Ga0157375_12063146 Ga0157375_120631462 87
988 3300013308 Ga0157375_13639561 Ga0157375_136395612 87
989 3300014326 Ga0157380_10131068 Ga0157380_101310682 87
990 3300014497 Ga0182008_10000034 Ga0182008_10000034100 87
991 3300014497 Ga0182008_10000131 Ga0182008_1000013114 87
992 3300014497 Ga0182008_10015727 Ga0182008_100157272 87
993 3300014745 Ga0157377_10010434 Ga0157377_100104342 87
994 3300014745 Ga0157377_10935142 Ga0157377_109351421 87
995 3300014968 Ga0157379_10627177 Ga0157379_106271773 87
996 3300014968 Ga0157379_11139347 Ga0157379_111393472 87
997 3300014969 Ga0157376_10131207 Ga0157376_101312075 87
998 3300014969 Ga0157376_10230581 Ga0157376_102305813 87
999 3300014969 Ga0157376_10552960 Ga0157376_105529602 87
1000 3300015261 Ga0182006_1002107 Ga0182006_10021072 87
1001 3300015261 Ga0182006_1003410 Ga0182006_10034105 87
1002 3300015261 Ga0182006_1003629 Ga0182006_10036292 87
1003 3300015261 Ga0182006_1025537 Ga0182006_10255372 87
1004 3300015261 Ga0182006_1166009 Ga0182006_11660092 87
1005 3300015262 Ga0182007_10000033 Ga0182007_10000033109 87
1006 3300015262 Ga0182007_10051916 Ga0182007_100519162 87
1007 3300015262 Ga0182007_10070841 Ga0182007_100708412 87
1008 3300015682 Ga0183373_1001 Ga0183373_1001452 87
1009 3300017792 Ga0163161_10000007 Ga0163161_10000007116 87
1010 3300017792 Ga0163161_10001494 Ga0163161_100014942 87
1011 3300017792 Ga0163161_10004072 Ga0163161_1000407213 87
1012 3300017792 Ga0163161_10021927 Ga0163161_100219273 87
1013 3300017792 Ga0163161_10059194 Ga0163161_100591943 87
1014 3300017792 Ga0163161_10080069 Ga0163161_100800692 87
1015 3300017792 Ga0163161_10638602 Ga0163161_106386022 87
1016 3300017792 Ga0163161_10723060 Ga0163161_107230602 87
1017 3300017792 Ga0163161_10910497 Ga0163161_109104972 87
1018 3300017792 Ga0163161_11355458 Ga0163161_113554582 87
1019 3300020069 Ga0197907_11045547 Ga0197907_110455472 87
1020 3300020069 Ga0197907_11085579 Ga0197907_110855792 87
1021 3300020069 Ga0197907_11104242 Ga0197907_111042422 87
1022 3300020070 Ga0206356_10186869 Ga0206356_101868692 87
1023 3300020070 Ga0206356_10384334 Ga0206356_103843342 87
1024 3300020070 Ga0206356_11672287 Ga0206356_116722872 87
1025 3300020075 Ga0206349_1401126 Ga0206349_14011262 87
1026 3300020076 Ga0206355_1078494 Ga0206355_10784941 87
1027 3300020076 Ga0206355_1494755 Ga0206355_14947552 87
1028 3300020077 Ga0206351_10193117 Ga0206351_101931172 87
1029 3300020077 Ga0206351_10433669 Ga0206351_104336692 87
1030 3300020077 Ga0206351_10652014 Ga0206351_106520141 87
1031 3300020077 Ga0206351_10858975 Ga0206351_108589752 87
1032 3300020078 Ga0206352_10015830 Ga0206352_100158303 87
1033 3300020078 Ga0206352_10560570 Ga0206352_105605702 87
1034 3300020078 Ga0206352_10852344 Ga0206352_108523442 87
1035 3300020078 Ga0206352_10955506 Ga0206352_109555062 87
1036 3300020078 Ga0206352_10996090 Ga0206352_109960902 87
1037 3300020078 Ga0206352_11271164 Ga0206352_112711642 87
1038 3300020078 Ga0206352_11274103 Ga0206352_112741032 87
1039 3300020080 Ga0206350_10339450 Ga0206350_103394501 87
1040 3300020080 Ga0206350_11064187 Ga0206350_110641872 87
1041 3300020080 Ga0206350_11448088 Ga0206350_114480882 87
1042 3300020080 Ga0206350_11556821 Ga0206350_115568212 87
1043 3300020081 Ga0206354_10423924 Ga0206354_104239242 87
1044 3300020081 Ga0206354_10546343 Ga0206354_105463432 87
1045 3300020081 Ga0206354_10759203 Ga0206354_107592032 87
1046 3300020081 Ga0206354_10952035 Ga0206354_109520352 87
1047 3300020610 Ga0154015_1103227 Ga0154015_11032272 87
1048 3300020610 Ga0154015_1252578 Ga0154015_12525782 87
1049 3300020610 Ga0154015_1476743 Ga0154015_14767432 87
1050 3300021361 Ga0213872_10125420 Ga0213872_101254201 87
1051 3300022467 Ga0224712_10106337 Ga0224712_101063372 87
1052 3300022467 Ga0224712_10127284 Ga0224712_101272842 87
1053 3300022467 Ga0224712_10203158 Ga0224712_102031582 87
1054 3300025230 Ga0209563_111486 Ga0209563_1114862 87
1055 3300025231 Ga0207427_100025 Ga0207427_10002512 87
1056 3300025233 Ga0209437_100010 Ga0209437_100010274 87
1057 3300025233 Ga0209437_100089 Ga0209437_100089181 87
1058 3300025250 Ga0209026_1000388 Ga0209026_100038811 87
1059 3300025250 Ga0209026_1002027 Ga0209026_10020273 87
1060 3300025250 Ga0209026_1005224 Ga0209026_10052242 87
1061 3300025250 Ga0209026_1032053 Ga0209026_10320532 87
1062 3300025250 Ga0209026_1042062 Ga0209026_10420622 87
1063 3300025254 Ga0209148_1016389 Ga0209148_10163891 87
1064 3300025258 Ga0209129_1007640 Ga0209129_10076404 87
1065 3300025261 Ga0209233_1000017 Ga0209233_1000017287 87
1066 3300025261 Ga0209233_1006602 Ga0209233_10066022 87
1067 3300025261 Ga0209233_1006682 Ga0209233_10066822 87
1068 3300025261 Ga0209233_1089858 Ga0209233_10898581 87
1069 3300025272 Ga0209455_1003109 Ga0209455_10031096 87
1070 3300025292 Ga0209676_1000008 Ga0209676_1000008353 87
1071 3300025298 Ga0209050_1000055 Ga0209050_100005559 87
1072 3300025321 Ga0207656_10298963 Ga0207656_102989632 87
1073 3300025321 Ga0207656_10330703 Ga0207656_103307032 87
1074 3300025728 Ga0207655_1000008 Ga0207655_1000008167 87
1075 3300025728 Ga0207655_1056900 Ga0207655_10569003 87
1076 3300025735 Ga0207713_1074258 Ga0207713_10742582 87
1077 3300025898 Ga0207692_10442652 Ga0207692_104426521 87
1078 3300025899 Ga0207642_10089570 Ga0207642_100895702 87
1079 3300025904 Ga0207647_10000079 Ga0207647_1000007937 87
1080 3300025904 Ga0207647_10000169 Ga0207647_1000016910 87
1081 3300025904 Ga0207647_10189206 Ga0207647_101892062 87
1082 3300025904 Ga0207647_10438660 Ga0207647_104386602 87
1083 3300025904 Ga0207647_10703771 Ga0207647_107037711 87
1084 3300025907 Ga0207645_10000672 Ga0207645_1000067224 87
1085 3300025909 Ga0207705_10000043 Ga0207705_1000004345 87
1086 3300025909 Ga0207705_10055803 Ga0207705_100558032 87
1087 3300025909 Ga0207705_10059994 Ga0207705_100599941 87
1088 3300025911 Ga0207654_10001248 Ga0207654_1000124814 87
1089 3300025911 Ga0207654_10057252 Ga0207654_100572524 87
1090 3300025911 Ga0207654_10106665 Ga0207654_101066653 87
1091 3300025911 Ga0207654_10174948 Ga0207654_101749483 87
1092 3300025911 Ga0207654_10288611 Ga0207654_102886112 87
1093 3300025911 Ga0207654_10584725 Ga0207654_105847252 87
1094 3300025912 Ga0207707_10003763 Ga0207707_100037634 87
1095 3300025913 Ga0207695_10000055 Ga0207695_1000005554 87
1096 3300025913 Ga0207695_10008885 Ga0207695_100088854 87
1097 3300025913 Ga0207695_10044132 Ga0207695_100441321 87
1098 3300025913 Ga0207695_10057528 Ga0207695_100575282 87
1099 3300025913 Ga0207695_10114076 Ga0207695_101140764 87
1100 3300025913 Ga0207695_10142725 Ga0207695_101427254 87
1101 3300025913 Ga0207695_10248838 Ga0207695_102488383 87
1102 3300025913 Ga0207695_10479951 Ga0207695_104799513 87
1103 3300025913 Ga0207695_10623476 Ga0207695_106234762 87
1104 3300025914 Ga0207671_10000486 Ga0207671_1000048628 87
1105 3300025914 Ga0207671_10002797 Ga0207671_1000279720 87
1106 3300025914 Ga0207671_10007031 Ga0207671_100070314 87
