metagRoot

F495912

General Info

Members	Datasets	Scaffolds	Average Seq Length
1861	793	1535	216

Family's Representative Sequence

Representative Sequence	3300005367\|Ga0070667_100000273\|Ga0070667_10000027317
Length	208
Sequence	MKFFVDTAATGLLDGVTTNPSLIAKSGRKFVEVIEEICGIVAGPVSAEVVALDHPTMMKEAAVLRKIASNVCIKVPLTIDGLKTCKALTDEGTMVNVTLCFSANQALLAAKAGASFISPFVGRHDDNGFDGMALIADIRQIYDNYDFGTEILVASVRHPIHVLESAKIGADVMTAPPAVIKSLFNHVLTEKGIQGFMADWAKTGQTII

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
3	2509276019	Ensifer aridi TW10	Isolate	Nodule
4	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
5	2510917021	Novosphingobium sp. AP12	Isolate	Rhizosphere
6	2511231027	Phyllobacterium sp. YR531	Isolate	Rhizosphere
7	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
8	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
9	2512564014	Sphingobium sp. AP49	Isolate	Rhizosphere
10	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
11	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
12	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
13	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
14	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
15	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
16	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
17	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
18	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
19	2513237351	Mesorhizobium alhagi CCNWXJ12-2	Isolate	Nodule
20	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
21	2516143018	Ensifer sp. BR816	Isolate	Nodule
22	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
23	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
24	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
25	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
26	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
27	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
28	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
29	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
30	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
31	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
32	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
33	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
34	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
35	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
36	2582581305	Rhizorhabdus wittichii YR128	Isolate	Rhizosphere
37	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
38	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
39	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
40	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
41	2599185359	Sphingomonas sp. NFR04	Isolate	Rhizoplane
42	2643221541	Sphingomonas sp. Root50	Isolate	Unclassified
43	2643221557	Ensifer sp. Root558	Isolate	Unclassified
44	2643221560	Sphingopyxis sp. Root1497	Isolate	Unclassified
45	2643221563	Sphingopyxis sp. Root154	Isolate	Unclassified
46	2643221591	Devosia sp. Root685	Isolate	Unclassified
47	2643221606	Sphingomonas sp. Root720	Isolate	Unclassified
48	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
49	2643221608	Sphingopyxis sp. Root214	Isolate	Unclassified
50	2643221610	Ensifer sp. Root74	Isolate	Unclassified
51	2643221618	Ensifer sp. Root231	Isolate	Unclassified
52	2643221623	Aminobacter sp. DSM 101952 Root100	Isolate	Unclassified
53	2643221626	Ensifer sp. Root31	Isolate	Unclassified
54	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
55	2643221637	Rhizobium sp. Root1212	Isolate	Unclassified
56	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
57	2643221659	Ensifer sp. Root127	Isolate	Unclassified
58	2643221668	Ensifer sp. Root423	Isolate	Unclassified
59	2643221671	Sphingomonas sp. Root1294	Isolate	Unclassified
60	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
61	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
62	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
63	2643221688	Rhizobium sp. Root482	Isolate	Unclassified
64	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
65	2643221698	Ensifer sp. Root142	Isolate	Unclassified
66	2643221712	Ensifer sp. Root258	Isolate	Unclassified
67	2643221718	Rhizobium sp. Root268	Isolate	Unclassified
68	2643221723	Ensifer sp. Root278	Isolate	Unclassified
69	2643221726	Ensifer sp. Root954	Isolate	Unclassified
70	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
71	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
72	2738541275	Novosphingobium sp. GV027	Isolate	Unclassified
73	2738541301	Novosphingobium sp. GV079	Isolate	Unclassified
74	2738541304	Novosphingobium sp. GV061	Isolate	Unclassified
75	2738543022	Novosphingobium sp. GV055	Isolate	Unclassified
76	2738543024	Aminobacter sp. AP02	Isolate	Unclassified
77	2738543033	Novosphingobium sp. GV064	Isolate	Unclassified
78	2739367664	Novosphingobium sp. GV002	Isolate	Unclassified
79	2739367865	Novosphingobium sp. GV013	Isolate	Unclassified
80	2751185800	Brucella pituitosa AA2	Isolate	Unclassified
81	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
82	2757320392	Phyllobacterium leguminum ORS 1419	Isolate	Nodule
83	2758568016	[Ochrobactrum] quorumnocens A44	Isolate	Rhizosphere
84	2765235802	Phyllobacterium bourgognense 31-25a	Isolate	Rhizoplane
85	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
86	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
87	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
88	2775507255	Sphingobium indicum B90A	Isolate	Rhizosphere
89	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
90	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
91	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
92	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
93	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
94	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
95	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
96	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
97	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
98	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
99	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
100	2808606401	Sphingobium sp. AEW010	Isolate	Rhizosphere
101	2808606404	Sphingobium sp. AEW013	Isolate	Rhizosphere
102	2808606405	Sphingobium sp. AEW001	Isolate	Rhizosphere
103	2818991438	Novosphingobium barchaimii 1192	Isolate	Unclassified
104	2818991466	Sphingomonas trueperi 1152a	Isolate	Unclassified
105	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
106	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
107	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
108	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
109	2840878972	Albibacillus kandeliae J95	Isolate	Rhizosphere
110	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
111	2842871566	Phyllobacterium sp. R-73111	Isolate	Unclassified
112	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
113	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
114	2848297114	Croceibacterium ferulae EGI 63111	Isolate	Unclassified
115	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
116	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
117	2852653556	Sphingopyxis sp. JAI108	Isolate	Rhizosphere
118	2852680915	Sphingopyxis sp. JAI128	Isolate	Rhizosphere
119	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
120	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
121	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
122	2857609550	Domibacillus sp. R-71929	Isolate	Unclassified
123	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
124	2874123672	Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1	Isolate	Nodule
125	2879163058	Sphingomonas pokkalii L3B27	Isolate	Rhizosphere
126	2880518877	Sphingobium sp. JAI105	Isolate	Rhizosphere
127	2882806704	Pelagerythrobacter rhizovicinus AY-3R	Isolate	Rhizosphere
128	2883577096	Roseococcus sp. SYP-B2431	Isolate	Rhizosphere
129	2895880812	Frankia sp. BMG5.11	Isolate	Unclassified
130	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
131	2904578770	Phyllobacterium sp. 586	Isolate	Unclassified
132	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
133	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
134	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
135	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
136	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
137	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
138	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
139	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
140	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
141	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
142	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
143	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
144	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
145	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
146	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
147	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
148	2919119836	Phyllobacterium sp. 1468	Isolate	Rhizosphere
149	2919138771	Novosphingobium sp. 1748	Isolate	Rhizosphere
150	2919679072	Pseudotabrizicola sp. 4114	Isolate	Unclassified
151	2919709256	Sphingobium xenophagum 4256	Isolate	Unclassified
152	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
153	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
154	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
155	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
156	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
157	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
158	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
159	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
160	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
161	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
162	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
163	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
164	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
165	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
166	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
167	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
168	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
169	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
170	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
171	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
172	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
173	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
174	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
175	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
176	2928100450	Novosphingobium sp. 1529	Isolate	Rhizosphere
177	2928521798	Phyllobacterium ifriqiyense 1451	Isolate	Rhizosphere
178	2928526807	Sphingomonas trueperi 1770	Isolate	Rhizosphere
179	2928959182	Novosphingobium capsulatum 1057	Isolate	Unclassified
180	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
181	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
182	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
183	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
184	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
185	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
186	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
187	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
188	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
189	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
190	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
191	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
192	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
193	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
194	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
195	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
196	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
197	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
198	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
199	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
200	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
201	2954011201	Phyllobacterium ifrigiyense W4I11	Isolate	Rhizosphere
202	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
203	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
204	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
205	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
206	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
207	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
208	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
209	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
210	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
211	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
212	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
213	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
214	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
215	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
216	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
217	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
218	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
219	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
220	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
221	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
222	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
223	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
224	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
225	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
226	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
227	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
228	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
229	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
230	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
231	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
232	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
233	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
234	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
235	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
236	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
237	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
238	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
239	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
240	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
241	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
242	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
243	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
244	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
245	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
246	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
247	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
248	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
249	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
250	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
251	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
252	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
253	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
254	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
255	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
256	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
257	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
258	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
259	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
260	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
261	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
262	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
263	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
264	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
265	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
266	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
267	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
268	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
269	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
270	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
271	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
272	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
273	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
274	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
275	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
276	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
277	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
278	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
279	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
280	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
281	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
282	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
283	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
284	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
285	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
286	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
287	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
288	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
289	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