1107 3300025914 Ga0207671_10011297 Ga0207671_100112974 87
1108 3300025914 Ga0207671_10030075 Ga0207671_100300752 87
1109 3300025914 Ga0207671_10032943 Ga0207671_100329435 87
1110 3300025914 Ga0207671_10095806 Ga0207671_100958062 87
1111 3300025914 Ga0207671_10326915 Ga0207671_103269153 87
1112 3300025914 Ga0207671_10498717 Ga0207671_104987172 87
1113 3300025916 Ga0207663_10972136 Ga0207663_109721361 87
1114 3300025919 Ga0207657_10049264 Ga0207657_100492644 87
1115 3300025919 Ga0207657_10086081 Ga0207657_100860814 87
1116 3300025919 Ga0207657_11176357 Ga0207657_111763572 87
1117 3300025921 Ga0207652_10002224 Ga0207652_1000222412 87
1118 3300025921 Ga0207652_10396247 Ga0207652_103962473 87
1119 3300025921 Ga0207652_11359734 Ga0207652_113597341 87
1120 3300025924 Ga0207694_10270699 Ga0207694_102706992 87
1121 3300025924 Ga0207694_10333722 Ga0207694_103337222 87
1122 3300025924 Ga0207694_11536799 Ga0207694_115367992 87
1123 3300025931 Ga0207644_10001419 Ga0207644_1000141913 87
1124 3300025931 Ga0207644_10534310 Ga0207644_105343102 87
1125 3300025932 Ga0207690_10024087 Ga0207690_100240872 87
1126 3300025932 Ga0207690_10026901 Ga0207690_100269013 87
1127 3300025932 Ga0207690_10036601 Ga0207690_100366012 87
1128 3300025933 Ga0207706_10000167 Ga0207706_1000016761 87
1129 3300025934 Ga0207686_10027404 Ga0207686_100274046 87
1130 3300025934 Ga0207686_10162090 Ga0207686_101620903 87
1131 3300025935 Ga0207709_10000072 Ga0207709_10000072100 87
1132 3300025935 Ga0207709_10136941 Ga0207709_101369412 87
1133 3300025937 Ga0207669_10159243 Ga0207669_101592432 87
1134 3300025937 Ga0207669_10290217 Ga0207669_102902172 87
1135 3300025937 Ga0207669_11481274 Ga0207669_114812742 87
1136 3300025938 Ga0207704_10000042 Ga0207704_1000004224 87
1137 3300025939 Ga0207665_10311991 Ga0207665_103119913 87
1138 3300025940 Ga0207691_10196394 Ga0207691_101963942 87
1139 3300025942 Ga0207689_10651194 Ga0207689_106511942 87
1140 3300025944 Ga0207661_11744899 Ga0207661_117448991 87
1141 3300025949 Ga0207667_10000015 Ga0207667_1000001540 87
1142 3300025949 Ga0207667_10000190 Ga0207667_1000019014 87
1143 3300025949 Ga0207667_10051425 Ga0207667_100514257 87
1144 3300025949 Ga0207667_10215447 Ga0207667_102154472 87
1145 3300025949 Ga0207667_11011180 Ga0207667_110111802 87
1146 3300025960 Ga0207651_10011501 Ga0207651_100115015 87
1147 3300025960 Ga0207651_10260641 Ga0207651_102606412 87
1148 3300025961 Ga0207712_10181490 Ga0207712_101814904 87
1149 3300025981 Ga0207640_10044474 Ga0207640_100444743 87
1150 3300025981 Ga0207640_10522500 Ga0207640_105225001 87
1151 3300025981 Ga0207640_10769742 Ga0207640_107697422 87
1152 3300025981 Ga0207640_11161701 Ga0207640_111617012 87
1153 3300025986 Ga0207658_10422882 Ga0207658_104228822 87
1154 3300026023 Ga0207677_10017709 Ga0207677_100177095 87
1155 3300026035 Ga0207703_10043084 Ga0207703_100430843 87
1156 3300026035 Ga0207703_11318589 Ga0207703_113185892 87
1157 3300026041 Ga0207639_10027578 Ga0207639_100275783 87
1158 3300026041 Ga0207639_10343918 Ga0207639_103439182 87
1159 3300026041 Ga0207639_10381586 Ga0207639_103815862 87
1160 3300026041 Ga0207639_10396705 Ga0207639_103967051 87
1161 3300026067 Ga0207678_10016173 Ga0207678_100161736 87
1162 3300026078 Ga0207702_10000165 Ga0207702_1000016515 87
1163 3300026078 Ga0207702_10066516 Ga0207702_100665163 87
1164 3300026078 Ga0207702_10087163 Ga0207702_100871633 87
1165 3300026078 Ga0207702_10170920 Ga0207702_101709202 87
1166 3300026078 Ga0207702_10372316 Ga0207702_103723163 87
1167 3300026078 Ga0207702_10613550 Ga0207702_106135502 87
1168 3300026078 Ga0207702_11956522 Ga0207702_119565221 87
1169 3300026089 Ga0207648_10008139 Ga0207648_1000813913 87
1170 3300026089 Ga0207648_10474076 Ga0207648_104740762 87
1171 3300026116 Ga0207674_10029322 Ga0207674_100293225 87
1172 3300026116 Ga0207674_10120833 Ga0207674_101208334 87
1173 3300026116 Ga0207674_10221852 Ga0207674_102218522 87
1174 3300026116 Ga0207674_12247220 Ga0207674_122472201 87
1175 3300026121 Ga0207683_10003832 Ga0207683_1000383215 87
1176 3300026121 Ga0207683_10415407 Ga0207683_104154072 87
1177 3300026142 Ga0207698_10101808 Ga0207698_101018081 87
1178 3300026142 Ga0207698_10142345 Ga0207698_101423452 87
1179 3300026142 Ga0207698_10471206 Ga0207698_104712062 87
1180 3300026142 Ga0207698_10698898 Ga0207698_106988982 87
1181 3300026142 Ga0207698_11527375 Ga0207698_115273752 87
1182 3300027111 Ga0209281_1000116 Ga0209281_100011634 87
1183 3300027361 Ga0209489_117456 Ga0209489_1174564 87
1184 3300027471 Ga0209995_1007505 Ga0209995_10075051 87
1185 3300027526 Ga0209968_1000567 Ga0209968_10005674 87
1186 3300027617 Ga0210002_1008982 Ga0210002_10089823 87
1187 3300027666 Ga0209282_1034968 Ga0209282_10349683 87
1188 3300027876 Ga0209974_10010090 Ga0209974_100100904 87
1189 3300028379 Ga0268266_10000030 Ga0268266_10000030301 87
1190 3300028381 Ga0268264_10978971 Ga0268264_109789712 87
1191 3300028786 Ga0307517_10094778 Ga0307517_100947785 87
1192 3300028794 Ga0307515_10009260 Ga0307515_1000926015 87
1193 3300028794 Ga0307515_10023678 Ga0307515_1002367814 87
1194 3300028794 Ga0307515_10217054 Ga0307515_102170541 87
1195 3300028794 Ga0307515_10587296 Ga0307515_105872962 87
1196 3300028800 Ga0265338_10000319 Ga0265338_1000031939 87
1197 3300028800 Ga0265338_10035130 Ga0265338_100351308 87
1198 3300028800 Ga0265338_10307415 Ga0265338_103074152 87
1199 3300030731 Ga0316177_1003116 Ga0316177_10031163 87
1200 3300030731 Ga0316177_1025107 Ga0316177_10251074 87
1201 3300030732 Ga0316176_1055565 Ga0316176_10555653 87
1202 3300030734 Ga0316179_1071760 Ga0316179_10717603 87
1203 3300030734 Ga0316179_1112906 Ga0316179_11129062 87
1204 3300030742 Ga0316183_1008515 Ga0316183_100851524 87
1205 3300030744 Ga0316181_1155381 Ga0316181_11553812 87
1206 3300030744 Ga0316181_1199869 Ga0316181_11998691 87
1207 3300030744 Ga0316181_1223835 Ga0316181_12238352 87
1208 3300030744 Ga0316181_1260471 Ga0316181_12604712 87
1209 3300030744 Ga0316181_1274070 Ga0316181_12740703 87
1210 3300030745 Ga0316182_1122312 Ga0316182_11223122 87
1211 3300030745 Ga0316182_1170114 Ga0316182_11701142 87
1212 3300031251 Ga0265327_10000669 Ga0265327_100006695 87
1213 3300031251 Ga0265327_10017211 Ga0265327_100172114 87
1214 3300031251 Ga0265327_10088057 Ga0265327_100880572 87
1215 3300031507 Ga0307509_10037726 Ga0307509_100377265 87
1216 3300031507 Ga0307509_10700987 Ga0307509_107009872 87
1217 3300031548 Ga0307408_100000984 Ga0307408_1000009842 87
1218 3300031548 Ga0307408_100001545 Ga0307408_10000154516 87
1219 3300031548 Ga0307408_100002868 Ga0307408_1000028686 87
1220 3300031548 Ga0307408_100003413 Ga0307408_1000034139 87
1221 3300031548 Ga0307408_100770218 Ga0307408_1007702182 87
1222 3300031548 Ga0307408_101570665 Ga0307408_1015706652 87
1223 3300031616 Ga0307508_10299229 Ga0307508_102992292 87
1224 3300031616 Ga0307508_10875855 Ga0307508_108758551 87
1225 3300031649 Ga0307514_10528061 Ga0307514_105280612 87
1226 3300031665 Ga0316575_10115219 Ga0316575_101152192 87
1227 3300031691 Ga0316579_10012511 Ga0316579_100125113 87
1228 3300031691 Ga0316579_10215954 Ga0316579_102159541 87
1229 3300031691 Ga0316579_10283310 Ga0316579_102833102 87
1230 3300031727 Ga0316576_10036481 Ga0316576_100364814 87
1231 3300031727 Ga0316576_10088429 Ga0316576_100884293 87
1232 3300031727 Ga0316576_10175354 Ga0316576_101753542 87
1233 3300031727 Ga0316576_10176590 Ga0316576_101765903 87
1234 3300031727 Ga0316576_10778608 Ga0316576_107786082 87
1235 3300031728 Ga0316578_10061480 Ga0316578_100614803 87
1236 3300031728 Ga0316578_10062341 Ga0316578_100623413 87
1237 3300031728 Ga0316578_10174216 Ga0316578_101742163 87
1238 3300031730 Ga0307516_10917600 Ga0307516_109176001 87
1239 3300031731 Ga0307405_10000002 Ga0307405_10000002275 87
1240 3300031731 Ga0307405_10000003 Ga0307405_10000003308 87
1241 3300031731 Ga0307405_10020255 Ga0307405_100202555 87
1242 3300031731 Ga0307405_10050937 Ga0307405_100509373 87
1243 3300031733 Ga0316577_10063583 Ga0316577_100635832 87
1244 3300031733 Ga0316577_10254309 Ga0316577_102543092 87
1245 3300031824 Ga0307413_10005723 Ga0307413_100057235 87
1246 3300031824 Ga0307413_10045688 Ga0307413_100456884 87
1247 3300031824 Ga0307413_10059831 Ga0307413_100598313 87
1248 3300031824 Ga0307413_10753891 Ga0307413_107538911 87
1249 3300031852 Ga0307410_10000075 Ga0307410_100000759 87
1250 3300031901 Ga0307406_10000038 Ga0307406_1000003834 87
1251 3300031901 Ga0307406_10042611 Ga0307406_100426114 87
1252 3300031903 Ga0307407_10000010 Ga0307407_10000010110 87
1253 3300031903 Ga0307407_10002342 Ga0307407_100023427 87
1254 3300031911 Ga0307412_10000049 Ga0307412_1000004979 87
1255 3300031911 Ga0307412_10002839 Ga0307412_100028399 87
1256 3300031911 Ga0307412_10014212 Ga0307412_100142124 87
1257 3300031911 Ga0307412_10098671 Ga0307412_100986713 87
1258 3300031911 Ga0307412_10313990 Ga0307412_103139902 87
1259 3300031911 Ga0307412_10462477 Ga0307412_104624772 87
1260 3300031911 Ga0307412_10973312 Ga0307412_109733122 87
1261 3300031911 Ga0307412_11114432 Ga0307412_111144321 87
1262 3300031911 Ga0307412_11513853 Ga0307412_115138532 87
1263 3300031995 Ga0307409_100099309 Ga0307409_1000993092 87
1264 3300032002 Ga0307416_100000014 Ga0307416_100000014119 87
1265 3300032002 Ga0307416_100037502 Ga0307416_1000375025 87
1266 3300032004 Ga0307414_10000001 Ga0307414_10000001728 87
1267 3300032004 Ga0307414_10000142 Ga0307414_100001428 87
1268 3300032004 Ga0307414_10002670 Ga0307414_100026703 87
1269 3300032004 Ga0307414_10004731 Ga0307414_100047316 87
1270 3300032004 Ga0307414_10005109 Ga0307414_100051094 87
1271 3300032004 Ga0307414_10021506 Ga0307414_100215063 87
1272 3300032004 Ga0307414_10033178 Ga0307414_100331783 87
1273 3300032004 Ga0307414_10065932 Ga0307414_100659322 87
1274 3300032004 Ga0307414_10104846 Ga0307414_101048463 87
1275 3300032004 Ga0307414_10189258 Ga0307414_101892581 87
1276 3300032004 Ga0307414_10280613 Ga0307414_102806132 87
1277 3300032004 Ga0307414_10284003 Ga0307414_102840031 87
1278 3300032004 Ga0307414_10328253 Ga0307414_103282533 87
1279 3300032004 Ga0307414_10385975 Ga0307414_103859752 87
1280 3300032004 Ga0307414_10553711 Ga0307414_105537112 87
1281 3300032004 Ga0307414_10677300 Ga0307414_106773002 87
1282 3300032004 Ga0307414_10863571 Ga0307414_108635712 87
1283 3300032004 Ga0307414_10980081 Ga0307414_109800811 87
1284 3300032004 Ga0307414_11193099 Ga0307414_111930992 87
1285 3300032004 Ga0307414_11205998 Ga0307414_112059982 87
1286 3300032005 Ga0307411_10000013 Ga0307411_10000013120 87
1287 3300032005 Ga0307411_10065433 Ga0307411_100654334 87
1288 3300032005 Ga0307411_10094212 Ga0307411_100942124 87
1289 3300032005 Ga0307411_10171212 Ga0307411_101712122 87
1290 3300032005 Ga0307411_10419533 Ga0307411_104195332 87
1291 3300032005 Ga0307411_10517913 Ga0307411_105179132 87
1292 3300032126 Ga0307415_100170623 Ga0307415_1001706232 87
1293 3300032137 Ga0316585_10068050 Ga0316585_100680502 87
1294 3300032137 Ga0316585_10181158 Ga0316585_101811581 87
1295 3300032139 Ga0316580_10004937 Ga0316580_100049373 87
1296 3300032139 Ga0316580_10021055 Ga0316580_100210553 87
1297 3300032168 Ga0316593_10068701 Ga0316593_100687013 87
1298 3300032168 Ga0316593_10075217 Ga0316593_100752172 87
1299 3300032168 Ga0316593_10127242 Ga0316593_101272422 87
1300 3300032168 Ga0316593_10130323 Ga0316593_101303232 87
1301 3300033179 Ga0307507_10000184 Ga0307507_1000018439 87
1302 3300033180 Ga0307510_10012916 Ga0307510_100129169 87
1303 3300033180 Ga0307510_10027298 Ga0307510_100272985 87
1304 3300033524 Ga0316592_1031812 Ga0316592_10318122 87
1305 3300033524 Ga0316592_1034730 Ga0316592_10347302 87
1306 3300033524 Ga0316592_1055522 Ga0316592_10555221 87
1307 3300033524 Ga0316592_1057339 Ga0316592_10573392 87
1308 3300033524 Ga0316592_1058002 Ga0316592_10580022 87
1309 3300033527 Ga0316586_1019239 Ga0316586_10192392 87
1310 3300033527 Ga0316586_1066090 Ga0316586_10660902 87
1311 3300033528 Ga0316588_1080731 Ga0316588_10807312 87
1312 3300033528 Ga0316588_1085715 Ga0316588_10857152 87
1313 3300033541 Ga0316596_1047991 Ga0316596_10479912 87
1314 3300033541 Ga0316596_1048119 Ga0316596_10481192 87
1315 3300033541 Ga0316596_1096663 Ga0316596_10966632 87
1316 3300033541 Ga0316596_1096821 Ga0316596_10968212 87
1317 3300033541 Ga0316596_1117249 Ga0316596_11172492 87
1318 3300033541 Ga0316596_1201375 Ga0316596_12013752 87
1319 3300035398 Ga0316574_0035409 Ga0316574_0035409_735_1004 87
1320 3300035398 Ga0316574_0036021 Ga0316574_0036021_848_1117 87
1321 3300035398 Ga0316574_0065389 Ga0316574_0065389_681_950 87
1322 3300035398 Ga0316574_0126841 Ga0316574_0126841_604_873 87
1323 3300035398 Ga0316574_0140133 Ga0316574_0140133_119_415 87
1324 3300035398 Ga0316574_0147555 Ga0316574_0147555_995_1291 87
1325 3300035398 Ga0316574_0195621 Ga0316574_0195621_133_429 87
1326 3300035398 Ga0316574_0438906 Ga0316574_0438906_193_489 87
1327 3300035398 Ga0316574_0583060 Ga0316574_0583060_265_561 87
1328 3300036457 Ga0265778_012060 Ga0265778_012060_408_671 87
1329 3300036457 Ga0265778_027813 Ga0265778_027813_56_319 87
1330 3300036647 Ga0316582_0029832 Ga0316582_0029832_2015_2284 87
1331 3300036647 Ga0316582_0062598 Ga0316582_0062598_1791_2060 87
1332 3300036647 Ga0316582_0302548 Ga0316582_0302548_163_432 87
1333 3300036647 Ga0316582_0916773 Ga0316582_0916773_139_408 87
1334 3300036647 Ga0316582_0934711 Ga0316582_0934711_100_396 87
1335 3300036712 Ga0316584_0004613 Ga0316584_0004613_2069_2338 87
1336 3300036712 Ga0316584_0041514 Ga0316584_0041514_2809_3105 87
1337 3300036712 Ga0316584_0080910 Ga0316584_0080910_361_657 87
1338 3300036712 Ga0316584_0153636 Ga0316584_0153636_1132_1401 87
1339 3300036712 Ga0316584_0679220 Ga0316584_0679220_332_601 87
1340 3300036712 Ga0316584_0929679 Ga0316584_0929679_78_347 87
1341 3300037312 Ga0395899_0000002 Ga0395899_0000002_441598_441861 87
1342 3300037312 Ga0395899_0000136 Ga0395899_0000136_71903_72166 87