290	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
291	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
292	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
293	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
294	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
295	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
296	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
297	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
298	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
299	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
300	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
301	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
302	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
303	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
304	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
305	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
306	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
307	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
308	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
309	3000405567	Rhodobacteraceae bacterium LNNU 3342	Isolate	Rhizosphere
310	3000865235	Altericroceibacterium indicum DSM 18604	Isolate	Rhizosphere
311	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
312	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
313	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
314	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
315	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
316	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
317	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
318	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
319	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
320	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
321	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
322	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
323	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
324	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
325	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
326	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
327	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
328	3300003371	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM	Metagenome	Rhizosphere
329	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
330	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
331	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
332	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
333	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
334	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
335	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
336	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
337	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
338	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
339	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
340	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
341	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
342	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
343	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
344	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
345	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
346	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
347	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
348	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
349	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
350	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
351	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
352	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
353	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
354	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
355	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
356	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
357	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
358	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
359	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
360	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
361	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
362	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
363	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
364	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
365	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
366	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
367	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
368	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
369	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
370	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
371	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
372	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
373	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
374	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
375	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
376	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
377	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
378	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
379	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
380	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
381	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
382	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
383	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
384	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
385	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
386	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
387	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
388	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
389	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
390	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
391	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
392	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
393	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
394	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
395	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
396	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
397	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
398	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
399	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
400	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
401	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
402	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
403	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
404	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
405	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
406	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
407	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
408	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
409	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
410	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
411	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
412	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
413	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
414	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
415	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
416	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
417	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
418	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
419	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
420	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
421	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
422	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
423	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
424	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
425	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
426	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
427	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
428	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
429	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
430	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
431	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
432	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
433	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
434	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
435	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
436	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
437	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
438	3300009978	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG	Metagenome	Rhizosphere
439	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
440	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
441	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
442	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
443	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
444	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
445	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
446	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
447	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
448	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
449	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
450	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
451	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
452	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
453	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
454	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
455	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
456	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
457	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
458	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
459	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
460	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
461	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
462	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
463	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
464	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
465	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
466	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
467	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
468	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
469	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
470	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
471	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
472	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
473	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
474	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
475	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
476	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
477	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
478	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
479	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
480	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
481	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
482	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
483	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
484	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
485	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
486	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
487	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
488	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
489	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
490	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
491	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
492	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
493	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
494	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
495	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
496	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
497	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
498	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
499	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
500	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
501	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
502	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
503	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
504	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
505	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
506	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
507	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
508	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
509	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
510	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
511	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
512	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
513	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
514	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
515	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
516	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
517	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
518	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
519	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
520	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
521	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
522	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
523	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
524	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
525	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
526	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
527	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
528	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
529	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
530	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
531	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
532	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
533	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
534	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
535	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
536	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
537	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
538	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
539	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
540	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
541	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
542	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
543	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
544	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
545	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
546	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
547	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
548	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
549	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
550	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
551	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
552	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
553	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
554	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
555	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
556	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
557	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
558	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
559	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
560	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
561	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
562	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
563	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
564	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
565	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
566	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
567	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
568	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
569	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
570	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
571	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
572	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
573	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
574	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
575	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
576	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
577	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
578	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
579	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
580	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
581	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
582	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
583	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
584	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
585	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
586	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
587	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
588	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
589	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
590	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
591	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
592	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
593	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
594	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
595	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
596	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
597	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
598	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
599	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
600	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
601	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
602	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
603	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
604	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
605	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
606	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
607	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
608	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
609	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
610	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
611	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
612	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
613	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
614	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
615	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
616	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
617	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
618	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
619	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
620	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
621	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
622	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
623	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
624	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
625	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
626	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
627	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
628	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
629	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
630	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
631	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
632	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
633	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
634	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
635	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
636	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
637	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
638	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
639	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
640	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
641	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
642	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
643	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
644	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
645	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
646	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
647	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
648	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
649	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
650	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
651	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
652	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
653	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
654	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
655	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
656	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
657	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
658	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
659	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
660	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
661	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
662	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
663	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
664	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
665	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
666	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
667	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
668	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
669	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
670	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
671	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
672	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
673	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
674	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
675	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
676	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
677	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
678	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
679	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
680	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
681	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
682	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
683	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
684	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
685	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
686	3300049517	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control	Metagenome	Rhizosphere
687	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
688	3300049530	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
689	3300049533	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
690	3300049550	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
691	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
692	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
693	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
694	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
695	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
696	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
697	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
698	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
699	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
700	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
701	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
702	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
703	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
704	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
705	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
706	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
707	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
708	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
709	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
710	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
711	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
712	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
713	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
714	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
715	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
716	3300049654	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control	Metagenome	Rhizosphere
717	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
718	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
719	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
720	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
721	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
722	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
723	3300049675	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control	Metagenome	Rhizosphere
724	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
725	3300049688	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought	Metagenome	Rhizosphere
726	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
727	3300049707	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought	Metagenome	Rhizosphere
728	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
729	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
730	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
731	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
732	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
733	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
734	3300049777	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control	Metagenome	Rhizosphere
735	3300049778	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control	Metagenome	Rhizosphere
736	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
737	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
738	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
739	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
740	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
741	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
742	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
743	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
744	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
745	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
746	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
747	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
748	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
749	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
750	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
751	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
752	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
753	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
754	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
755	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
756	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
757	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
758	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
759	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
760	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
761	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
762	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
763	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
764	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
765	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
766	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
767	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
768	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
769	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
770	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
771	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
772	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
773	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
774	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
775	3300053723	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere	Metagenome	Endosphere
776	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
777	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
778	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
779	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
780	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
781	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
782	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
783	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
784	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
785	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
786	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
787	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
788	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
789	8002285264	Aminobacter anthyllidis LMG 26462	Isolate	Nodule
790	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
791	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
792	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
793	8054302542	Novosphingobium kaempferiae Sx8-5	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	81.89
Metatranscriptomes	0.59
Isolates	17.52

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	7.9
Nodule	13
Rhizoplane	3.71
Rhizosphere	67.01
Stem	0
Stem Tuber	0
Unclassified	8.38

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_1557986	2162886007	Bacteria	3132
2	SwRhRL2b_contig_1688787	2162886007	Bacteria	29014
3	JGI24736J21556_1000056	3300001904	Bacteria	18329
4	JGI24736J21556_1001338	3300001904	Bacteria	4505
5	JGI24741J21665_1000749	3300001915	Bacteria	9761
6	JGI24752J21851_1000794	3300001976	Bacteria	4261
7	JGI24752J21851_1005077	3300001976	Bacteria	1722
8	JGI24752J21851_1008930	3300001976	Bacteria	1307
9	JGI24740J21852_10003497	3300001979	Bacteria	6886
10	JGI24740J21852_10096713	3300001979	Bacteria	755
11	JGI24739J22299_10017443	3300001989	Bacteria	2590
12	JGI24739J22299_10043529	3300001989	Bacteria	1484
13	JGI24739J22299_10069364	3300001989	Bacteria	1099
14	JGI24737J22298_10005958	3300001990	Bacteria	4186
15	JGI24737J22298_10009835	3300001990	Bacteria	3168
16	JGI24735J21928_10002656	3300002067	Bacteria	6181
17	JGI24750J21931_1000004	3300002070	Bacteria	25671
18	JGI24748J21848_1000044	3300002074	Bacteria	59119
19	JGI24738J21930_10001439	3300002075	Bacteria	6611
20	JGI24738J21930_10045506	3300002075	Bacteria	893
21	JGI24749J21850_1000089	3300002076	Bacteria	16491
22	JGI24034J26672_10000020	3300002239	Bacteria	122643
23	JGI24034J26672_10010406	3300002239	Bacteria	1382
24	JGI24742J22300_10012628	3300002244	Bacteria	1409
25	JGI24751J29686_10000048	3300002459	Bacteria	72524
26	JGI24751J29686_10000211	3300002459	Bacteria	24751
27	JGI24751J29686_10009126	3300002459	Bacteria	2036
28	JGI24751J29686_10009557	3300002459	Bacteria	1996
29	JGI24751J29686_10028069	3300002459	Bacteria	1169
30	JGI25151J46595_10048188	3300003187	Bacteria	1475
31	JGI25165J46597_1000351	3300003214	Bacteria	52020
32	JGI25160J50197_1000168	3300003354	Bacteria	56596
33	JGI26145J50221_1005738	3300003371	Bacteria	1027
34	JGI25161J50226_1001996	3300003374	Bacteria	5590
35	Ga0055526_1012082	3300003771	Bacteria	3809
36	Ga0055524_1015685	3300003775	Bacteria	2751
37	Ga0055536_1002841	3300003781	Bacteria	9536
38	Ga0055536_1005538	3300003781	Bacteria	6141
39	Ga0055536_1015198	3300003781	Bacteria	2649
40	Ga0055536_1019079	3300003781	Bacteria	2170
41	Ga0055530_10001551	3300003791	Bacteria	16496
42	Ga0055531_10000923	3300003794	Bacteria	23787
43	Ga0055531_10002091	3300003794	Bacteria	13717
44	Ga0055531_10027310	3300003794	Bacteria	2006
45	JGI25405J52794_10061385	3300003911	Bacteria	813
46	Ga0055543_1000229	3300004625	Bacteria	44446
47	Ga0065165_1000133	3300005262	Bacteria	128540
48	Ga0065165_1001460	3300005262	Bacteria	25510
49	Ga0065714_10176389	3300005288	Bacteria	981
50	Ga0065704_10000190	3300005289	Bacteria	213919
51	Ga0065704_10072226	3300005289	Bacteria	8906
52	Ga0065704_10072924	3300005289	Bacteria	7809
53	Ga0065704_10157746	3300005289	Bacteria	1378
54	Ga0065704_10201626	3300005289	Bacteria	1144
55	Ga0065715_10326847	3300005293	Bacteria	991
56	Ga0065707_10084485	3300005295	Bacteria	7154
57	Ga0065707_10087167	3300005295	Bacteria	5135
58	Ga0065707_10090929	3300005295	Bacteria	4036
59	Ga0065707_10115953	3300005295	Bacteria	2252
60	Ga0065707_10288602	3300005295	Bacteria	1029
61	Ga0070658_10000001	3300005327	Bacteria	856789
62	Ga0070658_10000389	3300005327	Bacteria	38156
63	Ga0070658_10017025	3300005327	Bacteria	5816
64	Ga0070658_10262717	3300005327	Bacteria	1466
65	Ga0070658_10269221	3300005327	Bacteria	1448
66	Ga0070658_10282611	3300005327	Bacteria	1413
67	Ga0070658_10377738	3300005327	Bacteria	1215
68	Ga0070676_10001496	3300005328	Bacteria	11830
69	Ga0070683_100538672	3300005329	Bacteria	1116
70	Ga0070690_100000180	3300005330	Bacteria	32463
71	Ga0070690_100332717	3300005330	Bacteria	1098
72	Ga0070670_100000012	3300005331	Bacteria	256314
73	Ga0070670_100000016	3300005331	Bacteria	226440
74	Ga0070670_100002488	3300005331	Bacteria	15189
75	Ga0070670_100007633	3300005331	Bacteria	9190
76	Ga0070670_100064947	3300005331	Bacteria	3131
77	Ga0068869_100300565	3300005334	Bacteria	1296
78	Ga0070666_10000027	3300005335	Bacteria	151010
79	Ga0070666_10001023	3300005335	Bacteria	17149
80	Ga0070666_10024790	3300005335	Bacteria	3910
81	Ga0070680_100005786	3300005336	Bacteria	9384
82	Ga0070680_100015139	3300005336	Bacteria	6041
83	Ga0070680_100618395	3300005336	Bacteria	930
84	Ga0070682_100017938	3300005337	Bacteria	4128
85	Ga0068868_100000752	3300005338	Bacteria	21953
86	Ga0068868_100104833	3300005338	Bacteria	2292
87	Ga0070660_100000322	3300005339	Bacteria	31658
88	Ga0070660_100000862	3300005339	Bacteria	20203
89	Ga0070660_100049245	3300005339	Bacteria	3239
90	Ga0070660_100055334	3300005339	Bacteria	3065
91	Ga0070660_100121834	3300005339	Bacteria	2082