1343 3300037312 Ga0395899_0001075 Ga0395899_0001075_21454_21717 87
1344 3300037418 Ga0395900_0000115 Ga0395900_0000115_96077_96340 87
1345 3300037418 Ga0395900_0000194 Ga0395900_0000194_58189_58452 87
1346 3300037418 Ga0395900_0004186 Ga0395900_0004186_10248_10511 87
1347 3300037418 Ga0395900_0235955 Ga0395900_0235955_1036_1299 87
1348 3300037466 Ga0395898_0012085 Ga0395898_0012085_6409_6672 87
1349 3300037466 Ga0395898_0238609 Ga0395898_0238609_455_718 87
1350 3300037471 Ga0395905_0000045 Ga0395905_0000045_95883_96146 87
1351 3300037471 Ga0395905_0004409 Ga0395905_0004409_13073_13336 87
1352 3300037471 Ga0395905_0454439 Ga0395905_0454439_296_559 87
1353 3300037471 Ga0395905_0913274 Ga0395905_0913274_19_282 87
1354 3300037588 Ga0316581_0175238 Ga0316581_0175238_14_283 87
1355 3300038443 Ga0395901_0000254 Ga0395901_0000254_45696_45959 87
1356 3300038443 Ga0395901_0194606 Ga0395901_0194606_64_327 87
1357 3300038443 Ga0395901_0228295 Ga0395901_0228295_148_411 87
1358 3300038443 Ga0395901_0535197 Ga0395901_0535197_532_795 87
1359 3300039093 Ga0400489_08915 Ga0400489_08915_757_1026 87
1360 3300039093 Ga0400489_12149 Ga0400489_12149_641_910 87
1361 3300039447 Ga0436361_0619622 Ga0436361_0619622_181_444 87
1362 3300039447 Ga0436361_1212167 Ga0436361_1212167_845_1108 87
1363 3300041404 Ga0439436_0204127 Ga0439436_0204127_258_521 87
1364 3300041407 Ga0439447_015952 Ga0439447_015952_135_431 87
1365 3300041411 Ga0439466_0001586 Ga0439466_0001586_5086_5382 87
1366 3300041441 Ga0451787_399266 Ga0451787_399266_118_384 87
1367 3300041443 Ga0451789_0083252 Ga0451789_0083252_18_281 87
1368 3300041443 Ga0451789_0608028 Ga0451789_0608028_543_809 87
1369 3300041444 Ga0451790_01015 Ga0451790_01015_361_624 87
1370 3300041444 Ga0451790_05708 Ga0451790_05708_316_612 87
1371 3300041444 Ga0451790_07186 Ga0451790_07186_42_305 87
1372 3300041444 Ga0451790_12354 Ga0451790_12354_349_612 87
1373 3300041444 Ga0451790_26522 Ga0451790_26522_427_690 87
1374 3300041444 Ga0451790_28585 Ga0451790_28585_492_788 87
1375 3300041445 Ga0451792_12716 Ga0451792_12716_233_496 87
1376 3300041445 Ga0451792_15045 Ga0451792_15045_100_396 87
1377 3300041445 Ga0451792_21275 Ga0451792_21275_344_607 87
1378 3300041445 Ga0451792_22650 Ga0451792_22650_92_355 87
1379 3300041445 Ga0451792_23085 Ga0451792_23085_536_832 87
1380 3300041446 Ga0451794_04048 Ga0451794_04048_204_467 87
1381 3300041446 Ga0451794_29390 Ga0451794_29390_352_648 87
1382 3300041446 Ga0451794_39496 Ga0451794_39496_84_347 87
1383 3300041446 Ga0451794_46214 Ga0451794_46214_457_720 87
1384 3300041446 Ga0451794_47763 Ga0451794_47763_69_332 87
1385 3300041451 Ga0451791_0720560 Ga0451791_0720560_652_948 87
1386 3300041451 Ga0451791_1131336 Ga0451791_1131336_309_572 87
1387 3300041451 Ga0451791_1786408 Ga0451791_1786408_95_358 87
1388 3300041452 Ga0451793_0593804 Ga0451793_0593804_26_289 87
1389 3300041453 Ga0451797_0093093 Ga0451797_0093093_326_589 87
1390 3300041453 Ga0451797_1398792 Ga0451797_1398792_297_593 87
1391 3300041455 Ga0451801_35217 Ga0451801_35217_187_483 87
1392 3300041458 Ga0451798_0335166 Ga0451798_0335166_691_987 87
1393 3300041459 Ga0451800_0728801 Ga0451800_0728801_713_976 87
1394 3300041461 Ga0451805_000777 Ga0451805_000777_265_528 87
1395 3300041461 Ga0451805_104840 Ga0451805_104840_163_426 87
1396 3300041462 Ga0451806_273099 Ga0451806_273099_590_853 87
1397 3300041464 Ga0451808_04453 Ga0451808_04453_194_490 87
1398 3300041486 Ga0451807_0721014 Ga0451807_0721014_707_970 87
1399 3300041486 Ga0451807_0922658 Ga0451807_0922658_226_489 87
1400 3300041486 Ga0451807_1381593 Ga0451807_1381593_40_366 87
1401 3300041486 Ga0451807_2187678 Ga0451807_2187678_133_429 87
1402 3300041491 Ga0451833_0918318 Ga0451833_0918318_208_471 87
1403 3300041492 Ga0451835_0618806 Ga0451835_0618806_176_472 87
1404 3300041494 Ga0451837_0670671 Ga0451837_0670671_186_449 87
1405 3300041494 Ga0451837_0801724 Ga0451837_0801724_2179_2475 87
1406 3300041494 Ga0451837_1312884 Ga0451837_1312884_77_373 87
1407 3300041494 Ga0451837_1859320 Ga0451837_1859320_272_571 87
1408 3300041496 Ga0451839_0971585 Ga0451839_0971585_556_852 87
1409 3300041497 Ga0451840_17532 Ga0451840_17532_341_604 87
1410 3300041498 Ga0451841_0204445 Ga0451841_0204445_108_371 87
1411 3300041498 Ga0451841_0372921 Ga0451841_0372921_452_748 87
1412 3300041500 Ga0451844_13600 Ga0451844_13600_534_830 87
1413 3300041502 Ga0451846_10133 Ga0451846_10133_189_485 87
1414 3300041505 Ga0451849_0942038 Ga0451849_0942038_858_1154 87
1415 3300041505 Ga0451849_1204063 Ga0451849_1204063_29_292 87
1416 3300041507 Ga0451851_0418638 Ga0451851_0418638_149_412 87
1417 3300041508 Ga0451852_08582 Ga0451852_08582_430_699 87
1418 3300041509 Ga0451843_0781574 Ga0451843_0781574_68_364 87
1419 3300041511 Ga0451855_0409812 Ga0451855_0409812_183_449 87
1420 3300041907 Ga0452268_21347 Ga0452268_21347_388_651 87
1421 3300041907 Ga0452268_21928 Ga0452268_21928_48_311 87
1422 3300041916 Ga0452271_25614 Ga0452271_25614_32_295 87
1423 3300041916 Ga0452271_30878 Ga0452271_30878_329_592 87
1424 3300041916 Ga0452271_52098 Ga0452271_52098_146_442 87
1425 3300042004 Ga0439445_0025207 Ga0439445_0025207_786_1082 87
1426 3300042005 Ga0439448_0023965 Ga0439448_0023965_66_329 87
1427 3300042014 Ga0439457_014141 Ga0439457_014141_764_1027 87
1428 3300042015 Ga0439462_0145120 Ga0439462_0145120_286_549 87
1429 3300042436 Ga0439435_0042831 Ga0439435_0042831_156_452 87
1430 3300042876 Ga0451577_0078246 Ga0451577_0078246_873_1142 87
1431 3300042876 Ga0451577_0081748 Ga0451577_0081748_792_1061 87
1432 3300042876 Ga0451577_0297989 Ga0451577_0297989_674_943 87
1433 3300042876 Ga0451577_0863964 Ga0451577_0863964_243_515 87
1434 3300042876 Ga0451577_1549191 Ga0451577_1549191_62_334 87
1435 3300044656 Ga0466969_0045320 Ga0466969_0045320_921_1184 87
1436 3300044673 Ga0453683_0004138 Ga0453683_0004138_3091_3360 87
1437 3300044673 Ga0453683_0048780 Ga0453683_0048780_1664_1936 87
1438 3300044673 Ga0453683_0113897 Ga0453683_0113897_573_842 87
1439 3300044673 Ga0453683_0874742 Ga0453683_0874742_26_295 87
1440 3300044684 Ga0466966_0088319 Ga0466966_0088319_1119_1382 87
1441 3300044684 Ga0466966_0192121 Ga0466966_0192121_138_401 87
1442 3300044684 Ga0466966_0332404 Ga0466966_0332404_64_327 87
1443 3300044693 Ga0466961_0058300 Ga0466961_0058300_418_681 87
1444 3300044712 Ga0453684_0006725 Ga0453684_0006725_5807_6076 87
1445 3300044712 Ga0453684_0013721 Ga0453684_0013721_12609_12878 87
1446 3300044712 Ga0453684_0034416 Ga0453684_0034416_5665_5934 87
1447 3300044712 Ga0453684_0041984 Ga0453684_0041984_1772_2059 87
1448 3300044712 Ga0453684_0045232 Ga0453684_0045232_4576_4845 87
1449 3300044712 Ga0453684_1050736 Ga0453684_1050736_393_662 87
1450 3300044712 Ga0453684_1484347 Ga0453684_1484347_217_486 87
1451 3300045049 Ga0466959_0055811 Ga0466959_0055811_941_1204 87
1452 3300045051 Ga0451576_0011523 Ga0451576_0011523_1752_2021 87
1453 3300045051 Ga0451576_0025368 Ga0451576_0025368_4292_4561 87
1454 3300045051 Ga0451576_0039109 Ga0451576_0039109_2428_2697 87
1455 3300045051 Ga0451576_0232225 Ga0451576_0232225_1115_1384 87
1456 3300045051 Ga0451576_0802579 Ga0451576_0802579_343_612 87
1457 3300045051 Ga0451576_2134558 Ga0451576_2134558_68_337 87
1458 3300045836 Ga0466958_0103944 Ga0466958_0103944_521_784 87
1459 3300046453 Ga0495627_035052 Ga0495627_035052_606_869 87
1460 3300046453 Ga0495627_064391 Ga0495627_064391_498_794 87
1461 3300046453 Ga0495627_160732 Ga0495627_160732_135_431 87
1462 3300046454 Ga0495592_0248083 Ga0495592_0248083_400_663 87
1463 3300046454 Ga0495592_0403922 Ga0495592_0403922_76_339 87
1464 3300046460 Ga0495638_0625385 Ga0495638_0625385_53_316 87
1465 3300046462 Ga0495651_0125167 Ga0495651_0125167_507_770 87
1466 3300046463 Ga0495653_0191509 Ga0495653_0191509_422_685 87
1467 3300046471 Ga0495650_0000198 Ga0495650_0000198_5536_5799 87
1468 3300046471 Ga0495650_0065434 Ga0495650_0065434_758_1021 87
1469 3300046471 Ga0495650_0204530 Ga0495650_0204530_394_657 87
1470 3300046474 Ga0495605_0028808 Ga0495605_0028808_1008_1271 87
1471 3300046474 Ga0495605_0287208 Ga0495605_0287208_399_662 87
1472 3300046492 Ga0495585_0000037 Ga0495585_0000037_3118_3381 87
1473 3300046492 Ga0495585_0268735 Ga0495585_0268735_549_812 87
1474 3300046501 Ga0495607_0023355 Ga0495607_0023355_231_527 87
1475 3300046501 Ga0495607_0109099 Ga0495607_0109099_762_1025 87
1476 3300046501 Ga0495607_0124250 Ga0495607_0124250_423_686 87
1477 3300046506 Ga0495583_0083474 Ga0495583_0083474_649_912 87
1478 3300046506 Ga0495583_0099994 Ga0495583_0099994_670_933 87
1479 3300046506 Ga0495583_0294110 Ga0495583_0294110_282_545 87
1480 3300046507 Ga0495606_0000060 Ga0495606_0000060_14569_14832 87
1481 3300046507 Ga0495606_0006519 Ga0495606_0006519_6729_6992 87
1482 3300046507 Ga0495606_0045259 Ga0495606_0045259_2167_2430 87
1483 3300046507 Ga0495606_0045808 Ga0495606_0045808_299_562 87
1484 3300046507 Ga0495606_0082387 Ga0495606_0082387_51_314 87
1485 3300046507 Ga0495606_0295421 Ga0495606_0295421_201_497 87
1486 3300046512 Ga0495610_0000152 Ga0495610_0000152_64838_65101 87
1487 3300046512 Ga0495610_0000906 Ga0495610_0000906_6076_6339 87
1488 3300046512 Ga0495610_0268835 Ga0495610_0268835_51_314 87
1489 3300046513 Ga0495616_0002139 Ga0495616_0002139_10929_11192 87
1490 3300046513 Ga0495616_0113271 Ga0495616_0113271_310_606 87
1491 3300046514 Ga0495618_0122221 Ga0495618_0122221_552_815 87
1492 3300046516 Ga0495628_0563179 Ga0495628_0563179_89_352 87
1493 3300046518 Ga0495631_0022679 Ga0495631_0022679_1536_1799 87
1494 3300046518 Ga0495631_0051519 Ga0495631_0051519_501_764 87
1495 3300046518 Ga0495631_0260905 Ga0495631_0260905_94_357 87
1496 3300046519 Ga0495632_0083663 Ga0495632_0083663_1196_1459 87
1497 3300046519 Ga0495632_0261323 Ga0495632_0261323_194_457 87
1498 3300046520 Ga0495637_0051701 Ga0495637_0051701_746_1009 87
1499 3300046522 Ga0495643_0001123 Ga0495643_0001123_5329_5625 87
1500 3300046522 Ga0495643_0425458 Ga0495643_0425458_230_493 87
1501 3300046523 Ga0495644_0014181 Ga0495644_0014181_910_1173 87
1502 3300046524 Ga0495648_0006432 Ga0495648_0006432_3320_3583 87
1503 3300046525 Ga0495663_0287394 Ga0495663_0287394_57_320 87
1504 3300046525 Ga0495663_0389278 Ga0495663_0389278_110_373 87
1505 3300046528 Ga0495642_0090939 Ga0495642_0090939_511_774 87
1506 3300046529 Ga0495652_0174440 Ga0495652_0174440_696_959 87
1507 3300046529 Ga0495652_0213444 Ga0495652_0213444_1006_1269 87
1508 3300046529 Ga0495652_0487257 Ga0495652_0487257_111_374 87
1509 3300046530 Ga0495654_0080675 Ga0495654_0080675_855_1151 87
1510 3300046536 Ga0495587_0289805 Ga0495587_0289805_334_597 87
1511 3300046538 Ga0495609_0009054 Ga0495609_0009054_3660_3923 87
1512 3300046538 Ga0495609_0020601 Ga0495609_0020601_2262_2525 87
1513 3300046538 Ga0495609_0042667 Ga0495609_0042667_454_717 87
1514 3300046542 Ga0495597_0313198 Ga0495597_0313198_12_275 87
1515 3300046558 Ga0495633_0000021 Ga0495633_0000021_134637_134900 87
1516 3300046558 Ga0495633_0021277 Ga0495633_0021277_2191_2454 87
1517 3300046558 Ga0495633_0144844 Ga0495633_0144844_421_717 87
1518 3300046616 Ga0495668_0000075 Ga0495668_0000075_85032_85295 87
1519 3300046616 Ga0495668_0331064 Ga0495668_0331064_424_687 87
1520 3300046648 Ga0495611_0230525 Ga0495611_0230525_326_589 87
1521 3300046660 Ga0495625_0000524 Ga0495625_0000524_53660_53923 87
1522 3300046660 Ga0495625_0001162 Ga0495625_0001162_30970_31233 87
1523 3300046660 Ga0495625_0053615 Ga0495625_0053615_590_886 87
1524 3300046660 Ga0495625_0076250 Ga0495625_0076250_877_1173 87
1525 3300046660 Ga0495625_0154893 Ga0495625_0154893_570_833 87
1526 3300046660 Ga0495625_0349963 Ga0495625_0349963_133_396 87
1527 3300046660 Ga0495625_0475028 Ga0495625_0475028_346_609 87
1528 3300046663 Ga0495635_0879141 Ga0495635_0879141_24_287 87
1529 3300046665 Ga0495661_0000485 Ga0495661_0000485_11799_12062 87
1530 3300046665 Ga0495661_0021286 Ga0495661_0021286_2939_3202 87
1531 3300046680 Ga0495646_0360945 Ga0495646_0360945_486_749 87
1532 3300046691 Ga0495670_0114612 Ga0495670_0114612_433_696 87
1533 3300046692 Ga0495671_0361437 Ga0495671_0361437_153_416 87
1534 3300046692 Ga0495671_0385072 Ga0495671_0385072_60_323 87
1535 3300046692 Ga0495671_0564843 Ga0495671_0564843_93_389 87
1536 3300046694 Ga0495649_0000168 Ga0495649_0000168_54187_54450 87
1537 3300046794 Ga0495589_0077133 Ga0495589_0077133_349_612 87
1538 3300046809 Ga0495600_0246110 Ga0495600_0246110_223_486 87
1539 3300046810 Ga0495660_0043141 Ga0495660_0043141_1225_1488 87
1540 3300046810 Ga0495660_0082379 Ga0495660_0082379_1359_1655 87
1541 3300047317 Ga0495604_0510090 Ga0495604_0510090_491_754 87
1542 3300047319 Ga0495674_0766408 Ga0495674_0766408_327_590 87
1543 3300047323 Ga0495683_0036132 Ga0495683_0036132_1398_1661 87
1544 3300047323 Ga0495683_0153634 Ga0495683_0153634_378_641 87
1545 3300047443 Ga0495687_014173 Ga0495687_014173_3579_3842 87
1546 3300047443 Ga0495687_043861 Ga0495687_043861_235_498 87
1547 3300047446 Ga0495679_097180 Ga0495679_097180_64_327 87
1548 3300047447 Ga0495685_011826 Ga0495685_011826_432_695 87
1549 3300047469 Ga0495673_0035173 Ga0495673_0035173_1146_1409 87
1550 3300047470 Ga0495681_0045335 Ga0495681_0045335_1502_1765 87
1551 3300047470 Ga0495681_0089317 Ga0495681_0089317_449_712 87
1552 3300047472 Ga0495686_0000237 Ga0495686_0000237_4270_4533 87
1553 3300047472 Ga0495686_0001755 Ga0495686_0001755_9805_10068 87
1554 3300047472 Ga0495686_0068930 Ga0495686_0068930_1789_2052 87
1555 3300047472 Ga0495686_0200427 Ga0495686_0200427_850_1113 87
1556 3300047472 Ga0495686_0307523 Ga0495686_0307523_61_324 87
1557 3300047673 Ga0495593_0172556 Ga0495593_0172556_565_828 87
1558 3300048089 Ga0495614_0011515 Ga0495614_0011515_2619_2882 87
1559 3300048917 Ga0496114_0209666 Ga0496114_0209666_353_616 87
1560 3300048918 Ga0496115_0576434 Ga0496115_0576434_395_658 87