92	Ga0070689_100221461	3300005340	Bacteria	1552
93	Ga0070689_100279205	3300005340	Bacteria	1385
94	Ga0070689_100497312	3300005340	Bacteria	1044
95	Ga0070689_100565924	3300005340	Bacteria	981
96	Ga0070691_10059236	3300005341	Bacteria	1840
97	Ga0070687_100165183	3300005343	Bacteria	1312
98	Ga0070661_100000189	3300005344	Bacteria	51018
99	Ga0070661_100005966	3300005344	Bacteria	8385
100	Ga0070661_100192103	3300005344	Bacteria	1557
101	Ga0070692_10000806	3300005345	Bacteria	10419
102	Ga0070668_100000123	3300005347	Bacteria	48192
103	Ga0070668_100000311	3300005347	Bacteria	32092
104	Ga0070668_100010654	3300005347	Bacteria	6837
105	Ga0070668_100029700	3300005347	Bacteria	4153
106	Ga0070668_100084281	3300005347	Bacteria	2496
107	Ga0070668_100102080	3300005347	Bacteria	2274
108	Ga0070668_100230973	3300005347	Bacteria	1529
109	Ga0070668_100269174	3300005347	Bacteria	1420
110	Ga0070668_100527387	3300005347	Bacteria	1025
111	Ga0070669_100000001	3300005353	Bacteria	537589
112	Ga0070669_100000041	3300005353	Bacteria	127426
113	Ga0070669_100000099	3300005353	Bacteria	85328
114	Ga0070669_100000127	3300005353	Bacteria	69910
115	Ga0070669_100000200	3300005353	Bacteria	52177
116	Ga0070669_100001690	3300005353	Bacteria	15986
117	Ga0070669_100026065	3300005353	Bacteria	4204
118	Ga0070669_100070225	3300005353	Bacteria	2588
119	Ga0070669_100081542	3300005353	Bacteria	2410
120	Ga0070669_100147036	3300005353	Bacteria	1822
121	Ga0070669_100236977	3300005353	Bacteria	1448
122	Ga0070669_100297993	3300005353	Bacteria	1296
123	Ga0070675_100052128	3300005354	Bacteria	3363
124	Ga0070675_100252669	3300005354	Bacteria	1543
125	Ga0070671_100000007	3300005355	Bacteria	250397
126	Ga0070671_100000030	3300005355	Bacteria	112182
127	Ga0070671_100000232	3300005355	Bacteria	37343
128	Ga0070671_100000732	3300005355	Bacteria	23496
129	Ga0070671_100019290	3300005355	Bacteria	5548
130	Ga0070671_100021460	3300005355	Bacteria	5273
131	Ga0070673_100098358	3300005364	Bacteria	2405
132	Ga0070673_100518716	3300005364	Bacteria	1080
133	Ga0070659_100000032	3300005366	Bacteria	120241
134	Ga0070659_100065020	3300005366	Bacteria	2888
135	Ga0070659_100065327	3300005366	Bacteria	2882
136	Ga0070659_100545779	3300005366	Bacteria	992
137	Ga0070667_100000024	3300005367	Bacteria	191216
138	Ga0070667_100000198	3300005367	Bacteria	71378
139	Ga0070667_100000273	3300005367	Bacteria	58596
140	Ga0070667_100000419	3300005367	Bacteria	45202
141	Ga0070667_100000670	3300005367	Bacteria	33199
142	Ga0070667_100001215	3300005367	Bacteria	23486
143	Ga0070667_100018104	3300005367	Bacteria	5840
144	Ga0070667_100029038	3300005367	Bacteria	4606
145	Ga0070667_100030696	3300005367	Bacteria	4482
146	Ga0070667_100066915	3300005367	Bacteria	3054
147	Ga0070667_100067013	3300005367	Bacteria	3051
148	Ga0070667_100070924	3300005367	Bacteria	2967
149	Ga0070667_100098169	3300005367	Bacteria	2527
150	Ga0070667_100236572	3300005367	Bacteria	1630
151	Ga0070667_100297249	3300005367	Bacteria	1453
152	Ga0070667_100368449	3300005367	Bacteria	1303
153	Ga0070667_100410284	3300005367	Bacteria	1234
154	Ga0070667_100911391	3300005367	Bacteria	818
155	Ga0070701_10016766	3300005438	Bacteria	3412
156	Ga0070705_100000119	3300005440	Bacteria	45310
157	Ga0070705_100051927	3300005440	Bacteria	2393
158	Ga0070705_100105573	3300005440	Bacteria	1789
159	Ga0070700_100002199	3300005441	Bacteria	9919
160	Ga0070708_100034871	3300005445	Bacteria	4381
161	Ga0070708_100358207	3300005445	Bacteria	1375
162	Ga0070708_100574866	3300005445	Bacteria	1063
163	Ga0070663_100001752	3300005455	Bacteria	12072
164	Ga0070663_100224827	3300005455	Bacteria	1475
165	Ga0070663_100500198	3300005455	Bacteria	1009
166	Ga0070678_100109921	3300005456	Bacteria	2155
167	Ga0070678_100136786	3300005456	Bacteria	1955
168	Ga0070662_100108111	3300005457	Bacteria	2115
169	Ga0070662_100263976	3300005457	Bacteria	1388
170	Ga0070681_10002329	3300005458	Bacteria	17371
171	Ga0070681_10062873	3300005458	Bacteria	3685
172	Ga0070685_10000238	3300005466	Bacteria	36209
173	Ga0070685_10124568	3300005466	Bacteria	1604
174	Ga0070707_100629646	3300005468	Bacteria	1035
175	Ga0070698_100416485	3300005471	Bacteria	1278
176	Ga0070698_101084409	3300005471	Bacteria	749
177	Ga0070699_100002098	3300005518	Bacteria	18046
178	Ga0070679_100000019	3300005530	Bacteria	127108
179	Ga0070679_100015293	3300005530	Bacteria	7373
180	Ga0070679_100049279	3300005530	Bacteria	4195
181	Ga0070684_100060777	3300005535	Bacteria	3306
182	Ga0070697_100162826	3300005536	Bacteria	1885
183	Ga0068853_100001057	3300005539	Bacteria	19447
184	Ga0068853_100012722	3300005539	Bacteria	6851
185	Ga0068853_100048244	3300005539	Bacteria	3657
186	Ga0068853_100252068	3300005539	Bacteria	1620
187	Ga0068853_100290940	3300005539	Bacteria	1508
188	Ga0068853_100584819	3300005539	Bacteria	1059
189	Ga0070686_100000010	3300005544	Bacteria	192116
190	Ga0070686_100000490	3300005544	Bacteria	23906
191	Ga0070686_100042784	3300005544	Bacteria	2839
192	Ga0070686_100059373	3300005544	Bacteria	2464
193	Ga0070686_100179494	3300005544	Bacteria	1503
194	Ga0070695_100000607	3300005545	Bacteria	19017
195	Ga0070695_100075134	3300005545	Bacteria	2222
196	Ga0070696_100009985	3300005546	Bacteria	6349
197	Ga0070696_100085009	3300005546	Bacteria	2245
198	Ga0070665_100000254	3300005548	Bacteria	88587
199	Ga0070665_100006633	3300005548	Bacteria	11765
200	Ga0070665_100030350	3300005548	Bacteria	5441
201	Ga0070665_100052465	3300005548	Bacteria	4090
202	Ga0070665_100072911	3300005548	Bacteria	3441
203	Ga0070665_100158115	3300005548	Bacteria	2268
204	Ga0070704_100009975	3300005549	Bacteria	5766
205	Ga0070704_100589438	3300005549	Bacteria	976
206	Ga0068855_100006131	3300005563	Bacteria	14659
207	Ga0068855_100034720	3300005563	Bacteria	6011
208	Ga0068855_100153171	3300005563	Bacteria	2620
209	Ga0068855_100168326	3300005563	Bacteria	2483
210	Ga0068855_100292817	3300005563	Bacteria	1804
211	Ga0068855_100705349	3300005563	Bacteria	1079
212	Ga0068855_100818865	3300005563	Bacteria	988
213	Ga0070664_100058822	3300005564	Bacteria	3269
214	Ga0070664_100267782	3300005564	Bacteria	1538
215	Ga0070664_100407974	3300005564	Bacteria	1243
216	Ga0070664_100558761	3300005564	Bacteria	1059
217	Ga0068857_100044211	3300005577	Bacteria	3950
218	Ga0068857_100076769	3300005577	Bacteria	2980
219	Ga0068857_100166171	3300005577	Bacteria	2004
220	Ga0068857_100287689	3300005577	Bacteria	1513
221	Ga0068857_100317317	3300005577	Bacteria	1439
222	Ga0068857_100327436	3300005577	Bacteria	1415
223	Ga0068857_100460888	3300005577	Bacteria	1189
224	Ga0068854_100001856	3300005578	Bacteria	12879
225	Ga0068854_100004954	3300005578	Bacteria	8393
226	Ga0068854_100006310	3300005578	Bacteria	7542
227	Ga0068854_100044440	3300005578	Bacteria	3153
228	Ga0068854_100129907	3300005578	Bacteria	1922
229	Ga0068854_100163281	3300005578	Bacteria	1727
230	Ga0068854_100445446	3300005578	Bacteria	1080
231	Ga0068854_101153238	3300005578	Bacteria	692
232	Ga0068856_100009109	3300005614	Bacteria	9650
233	Ga0068856_100019183	3300005614	Bacteria	6639
234	Ga0068856_100032811	3300005614	Bacteria	5085
235	Ga0068856_100110036	3300005614	Bacteria	2752
236	Ga0068856_100278731	3300005614	Bacteria	1689
237	Ga0068856_100560854	3300005614	Bacteria	1163
238	Ga0070702_100036806	3300005615	Bacteria	2714
239	Ga0068852_100003019	3300005616	Bacteria	11710
240	Ga0068852_100068666	3300005616	Bacteria	3103
241	Ga0068852_100081130	3300005616	Bacteria	2878
242	Ga0068852_100204024	3300005616	Bacteria	1872
243	Ga0068852_100213065	3300005616	Bacteria	1834
244	Ga0068859_100000222	3300005617	Bacteria	56119
245	Ga0068859_100000294	3300005617	Bacteria	49703
246	Ga0068859_100002268	3300005617	Bacteria	19507
247	Ga0068859_100022229	3300005617	Bacteria	6359
248	Ga0068859_100025761	3300005617	Bacteria	5899
249	Ga0068859_100051974	3300005617	Bacteria	4120
250	Ga0068859_100055919	3300005617	Bacteria	3971
251	Ga0068859_100134792	3300005617	Bacteria	2542
252	Ga0068859_100171135	3300005617	Bacteria	2253
253	Ga0068859_100255605	3300005617	Bacteria	1842
254	Ga0068859_100330351	3300005617	Bacteria	1619
255	Ga0068859_100619609	3300005617	Bacteria	1175
256	Ga0068864_100000010	3300005618	Bacteria	358723
257	Ga0068864_100000017	3300005618	Bacteria	285607
258	Ga0068864_100009428	3300005618	Bacteria	8056
259	Ga0068864_100026526	3300005618	Bacteria	4886
260	Ga0068864_100060052	3300005618	Bacteria	3291
261	Ga0068864_100084583	3300005618	Bacteria	2788
262	Ga0068864_100139625	3300005618	Bacteria	2185
263	Ga0068861_100000046	3300005719	Bacteria	56414
264	Ga0068861_100015706	3300005719	Bacteria	5342
265	Ga0068861_100016562	3300005719	Bacteria	5219
266	Ga0068861_100018517	3300005719	Bacteria	4961
267	Ga0068861_100635869	3300005719	Bacteria	984
268	Ga0068851_10029689	3300005834	Bacteria	2708
269	Ga0068851_10059004	3300005834	Bacteria	1962
270	Ga0068851_10140369	3300005834	Bacteria	1314
271	Ga0068851_10231449	3300005834	Bacteria	1042
272	Ga0068851_10243243	3300005834	Bacteria	1018
273	Ga0068851_10268597	3300005834	Bacteria	972
274	Ga0068870_10045372	3300005840	Bacteria	2301
275	Ga0068870_10184607	3300005840	Bacteria	1254
276	Ga0068863_100000018	3300005841	Bacteria	206948
277	Ga0068863_100000020	3300005841	Bacteria	198519
278	Ga0068863_100000082	3300005841	Bacteria	105688
279	Ga0068863_100000196	3300005841	Bacteria	64527
280	Ga0068863_100000775	3300005841	Bacteria	32088
281	Ga0068863_100002440	3300005841	Bacteria	18462
282	Ga0068863_100002504	3300005841	Bacteria	18262
283	Ga0068863_100071671	3300005841	Bacteria	3278
284	Ga0068863_100112414	3300005841	Bacteria	2594
285	Ga0068863_100212920	3300005841	Bacteria	1861
286	Ga0068863_100223777	3300005841	Bacteria	1813
287	Ga0068863_100657692	3300005841	Bacteria	1039
288	Ga0068858_100000530	3300005842	Bacteria	39968
289	Ga0068858_100012035	3300005842	Bacteria	8155
290	Ga0068858_100019373	3300005842	Bacteria	6363
291	Ga0068858_100020404	3300005842	Bacteria	6196
292	Ga0068858_100048778	3300005842	Bacteria	3922
293	Ga0068858_100072461	3300005842	Bacteria	3196
294	Ga0068858_100172457	3300005842	Bacteria	2040
295	Ga0068858_100581063	3300005842	Bacteria	1086
296	Ga0068860_100000008	3300005843	Bacteria	427367
297	Ga0068860_100000080	3300005843	Bacteria	170152
298	Ga0068860_100000269	3300005843	Bacteria	76230
299	Ga0068860_100000938	3300005843	Bacteria	32302
300	Ga0068860_100001501	3300005843	Bacteria	25173
301	Ga0068860_100002576	3300005843	Bacteria	18976
302	Ga0068860_100035390	3300005843	Bacteria	4789
303	Ga0068860_100056447	3300005843	Bacteria	3733
304	Ga0068860_100089367	3300005843	Bacteria	2933
305	Ga0068860_100108886	3300005843	Bacteria	2648
306	Ga0068860_100112794	3300005843	Bacteria	2599
307	Ga0068860_100166956	3300005843	Bacteria	2125
308	Ga0068860_100332652	3300005843	Bacteria	1492
309	Ga0068862_100000010	3300005844	Bacteria	285607
310	Ga0068862_100000016	3300005844	Bacteria	250031
311	Ga0068862_100000115	3300005844	Bacteria	94951
312	Ga0068862_100000236	3300005844	Bacteria	61275
313	Ga0068862_100000561	3300005844	Bacteria	38672
314	Ga0068862_100002041	3300005844	Bacteria	18258
315	Ga0068862_100003132	3300005844	Bacteria	14381
316	Ga0068862_100007340	3300005844	Bacteria	9155
317	Ga0068862_100024680	3300005844	Bacteria	5045
318	Ga0068862_100060831	3300005844	Bacteria	3246
319	Ga0068862_100108912	3300005844	Bacteria	2430
320	Ga0068862_100204331	3300005844	Bacteria	1782
321	Ga0068862_100415095	3300005844	Bacteria	1262
322	Ga0081455_10000545	3300005937	Bacteria	48941
323	Ga0081539_10009174	3300005985	Bacteria	8344
324	Ga0081539_10015931	3300005985	Bacteria	5416
325	Ga0075365_10021827	3300006038	Bacteria	4000
326	Ga0075365_10029436	3300006038	Bacteria	3510
327	Ga0075365_10053041	3300006038	Bacteria	2684
328	Ga0075365_10175865	3300006038	Bacteria	1495
329	Ga0075368_10000060	3300006042	Bacteria	26223
330	Ga0075368_10015017	3300006042	Bacteria	2867
331	Ga0075363_100008972	3300006048	Bacteria	4684
332	Ga0075363_100016644	3300006048	Bacteria	3635
333	Ga0075363_100020688	3300006048	Bacteria	3303
334	Ga0075363_100025410	3300006048	Bacteria	3021
335	Ga0075364_10005216	3300006051	Bacteria	7543
336	Ga0075364_10012828	3300006051	Bacteria	5140
337	Ga0075364_10062860	3300006051	Bacteria	2437
338	Ga0075432_10000355	3300006058	Bacteria	13147
339	Ga0075362_10000096	3300006177	Bacteria	24783
340	Ga0075362_10001731	3300006177	Bacteria	7084
341	Ga0075362_10009559	3300006177	Bacteria	3754
342	Ga0075367_10000630	3300006178	Bacteria	13498
343	Ga0075367_10001769	3300006178	Bacteria	9489
344	Ga0075367_10164371	3300006178	Bacteria	1381
345	Ga0075369_10002114	3300006186	Bacteria	7021
346	Ga0075369_10033849	3300006186	Bacteria	2167
347	Ga0075369_10077528	3300006186	Bacteria	1470
348	Ga0075366_10000425	3300006195	Bacteria	19753
349	Ga0075366_10098320	3300006195	Bacteria	1756
350	Ga0075366_10106059	3300006195	Bacteria	1689
351	Ga0097621_100116213	3300006237	Bacteria	2265
352	Ga0075370_10000003	3300006353	Bacteria	133163
353	Ga0075370_10012212	3300006353	Bacteria	4534
354	Ga0075370_10147531	3300006353	Bacteria	1378
355	Ga0075370_10285721	3300006353	Bacteria	980
356	Ga0068871_100022855	3300006358	Bacteria	4827
357	Ga0068871_100339466	3300006358	Bacteria	1326
358	Ga0075430_100131931	3300006846	Bacteria	2082
359	Ga0075431_100064416	3300006847	Bacteria	3785
360	Ga0075431_100264559	3300006847	Bacteria	1744
361	Ga0075433_10640689	3300006852	Bacteria	932
362	Ga0075434_100920711	3300006871	Bacteria	889
363	Ga0075429_100106194	3300006880	Bacteria	2453
364	Ga0075429_100117239	3300006880	Bacteria	2327
365	Ga0068865_100069669	3300006881	Bacteria	2489
366	Ga0068865_100315722	3300006881	Bacteria	1255
367	Ga0097620_100000222	3300006931	Bacteria	56119
368	Ga0097620_100000294	3300006931	Bacteria	49703
369	Ga0097620_100002268	3300006931	Bacteria	19507
370	Ga0097620_100022229	3300006931	Bacteria	6359
371	Ga0097620_100025761	3300006931	Bacteria	5899
372	Ga0097620_100051977	3300006931	Bacteria	4120
373	Ga0097620_100055918	3300006931	Bacteria	3971
374	Ga0097620_100134797	3300006931	Bacteria	2542
375	Ga0097620_100171129	3300006931	Bacteria	2253
376	Ga0097620_100255616	3300006931	Bacteria	1842
377	Ga0097620_100330333	3300006931	Bacteria	1619
378	Ga0097620_100619515	3300006931	Bacteria	1175
379	Ga0079104_1000183	3300006946	Bacteria	89496
380	Ga0079104_1000992	3300006946	Bacteria	21992
381	Ga0079104_1056242	3300006946	Bacteria	860
382	Ga0105251_10002397	3300009011	Bacteria	14810
383	Ga0105251_10005304	3300009011	Bacteria	8477
384	Ga0105251_10030194	3300009011	Bacteria	2724
385	Ga0105251_10049245	3300009011	Bacteria	2017
386	Ga0105251_10216211	3300009011	Bacteria	863
387	Ga0105250_10012137	3300009092	Bacteria	3564
388	Ga0105240_10002881	3300009093	Bacteria	27174
389	Ga0105240_10010741	3300009093	Bacteria	12846
390	Ga0105240_10016639	3300009093	Bacteria	9947
391	Ga0105240_10094436	3300009093	Bacteria	3648
392	Ga0105240_10136617	3300009093	Bacteria	2936
393	Ga0105240_10261534	3300009093	Bacteria	1996
394	Ga0105240_10341272	3300009093	Bacteria	1701
395	Ga0111539_10024146	3300009094	Bacteria	7465
396	Ga0111539_10586855	3300009094	Bacteria	1298
397	Ga0105245_10320627	3300009098	Bacteria	1526
398	Ga0105245_10566328	3300009098	Bacteria	1159
399	Ga0105245_11175393	3300009098	Bacteria	815
400	Ga0105247_10007248	3300009101	Bacteria	6810
401	Ga0105247_10020031	3300009101	Bacteria	4021
402	Ga0105247_10041107	3300009101	Bacteria	2828
403	Ga0105247_10068802	3300009101	Bacteria	2208
404	Ga0105247_10179814	3300009101	Bacteria	1411
405	Ga0105247_10198861	3300009101	Bacteria	1345
406	Ga0105247_10296319	3300009101	Bacteria	1120
407	Ga0114129_10029871	3300009147	Bacteria	7719
408	Ga0105243_10027709	3300009148	Bacteria	4343
409	Ga0105243_10197750	3300009148	Bacteria	1761
410	Ga0105241_10042303	3300009174	Bacteria	3446
411	Ga0105241_10180470	3300009174	Bacteria	1751
412	Ga0105241_10396049	3300009174	Bacteria	1210
413	Ga0105241_11020993	3300009174	Bacteria	775
414	Ga0105242_10343111	3300009176	Bacteria	1377
415	Ga0105242_10523420	3300009176	Bacteria	1132
416	Ga0105248_10000215	3300009177	Bacteria	66694
417	Ga0105248_10001231	3300009177	Bacteria	28569
418	Ga0105248_10002326	3300009177	Bacteria	21082
419	Ga0105248_10007162	3300009177	Bacteria	12236
420	Ga0105248_10016810	3300009177	Bacteria	8054
421	Ga0105248_10035124	3300009177	Bacteria	5608
422	Ga0105248_10071749	3300009177	Bacteria	3891
423	Ga0105248_10134206	3300009177	Bacteria	2793
424	Ga0105248_10202730	3300009177	Bacteria	2235
425	Ga0105248_10391159	3300009177	Bacteria	1565
426	Ga0105237_10058598	3300009545	Bacteria	3854
427	Ga0105237_10096672	3300009545	Bacteria	2944
428	Ga0105237_10159871	3300009545	Bacteria	2251
429	Ga0105237_10173109	3300009545	Bacteria	2159
430	Ga0105237_10179842	3300009545	Bacteria	2115
431	Ga0105238_10004082	3300009551	Bacteria	14483
432	Ga0105238_10081952	3300009551	Bacteria	3216
433	Ga0105238_10131536	3300009551	Bacteria	2480
434	Ga0105238_10156991	3300009551	Bacteria	2250
435	Ga0105238_10252022	3300009551	Bacteria	1744
436	Ga0105249_10000064	3300009553	Bacteria	151646
437	Ga0105249_10000244	3300009553	Bacteria	60263
438	Ga0105249_10000489	3300009553	Bacteria	36715
439	Ga0105249_10025940	3300009553	Bacteria	5278
440	Ga0105249_10049341	3300009553	Bacteria	3839
441	Ga0105249_10200296	3300009553	Bacteria	1953
442	Ga0105249_10201237	3300009553	Bacteria	1949
443	Ga0105249_10290767	3300009553	Bacteria	1635
444	Ga0105249_10454570	3300009553	Bacteria	1320
445	Ga0105148_100414	3300009978	Bacteria	4312
446	Ga0105239_10132871	3300010375	Bacteria	2769
447	Ga0105239_10179411	3300010375	Bacteria	2369
448	Ga0105239_10219656	3300010375	Bacteria	2131
449	Ga0105239_10240013	3300010375	Bacteria	2034
450	Ga0105239_10290950	3300010375	Bacteria	1839
451	Ga0105239_10510813	3300010375	Bacteria	1367
452	Ga0105239_10711593	3300010375	Bacteria	1149
453	Ga0105246_10295250	3300011119	Bacteria	1306
454	Ga0105246_10371629	3300011119	Bacteria	1178
455	Ga0157373_10112542	3300013100	Bacteria	1913
456	Ga0157373_10196794	3300013100	Bacteria	1421
457	Ga0157373_10205828	3300013100	Bacteria	1387
458	Ga0157373_10266256	3300013100	Bacteria	1213
459	Ga0157371_10010308	3300013102	Bacteria	7293
460	Ga0157371_10018320	3300013102	Bacteria	5179
461	Ga0157371_10165686	3300013102	Bacteria	1578
462	Ga0157371_10302910	3300013102	Bacteria	1157
463	Ga0157371_10323556	3300013102	Bacteria	1119
464	Ga0157371_10346820	3300013102	Bacteria	1080
465	Ga0157370_10008526	3300013104	Bacteria	11047
466	Ga0157370_10019603	3300013104	Bacteria	6776
467	Ga0157370_10042151	3300013104	Bacteria	4400
468	Ga0157370_10113455	3300013104	Bacteria	2533
469	Ga0157369_10001177	3300013105	Bacteria	32602
470	Ga0157369_10001892	3300013105	Bacteria	25239
471	Ga0157369_10012443	3300013105	Bacteria	9659
472	Ga0157369_10012700	3300013105	Bacteria	9553
473	Ga0157369_10017428	3300013105	Bacteria	8070
474	Ga0157369_10054347	3300013105	Bacteria	4325
475	Ga0157369_10081688	3300013105	Bacteria	3459
476	Ga0157369_10173990	3300013105	Bacteria	2267
477	Ga0171463_1004	3300013249	Bacteria	437207
478	Ga0157374_10029857	3300013296	Bacteria	4945
479	Ga0157374_10491344	3300013296	Bacteria	1231
480	Ga0157378_10396307	3300013297	Bacteria	1359
481	Ga0157378_11113360	3300013297	Bacteria	827
482	Ga0163162_10003521	3300013306	Bacteria	14979
483	Ga0163162_10032252	3300013306	Bacteria	5201
484	Ga0163162_10037677	3300013306	Bacteria	4826
485	Ga0163162_10321184	3300013306	Bacteria	1681
486	Ga0157372_10077500	3300013307	Bacteria	3754
487	Ga0157372_10081328	3300013307	Bacteria	3667
488	Ga0157372_10154004	3300013307	Bacteria	2654
489	Ga0157372_10373530	3300013307	Bacteria	1661
490	Ga0157372_11645488	3300013307	Bacteria	739
491	Ga0157375_10098321	3300013308	Bacteria	3003
492	Ga0157375_10586843	3300013308	Bacteria	1274
493	Ga0157375_10800404	3300013308	Bacteria	1091
494	Ga0163163_10016014	3300014325	Bacteria	6951
495	Ga0163163_10096613	3300014325	Bacteria	2975
496	Ga0163163_10103678	3300014325	Bacteria	2869
497	Ga0163163_10999347	3300014325	Bacteria	900
498	Ga0157380_10000086	3300014326	Bacteria	51604
499	Ga0157380_10000120	3300014326	Bacteria	43644
500	Ga0157380_10022685	3300014326	Bacteria	4731
501	Ga0157380_10058715	3300014326	Bacteria	3068
502	Ga0157380_10064619	3300014326	Bacteria	2938
503	Ga0157380_10207721	3300014326	Bacteria	1742
504	Ga0157380_10208304	3300014326	Bacteria	1740
505	Ga0157380_10345138	3300014326	Bacteria	1390
506	Ga0157380_10367134	3300014326	Bacteria	1353
507	Ga0157380_10476256	3300014326	Bacteria	1206
508	Ga0157380_10493005	3300014326	Bacteria	1188
509	Ga0157380_10758359	3300014326	Bacteria	983
510	Ga0157380_11185511	3300014326	Bacteria	807
511	Ga0157379_10002697	3300014968	Bacteria	14964
512	Ga0157379_10039739	3300014968	Bacteria	4197
513	Ga0157379_10063845	3300014968	Bacteria	3292
514	Ga0157379_10164262	3300014968	Bacteria	2004
515	Ga0157376_10667281	3300014969	Bacteria	1042
516	Ga0183363_1122	3300015690	Bacteria	20353
517	Ga0163161_10000110	3300017792	Bacteria	78102
518	Ga0163161_10008263	3300017792	Bacteria	7200
519	Ga0163161_10183416	3300017792	Bacteria	1606
520	Ga0163161_10185602	3300017792	Bacteria	1596
521	Ga0163161_10253754	3300017792	Bacteria	1372
522	Ga0197907_10060642	3300020069	Bacteria	914
523	Ga0206349_1077304	3300020075	Bacteria	880
524	Ga0206354_10699577	3300020081	Bacteria	4287
525	Ga0206353_10986306	3300020082	Bacteria	4248
526	Ga0214544_1002508	3300021320	Bacteria	38594
527	Ga0214542_1000008	3300021321	Bacteria	278895
528	Ga0214542_1019024	3300021321	Bacteria	5572
529	Ga0214543_1000031	3300021327	Bacteria	206436
530	Ga0214543_1000053	3300021327	Bacteria	141797
531	Ga0213873_10000007	3300021358	Bacteria	309961
532	Ga0213876_10000005	3300021384	Bacteria	727326
533	Ga0213876_10000332	3300021384	Bacteria	41214
534	Ga0213876_10021798	3300021384	Bacteria	3388
535	Ga0213876_10040362	3300021384	Bacteria	2465
536	Ga0213875_10000043	3300021388	Bacteria	152637
537	Ga0224712_10132250	3300022467	Bacteria	1091
538	Ga0228711_1000050	3300022739	Bacteria	81399
539	Ga0228710_1000063	3300022740	Bacteria	81399
540	Ga0209436_100736	3300025208	Bacteria	13649
541	Ga0209233_1000310	3300025261	Bacteria	56582
542	Ga0209565_1023619	3300025263	Bacteria	1262
543	Ga0209130_1000027	3300025284	Bacteria	327700
544	Ga0209675_1000184	3300025291	Bacteria	70175
545	Ga0209676_1000174	3300025292	Bacteria	153292
546	Ga0209676_1000246	3300025292	Bacteria	116315
547	Ga0209676_1000932	3300025292	Bacteria	35988
548	Ga0209676_1009932	3300025292	Bacteria	4033
549	Ga0209025_1000241	3300025294	Bacteria	128329
550	Ga0209025_1016415	3300025294	Bacteria	4372
551	Ga0209025_1032475	3300025294	Bacteria	2439
552	Ga0209564_1000111	3300025295	Bacteria	212210
553	Ga0209758_1080404	3300025297	Bacteria	988
554	Ga0209050_1000068	3300025298	Bacteria	298849
555	Ga0209050_1001213	3300025298	Bacteria	30197
556	Ga0209050_1040016	3300025298	Bacteria	1312
557	Ga0209256_1000132	3300025299	Bacteria	160806
558	Ga0209256_1000361	3300025299	Bacteria	73723
559	Ga0209256_1001681	3300025299	Bacteria	21438
560	Ga0207426_1000072	3300025302	Bacteria	327700
561	Ga0209051_1008097	3300025303	Bacteria	5620
562	Ga0209257_1000132	3300025304	Bacteria	210870
563	Ga0209257_1000169	3300025304	Bacteria	171227
564	Ga0209257_1001026	3300025304	Bacteria	37528
565	Ga0209257_1011053	3300025304	Bacteria	4425
566	Ga0207697_10000041	3300025315	Bacteria	48652
567	Ga0207697_10029068	3300025315	Bacteria	2261
568	Ga0207697_10095175	3300025315	Bacteria	1265
569	Ga0207656_10005239	3300025321	Bacteria	4568
570	Ga0207656_10026913	3300025321	Bacteria	2348
571	Ga0207656_10072562	3300025321	Bacteria	1533
572	Ga0207696_1005798	3300025711	Bacteria	5073
573	Ga0207713_1002993	3300025735	Bacteria	11810
574	Ga0207713_1012106	3300025735	Bacteria	4638
575	Ga0207713_1149252	3300025735	Bacteria	756
576	Ga0207653_10005411	3300025885	Bacteria	3992
577	Ga0207682_10003496	3300025893	Bacteria	6810
578	Ga0207682_10211545	3300025893	Bacteria	894
579	Ga0207710_10013548	3300025900	Bacteria	3430
580	Ga0207710_10030160	3300025900	Bacteria	2364
581	Ga0207710_10092772	3300025900	Bacteria	1415
582	Ga0207710_10182121	3300025900	Bacteria	1031
583	Ga0207680_10000009	3300025903	Bacteria	464571
584	Ga0207680_10004663	3300025903	Bacteria	6509
585	Ga0207680_10006477	3300025903	Bacteria	5662
586	Ga0207647_10000684	3300025904	Bacteria	26599
587	Ga0207647_10017454	3300025904	Bacteria	4878
588	Ga0207647_10034292	3300025904	Bacteria	3242
589	Ga0207647_10044401	3300025904	Bacteria	2777
590	Ga0207647_10083383	3300025904	Bacteria	1914
591	Ga0207647_10088910	3300025904	Bacteria	1844
592	Ga0207647_10154216	3300025904	Bacteria	1342
593	Ga0207645_10002747	3300025907	Bacteria	13707
594	Ga0207643_10017186	3300025908	Bacteria	3951
595	Ga0207643_10068905	3300025908	Bacteria	2032
596	Ga0207705_10000002	3300025909	Bacteria	2046852
597	Ga0207705_10000004	3300025909	Bacteria	705756
598	Ga0207705_10000101	3300025909	Bacteria	98231
599	Ga0207705_10071261	3300025909	Bacteria	2519
600	Ga0207705_10223126	3300025909	Bacteria	1432
601	Ga0207705_10288967	3300025909	Bacteria	1256
602	Ga0207705_10313682	3300025909	Bacteria	1204
603	Ga0207684_10177054	3300025910	Bacteria	1839
604	Ga0207654_10002488	3300025911	Bacteria	9359
605	Ga0207654_10052787	3300025911	Bacteria	2344
606	Ga0207707_10196156	3300025912	Bacteria	1761
607	Ga0207695_10003071	3300025913	Bacteria	23930
608	Ga0207695_10003145	3300025913	Bacteria	23572
609	Ga0207695_10010486	3300025913	Bacteria	11335
610	Ga0207695_10012466	3300025913	Bacteria	10204
611	Ga0207695_10018947	3300025913	Bacteria	7939
612	Ga0207695_10054054	3300025913	Bacteria	4197
613	Ga0207695_10336104	3300025913	Bacteria	1398
614	Ga0207671_10001965	3300025914	Bacteria	22681
615	Ga0207671_10030797	3300025914	Bacteria	3999
616	Ga0207671_10093164	3300025914	Bacteria	2272
617	Ga0207671_10134699	3300025914	Bacteria	1899
618	Ga0207671_10189092	3300025914	Bacteria	1605
619	Ga0207660_10000211	3300025917	Bacteria	37354
620	Ga0207660_10003076	3300025917	Bacteria	10904
621	Ga0207660_10154941	3300025917	Bacteria	1763
622	Ga0207662_10121883	3300025918	Bacteria	1636
623	Ga0207662_10252349	3300025918	Bacteria	1158
624	Ga0207657_10000601	3300025919	Bacteria	38257
625	Ga0207657_10009551	3300025919	Bacteria	9737
626	Ga0207657_10011456	3300025919	Bacteria	8805
627	Ga0207657_10020585	3300025919	Bacteria	6230
628	Ga0207657_10043161	3300025919	Bacteria	3974
629	Ga0207657_10056808	3300025919	Bacteria	3375
630	Ga0207657_10071057	3300025919	Bacteria	2948
631	Ga0207649_10000055	3300025920	Bacteria	103054
632	Ga0207649_10003307	3300025920	Bacteria	8820
633	Ga0207649_10790482	3300025920	Bacteria	740
634	Ga0207652_10000004	3300025921	Bacteria	436303
635	Ga0207652_10125648	3300025921	Bacteria	2284
636	Ga0207652_10219734	3300025921	Bacteria	1712
637	Ga0207652_10455790	3300025921	Bacteria	1153
638	Ga0207646_10021625	3300025922	Bacteria	5939
639	Ga0207681_10000002	3300025923	Bacteria	985597
640	Ga0207681_10000013	3300025923	Bacteria	357411
641	Ga0207681_10000106	3300025923	Bacteria	71721
642	Ga0207681_10000187	3300025923	Bacteria	50363
643	Ga0207681_10002411	3300025923	Bacteria	11878
644	Ga0207681_10004998	3300025923	Bacteria	8147
645	Ga0207681_10035146	3300025923	Bacteria	3300
646	Ga0207681_10064787	3300025923	Bacteria	2524
647	Ga0207681_10156431	3300025923	Bacteria	1713
648	Ga0207681_10197089	3300025923	Bacteria	1544
649	Ga0207681_10226040	3300025923	Bacteria	1450
650	Ga0207694_10004071	3300025924	Bacteria	11491
651	Ga0207694_10077182	3300025924	Bacteria	2610
652	Ga0207694_10102422	3300025924	Bacteria	2270
653	Ga0207694_10126630	3300025924	Bacteria	2044
654	Ga0207694_10136396	3300025924	Bacteria	1971
655	Ga0207694_10317942	3300025924	Bacteria	1284
656	Ga0207650_10000008	3300025925	Bacteria	498534
657	Ga0207650_10000196	3300025925	Bacteria	69604
658	Ga0207650_10012542	3300025925	Bacteria	5848
659	Ga0207650_10063140	3300025925	Bacteria	2769
660	Ga0207650_10322186	3300025925	Bacteria	1266
661	Ga0207650_10514953	3300025925	Bacteria	1001
662	Ga0207659_10031858	3300025926	Bacteria	3613
663	Ga0207659_10040891	3300025926	Bacteria	3245
664	Ga0207687_10002140	3300025927	Bacteria	13455
665	Ga0207687_11076690	3300025927	Bacteria	690
666	Ga0207644_10000002	3300025931	Bacteria	942221
667	Ga0207644_10000011	3300025931	Bacteria	223950
668	Ga0207644_10000025	3300025931	Bacteria	152401
669	Ga0207644_10000578	3300025931	Bacteria	23523
670	Ga0207644_10003436	3300025931	Bacteria	10238
671	Ga0207644_10031976	3300025931	Bacteria	3669
672	Ga0207644_10044046	3300025931	Bacteria	3169
673	Ga0207644_10102637	3300025931	Bacteria	2151
674	Ga0207644_10893406	3300025931	Bacteria	744
675	Ga0207690_10000001	3300025932	Bacteria	807539
676	Ga0207690_10005587	3300025932	Bacteria	7429
677	Ga0207690_10043558	3300025932	Bacteria	2954
678	Ga0207690_10068996	3300025932	Bacteria	2431
679	Ga0207706_10007566	3300025933	Bacteria	10048
680	Ga0207706_10090790	3300025933	Bacteria	2686
681	Ga0207706_10123155	3300025933	Bacteria	2281
682	Ga0207706_10140896	3300025933	Bacteria	2121
683	Ga0207706_10822891	3300025933	Bacteria	788
684	Ga0207709_10104202	3300025935	Bacteria	1882
685	Ga0207709_10244382	3300025935	Bacteria	1307
686	Ga0207709_10305790	3300025935	Bacteria	1184
687	Ga0207670_10092675	3300025936	Bacteria	2139
688	Ga0207670_10210884	3300025936	Bacteria	1481
689	Ga0207670_10242691	3300025936	Bacteria	1389
690	Ga0207669_10048639	3300025937	Bacteria	2521
691	Ga0207704_10032881	3300025938	Bacteria	2942
692	Ga0207704_10537857	3300025938	Bacteria	947
693	Ga0207691_10171810	3300025940	Bacteria	1898
694	Ga0207691_10278647	3300025940	Bacteria	1439
695	Ga0207711_10000031	3300025941	Bacteria	203323
696	Ga0207711_10002001	3300025941	Bacteria	18440
697	Ga0207711_10005829	3300025941	Bacteria	10407
698	Ga0207711_10016654	3300025941	Bacteria	6104
699	Ga0207711_10017455	3300025941	Bacteria	5962
700	Ga0207711_10102754	3300025941	Bacteria	2530
701	Ga0207711_10197071	3300025941	Bacteria	1837
702	Ga0207689_10073777	3300025942	Bacteria	2803
703	Ga0207689_10327575	3300025942	Bacteria	1272
704	Ga0207661_10412974	3300025944	Bacteria	1225
705	Ga0207679_10038735	3300025945	Bacteria	3399
706	Ga0207679_10231894	3300025945	Bacteria	1559
707	Ga0207679_11033710	3300025945	Bacteria	753
708	Ga0207667_10001563	3300025949	Bacteria	28840
709	Ga0207667_10014134	3300025949	Bacteria	9111
710	Ga0207667_10016908	3300025949	Bacteria	8229
711	Ga0207667_10031714	3300025949	Bacteria	5702
712	Ga0207667_10035304	3300025949	Bacteria	5363
713	Ga0207667_10055392	3300025949	Bacteria	4168
714	Ga0207667_10117136	3300025949	Bacteria	2745
715	Ga0207667_10156307	3300025949	Bacteria	2346
716	Ga0207667_10279985	3300025949	Bacteria	1704
717	Ga0207667_11261288	3300025949	Bacteria	717
718	Ga0207651_10096617	3300025960	Bacteria	2179
719	Ga0207651_10654462	3300025960	Bacteria	922
720	Ga0207651_10667745	3300025960	Bacteria	913
721	Ga0207712_10000044	3300025961	Bacteria	171240
722	Ga0207712_10000149	3300025961	Bacteria	72521
723	Ga0207712_10000550	3300025961	Bacteria	30264
724	Ga0207712_10004547	3300025961	Bacteria	8755
725	Ga0207712_10012890	3300025961	Bacteria	5350
726	Ga0207712_10019135	3300025961	Bacteria	4468
727	Ga0207712_10424280	3300025961	Bacteria	1123
728	Ga0207712_10483165	3300025961	Bacteria	1056
729	Ga0207712_10500321	3300025961	Bacteria	1039
730	Ga0207668_10000021	3300025972	Bacteria	137592
731	Ga0207668_10000085	3300025972	Bacteria	70401
732	Ga0207668_10001463	3300025972	Bacteria	13863
733	Ga0207668_10004580	3300025972	Bacteria	8131
734	Ga0207668_10004701	3300025972	Bacteria	8034
735	Ga0207668_10006338	3300025972	Bacteria	6996
736	Ga0207668_10110910	3300025972	Bacteria	2058
737	Ga0207668_10143367	3300025972	Bacteria	1840
738	Ga0207668_10170133	3300025972	Bacteria	1708
739	Ga0207668_10308252	3300025972	Bacteria	1309
740	Ga0207668_10336078	3300025972	Bacteria	1258
741	Ga0207668_10372254	3300025972	Bacteria	1200
742	Ga0207668_10460035	3300025972	Bacteria	1088
743	Ga0207668_10656640	3300025972	Bacteria	918
744	Ga0207640_10001358	3300025981	Bacteria	13259
745	Ga0207640_10001622	3300025981	Bacteria	12068
746	Ga0207640_10001696	3300025981	Bacteria	11807
747	Ga0207640_10015969	3300025981	Bacteria	4357
748	Ga0207640_10022787	3300025981	Bacteria	3754
749	Ga0207640_10054864	3300025981	Bacteria	2607
750	Ga0207640_10204444	3300025981	Bacteria	1499
751	Ga0207640_10273048	3300025981	Bacteria	1324
752	Ga0207640_10273057	3300025981	Bacteria	1324
753	Ga0207640_10978437	3300025981	Bacteria	743
754	Ga0207658_10000022	3300025986	Bacteria	191235
755	Ga0207658_10000221	3300025986	Bacteria	59789
756	Ga0207658_10000338	3300025986	Bacteria	46920
757	Ga0207658_10000443	3300025986	Bacteria	39002
758	Ga0207658_10001044	3300025986	Bacteria	22500
759	Ga0207658_10002864	3300025986	Bacteria	12353
760	Ga0207658_10004594	3300025986	Bacteria	9582
761	Ga0207658_10005503	3300025986	Bacteria	8681
762	Ga0207658_10043342	3300025986	Bacteria	3270
763	Ga0207658_10043992	3300025986	Bacteria	3249
764	Ga0207658_10099713	3300025986	Bacteria	2272
765	Ga0207658_10346174	3300025986	Bacteria	1293
766	Ga0207658_10961924	3300025986	Bacteria	778
767	Ga0207677_10000422	3300026023	Bacteria	28652
768	Ga0207677_10107049	3300026023	Bacteria	2073
769	Ga0207703_10003167	3300026035	Bacteria	13874
770	Ga0207703_10006514	3300026035	Bacteria	9318
771	Ga0207703_10032025	3300026035	Bacteria	4159
772	Ga0207703_10076414	3300026035	Bacteria	2778
773	Ga0207703_10184695	3300026035	Bacteria	1842
774	Ga0207703_10627392	3300026035	Bacteria	1018
775	Ga0207639_10002194	3300026041	Bacteria	13147
776	Ga0207639_10002874	3300026041	Bacteria	11566
777	Ga0207639_10005970	3300026041	Bacteria	8262
778	Ga0207639_10010464	3300026041	Bacteria	6426
779	Ga0207639_10012207	3300026041	Bacteria	5978
780	Ga0207639_10065912	3300026041	Bacteria	2812
781	Ga0207639_10128790	3300026041	Bacteria	2092
782	Ga0207639_10167166	3300026041	Bacteria	1859
783	Ga0207639_10314662	3300026041	Bacteria	1388
784	Ga0207639_10743364	3300026041	Bacteria	912
785	Ga0207678_10000853	3300026067	Bacteria	27956
786	Ga0207678_10005788	3300026067	Bacteria	11022
787	Ga0207678_10016703	3300026067	Bacteria	6446
788	Ga0207678_10020075	3300026067	Bacteria	5870
789	Ga0207678_10047741	3300026067	Bacteria	3702
790	Ga0207678_10185898	3300026067	Bacteria	1775
791	Ga0207708_10000550	3300026075	Bacteria	28982
792	Ga0207708_10642138	3300026075	Bacteria	903
793	Ga0207702_10001379	3300026078	Bacteria	24214
794	Ga0207702_10004365	3300026078	Bacteria	12607
795	Ga0207702_10012315	3300026078	Bacteria	7118
796	Ga0207702_10066033	3300026078	Bacteria	3100
797	Ga0207702_10126510	3300026078	Bacteria	2295
798	Ga0207702_10137210	3300026078	Bacteria	2208
799	Ga0207702_10164242	3300026078	Bacteria	2030
800	Ga0207702_11355968	3300026078	Bacteria	705
801	Ga0207641_10000001	3300026088	Bacteria	1180841