1561 3300048918 Ga0496115_1233899 Ga0496115_1233899_118_381 87
1562 3300048919 Ga0496116_0000041 Ga0496116_0000041_10076_10372 87
1563 3300048919 Ga0496116_0002559 Ga0496116_0002559_5826_6089 87
1564 3300048920 Ga0496117_0000407 Ga0496117_0000407_60572_60835 87
1565 3300048920 Ga0496117_0084945 Ga0496117_0084945_990_1286 87
1566 3300048921 Ga0496118_0058060 Ga0496118_0058060_667_963 87
1567 3300048921 Ga0496118_0135576 Ga0496118_0135576_249_512 87
1568 3300048921 Ga0496118_0543650 Ga0496118_0543650_54_317 87
1569 3300048924 Ga0496121_0059029 Ga0496121_0059029_1218_1514 87
1570 3300048925 Ga0496122_0001781 Ga0496122_0001781_16317_16580 87
1571 3300048925 Ga0496122_0011839 Ga0496122_0011839_4124_4387 87
1572 3300048926 Ga0496123_0003360 Ga0496123_0003360_17050_17313 87
1573 3300048926 Ga0496123_0015493 Ga0496123_0015493_11_274 87
1574 3300048927 Ga0496124_0050873 Ga0496124_0050873_2337_2633 87
1575 3300048927 Ga0496124_0180835 Ga0496124_0180835_858_1121 87
1576 3300048928 Ga0496125_0000026 Ga0496125_0000026_8695_8991 87
1577 3300048928 Ga0496125_0000286 Ga0496125_0000286_93587_93883 87
1578 3300048928 Ga0496125_0121769 Ga0496125_0121769_727_990 87
1579 3300048928 Ga0496125_0206882 Ga0496125_0206882_843_1106 87
1580 3300048928 Ga0496125_0364324 Ga0496125_0364324_269_565 87
1581 3300048929 Ga0496126_0005340 Ga0496126_0005340_5266_5562 87
1582 3300048929 Ga0496126_0021511 Ga0496126_0021511_4500_4796 87
1583 3300049127 Ga0501306_011248 Ga0501306_011248_321_584 87
1584 3300049127 Ga0501306_013243 Ga0501306_013243_391_654 87
1585 3300049127 Ga0501306_016046 Ga0501306_016046_397_660 87
1586 3300049127 Ga0501306_066244 Ga0501306_066244_260_523 87
1587 3300049128 Ga0501308_021450 Ga0501308_021450_431_700 87
1588 3300049130 Ga0501310_006083 Ga0501310_006083_601_897 87
1589 3300049130 Ga0501310_010327 Ga0501310_010327_369_632 87
1590 3300049130 Ga0501310_012814 Ga0501310_012814_170_466 87
1591 3300049130 Ga0501310_013017 Ga0501310_013017_389_652 87
1592 3300049131 Ga0501341_02973 Ga0501341_02973_371_634 87
1593 3300049131 Ga0501341_15504 Ga0501341_15504_168_515 87
1594 3300049132 Ga0501343_006960 Ga0501343_006960_257_520 87
1595 3300049132 Ga0501343_007343 Ga0501343_007343_251_514 87
1596 3300049132 Ga0501343_009639 Ga0501343_009639_439_702 87
1597 3300049132 Ga0501343_010756 Ga0501343_010756_141_404 87
1598 3300049132 Ga0501343_012324 Ga0501343_012324_192_455 87
1599 3300049132 Ga0501343_012944 Ga0501343_012944_128_391 87
1600 3300049134 Ga0501345_05308 Ga0501345_05308_249_512 87
1601 3300049161 Ga0501305_020970 Ga0501305_020970_392_655 87
1602 3300049162 Ga0501307_038844 Ga0501307_038844_383_646 87
1603 3300049162 Ga0501307_046142 Ga0501307_046142_12_275 87
1604 3300049162 Ga0501307_057264 Ga0501307_057264_312_575 87
1605 3300049162 Ga0501307_066933 Ga0501307_066933_46_309 87
1606 3300049459 Ga0495678_004560 Ga0495678_004560_3701_3964 87
1607 3300049460 Ga0495682_0072252 Ga0495682_0072252_222_485 87
1608 3300049460 Ga0495682_0129990 Ga0495682_0129990_272_535 87
1609 3300049527 Ga0501311_012110 Ga0501311_012110_386_649 87
1610 3300049527 Ga0501311_020027 Ga0501311_020027_257_520 87
1611 3300049527 Ga0501311_031815 Ga0501311_031815_137_400 87
1612 3300049528 Ga0501312_017231 Ga0501312_017231_386_649 87
1613 3300049530 Ga0501314_004429 Ga0501314_004429_357_653 87
1614 3300049530 Ga0501314_008537 Ga0501314_008537_409_672 87
1615 3300049530 Ga0501314_010685 Ga0501314_010685_118_414 87
1616 3300049531 Ga0501315_030238 Ga0501315_030238_349_612 87
1617 3300049531 Ga0501315_033397 Ga0501315_033397_383_646 87
1618 3300049531 Ga0501315_065794 Ga0501315_065794_74_337 87
1619 3300049532 Ga0501316_009778 Ga0501316_009778_380_643 87
1620 3300049532 Ga0501316_014090 Ga0501316_014090_256_519 87
1621 3300049532 Ga0501316_064111 Ga0501316_064111_260_523 87
1622 3300049533 Ga0501317_041781 Ga0501317_041781_348_611 87
1623 3300049535 Ga0501319_001903 Ga0501319_001903_536_799 87
1624 3300049535 Ga0501319_002523 Ga0501319_002523_513_809 87
1625 3300049535 Ga0501319_002761 Ga0501319_002761_485_781 87
1626 3300049535 Ga0501319_005039 Ga0501319_005039_482_745 87
1627 3300049535 Ga0501319_012612 Ga0501319_012612_376_639 87
1628 3300049535 Ga0501319_013539 Ga0501319_013539_28_324 87
1629 3300049535 Ga0501319_014389 Ga0501319_014389_27_323 87
1630 3300049536 Ga0501320_004749 Ga0501320_004749_357_653 87
1631 3300049536 Ga0501320_011310 Ga0501320_011310_169_432 87
1632 3300049536 Ga0501320_023189 Ga0501320_023189_89_352 87
1633 3300049536 Ga0501320_026146 Ga0501320_026146_346_642 87
1634 3300049536 Ga0501320_027181 Ga0501320_027181_37_300 87
1635 3300049536 Ga0501320_050815 Ga0501320_050815_261_524 87
1636 3300049536 Ga0501320_064333 Ga0501320_064333_246_509 87
1637 3300049537 Ga0501321_013063 Ga0501321_013063_387_650 87
1638 3300049537 Ga0501321_039322 Ga0501321_039322_11_307 87
1639 3300049537 Ga0501321_062161 Ga0501321_062161_171_434 87
1640 3300049539 Ga0501323_005201 Ga0501323_005201_352_648 87
1641 3300049539 Ga0501323_019175 Ga0501323_019175_397_660 87
1642 3300049539 Ga0501323_022797 Ga0501323_022797_50_346 87
1643 3300049539 Ga0501323_036198 Ga0501323_036198_55_318 87
1644 3300049539 Ga0501323_036389 Ga0501323_036389_352_615 87
1645 3300049539 Ga0501323_049393 Ga0501323_049393_137_400 87
1646 3300049539 Ga0501323_055652 Ga0501323_055652_215_478 87
1647 3300049540 Ga0501324_004496 Ga0501324_004496_200_496 87
1648 3300049540 Ga0501324_008273 Ga0501324_008273_396_659 87
1649 3300049540 Ga0501324_010366 Ga0501324_010366_369_632 87
1650 3300049540 Ga0501324_014967 Ga0501324_014967_312_575 87
1651 3300049540 Ga0501324_038506 Ga0501324_038506_211_480 87
1652 3300049540 Ga0501324_038574 Ga0501324_038574_253_516 87
1653 3300049540 Ga0501324_042776 Ga0501324_042776_37_300 87
1654 3300049541 Ga0501325_008635 Ga0501325_008635_255_518 87
1655 3300049541 Ga0501325_015155 Ga0501325_015155_140_436 87
1656 3300049541 Ga0501325_022953 Ga0501325_022953_315_611 87
1657 3300049542 Ga0501326_00555 Ga0501326_00555_656_952 87
1658 3300049542 Ga0501326_13357 Ga0501326_13357_86_349 87
1659 3300049543 Ga0501327_02076 Ga0501327_02076_373_636 87
1660 3300049543 Ga0501327_04128 Ga0501327_04128_79_342 87
1661 3300049543 Ga0501327_10277 Ga0501327_10277_265_528 87
1662 3300049544 Ga0501328_01300 Ga0501328_01300_502_798 87
1663 3300049545 Ga0501329_01513 Ga0501329_01513_265_561 87
1664 3300049545 Ga0501329_01780 Ga0501329_01780_110_406 87
1665 3300049545 Ga0501329_02296 Ga0501329_02296_180_443 87
1666 3300049545 Ga0501329_05862 Ga0501329_05862_356_619 87
1667 3300049545 Ga0501329_16338 Ga0501329_16338_55_351 87
1668 3300049546 Ga0501330_001814 Ga0501330_001814_645_941 87
1669 3300049546 Ga0501330_007309 Ga0501330_007309_103_366 87
1670 3300049546 Ga0501330_011078 Ga0501330_011078_128_391 87
1671 3300049547 Ga0501331_02589 Ga0501331_02589_371_634 87
1672 3300049548 Ga0501332_15721 Ga0501332_15721_26_289 87
1673 3300049549 Ga0501333_023046 Ga0501333_023046_37_300 87