802	Ga0207641_10000002	3300026088	Bacteria	981004
803	Ga0207641_10000047	3300026088	Bacteria	179977
804	Ga0207641_10000139	3300026088	Bacteria	105740
805	Ga0207641_10000557	3300026088	Bacteria	41685
806	Ga0207641_10003469	3300026088	Bacteria	13968
807	Ga0207641_10003688	3300026088	Bacteria	13494
808	Ga0207641_10003978	3300026088	Bacteria	12899
809	Ga0207641_10007788	3300026088	Bacteria	8901
810	Ga0207641_10018708	3300026088	Bacteria	5679
811	Ga0207641_10040282	3300026088	Bacteria	3911
812	Ga0207641_10107642	3300026088	Bacteria	2466
813	Ga0207641_10165900	3300026088	Bacteria	2011
814	Ga0207676_10000005	3300026095	Bacteria	698744
815	Ga0207676_10000012	3300026095	Bacteria	353971
816	Ga0207676_10001536	3300026095	Bacteria	17029
817	Ga0207676_10003902	3300026095	Bacteria	10534
818	Ga0207676_10059674	3300026095	Bacteria	3014
819	Ga0207676_10066502	3300026095	Bacteria	2875
820	Ga0207676_10119760	3300026095	Bacteria	2217
821	Ga0207676_10325226	3300026095	Bacteria	1413
822	Ga0207674_10004313	3300026116	Bacteria	17140
823	Ga0207674_10007279	3300026116	Bacteria	12900
824	Ga0207674_10008215	3300026116	Bacteria	12097
825	Ga0207674_10016841	3300026116	Bacteria	7988
826	Ga0207674_10070213	3300026116	Bacteria	3521
827	Ga0207674_10107070	3300026116	Bacteria	2773
828	Ga0207674_10119176	3300026116	Bacteria	2608
829	Ga0207674_10165266	3300026116	Bacteria	2167
830	Ga0207674_10310025	3300026116	Bacteria	1527
831	Ga0207674_10462960	3300026116	Bacteria	1225
832	Ga0207675_100000122	3300026118	Bacteria	63834
833	Ga0207675_100000207	3300026118	Bacteria	54791
834	Ga0207675_100003225	3300026118	Bacteria	15997
835	Ga0207675_100174064	3300026118	Bacteria	2058
836	Ga0207675_100596644	3300026118	Bacteria	1107
837	Ga0207683_10263625	3300026121	Bacteria	1573
838	Ga0207698_10000177	3300026142	Bacteria	39133
839	Ga0207698_10010714	3300026142	Bacteria	5914
840	Ga0207698_10025015	3300026142	Bacteria	4198
841	Ga0207698_10044874	3300026142	Bacteria	3325
842	Ga0207698_10105807	3300026142	Bacteria	2345
843	Ga0207698_10344083	3300026142	Bacteria	1406
844	Ga0207698_10463093	3300026142	Bacteria	1226
845	Ga0209281_1000030	3300027111	Bacteria	425931
846	Ga0209281_1000295	3300027111	Bacteria	90994
847	Ga0209281_1001983	3300027111	Bacteria	9436
848	Ga0209281_1024107	3300027111	Bacteria	1146
849	Ga0209983_1033533	3300027665	Bacteria	1099
850	Ga0209983_1039177	3300027665	Bacteria	1023
851	Ga0209282_1000004	3300027666	Bacteria	425931
852	Ga0209813_10000021	3300027866	Bacteria	75014
853	Ga0209813_10000096	3300027866	Bacteria	32697
854	Ga0209813_10015570	3300027866	Bacteria	2063
855	Ga0209813_10025790	3300027866	Bacteria	1694
856	Ga0209813_10073837	3300027866	Bacteria	1114
857	Ga0209974_10021180	3300027876	Bacteria	2153
858	Ga0268266_10000069	3300028379	Bacteria	239714
859	Ga0268266_10000354	3300028379	Bacteria	70983
860	Ga0268266_10002635	3300028379	Bacteria	18935
861	Ga0268266_10028160	3300028379	Bacteria	4777
862	Ga0268266_10046502	3300028379	Bacteria	3715
863	Ga0268266_10053488	3300028379	Bacteria	3469
864	Ga0268266_10074969	3300028379	Bacteria	2938
865	Ga0268266_10118718	3300028379	Bacteria	2351
866	Ga0268266_10287221	3300028379	Bacteria	1531
867	Ga0268265_10000003	3300028380	Bacteria	949201
868	Ga0268265_10000006	3300028380	Bacteria	466482
869	Ga0268265_10000100	3300028380	Bacteria	108659
870	Ga0268265_10000428	3300028380	Bacteria	44880
871	Ga0268265_10000789	3300028380	Bacteria	30232
872	Ga0268265_10001727	3300028380	Bacteria	17651
873	Ga0268265_10002565	3300028380	Bacteria	13578
874	Ga0268265_10011065	3300028380	Bacteria	6096
875	Ga0268265_10021824	3300028380	Bacteria	4491
876	Ga0268265_10044474	3300028380	Bacteria	3307
877	Ga0268265_10047300	3300028380	Bacteria	3223
878	Ga0268265_10108239	3300028380	Bacteria	2262
879	Ga0268265_10432745	3300028380	Bacteria	1224
880	Ga0268264_10000018	3300028381	Bacteria	495324
881	Ga0268264_10000071	3300028381	Bacteria	267236
882	Ga0268264_10000131	3300028381	Bacteria	181459
883	Ga0268264_10000184	3300028381	Bacteria	131402
884	Ga0268264_10001197	3300028381	Bacteria	25051
885	Ga0268264_10008283	3300028381	Bacteria	8638
886	Ga0268264_10043247	3300028381	Bacteria	3732
887	Ga0268264_10056108	3300028381	Bacteria	3292
888	Ga0268264_10105213	3300028381	Bacteria	2461
889	Ga0268264_10138887	3300028381	Bacteria	2164
890	Ga0268264_10174093	3300028381	Bacteria	1949
891	Ga0268264_10194775	3300028381	Bacteria	1850
892	Ga0268264_10287928	3300028381	Bacteria	1542
893	Ga0307515_10000377	3300028794	Bacteria	109082
894	Ga0307515_10004005	3300028794	Bacteria	30754
895	Ga0265338_10002225	3300028800	Bacteria	29574
896	Ga0265330_10000050	3300031235	Bacteria	103087
897	Ga0265332_10001306	3300031238	Bacteria	14211
898	Ga0265320_10027303	3300031240	Bacteria	2978
899	Ga0265325_10026680	3300031241	Unclassified	3126
900	Ga0265329_10019381	3300031242	Unclassified	2311
901	Ga0265340_10052831	3300031247	Bacteria	1963
902	Ga0265340_10188979	3300031247	Bacteria	929
903	Ga0265331_10008335	3300031250	Bacteria	5901
904	Ga0265331_10052039	3300031250	Bacteria	1958
905	Ga0265327_10238403	3300031251	Bacteria	813
906	Ga0265316_10000238	3300031344	Bacteria	63443
907	Ga0265316_10169690	3300031344	Bacteria	1628
908	Ga0265316_10396584	3300031344	Bacteria	994
909	Ga0307513_10005946	3300031456	Bacteria	16016
910	Ga0307513_10029559	3300031456	Bacteria	6245
911	Ga0307408_100018749	3300031548	Bacteria	4649
912	Ga0307408_100022433	3300031548	Bacteria	4289
913	Ga0307408_100046710	3300031548	Bacteria	3097
914	Ga0307408_100088304	3300031548	Bacteria	2334
915	Ga0307408_100164072	3300031548	Bacteria	1767
916	Ga0307408_100191094	3300031548	Bacteria	1649
917	Ga0307408_100524312	3300031548	Bacteria	1041
918	Ga0307408_101122957	3300031548	Bacteria	730
919	Ga0265313_10053327	3300031595	Bacteria	1925
920	Ga0316575_10107306	3300031665	Bacteria	1138
921	Ga0265314_10000112	3300031711	Bacteria	124291
922	Ga0265314_10117321	3300031711	Bacteria	1682
923	Ga0265314_10236426	3300031711	Bacteria	1057
924	Ga0265342_10001741	3300031712	Bacteria	19869
925	Ga0265342_10385906	3300031712	Bacteria	725
926	Ga0316576_10199604	3300031727	Bacteria	1507
927	Ga0307405_10001537	3300031731	Bacteria	9770
928	Ga0307405_10004902	3300031731	Bacteria	6391
929	Ga0307405_10012236	3300031731	Bacteria	4533
930	Ga0307405_10103345	3300031731	Bacteria	1916
931	Ga0307405_10146728	3300031731	Bacteria	1653
932	Ga0307405_10198422	3300031731	Bacteria	1455
933	Ga0307405_10217534	3300031731	Bacteria	1399
934	Ga0307405_10233229	3300031731	Bacteria	1358
935	Ga0307405_10431046	3300031731	Bacteria	1040
936	Ga0307405_10436441	3300031731	Bacteria	1034
937	Ga0307413_10002752	3300031824	Bacteria	7231
938	Ga0307413_10005591	3300031824	Bacteria	5632
939	Ga0307413_10132503	3300031824	Bacteria	1708
940	Ga0307413_10302056	3300031824	Bacteria	1214
941	Ga0307413_10351181	3300031824	Bacteria	1138
942	Ga0307413_10733489	3300031824	Bacteria	824
943	Ga0307410_10003874	3300031852	Bacteria	7612
944	Ga0307410_10005467	3300031852	Bacteria	6730
945	Ga0307410_10006201	3300031852	Bacteria	6427
946	Ga0307410_10038711	3300031852	Bacteria	3125
947	Ga0307410_10041754	3300031852	Bacteria	3026
948	Ga0307410_10117229	3300031852	Bacteria	1936
949	Ga0307410_10340984	3300031852	Bacteria	1194
950	Ga0307410_10382111	3300031852	Bacteria	1133
951	Ga0307410_10433175	3300031852	Bacteria	1069
952	Ga0307410_10852901	3300031852	Bacteria	778
953	Ga0307406_10010001	3300031901	Bacteria	5336
954	Ga0307406_10030887	3300031901	Bacteria	3257
955	Ga0307406_10133407	3300031901	Bacteria	1747
956	Ga0307406_10137327	3300031901	Bacteria	1725
957	Ga0307406_10174354	3300031901	Bacteria	1559
958	Ga0307406_10218271	3300031901	Bacteria	1415
959	Ga0307406_10332974	3300031901	Bacteria	1179
960	Ga0307407_10011471	3300031903	Bacteria	4218
961	Ga0307407_10027744	3300031903	Bacteria	3018
962	Ga0307407_10074907	3300031903	Bacteria	2027
963	Ga0307407_10128090	3300031903	Bacteria	1620
964	Ga0307407_10237939	3300031903	Bacteria	1240
965	Ga0307412_10004881	3300031911	Bacteria	7492
966	Ga0307412_10005041	3300031911	Bacteria	7383
967	Ga0307412_10006903	3300031911	Bacteria	6441
968	Ga0307412_10009161	3300031911	Bacteria	5673
969	Ga0307412_10014182	3300031911	Bacteria	4694
970	Ga0307412_10070680	3300031911	Bacteria	2380
971	Ga0307412_10071362	3300031911	Bacteria	2370
972	Ga0307412_10103107	3300031911	Bacteria	2021
973	Ga0307412_10120999	3300031911	Bacteria	1884
974	Ga0307412_10160050	3300031911	Bacteria	1671
975	Ga0307412_10172012	3300031911	Bacteria	1620
976	Ga0307412_10215190	3300031911	Bacteria	1469
977	Ga0307412_10220488	3300031911	Bacteria	1453
978	Ga0307412_10287843	3300031911	Bacteria	1293
979	Ga0307412_10326305	3300031911	Bacteria	1223
980	Ga0307412_10402063	3300031911	Bacteria	1115
981	Ga0307412_10676361	3300031911	Bacteria	883
982	Ga0315914_1000001	3300031967	Bacteria	416633
983	Ga0307409_100004073	3300031995	Bacteria	8125
984	Ga0307409_100004490	3300031995	Bacteria	7853
985	Ga0307409_100061859	3300031995	Bacteria	2928
986	Ga0307409_100070637	3300031995	Bacteria	2772
987	Ga0307409_100092536	3300031995	Bacteria	2481
988	Ga0307409_100380876	3300031995	Bacteria	1341
989	Ga0307409_100420500	3300031995	Bacteria	1282
990	Ga0307409_100667466	3300031995	Bacteria	1035
991	Ga0307409_100727287	3300031995	Bacteria	994
992	Ga0307409_100871350	3300031995	Bacteria	912
993	Ga0307416_100021704	3300032002	Bacteria	4616
994	Ga0307416_100091449	3300032002	Bacteria	2613
995	Ga0307416_100139988	3300032002	Bacteria	2197
996	Ga0307416_100161772	3300032002	Bacteria	2070
997	Ga0307416_100272654	3300032002	Bacteria	1662
998	Ga0307416_100274683	3300032002	Bacteria	1657
999	Ga0307416_100393027	3300032002	Bacteria	1421
1000	Ga0307416_100405603	3300032002	Bacteria	1402
1001	Ga0307416_100461514	3300032002	Bacteria	1325
1002	Ga0307416_100540880	3300032002	Bacteria	1236
1003	Ga0307416_100549950	3300032002	Bacteria	1227
1004	Ga0307414_10000204	3300032004	Bacteria	39795
1005	Ga0307414_10000420	3300032004	Bacteria	22862
1006	Ga0307414_10021581	3300032004	Bacteria	4045
1007	Ga0307414_10025123	3300032004	Bacteria	3809
1008	Ga0307414_10034553	3300032004	Bacteria	3354
1009	Ga0307414_10054709	3300032004	Bacteria	2791
1010	Ga0307414_10075773	3300032004	Bacteria	2442
1011	Ga0307414_10131063	3300032004	Bacteria	1946
1012	Ga0307414_10167659	3300032004	Bacteria	1752
1013	Ga0307414_10177758	3300032004	Bacteria	1708
1014	Ga0307414_10275403	3300032004	Bacteria	1411
1015	Ga0307414_10294182	3300032004	Bacteria	1370
1016	Ga0307414_10342353	3300032004	Bacteria	1280
1017	Ga0307414_10418829	3300032004	Bacteria	1167
1018	Ga0307414_10643792	3300032004	Bacteria	955
1019	Ga0307414_10765169	3300032004	Bacteria	879
1020	Ga0307411_10000684	3300032005	Bacteria	12469
1021	Ga0307411_10003503	3300032005	Bacteria	7291
1022	Ga0307411_10003978	3300032005	Bacteria	6979
1023	Ga0307411_10085555	3300032005	Bacteria	2184
1024	Ga0307411_10126989	3300032005	Bacteria	1856
1025	Ga0307411_10172654	3300032005	Bacteria	1632
1026	Ga0307411_10345638	3300032005	Bacteria	1210
1027	Ga0307411_10432329	3300032005	Bacteria	1096
1028	Ga0307411_10853489	3300032005	Bacteria	806
1029	Ga0307415_100002358	3300032126	Bacteria	9392
1030	Ga0307415_100027841	3300032126	Bacteria	3586
1031	Ga0307415_100033282	3300032126	Bacteria	3345
1032	Ga0307415_100047678	3300032126	Bacteria	2885
1033	Ga0307415_100153234	3300032126	Bacteria	1777
1034	Ga0307415_100234066	3300032126	Bacteria	1481
1035	Ga0307415_100314041	3300032126	Bacteria	1304
1036	Ga0307415_100334029	3300032126	Bacteria	1269
1037	Ga0307415_100395678	3300032126	Bacteria	1178
1038	Ga0307415_100436897	3300032126	Bacteria	1128
1039	Ga0307510_10036797	3300033180	Bacteria	5444
1040	Ga0307510_10084916	3300033180	Bacteria	3046
1041	Ga0307510_10229170	3300033180	Bacteria	1362
1042	Ga0315913_1000024	3300033430	Bacteria	90863
1043	Ga0315915_1000002	3300033464	Bacteria	425854
1044	Ga0373941_0075547	3300035115	Bacteria	1128
1045	Ga0373955_0232407	3300035172	Bacteria	1103
1046	Ga0373931_0034705	3300035691	Bacteria	2619
1047	Ga0373937_0074974	3300036401	Bacteria	3123
1048	Ga0316582_0117706	3300036647	Bacteria	1775
1049	Ga0316584_0620695	3300036712	Bacteria	748
1050	Ga0373925_0523917	3300037068	Bacteria	974
1051	Ga0395899_0021460	3300037312	Bacteria	4899
1052	Ga0395899_0046848	3300037312	Bacteria	3219
1053	Ga0395899_0058238	3300037312	Bacteria	2850
1054	Ga0395899_0110839	3300037312	Bacteria	1973
1055	Ga0395899_0120923	3300037312	Bacteria	1876
1056	Ga0395900_0000056	3300037418	Bacteria	213077
1057	Ga0395900_0003576	3300037418	Bacteria	16706
1058	Ga0395900_0061906	3300037418	Bacteria	3847
1059	Ga0395900_0076608	3300037418	Bacteria	3437
1060	Ga0395900_0107472	3300037418	Bacteria	2866
1061	Ga0395900_0251375	3300037418	Bacteria	1769
1062	Ga0395900_0277045	3300037418	Bacteria	1670
1063	Ga0395900_0311822	3300037418	Bacteria	1556
1064	Ga0395900_0412586	3300037418	Bacteria	1312
1065	Ga0395898_0000114	3300037466	Bacteria	213068
1066	Ga0395898_0004254	3300037466	Bacteria	15703
1067	Ga0395898_0006820	3300037466	Bacteria	12144
1068	Ga0395898_0053516	3300037466	Bacteria	3942
1069	Ga0395898_0053702	3300037466	Bacteria	3935
1070	Ga0395898_0056597	3300037466	Bacteria	3822
1071	Ga0395898_0863938	3300037466	Bacteria	843
1072	Ga0395905_0000053	3300037471	Bacteria	213077
1073	Ga0395905_0006173	3300037471	Bacteria	12097
1074	Ga0395905_0664012	3300037471	Bacteria	944
1075	Ga0436364_0413139	3300037853	Bacteria	254582
1076	Ga0436364_1376717	3300037853	Bacteria	915
1077	Ga0395901_0000037	3300038443	Bacteria	213059
1078	Ga0395901_0005237	3300038443	Bacteria	13091
1079	Ga0395901_0023315	3300038443	Bacteria	6343
1080	Ga0395901_0045692	3300038443	Bacteria	4546
1081	Ga0395901_0046540	3300038443	Bacteria	4507
1082	Ga0395901_0059527	3300038443	Bacteria	3973
1083	Ga0395901_0144269	3300038443	Bacteria	2503
1084	Ga0395901_0300406	3300038443	Bacteria	1664
1085	Ga0395901_0423548	3300038443	Bacteria	1365
1086	Ga0400483_008249	3300039062	Bacteria	3225
1087	Ga0400483_017669	3300039062	Bacteria	11755
1088	Ga0400483_162951	3300039062	Bacteria	34224
1089	Ga0400483_231588	3300039062	Bacteria	2822
1090	Ga0400483_265059	3300039062	Bacteria	12189
1091	Ga0400483_278053	3300039062	Bacteria	1371
1092	Ga0436365_0010969	3300039437	Bacteria	175809
1093	Ga0436365_0352550	3300039437	Bacteria	74350
1094	Ga0436365_0651625	3300039437	Bacteria	21859
1095	Ga0436365_1449958	3300039437	Bacteria	3238
1096	Ga0436363_0105200	3300039450	Bacteria	786
1097	Ga0436362_0451893	3300039453	Bacteria	163419
1098	Ga0439436_0000865	3300041404	Bacteria	8268
1099	Ga0439436_0085954	3300041404	Bacteria	875
1100	Ga0439461_0076768	3300041410	Bacteria	782
1101	Ga0439466_0059865	3300041411	Bacteria	1229
1102	Ga0439465_0001683	3300041413	Bacteria	7215
1103	Ga0439465_0043414	3300041413	Bacteria	1459
1104	Ga0439465_0129456	3300041413	Bacteria	890
1105	Ga0451802_0633343	3300041460	Bacteria	976
1106	Ga0439432_096240	3300042006	Bacteria	888
1107	Ga0439449_0022203	3300042007	Bacteria	2375
1108	Ga0439449_0108600	3300042007	Bacteria	1027
1109	Ga0450920_010864	3300042122	Bacteria	1691
1110	Ga0450906_006482	3300042145	Bacteria	2363
1111	Ga0450909_006004	3300042185	Bacteria	1752
1112	Ga0439434_0020182	3300042435	Bacteria	2000
1113	Ga0450918_001164	3300042531	Bacteria	5395
1114	Ga0451577_0058360	3300042876	Bacteria	3440
1115	Ga0466966_0000010	3300044684	Bacteria	150868
1116	Ga0466966_0002854	3300044684	Bacteria	11375
1117	Ga0466961_0005066	3300044693	Bacteria	8289
1118	Ga0466963_0042941	3300044694	Bacteria	2970
1119	Ga0453684_0150924	3300044712	Bacteria	2762
1120	Ga0453684_0223984	3300044712	Bacteria	2176
1121	Ga0466971_0005161	3300044719	Bacteria	5653
1122	Ga0466970_0046274	3300044765	Bacteria	2317
1123	Ga0466957_0000272	3300044842	Bacteria	25068
1124	Ga0466959_0036925	3300045049	Bacteria	3609
1125	Ga0451576_0000023	3300045051	Bacteria	477965
1126	Ga0451576_0006550	3300045051	Bacteria	14252
1127	Ga0451576_0414838	3300045051	Bacteria	1412
1128	Ga0466958_0000445	3300045836	Bacteria	17129
1129	Ga0495627_002119	3300046453	Bacteria	10026
1130	Ga0495638_0000033	3300046460	Bacteria	288195
1131	Ga0495638_0016462	3300046460	Bacteria	4952
1132	Ga0495638_0084033	3300046460	Bacteria	1927
1133	Ga0495638_0261862	3300046460	Bacteria	948
1134	Ga0495650_0004291	3300046471	Bacteria	9845
1135	Ga0495596_0000207	3300046500	Bacteria	40468
1136	Ga0495596_0000730	3300046500	Bacteria	20234
1137	Ga0495607_0024796	3300046501	Bacteria	3735
1138	Ga0495583_0001255	3300046506	Bacteria	26748
1139	Ga0495606_0019701	3300046507	Bacteria	5006
1140	Ga0495610_0000018	3300046512	Bacteria	355044
1141	Ga0495610_0001536	3300046512	Bacteria	20324
1142	Ga0495610_0001795	3300046512	Bacteria	18710
1143	Ga0495610_0180340	3300046512	Bacteria	879
1144	Ga0495616_0000017	3300046513	Bacteria	167324
1145	Ga0495620_0072956	3300046515	Bacteria	1400
1146	Ga0495620_0079138	3300046515	Bacteria	1332
1147	Ga0495632_0001484	3300046519	Bacteria	19465
1148	Ga0495632_0004620	3300046519	Bacteria	9323
1149	Ga0495643_0004166	3300046522	Bacteria	10268
1150	Ga0495643_0021749	3300046522	Bacteria	3672
1151	Ga0495643_0041221	3300046522	Bacteria	2518
1152	Ga0495644_0121231	3300046523	Bacteria	995
1153	Ga0495648_0000014	3300046524	Bacteria	288365
1154	Ga0495663_0000735	3300046525	Bacteria	11246
1155	Ga0495654_0000224	3300046530	Bacteria	52709
1156	Ga0495654_0048028	3300046530	Bacteria	2096
1157	Ga0495598_0026609	3300046537	Bacteria	1587