1674 3300049550 Ga0501334_02507 Ga0501334_02507_503_799 87
1675 3300049550 Ga0501334_03753 Ga0501334_03753_300_563 87
1676 3300049550 Ga0501334_06785 Ga0501334_06785_458_721 87
1677 3300049551 Ga0501335_014990 Ga0501335_014990_480_776 87
1678 3300049551 Ga0501335_017490 Ga0501335_017490_373_636 87
1679 3300049551 Ga0501335_021736 Ga0501335_021736_295_558 87
1680 3300049551 Ga0501335_031660 Ga0501335_031660_27_290 87
1681 3300049551 Ga0501335_037517 Ga0501335_037517_51_314 87
1682 3300049551 Ga0501335_049727 Ga0501335_049727_186_449 87
1683 3300049551 Ga0501335_049734 Ga0501335_049734_36_299 87
1684 3300049552 Ga0501336_006073 Ga0501336_006073_252_515 87
1685 3300049552 Ga0501336_016948 Ga0501336_016948_123_386 87
1686 3300049552 Ga0501336_021644 Ga0501336_021644_245_508 87
1687 3300049552 Ga0501336_026837 Ga0501336_026837_117_380 87
1688 3300049553 Ga0501337_003097 Ga0501337_003097_502_798 87
1689 3300049553 Ga0501337_012159 Ga0501337_012159_121_384 87
1690 3300049554 Ga0501338_03833 Ga0501338_03833_105_401 87
1691 3300049556 Ga0501340_003327 Ga0501340_003327_397_660 87
1692 3300049556 Ga0501340_014618 Ga0501340_014618_123_386 87
1693 3300049570 Ga0501033_0386566 Ga0501033_0386566_465_728 87
1694 3300049571 Ga0501034_1416810 Ga0501034_1416810_201_464 87
1695 3300049572 Ga0501036_0234323 Ga0501036_0234323_147_443 87
1696 3300049574 Ga0501038_0592943 Ga0501038_0592943_273_569 87
1697 3300049581 Ga0501047_0948999 Ga0501047_0948999_218_514 87
1698 3300049649 Ga0501198_135825 Ga0501198_135825_43_306 87
1699 3300049661 Ga0501217_017119 Ga0501217_017119_797_1060 87
1700 3300049663 Ga0501223_005071 Ga0501223_005071_1691_1954 87
1701 3300049671 Ga0501238_000035 Ga0501238_000035_20053_20349 87
1702 3300049671 Ga0501238_026083 Ga0501238_026083_503_766 87
1703 3300049673 Ga0501240_002046 Ga0501240_002046_1066_1329 87
1704 3300049679 Ga0501249_000003 Ga0501249_000003_16142_16438 87
1705 3300049679 Ga0501249_001982 Ga0501249_001982_3786_4082 87
1706 3300049679 Ga0501249_059754 Ga0501249_059754_100_396 87
1707 3300049682 Ga0501252_005703 Ga0501252_005703_637_900 87
1708 3300049705 Ga0501225_0103534 Ga0501225_0103534_477_740 87
1709 3300049758 Ga0501241_008960 Ga0501241_008960_1457_1720 87
1710 3300049758 Ga0501241_027067 Ga0501241_027067_303_566 87
1711 3300049758 Ga0501241_162418 Ga0501241_162418_32_328 87
1712 3300049763 Ga0501266_000007 Ga0501266_000007_255779_256075 87
1713 3300049763 Ga0501266_002219 Ga0501266_002219_23_319 87
1714 3300049766 Ga0501269_037978 Ga0501269_037978_137_433 87
1715 3300049822 Ga0501035_0077492 Ga0501035_0077492_2265_2561 87
1716 3300050489 nmdc:mga03683_451284_c1 nmdc:mga03683_451284_c1_279_575 87
1717 3300050493 nmdc:mga0k408_294620_c1 nmdc:mga0k408_294620_c1_511_774 87
1718 3300050493 nmdc:mga0k408_3935_c1 nmdc:mga0k408_3935_c1_6193_6456 87
1719 3300050493 nmdc:mga0k408_44241_c1 nmdc:mga0k408_44241_c1_1033_1296 87
1720 3300050493 nmdc:mga0k408_542425_c1 nmdc:mga0k408_542425_c1_298_561 87
1721 3300053080 Ga0500635_0000470 Ga0500635_0000470_9266_9529 87
1722 3300053085 Ga0495619_0495243 Ga0495619_0495243_305_568 87
1723 3300053086 Ga0500578_0075845 Ga0500578_0075845_1179_1475 87
1724 3300053086 Ga0500578_0786473 Ga0500578_0786473_179_442 87
1725 3300053090 Ga0500646_0009457 Ga0500646_0009457_1597_1893 87
1726 3300053090 Ga0500646_0013189 Ga0500646_0013189_1572_1868 87
1727 3300053093 Ga0500651_0000202 Ga0500651_0000202_26341_26604 87
1728 3300053093 Ga0500651_0409870 Ga0500651_0409870_158_454 87
1729 3300053093 Ga0500651_0607567 Ga0500651_0607567_105_368 87
1730 3300053096 Ga0500641_0000006 Ga0500641_0000006_211705_212001 87
1731 3300053096 Ga0500641_0000092 Ga0500641_0000092_3612_3908 87
1732 3300053096 Ga0500641_0340748 Ga0500641_0340748_105_368 87
1733 3300053096 Ga0500641_0341138 Ga0500641_0341138_134_430 87
1734 3300053111 Ga0500572_255977 Ga0500572_255977_135_431 87
1735 3300053121 Ga0500607_281385 Ga0500607_281385_181_477 87
1736 3300053122 Ga0500608_000470 Ga0500608_000470_1827_2090 87
1737 3300053122 Ga0500608_164045 Ga0500608_164045_153_416 87
1738 3300053122 Ga0500608_297386 Ga0500608_297386_237_533 87
1739 3300053125 Ga0500618_000012 Ga0500618_000012_121337_121600 87
1740 3300053130 Ga0500642_0335539 Ga0500642_0335539_334_597 87
1741 3300053131 Ga0500652_159455 Ga0500652_159455_538_801 87
1742 3300053134 Ga0500658_0000013 Ga0500658_0000013_138408_138704 87
1743 3300053136 Ga0500559_0005610 Ga0500559_0005610_407_703 87
1744 3300053139 Ga0500568_0078173 Ga0500568_0078173_592_855 87
1745 3300053139 Ga0500568_0084345 Ga0500568_0084345_413_709 87
1746 3300053139 Ga0500568_0150665 Ga0500568_0150665_432_695 87
1747 3300053140 Ga0500573_0174476 Ga0500573_0174476_400_663 87
1748 3300053140 Ga0500573_0194042 Ga0500573_0194042_516_812 87
1749 3300053142 Ga0500577_0334420 Ga0500577_0334420_282_578 87
1750 3300053147 Ga0500589_115807 Ga0500589_115807_692_988 87
1751 3300053148 Ga0500590_144348 Ga0500590_144348_223_519 87
1752 3300053154 Ga0500619_265509 Ga0500619_265509_176_439 87
1753 3300053156 Ga0500622_0081684 Ga0500622_0081684_778_1041 87
1754 3300053156 Ga0500622_0185621 Ga0500622_0185621_455_751 87
1755 3300053156 Ga0500622_0221326 Ga0500622_0221326_160_423 87
1756 3300053157 Ga0500624_000154 Ga0500624_000154_13833_14096 87
1757 3300053161 Ga0500634_0055583 Ga0500634_0055583_1610_1873 87
1758 3300053726 Ga0500584_130079 Ga0500584_130079_43_339 87
1759 3300059477 Ga0587084_015261 Ga0587084_015261_381_644 87
1760 3300059478 Ga0587093_014887 Ga0587093_014887_274_537 87
1761 3300059478 Ga0587093_024642 Ga0587093_024642_132_395 87
1762 3300059478 Ga0587093_027181 Ga0587093_027181_104_367 87
1763 3300059478 Ga0587093_078898 Ga0587093_078898_63_326 87
1764 3300059490 Ga0587066_020322 Ga0587066_020322_440_703 87
1765 3300059490 Ga0587066_021540 Ga0587066_021540_415_678 87
1766 3300059490 Ga0587066_024447 Ga0587066_024447_396_659 87
1767 3300059490 Ga0587066_068764 Ga0587066_068764_67_336 87
1768 3300059490 Ga0587066_075787 Ga0587066_075787_143_406 87
1769 3300059491 Ga0587070_016922 Ga0587070_016922_492_761 87
1770 3300059491 Ga0587070_047857 Ga0587070_047857_415_678 87
1771 3300059491 Ga0587070_070306 Ga0587070_070306_88_351 87
1772 3300059491 Ga0587070_071574 Ga0587070_071574_400_663 87
1773 3300059491 Ga0587070_092190 Ga0587070_092190_382_645 87
1774 3300059492 Ga0587073_0084045 Ga0587073_0084045_286_549 87
1775 3300059492 Ga0587073_0136583 Ga0587073_0136583_22_285 87
1776 3300059492 Ga0587073_0295896 Ga0587073_0295896_74_337 87
1777 3300059492 Ga0587073_0321877 Ga0587073_0321877_208_471 87
1778 3300059493 Ga0587077_020853 Ga0587077_020853_481_750 87
1779 3300059493 Ga0587077_020888 Ga0587077_020888_364_627 87
1780 3300059493 Ga0587077_031427 Ga0587077_031427_336_599 87
1781 3300059493 Ga0587077_057917 Ga0587077_057917_174_437 87
1782 3300059493 Ga0587077_096880 Ga0587077_096880_56_319 87
1783 3300059503 Ga0587080_017291 Ga0587080_017291_490_753 87
1784 3300059503 Ga0587080_023646 Ga0587080_023646_393_656 87
1785 3300059503 Ga0587080_047744 Ga0587080_047744_122_385 87
1786 3300059504 Ga0587082_028699 Ga0587082_028699_398_661 87
1787 3300059505 Ga0587083_0024001 Ga0587083_0024001_409_678 87
1788 3300059505 Ga0587083_0036979 Ga0587083_0036979_474_737 87
1789 3300059505 Ga0587083_0097861 Ga0587083_0097861_26_289 87
1790 3300059505 Ga0587083_0125128 Ga0587083_0125128_74_337 87
1791 3300059505 Ga0587083_0179848 Ga0587083_0179848_250_513 87
1792 3300059505 Ga0587083_0183797 Ga0587083_0183797_181_444 87
1793 3300059507 Ga0587086_011640 Ga0587086_011640_373_636 87
1794 3300059507 Ga0587086_024388 Ga0587086_024388_191_454 87
1795 3300059508 Ga0587088_035042 Ga0587088_035042_234_497 87
1796 3300059508 Ga0587088_055303 Ga0587088_055303_39_302 87
1797 3300059508 Ga0587088_068364 Ga0587088_068364_390_653 87
1798 3300059508 Ga0587088_075789 Ga0587088_075789_271_534 87
1799 3300059508 Ga0587088_089166 Ga0587088_089166_141_404 87
1800 3300059509 Ga0587089_010410 Ga0587089_010410_409_678 87
1801 3300059509 Ga0587089_012498 Ga0587089_012498_384_647 87
1802 3300059509 Ga0587089_013988 Ga0587089_013988_397_660 87
1803 3300059510 Ga0587090_017965 Ga0587090_017965_393_656 87
1804 3300059510 Ga0587090_032249 Ga0587090_032249_205_468 87
1805 3300059510 Ga0587090_128458 Ga0587090_128458_117_380 87
1806 3300059511 Ga0587091_023112 Ga0587091_023112_395_658 87
1807 3300059511 Ga0587091_038394 Ga0587091_038394_279_542 87
1808 3300059511 Ga0587091_062881 Ga0587091_062881_271_534 87
1809 3300059511 Ga0587091_074042 Ga0587091_074042_76_345 87
1810 3300059511 Ga0587091_084969 Ga0587091_084969_412_675 87
1811 3300059512 Ga0587092_014112 Ga0587092_014112_481_750 87
1812 3300059512 Ga0587092_018549 Ga0587092_018549_392_655 87
1813 3300059512 Ga0587092_018979 Ga0587092_018979_416_679 87
1814 3300059512 Ga0587092_059847 Ga0587092_059847_396_659 87
1815 3300059512 Ga0587092_068463 Ga0587092_068463_158_421 87
1816 3300059513 Ga0587094_011702 Ga0587094_011702_395_658 87
1817 3300059513 Ga0587094_011731 Ga0587094_011731_409_678 87
1818 3300059513 Ga0587094_015062 Ga0587094_015062_388_651 87
1819 3300059513 Ga0587094_042831 Ga0587094_042831_392_655 87
1820 3300059513 Ga0587094_048216 Ga0587094_048216_271_534 87
1821 3300059605 Ga0587106_016966 Ga0587106_016966_321_584 87
1822 3300059622 Ga0587099_052941 Ga0587099_052941_94_357 87
1823 3300059623 Ga0587101_012756 Ga0587101_012756_395_658 87
1824 3300059623 Ga0587101_016802 Ga0587101_016802_149_445 87
1825 3300059623 Ga0587101_074705 Ga0587101_074705_47_310 87
1826 3300059624 Ga0587109_021646 Ga0587109_021646_481_750 87
1827 3300059624 Ga0587109_026887 Ga0587109_026887_392_655 87
1828 3300059625 Ga0587113_013642 Ga0587113_013642_211_474 87
1829 3300059627 Ga0587117_012797 Ga0587117_012797_386_649 87
1830 3300059627 Ga0587117_037718 Ga0587117_037718_407_676 87
1831 3300059627 Ga0587117_116841 Ga0587117_116841_180_443 87
1832 3300059630 Ga0587128_062755 Ga0587128_062755_415_678 87
1833 3300059639 Ga0587062_010226 Ga0587062_010226_402_671 87
1834 3300059639 Ga0587062_014582 Ga0587062_014582_364_627 87
1835 3300059639 Ga0587062_054262 Ga0587062_054262_393_656 87
1836 3300059640 Ga0587067_153745 Ga0587067_153745_178_441 87
1837 3300059640 Ga0587067_178204 Ga0587067_178204_211_474 87
1838 3300059640 Ga0587067_207238 Ga0587067_207238_75_338 87
1839 3300059641 Ga0587068_017065 Ga0587068_017065_481_750 87
1840 3300059641 Ga0587068_023389 Ga0587068_023389_395_658 87
1841 3300059641 Ga0587068_038071 Ga0587068_038071_370_633 87
1842 3300059641 Ga0587068_134448 Ga0587068_134448_111_374 87
1843 3300059641 Ga0587068_146471 Ga0587068_146471_141_404 87
1844 3300059642 Ga0587069_035533 Ga0587069_035533_395_658 87
1845 3300059642 Ga0587069_036082 Ga0587069_036082_499_762 87
1846 3300059642 Ga0587069_049941 Ga0587069_049941_403_672 87
1847 3300059642 Ga0587069_070499 Ga0587069_070499_334_597 87
1848 3300059644 Ga0587075_023790 Ga0587075_023790_205_468 87
1849 3300059645 Ga0587076_011742 Ga0587076_011742_481_750 87
1850 3300059645 Ga0587076_020677 Ga0587076_020677_432_695 87
1851 3300059645 Ga0587076_021299 Ga0587076_021299_395_658 87
1852 3300059645 Ga0587076_026948 Ga0587076_026948_372_635 87
1853 3300059645 Ga0587076_143709 Ga0587076_143709_272_535 87
1854 3300059646 Ga0587078_039675 Ga0587078_039675_131_394 87
1855 3300059647 Ga0587079_027669 Ga0587079_027669_391_654 87
1856 3300059647 Ga0587079_036081 Ga0587079_036081_274_537 87
1857 3300059647 Ga0587079_150577 Ga0587079_150577_293_556 87
1858 3300059652 Ga0587107_025126 Ga0587107_025126_413_676 87
1859 3300059655 Ga0587114_071116 Ga0587114_071116_153_416 87
1860 3300060344 Ga0587071_029041 Ga0587071_029041_409_672 87
1861 3300060344 Ga0587071_157343 Ga0587071_157343_51_314 87
1862 3300060346 Ga0587111_0094347 Ga0587111_0094347_64_327 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01084

Ribosomal_S18

Ribosomal protein S18

39

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d8k-assembly1.cif.gz_R yeast mitochondrial small subunit assembly intermediate (state 2) 0.9463 34 77
4v6a-assembly1.cif.gz_AR structure of ef-p bound to the 70s ribosome. 0.944 33 77
4lf7-assembly1.cif.gz_R crystal structure of 30s ribosomal subunit from thermus thermophilus 0.9435 33 78
4v48-assembly1.cif.gz_BR real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9388 32 78
7d6z-assembly1.cif.gz_y molecular model of the cryo-em structure of 70s ribosome in complex with peptide deformylase and trigger factor 0.9343 32 78
ID Description Score Start End Superfamily
5xyuR00 Few Secondary Structures;Irregular;30s Ribosomal Protein S18;Ribosomal protein S18 0.9233 32 78 4.10.640.10
2jl5R00 Few Secondary Structures;Irregular;30s Ribosomal Protein S18;Ribosomal protein S18 0.9214 33 78 4.10.640.10
2aw7R00 Few Secondary Structures;Irregular;30s Ribosomal Protein S18;Ribosomal protein S18 0.9168 33 78 4.10.640.10
4tp2R00 Few Secondary Structures;Irregular;30s Ribosomal Protein S18;Ribosomal protein S18 0.9116 32 78 4.10.640.10
2xfzR00 Few Secondary Structures;Irregular;30s Ribosomal Protein S18;Ribosomal protein S18 0.9091 33 78 4.10.640.10
ID Description Score Start End GO Terms
AF-A0A7V1H3A1-F1-model_v4 Small ribosomal subunit protein bS18 0.8901 18 78 GO:0003735
GO:0006412
GO:0022627
GO:0070181
AF-A0A833ALQ1-F1-model_v4 Small ribosomal subunit protein bS18 0.8828 16 78 GO:0003735
GO:0006412
GO:0022627
GO:0070181
AF-A0A2E7ZMQ0-F1-model_v4 Small ribosomal subunit protein bS18 0.8803 17 78 GO:0003735
GO:0006412
GO:0022627
GO:0070181
AF-A0A011NDR0-F1-model_v4 Small ribosomal subunit protein bS18 0.88 22 81 GO:0003735
GO:0006412
GO:0022627
GO:0070181
AF-A0A355Q4L8-F1-model_v4 Small ribosomal subunit protein bS18 0.8777 16 78 GO:0003735
GO:0006412
GO:0022627
GO:0070181

Feature Viewer

pLDDT pTM Quality
87.05 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map