1158	Ga0495609_0003837	3300046538	Bacteria	8458
1159	Ga0495621_0009324	3300046539	Bacteria	2976
1160	Ga0495597_0169486	3300046542	Bacteria	887
1161	Ga0495622_0001865	3300046557	Bacteria	10383
1162	Ga0495633_0023564	3300046558	Bacteria	3049
1163	Ga0495633_0144141	3300046558	Bacteria	1101
1164	Ga0495668_0000002	3300046616	Bacteria	763179
1165	Ga0495668_0001200	3300046616	Bacteria	26319
1166	Ga0495668_0006297	3300046616	Bacteria	7816
1167	Ga0495668_0041677	3300046616	Bacteria	2557
1168	Ga0495668_0085862	3300046616	Bacteria	1726
1169	Ga0495668_0154609	3300046616	Bacteria	1256
1170	Ga0495625_0000281	3300046660	Bacteria	79314
1171	Ga0495625_0043237	3300046660	Bacteria	3269
1172	Ga0495625_0063446	3300046660	Bacteria	2609
1173	Ga0495625_0374173	3300046660	Bacteria	895
1174	Ga0495669_0115111	3300046684	Bacteria	1258
1175	Ga0495671_0000019	3300046692	Bacteria	288186
1176	Ga0495671_0006805	3300046692	Bacteria	6568
1177	Ga0495671_0083335	3300046692	Bacteria	1567
1178	Ga0495671_0088932	3300046692	Bacteria	1512
1179	Ga0495589_0126160	3300046794	Bacteria	1231
1180	Ga0495636_0032133	3300047318	Bacteria	2153
1181	Ga0495677_0013496	3300047445	Bacteria	2975
1182	Ga0495673_0000042	3300047469	Bacteria	288018
1183	Ga0495681_0000792	3300047470	Bacteria	24336
1184	Ga0495686_0031715	3300047472	Bacteria	3424
1185	Ga0495686_0038094	3300047472	Bacteria	3076
1186	Ga0495615_0000189	3300048090	Bacteria	15013
1187	Ga0495626_0001070	3300048091	Bacteria	23377
1188	Ga0496100_0013760	3300048903	Bacteria	4679
1189	Ga0496100_0090575	3300048903	Bacteria	2086
1190	Ga0496101_0004345	3300048904	Bacteria	8895
1191	Ga0496101_0075461	3300048904	Bacteria	2482
1192	Ga0496101_0304211	3300048904	Bacteria	1249
1193	Ga0496102_0000043	3300048905	Bacteria	189201
1194	Ga0496102_0002267	3300048905	Bacteria	16445
1195	Ga0496102_0009621	3300048905	Bacteria	8312
1196	Ga0496102_0040621	3300048905	Bacteria	4209
1197	Ga0496102_0105129	3300048905	Bacteria	2627
1198	Ga0496102_0327545	3300048905	Bacteria	1443
1199	Ga0496103_0000086	3300048906	Bacteria	104765
1200	Ga0496103_0000984	3300048906	Bacteria	20114
1201	Ga0496103_0001691	3300048906	Bacteria	14424
1202	Ga0496103_0019211	3300048906	Bacteria	4103
1203	Ga0496103_0082459	3300048906	Bacteria	2024
1204	Ga0496103_0209669	3300048906	Bacteria	1253
1205	Ga0496104_0000111	3300048907	Bacteria	77461
1206	Ga0496104_0008591	3300048907	Bacteria	9085
1207	Ga0496104_0009219	3300048907	Bacteria	8772
1208	Ga0496104_0012409	3300048907	Bacteria	7662
1209	Ga0496104_0125274	3300048907	Bacteria	2467
1210	Ga0496105_0000253	3300048908	Bacteria	35958
1211	Ga0496105_0062819	3300048908	Bacteria	3064
1212	Ga0496105_0180852	3300048908	Bacteria	1727
1213	Ga0496105_0250107	3300048908	Bacteria	1436
1214	Ga0496105_0251424	3300048908	Bacteria	1432
1215	Ga0496105_0312052	3300048908	Bacteria	1262
1216	Ga0496106_0002120	3300048909	Bacteria	14839
1217	Ga0496106_0014116	3300048909	Bacteria	5901
1218	Ga0496106_0140165	3300048909	Bacteria	1901
1219	Ga0496107_0002330	3300048910	Bacteria	12258
1220	Ga0496107_0004104	3300048910	Bacteria	9811
1221	Ga0496107_0036704	3300048910	Bacteria	3515
1222	Ga0496108_0136690	3300048911	Bacteria	2109
1223	Ga0496108_0170527	3300048911	Bacteria	1883
1224	Ga0496108_0321397	3300048911	Bacteria	1349
1225	Ga0496109_0031851	3300048912	Bacteria	4736
1226	Ga0496109_0464930	3300048912	Bacteria	1195
1227	Ga0496110_0013292	3300048913	Bacteria	6800
1228	Ga0496110_0064028	3300048913	Bacteria	3249
1229	Ga0496110_0185147	3300048913	Bacteria	1891
1230	Ga0496110_0224915	3300048913	Bacteria	1707
1231	Ga0496111_0011464	3300048914	Bacteria	5972
1232	Ga0496111_0051475	3300048914	Bacteria	2973
1233	Ga0496111_0058281	3300048914	Bacteria	2796
1234	Ga0496111_0302488	3300048914	Bacteria	1186
1235	Ga0496111_0435653	3300048914	Bacteria	968
1236	Ga0496112_0010329	3300048915	Bacteria	8467
1237	Ga0496112_0108095	3300048915	Bacteria	2751
1238	Ga0496112_0116406	3300048915	Bacteria	2643
1239	Ga0496112_0283733	3300048915	Bacteria	1602
1240	Ga0496112_0407482	3300048915	Bacteria	1299
1241	Ga0496113_0005870	3300048916	Bacteria	7706
1242	Ga0496113_0044476	3300048916	Bacteria	3290
1243	Ga0496113_0060043	3300048916	Bacteria	2865
1244	Ga0496113_0785899	3300048916	Bacteria	757
1245	Ga0496114_0020714	3300048917	Bacteria	5338
1246	Ga0496114_0045791	3300048917	Bacteria	3635
1247	Ga0496114_0235989	3300048917	Bacteria	1607
1248	Ga0496114_0439095	3300048917	Bacteria	1156
1249	Ga0496115_0001232	3300048918	Bacteria	18383
1250	Ga0496115_0030599	3300048918	Bacteria	4236
1251	Ga0496115_0201653	3300048918	Bacteria	1643
1252	Ga0496116_0000028	3300048919	Bacteria	424086
1253	Ga0496116_0001567	3300048919	Bacteria	25245
1254	Ga0496116_0021480	3300048919	Bacteria	4867
1255	Ga0496116_0041726	3300048919	Bacteria	3145
1256	Ga0496116_0058088	3300048919	Bacteria	2524
1257	Ga0496117_0000104	3300048920	Bacteria	189201
1258	Ga0496117_0007404	3300048920	Bacteria	10739
1259	Ga0496117_0010122	3300048920	Bacteria	8659
1260	Ga0496117_0018112	3300048920	Bacteria	5855
1261	Ga0496117_0046532	3300048920	Bacteria	3119
1262	Ga0496117_0087022	3300048920	Bacteria	2027
1263	Ga0496117_0279264	3300048920	Bacteria	895
1264	Ga0496118_0000080	3300048921	Bacteria	189201
1265	Ga0496118_0001361	3300048921	Bacteria	36837
1266	Ga0496118_0008328	3300048921	Bacteria	10739
1267	Ga0496118_0017494	3300048921	Bacteria	6520
1268	Ga0496118_0037527	3300048921	Bacteria	3898
1269	Ga0496118_0055405	3300048921	Bacteria	2993
1270	Ga0496118_0089054	3300048921	Bacteria	2132
1271	Ga0496119_0000288	3300048922	Bacteria	70703
1272	Ga0496119_0015384	3300048922	Bacteria	5896
1273	Ga0496119_0023466	3300048922	Bacteria	4372
1274	Ga0496120_0006043	3300048923	Bacteria	9411
1275	Ga0496120_0112406	3300048923	Bacteria	1421
1276	Ga0496121_0000021	3300048924	Bacteria	478544
1277	Ga0496121_0001600	3300048924	Bacteria	37578
1278	Ga0496121_0002197	3300048924	Bacteria	30505
1279	Ga0496121_0017762	3300048924	Bacteria	7233
1280	Ga0496121_0148470	3300048924	Bacteria	1729
1281	Ga0496121_0233451	3300048924	Bacteria	1287
1282	Ga0496122_0000858	3300048925	Bacteria	57235
1283	Ga0496122_0002264	3300048925	Bacteria	27867
1284	Ga0496122_0003115	3300048925	Bacteria	22243
1285	Ga0496122_0058954	3300048925	Bacteria	2838
1286	Ga0496122_0079524	3300048925	Bacteria	2290
1287	Ga0496122_0150520	3300048925	Bacteria	1437
1288	Ga0496122_0208342	3300048925	Bacteria	1135
1289	Ga0496123_0001259	3300048926	Bacteria	36435
1290	Ga0496123_0001766	3300048926	Bacteria	28525
1291	Ga0496123_0001920	3300048926	Bacteria	27131
1292	Ga0496123_0007890	3300048926	Bacteria	9892
1293	Ga0496123_0089708	3300048926	Bacteria	1830
1294	Ga0496124_0000093	3300048927	Bacteria	189201
1295	Ga0496124_0009666	3300048927	Bacteria	9876
1296	Ga0496124_0016615	3300048927	Bacteria	6985
1297	Ga0496124_0020844	3300048927	Bacteria	6048
1298	Ga0496125_0003360	3300048928	Bacteria	19487
1299	Ga0496125_0009483	3300048928	Bacteria	9992
1300	Ga0496125_0022921	3300048928	Bacteria	5784
1301	Ga0496125_0027431	3300048928	Bacteria	5161
1302	Ga0496125_0052300	3300048928	Bacteria	3359
1303	Ga0496125_0056750	3300048928	Bacteria	3177
1304	Ga0496125_0077159	3300048928	Bacteria	2570
1305	Ga0496125_0081128	3300048928	Bacteria	2479
1306	Ga0496125_0174765	3300048928	Bacteria	1438
1307	Ga0496125_0192058	3300048928	Bacteria	1347
1308	Ga0496126_0000028	3300048929	Bacteria	394082
1309	Ga0496126_0000079	3300048929	Bacteria	222463
1310	Ga0496126_0007606	3300048929	Bacteria	11833
1311	Ga0496126_0019474	3300048929	Bacteria	6683
1312	Ga0496126_0054168	3300048929	Bacteria	3635
1313	Ga0496126_0125474	3300048929	Bacteria	2222
1314	Ga0496126_0330968	3300048929	Bacteria	1250
1315	Ga0501290_000062	3300049513	Bacteria	15054
1316	Ga0501290_003528	3300049513	Bacteria	1973
1317	Ga0501292_000029	3300049515	Bacteria	40489
1318	Ga0501294_001323	3300049517	Bacteria	2533
1319	Ga0501300_003443	3300049523	Bacteria	2367
1320	Ga0501314_008934	3300049530	Bacteria	913
1321	Ga0501317_019422	3300049533	Bacteria	907
1322	Ga0501334_06261	3300049550	Bacteria	800
1323	Ga0501031_0000064	3300049568	Bacteria	56925
1324	Ga0501031_0032735	3300049568	Bacteria	3390
1325	Ga0501031_0122571	3300049568	Bacteria	1698
1326	Ga0501032_0000006	3300049569	Bacteria	261727
1327	Ga0501032_0514560	3300049569	Bacteria	764
1328	Ga0501033_0000053	3300049570	Bacteria	109042
1329	Ga0501033_0048170	3300049570	Bacteria	3166
1330	Ga0501033_0489790	3300049570	Bacteria	851
1331	Ga0501034_0000030	3300049571	Bacteria	248180
1332	Ga0501034_0000046	3300049571	Bacteria	224049
1333	Ga0501034_0003639	3300049571	Bacteria	17459
1334	Ga0501034_0022255	3300049571	Bacteria	6460
1335	Ga0501034_0023831	3300049571	Bacteria	6233
1336	Ga0501034_0076912	3300049571	Bacteria	3344
1337	Ga0501034_0121607	3300049571	Bacteria	2597
1338	Ga0501034_0182284	3300049571	Bacteria	2064
1339	Ga0501036_0000003	3300049572	Bacteria	261545
1340	Ga0501036_0108631	3300049572	Bacteria	2345
1341	Ga0501037_0000003	3300049573	Bacteria	261548
1342	Ga0501037_0003482	3300049573	Bacteria	11420
1343	Ga0501037_0065062	3300049573	Bacteria	2657
1344	Ga0501037_0074292	3300049573	Bacteria	2470
1345	Ga0501038_0000004	3300049574	Bacteria	261289
1346	Ga0501038_0001831	3300049574	Bacteria	19685
1347	Ga0501038_0064642	3300049574	Bacteria	3119
1348	Ga0501038_0147521	3300049574	Bacteria	1920
1349	Ga0501039_0000008	3300049575	Bacteria	274778
1350	Ga0501039_0000311	3300049575	Bacteria	34420
1351	Ga0501039_0153709	3300049575	Bacteria	1808
1352	Ga0501039_0374228	3300049575	Bacteria	1119
1353	Ga0501040_0002088	3300049576	Bacteria	12872
1354	Ga0501040_0005395	3300049576	Bacteria	8273
1355	Ga0501040_0036448	3300049576	Bacteria	3338
1356	Ga0501040_0062718	3300049576	Bacteria	2557
1357	Ga0501041_0180557	3300049577	Bacteria	1321
1358	Ga0501041_0371884	3300049577	Bacteria	904
1359	Ga0501042_0002577	3300049578	Bacteria	11146
1360	Ga0501042_0045625	3300049578	Bacteria	3124
1361	Ga0501043_0000365	3300049579	Bacteria	40969
1362	Ga0501043_0028255	3300049579	Bacteria	4402
1363	Ga0501046_0003188	3300049580	Bacteria	15120
1364	Ga0501046_0003639	3300049580	Bacteria	14124
1365	Ga0501046_0071019	3300049580	Bacteria	2706
1366	Ga0501046_0103008	3300049580	Bacteria	2188
1367	Ga0501046_0167800	3300049580	Bacteria	1649
1368	Ga0501047_0000241	3300049581	Bacteria	64670
1369	Ga0501047_0001197	3300049581	Bacteria	25699
1370	Ga0501047_0108171	3300049581	Bacteria	2662
1371	Ga0501047_0128991	3300049581	Bacteria	2409
1372	Ga0501047_0492510	3300049581	Bacteria	1053
1373	Ga0501048_0000651	3300049582	Bacteria	24982
1374	Ga0501048_0053164	3300049582	Bacteria	2882
1375	Ga0501048_0132958	3300049582	Bacteria	1758
1376	Ga0501067_0001053	3300049583	Bacteria	14855
1377	Ga0501067_0004641	3300049583	Bacteria	7612
1378	Ga0501068_0036993	3300049584	Bacteria	2922
1379	Ga0501069_0003881	3300049585	Bacteria	7703
1380	Ga0501069_0103570	3300049585	Bacteria	1617
1381	Ga0501070_0004657	3300049586	Bacteria	11745
1382	Ga0501070_0009239	3300049586	Bacteria	8337
1383	Ga0501070_0126752	3300049586	Bacteria	2109
1384	Ga0501070_0132440	3300049586	Bacteria	2059
1385	Ga0501070_0220911	3300049586	Bacteria	1554
1386	Ga0501070_0434082	3300049586	Bacteria	1060
1387	Ga0501072_0736858	3300049588	Bacteria	774
1388	Ga0501073_0009730	3300049589	Bacteria	7079
1389	Ga0501073_0018554	3300049589	Bacteria	5030
1390	Ga0501073_0122765	3300049589	Bacteria	1800
1391	Ga0501074_0114503	3300049590	Bacteria	1929
1392	Ga0501074_0208747	3300049590	Bacteria	1391
1393	Ga0501075_0015713	3300049591	Bacteria	5439
1394	Ga0501075_0198108	3300049591	Bacteria	1532
1395	Ga0501076_0015335	3300049592	Bacteria	5790
1396	Ga0501076_0122515	3300049592	Bacteria	2106
1397	Ga0501076_0749309	3300049592	Bacteria	806
1398	Ga0501077_0077652	3300049593	Bacteria	2104
1399	Ga0501207_029545	3300049654	Bacteria	916
1400	Ga0501217_070585	3300049661	Bacteria	950
1401	Ga0501222_003433	3300049662	Bacteria	2164
1402	Ga0501223_000002	3300049663	Bacteria	154573
1403	Ga0501223_000487	3300049663	Bacteria	9592
1404	Ga0501223_002755	3300049663	Bacteria	3857
1405	Ga0501223_009848	3300049663	Bacteria	1929
1406	Ga0501224_000016	3300049664	Bacteria	86205
1407	Ga0501224_001795	3300049664	Bacteria	2885
1408	Ga0501233_025280	3300049668	Bacteria	1304
1409	Ga0501235_026484	3300049669	Bacteria	1299
1410	Ga0501243_025684	3300049675	Bacteria	989
1411	Ga0501257_000007	3300049686	Bacteria	54757
1412	Ga0501259_006721	3300049688	Bacteria	1834
1413	Ga0501225_0000444	3300049705	Bacteria	12894
1414	Ga0501225_0000716	3300049705	Bacteria	10432
1415	Ga0501225_0003234	3300049705	Bacteria	4973
1416	Ga0501225_0017916	3300049705	Bacteria	1965
1417	Ga0501225_0056210	3300049705	Bacteria	1101
1418	Ga0501234_001907	3300049707	Bacteria	3292
1419	Ga0501079_0006189	3300049741	Bacteria	8979
1420	Ga0501079_0204379	3300049741	Bacteria	1543
1421	Ga0501079_0301366	3300049741	Bacteria	1254
1422	Ga0501079_0722449	3300049741	Bacteria	784
1423	Ga0501080_0000052	3300049742	Bacteria	75093
1424	Ga0501080_0019942	3300049742	Bacteria	6208
1425	Ga0501080_0024836	3300049742	Bacteria	5557
1426	Ga0501080_0142433	3300049742	Bacteria	2216
1427	Ga0501080_0420915	3300049742	Bacteria	1200
1428	Ga0501081_0638596	3300049743	Bacteria	798
1429	Ga0501083_0009057	3300049744	Bacteria	7029
1430	Ga0501083_0078482	3300049744	Bacteria	2190
1431	Ga0501279_000002	3300049775	Bacteria	205937
1432	Ga0501280_000003	3300049776	Bacteria	93762
1433	Ga0501281_00109	3300049777	Bacteria	10044
1434	Ga0501282_000402	3300049778	Bacteria	5166
1435	Ga0501035_0000006	3300049822	Bacteria	369040
1436	Ga0501035_0000031	3300049822	Bacteria	175591
1437	Ga0501035_0000104	3300049822	Bacteria	105594
1438	Ga0501035_0004535	3300049822	Bacteria	13180
1439	Ga0501035_0174718	3300049822	Bacteria	1854
1440	Ga0501035_0238330	3300049822	Bacteria	1548
1441	Ga0501044_0000008	3300049823	Bacteria	274778
1442	Ga0501044_0000020	3300049823	Bacteria	213460
1443	Ga0501044_0064411	3300049823	Bacteria	3742
1444	Ga0501044_0147186	3300049823	Bacteria	2340
1445	Ga0501044_0187815	3300049823	Bacteria	2030
1446	Ga0501226_000020	3300049853	Bacteria	141193
1447	nmdc:mga03683_145_c1	3300050489	Bacteria	24140
1448	nmdc:mga03683_30_c1	3300050489	Bacteria	71765
1449	nmdc:mga03n38_121722_c1	3300050490	Bacteria	1283
1450	nmdc:mga03n38_155_c1	3300050490	Bacteria	7524
1451	nmdc:mga03n38_52865_c1	3300050490	Bacteria	1820
1452	nmdc:mga03n38_66692_c1	3300050490	Bacteria	1654
1453	nmdc:mga00v17_27055_c1	3300050491	Bacteria	3346
1454	nmdc:mga00v17_326940_c1	3300050491	Bacteria	996
1455	nmdc:mga00v17_4114_c1	3300050491	Bacteria	7532
1456	nmdc:mga0yw44_38084_c1	3300050492	Bacteria	2843
1457	nmdc:mga0yw44_40884_c1	3300050492	Bacteria	2758
1458	nmdc:mga0yw44_4389_c1	3300050492	Bacteria	6458
1459	nmdc:mga0yw44_474902_c1	3300050492	Bacteria	848
1460	nmdc:mga0yw44_57379_c1	3300050492	Bacteria	1927
1461	nmdc:mga0k408_3_c1	3300050493	Bacteria	243777
1462	nmdc:mga0k408_63843_c1	3300050493	Bacteria	2143
1463	nmdc:mga06z11_126_c1	3300050494	Bacteria	31251
1464	nmdc:mga06z11_182300_c1	3300050494	Bacteria	1211
1465	nmdc:mga06z11_22_c1	3300050494	Bacteria	69485
1466	nmdc:mga06z11_3088_c1	3300050494	Bacteria	6418
1467	nmdc:mga06z11_785_c1	3300050494	Bacteria	11597
1468	nmdc:mga04h51_1116_c2	3300050495	Bacteria	2384
1469	nmdc:mga04h51_163_c1	3300050495	Bacteria	19128
1470	nmdc:mga04h51_2040_c1	3300050495	Bacteria	4735
1471	nmdc:mga04h51_24145_c1	3300050495	Bacteria	1859
1472	nmdc:mga07m45_325901_c1	3300050496	Bacteria	893
1473	nmdc:mga07m45_49890_c1	3300050496	Bacteria	2357
1474	nmdc:mga07m45_4_c1	3300050496	Bacteria	409607
1475	nmdc:mga07m45_6_c1	3300050496	Bacteria	260521
1476	nmdc:mga05p37_45245_c1	3300050507	Bacteria	5415
1477	nmdc:mga09592_517704_c1	3300050508	Bacteria	1026
1478	nmdc:mga0qj67_168920_c1	3300050509	Bacteria	1776
1479	nmdc:mga0qj67_60645_c1	3300050509	Bacteria	3002
1480	nmdc:mga0qj67_809215_c1	3300050509	Bacteria	741
1481	nmdc:mga06r32_171553_c1	3300050510	Bacteria	2153
1482	nmdc:mga06r32_870925_c1	3300050510	Bacteria	858
1483	nmdc:mga08y16_64332_c1	3300050511	Bacteria	3830
1484	nmdc:mga0sz30_186_c1	3300050516	Bacteria	22840
1485	nmdc:mga0sz30_70841_c1	3300050516	Bacteria	1500
1486	nmdc:mga0sz30_790_c1	3300050516	Bacteria	11476
1487	Ga0500643_000375	3300053087	Bacteria	34881
1488	Ga0500643_000783	3300053087	Bacteria	20603
1489	Ga0500643_002356	3300053087	Bacteria	9866
1490	Ga0500646_0103702	3300053090	Bacteria	896
1491	Ga0500651_0002827	3300053093	Bacteria	9316
1492	Ga0500562_035667	3300053108	Bacteria	1318
1493	Ga0500592_001209	3300053116	Bacteria	4204
1494	Ga0500594_0005302	3300053118	Bacteria	2857
1495	Ga0500595_020001	3300053119	Bacteria	2418
1496	Ga0500607_000591	3300053121	Bacteria	34933
1497	Ga0500607_000654	3300053121	Bacteria	33328
1498	Ga0500608_001900	3300053122	Bacteria	7447
1499	Ga0500618_004920	3300053125	Bacteria	4148
1500	Ga0500618_010106	3300053125	Bacteria	2543
1501	Ga0500642_0008568	3300053130	Bacteria	3510
1502	Ga0500655_000037	3300053133	Bacteria	38087
1503	Ga0500559_0000300	3300053136	Bacteria	37885
1504	Ga0500559_0010893	3300053136	Bacteria	3897
1505	Ga0500564_000236	3300053138	Bacteria	15379
1506	Ga0500568_0000005	3300053139	Bacteria	614296
1507	Ga0500604_0147294	3300053151	Bacteria	798
1508	Ga0500616_0006756	3300053153	Bacteria	7437
1509	Ga0500616_0009010	3300053153	Bacteria	6114
1510	Ga0500616_0022520	3300053153	Bacteria	3517
1511	Ga0500616_0106097	3300053153	Bacteria	1365
1512	Ga0500622_0004929	3300053156	Bacteria	8141
1513	Ga0500624_000038	3300053157	Bacteria	93803
1514	Ga0500624_000042	3300053157	Bacteria	90289
1515	Ga0500627_0000015	3300053158	Bacteria	132947
1516	Ga0500627_0000105	3300053158	Bacteria	28056
1517	Ga0500627_0012150	3300053158	Bacteria	3215
1518	Ga0500636_0003715	3300053177	Bacteria	8614
1519	Ga0500637_0000047	3300053178	Bacteria	43949
1520	Ga0500567_011863	3300053723	Bacteria	4182
1521	Ga0500611_000864	3300053727	Bacteria	3157
1522	Ga0500625_000020	3300053729	Bacteria	90193
1523	Ga0500645_005183	3300053730	Bacteria	4855
1524	Ga0500596_011916	3300053735	Bacteria	1325
1525	Ga0501084_0014933	3300054114	Bacteria	6440
1526	Ga0587090_017505	3300059510	Bacteria	1084
1527	Ga0587072_026371	3300059643	Bacteria	1061
1528	Ga0587111_0039255	3300060346	Bacteria	1003
1529	Ga0501082_0008216	3300060353	Bacteria	9004
1530	Ga0501082_0151871	3300060353	Bacteria	2012
1531	Ga0501082_0166790	3300060353	Bacteria	1914
1532	Ga0501082_0771017	3300060353	Bacteria	842
1533	Ga0501082_0947832	3300060353	Bacteria	753
1534	Ga0466962_0002892	3300061719	Bacteria	8187
1535	Ga0530510_0130896	3300061734	Bacteria	1846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300027665	Ga0209983_1033533	Ga0209983_10335332	201
2	3300049570	Ga0501033_0048170	Ga0501033_0048170_30_734	206
3	3300025940	Ga0207691_10171810	Ga0207691_101718104	207
4	3300005367	Ga0070667_100000273	Ga0070667_10000027317	208
5	3300005841	Ga0068863_100002440	Ga0068863_1000024405	208
6	3300005843	Ga0068860_100000269	Ga0068860_10000026954	208
7	3300009177	Ga0105248_10391159	Ga0105248_103911591	208
8	3300025986	Ga0207658_10000338	Ga0207658_1000033824	208
9	3300026088	Ga0207641_10003469	Ga0207641_1000346910	208
10	3300028381	Ga0268264_10000184	Ga0268264_1000018475	208
11	3300002076	JGI24749J21850_1000089	JGI24749J21850_100008914	209
12	3300002459	JGI24751J29686_10000211	JGI24751J29686_100002117	209
13	3300005293	Ga0065715_10326847	Ga0065715_103268472	209
14	3300005295	Ga0065707_10084485	Ga0065707_100844856	209
15	3300005331	Ga0070670_100000012	Ga0070670_10000001240	209
16	3300005335	Ga0070666_10024790	Ga0070666_100247905	209
17	3300005340	Ga0070689_100565924	Ga0070689_1005659242	209
18	3300005353	Ga0070669_100000041	Ga0070669_10000004168	209
19	3300005367	Ga0070667_100001215	Ga0070667_1000012153	209
20	3300005544	Ga0070686_100179494	Ga0070686_1001794942	209
21	3300005617	Ga0068859_100002268	Ga0068859_10000226811	209
22	3300005617	Ga0068859_100134792	Ga0068859_1001347922	209
23	3300005618	Ga0068864_100000010	Ga0068864_100000010136	209
24	3300005719	Ga0068861_100016562	Ga0068861_1000165625	209
25	3300005841	Ga0068863_100071671	Ga0068863_1000716713	209
26	3300005841	Ga0068863_100112414	Ga0068863_1001124143	209
27	3300005843	Ga0068860_100000938	Ga0068860_1000009387	209
28	3300005844	Ga0068862_100000016	Ga0068862_10000001630	209
29	3300005844	Ga0068862_100000236	Ga0068862_10000023625	209
30	3300006353	Ga0075370_10012212	Ga0075370_100122123	209
31	3300006852	Ga0075433_10640689	Ga0075433_106406891	209
32	3300006871	Ga0075434_100920711	Ga0075434_1009207112	209
33	3300006931	Ga0097620_100002268	Ga0097620_1000022683	209
34	3300006931	Ga0097620_100134797	Ga0097620_1001347972	209
35	3300009101	Ga0105247_10007248	Ga0105247_100072483	209
36	3300009177	Ga0105248_10007162	Ga0105248_100071625	209
37	3300009553	Ga0105249_10000244	Ga0105249_1000024425	209
38	3300009553	Ga0105249_10454570	Ga0105249_104545703	209
39	3300013306	Ga0163162_10321184	Ga0163162_103211842	209
40	3300014325	Ga0163163_10999347	Ga0163163_109993471	209
41	3300014326	Ga0157380_10000120	Ga0157380_100001205	209
42	3300014326	Ga0157380_10367134	Ga0157380_103671342	209
43	3300025900	Ga0207710_10013548	Ga0207710_100135484	209
44	3300025923	Ga0207681_10000013	Ga0207681_10000013122	209
45	3300025925	Ga0207650_10000008	Ga0207650_10000008202	209
46	3300025936	Ga0207670_10242691	Ga0207670_102426912	209
47	3300025941	Ga0207711_10002001	Ga0207711_100020018	209
48	3300025961	Ga0207712_10000149	Ga0207712_1000014943	209
49	3300025986	Ga0207658_10002864	Ga0207658_100028643	209
50	3300026088	Ga0207641_10003978	Ga0207641_100039789	209
51	3300026088	Ga0207641_10040282	Ga0207641_100402821	209
52	3300026095	Ga0207676_10000012	Ga0207676_10000012195	209
53	3300026116	Ga0207674_10310025	Ga0207674_103100252	209
54	3300028380	Ga0268265_10000006	Ga0268265_10000006229	209
55	3300028380	Ga0268265_10000428	Ga0268265_1000042835	209
56	3300028381	Ga0268264_10001197	Ga0268264_1000119711	209
57	3300031456	Ga0307513_10029559	Ga0307513_100295595	209
58	3300046460	Ga0495638_0084033	Ga0495638_0084033_410_1060	209
59	3300048913	Ga0496110_0185147	Ga0496110_0185147_587_1237	209
60	3300048915	Ga0496112_0407482	Ga0496112_0407482_226_876	209
61	3300049585	Ga0501069_0003881	Ga0501069_0003881_5490_6143	209
62	3300059510	Ga0587090_017505	Ga0587090_017505_285_938	209
63	3300059643	Ga0587072_026371	Ga0587072_026371_221_874	209
64	iso_pu_bacteria	2857609550	2857610306	209
65	3300005618	Ga0068864_100026526	Ga0068864_1000265264	210
66	3300005841	Ga0068863_100002504	Ga0068863_1000025047	210
67	3300026088	Ga0207641_10000557	Ga0207641_1000055732	210
68	3300026095	Ga0207676_10001536	Ga0207676_1000153613	210
69	3300048925	Ga0496122_0058954	Ga0496122_0058954_195_848	210
70	3300005327	Ga0070658_10282611	Ga0070658_102826112	211
71	3300025909	Ga0207705_10288967	Ga0207705_102889673	211
72	3300037312	Ga0395899_0110839	Ga0395899_0110839_661_1356	211
73	3300037466	Ga0395898_0053516	Ga0395898_0053516_381_1076	211
74	3300038443	Ga0395901_0300406	Ga0395901_0300406_647_1342	211
75	3300025942	Ga0207689_10327575	Ga0207689_103275752	212
76	3300031911	Ga0307412_10014182	Ga0307412_100141825	212
77	3300032004	Ga0307414_10765169	Ga0307414_107651691	212
78	iso_pu_bacteria	2510917021	2511128002	212
79	iso_pu_bacteria	2643221560	2643819737	212
80	iso_pu_bacteria	2643221563	2643832912	212
81	iso_pu_bacteria	2643221608	2644053293	212
82	iso_pu_bacteria	2818991438	2819553023	212
83	iso_pu_bacteria	2852653556	2852656518	212
84	iso_pu_bacteria	2852680915	2852684763	212
85	iso_pu_bacteria	2882806704	2882807261	212
86	iso_pu_bacteria	2883577096	2883580946	212
87	iso_pu_bacteria	2895880812	2895885954	212
88	iso_pu_bacteria	2919138771	2919140183	212
89	iso_pu_bacteria	3000865235	3000866762	212
90	iso_pu_bacteria	8054302542	8054305751	212
91	3300005367	Ga0070667_100368449	Ga0070667_1003684492	213
92	3300005548	Ga0070665_100052465	Ga0070665_1000524652	213
93	3300005549	Ga0070704_100589438	Ga0070704_1005894382	213
94	3300025941	Ga0207711_10016654	Ga0207711_100166542	213
95	3300028381	Ga0268264_10194775	Ga0268264_101947752	213
96	3300035172	Ga0373955_0232407	Ga0373955_0232407_334_981	213
97	3300036401	Ga0373937_0074974	Ga0373937_0074974_1822_2469	213
98	3300060346	Ga0587111_0039255	Ga0587111_0039255_187_834	213
99	iso_pu_bacteria	2508501122	2509109458	213
100	iso_pu_bacteria	2509276019	2509378232	213
101	iso_pu_bacteria	2510065057	2510307635	213
102	iso_pu_bacteria	2511231027	2511388914	213
103	iso_pu_bacteria	2511231052	2511503189	213
104	iso_pu_bacteria	2512047086	2512534467	213
105	iso_pu_bacteria	2512564014	2512643755	213
106	iso_pu_bacteria	2512875026	2512973728	213
107	iso_pu_bacteria	2513237086	2513585201	213
108	iso_pu_bacteria	2513237089	2513601755	213
109	iso_pu_bacteria	2513237091	2513616940	213
110	iso_pu_bacteria	2513237140	2513884155	213
111	iso_pu_bacteria	2513237143	2513903484	213
112	iso_pu_bacteria	2513237156	2513984028	213
113	iso_pu_bacteria	2513237159	2513998575	213
114	iso_pu_bacteria	2513237160	2514003662	213
115	iso_pu_bacteria	2513237351	2514586782	213
116	iso_pu_bacteria	2515154107	2515610931	213
117	iso_pu_bacteria	2516143018	2516205471	213
118	iso_pu_bacteria	2516653046	2516894622	213
119	iso_pu_bacteria	2517487022	2517571270	213
120	iso_pu_bacteria	2524023207	2524453322	213
121	iso_pu_bacteria	2551306084	2551682783	213
122	iso_pu_bacteria	2551306085	2551687395	213
123	iso_pu_bacteria	2551306086	2551692761	213
124	iso_pu_bacteria	2551306087	2551700879	213
125	iso_pu_bacteria	2551306089	2551713160	213
126	iso_pu_bacteria	2551306090	2551719924	213
127	iso_pu_bacteria	2551306091	2551725002	213
128	iso_pu_bacteria	2551306092	2551736401	213
129	iso_pu_bacteria	2551306093	2551746602	213
130	iso_pu_bacteria	2558860100	2558867283	213
131	iso_pu_bacteria	2582581283	2585166811	213
132	iso_pu_bacteria	2582581305	2585262346	213
133	iso_pu_bacteria	2582581306	2585266837	213
134	iso_pu_bacteria	2582581865	2585387880	213
135	iso_pu_bacteria	2582581866	2585395975	213
136	iso_pu_bacteria	2599185352	2600193491	213
137	iso_pu_bacteria	2599185359	2600227361	213
138	iso_pu_bacteria	2643221541	2643730382	213
139	iso_pu_bacteria	2643221557	2643808182	213
140	iso_pu_bacteria	2643221591	2643966859	213
141	iso_pu_bacteria	2643221606	2644043551	213
142	iso_pu_bacteria	2643221607	2644051953	213
143	iso_pu_bacteria	2643221610	2644068629	213
144	iso_pu_bacteria	2643221618	2644110037	213
145	iso_pu_bacteria	2643221623	2644131451	213
146	iso_pu_bacteria	2643221626	2644150313	213
147	iso_pu_bacteria	2643221636	2644201491	213
148	iso_pu_bacteria	2643221637	2644209391	213
149	iso_pu_bacteria	2643221655	2644312917	213
150	iso_pu_bacteria	2643221659	2644336465	213
151	iso_pu_bacteria	2643221668	2644379616	213
152	iso_pu_bacteria	2643221671	2644393710	213
153	iso_pu_bacteria	2643221675	2644419698	213
154	iso_pu_bacteria	2643221680	2644453055	213
155	iso_pu_bacteria	2643221686	2644484405	213
156	iso_pu_bacteria	2643221688	2644492416	213
157	iso_pu_bacteria	2643221689	2644499864	213
158	iso_pu_bacteria	2643221698	2644546111	213
159	iso_pu_bacteria	2643221712	2644618647	213
160	iso_pu_bacteria	2643221718	2644652919	213
161	iso_pu_bacteria	2643221723	2644677208	213
162	iso_pu_bacteria	2643221726	2644688916	213
163	iso_pu_bacteria	2657244999	2657682536	213
164	iso_pu_bacteria	2657244999	2657685960	213
165	iso_pu_bacteria	2690316117	2692320194	213
166	iso_pu_bacteria	2738541275	2738709406	213
167	iso_pu_bacteria	2738541301	2738847831	213
168	iso_pu_bacteria	2738541304	2738863560	213
169	iso_pu_bacteria	2738543022	2739296078	213
170	iso_pu_bacteria	2738543024	2739306171	213
171	iso_pu_bacteria	2738543033	2739357756	213
172	iso_pu_bacteria	2739367664	2739651752	213
173	iso_pu_bacteria	2739367865	2740030226	213
174	iso_pu_bacteria	2751185800	2753360261	213
175	iso_pu_bacteria	2751185821	2753459061	213
176	iso_pu_bacteria	2757320392	2757570995	213
177	iso_pu_bacteria	2758568016	2758642581	213
178	iso_pu_bacteria	2765235802	2765467977	213
179	iso_pu_bacteria	2767802442	2770200187	213
180	iso_pu_bacteria	2775506902	2776269690	213
181	iso_pu_bacteria	2775506904	2776282619	213
182	iso_pu_bacteria	2775507255	2778124959	213
183	iso_pu_bacteria	2791355082	2792582112	213
184	iso_pu_bacteria	2791355091	2792622027	213
185	iso_pu_bacteria	2791355092	2792628716	213
186	iso_pu_bacteria	2791355094	2792641354	213
187	iso_pu_bacteria	2802428858	2802717364	213
188	iso_pu_bacteria	2802428859	2802724648	213
189	iso_pu_bacteria	2802428860	2802729400	213
190	iso_pu_bacteria	2802428861	2802736745	213
191	iso_pu_bacteria	2802428862	2802743150	213
192	iso_pu_bacteria	2802428863	2802749724	213
193	iso_pu_bacteria	2802429268	2804753573	213
194	iso_pu_bacteria	2802429268	2804755457	213
195	iso_pu_bacteria	2808606401	2809064283	213
196	iso_pu_bacteria	2808606404	2809080251	213
197	iso_pu_bacteria	2808606405	2809084615	213
198	iso_pu_bacteria	2818991466	2819715892	213
199	iso_pu_bacteria	2837651117	2837651228	213
200	iso_pu_bacteria	2838074704	2838078291	213
201	iso_pu_bacteria	2839993093	2839993251	213
202	iso_pu_bacteria	2840764183	2840766247	213
203	iso_pu_bacteria	2840878972	2840880660	213
204	iso_pu_bacteria	2842521101	2842524394	213
205	iso_pu_bacteria	2842871566	2842873848	213
206	iso_pu_bacteria	2844163670	2844164235	213
207	iso_pu_bacteria	2847417321	2847420708	213
208	iso_pu_bacteria	2848297114	2848298418	213
209	iso_pu_bacteria	2848992105	2848995539	213
210	iso_pu_bacteria	2850079185	2850082518	213
211	iso_pu_bacteria	2855825444	2855827248	213
212	iso_pu_bacteria	2855839649	2855842630	213
213	iso_pu_bacteria	2855872281	2855878066	213
214	iso_pu_bacteria	2858800743	2858803441	213
215	iso_pu_bacteria	2874123672	2874130232	213
216	iso_pu_bacteria	2879163058	2879163349	213
217	iso_pu_bacteria	2880518877	2880522149	213
218	iso_pu_bacteria	2896384573	2896387994	213
219	iso_pu_bacteria	2904578770	2904580100	213
220	iso_pu_bacteria	2913295892	2913300051	213
221	iso_pu_bacteria	2915980308	2915982580	213
222	iso_pu_bacteria	2915986958	2915991144	213
223	iso_pu_bacteria	2915993759	2915995401	213
224	iso_pu_bacteria	2916000859	2916001530	213
225	iso_pu_bacteria	2916007675	2916014643	213
226	iso_pu_bacteria	2916014648	2916019713	213
227	iso_pu_bacteria	2916021584	2916026711	213
228	iso_pu_bacteria	2916028427	2916033558	213
229	iso_pu_bacteria	2916035215	2916039664	213
230	iso_pu_bacteria	2916041962	2916046996	213
231	iso_pu_bacteria	2916048683	2916052813	213
232	iso_pu_bacteria	2916055098	2916059525	213
233	iso_pu_bacteria	2916061851	2916065133	213
234	iso_pu_bacteria	2916068649	2916075740	213
235	iso_pu_bacteria	2916076590	2916078276	213
236	iso_pu_bacteria	2919119836	2919120227	213
237	iso_pu_bacteria	2919679072	2919679510	213
238	iso_pu_bacteria	2919709256	2919712205	213
239	iso_pu_bacteria	2920760137	2920760472	213
240	iso_pu_bacteria	2920822456	2920825817	213
241	iso_pu_bacteria	2921201388	2921201656	213
242	iso_pu_bacteria	2921208531	2921209400	213
243	iso_pu_bacteria	2921237296	2921237757	213
244	iso_pu_bacteria	2921244191	2921248719	213
245	iso_pu_bacteria	2921250672	2921254659	213
246	iso_pu_bacteria	2921257292	2921262108	213
247	iso_pu_bacteria	2921257292	2921263253	213
248	iso_pu_bacteria	2921263974	2921270654	213
249	iso_pu_bacteria	2921289301	2921290039	213
250	iso_pu_bacteria	2921296804	2921298109	213
251	iso_pu_bacteria	2924144063	2924147746	213
252	iso_pu_bacteria	2924150972	2924156425	213
253	iso_pu_bacteria	2924158325	2924160205	213
254	iso_pu_bacteria	2924165586	2924170241	213
255	iso_pu_bacteria	2924172951	2924177595	213
256	iso_pu_bacteria	2924179722	2924181612	213
257	iso_pu_bacteria	2924186466	2924191560	213
258	iso_pu_bacteria	2924193448	2924195260	213
259	iso_pu_bacteria	2924200457	2924204817	213
260	iso_pu_bacteria	2924207177	2924209377	213
261	iso_pu_bacteria	2924214083	2924215275	213
262	iso_pu_bacteria	2924221636	2924222452	213
263	iso_pu_bacteria	2924228884	2924234424	213
264	iso_pu_bacteria	2928100450	2928102545	213
265	iso_pu_bacteria	2928521798	2928522901	213
266	iso_pu_bacteria	2928526807	2928529934	213
267	iso_pu_bacteria	2928959182	2928959369	213
268	iso_pu_bacteria	2936996657	2936997591	213
269	iso_pu_bacteria	2937002841	2937007575	213
270	iso_pu_bacteria	2937009748	2937013979	213
271	iso_pu_bacteria	2937016420	2937020917	213
272	iso_pu_bacteria	2937023124	2937024472	213
273	iso_pu_bacteria	2937023124	2937024748	213
274	iso_pu_bacteria	2937029754	2937033325	213
275	iso_pu_bacteria	2937036028	2937036062	213
276	iso_pu_bacteria	2937042894	2937043756	213
277	iso_pu_bacteria	2937049772	2937050486	213
278	iso_pu_bacteria	2937056579	2937061402	213
279	iso_pu_bacteria	2937063883	2937069197	213
280	iso_pu_bacteria	2937071275	2937076329	213
281	iso_pu_bacteria	2937078374	2937082377	213
282	iso_pu_bacteria	2937084907	2937085859	213
283	iso_pu_bacteria	2937091812	2937097261	213
284	iso_pu_bacteria	2937098957	2937106402	213
285	iso_pu_bacteria	2937106411	2937106797	213
286	iso_pu_bacteria	2937113482	2937116430	213
287	iso_pu_bacteria	2937119839	2937121764	213
288	iso_pu_bacteria	2937126314	2937127859	213
289	iso_pu_bacteria	2941499720	2941501230	213
290	iso_pu_bacteria	2954011201	2954013733	213
291	iso_pu_bacteria	2957375807	2957378869	213
292	iso_pu_bacteria	2957382221	2957383831	213
293	iso_pu_bacteria	2957382221	2957385841	213
294	iso_pu_bacteria	2957388812	2957391501	213
295	iso_pu_bacteria	2957395598	2957396443	213
296	iso_pu_bacteria	2957395598	2957400656	213
297	iso_pu_bacteria	2957402308	2957403966	213
298	iso_pu_bacteria	2957402308	2957406128	213
299	iso_pu_bacteria	2957408893	2957409875	213
300	iso_pu_bacteria	2957415311	2957420526	213
301	iso_pu_bacteria	2957422303	2957424490	213
302	iso_pu_bacteria	2957430029	2957435939	213
303	iso_pu_bacteria	2957437181	2957439723	213
304	iso_pu_bacteria	2957443900	2957449083	213
305	iso_pu_bacteria	2957450854	2957457422	213
306	iso_pu_bacteria	2957457609	2957462803	213
307	iso_pu_bacteria	2957464669	2957467522	213
308	iso_pu_bacteria	2957471148	2957472341	213
309	iso_pu_bacteria	2957478035	2957482502	213
310	iso_pu_bacteria	2957484790	2957485780	213
311	iso_pu_bacteria	2957491536	2957493708	213
312	iso_pu_bacteria	2957498199	2957498622	213
313	iso_pu_bacteria	2957505466	2957510721	213
314	iso_pu_bacteria	2960584000	2960584711	213
315	iso_pu_bacteria	2960591022	2960594946	213
316	iso_pu_bacteria	2960597568	2960599367	213
317	iso_pu_bacteria	2960603979	2960609037	213
318	iso_pu_bacteria	2960610863	2960612149	213
319	iso_pu_bacteria	2960617483	2960618197	213
320	iso_pu_bacteria	2960624210	2960629940	213
321	iso_pu_bacteria	2960631154	2960634733	213
322	iso_pu_bacteria	2960637947	2960638756	213
323	iso_pu_bacteria	2960645483	2960650737	213
324	iso_pu_bacteria	2960652885	2960655423	213
325	iso_pu_bacteria	2960660292	2960665744	213
326	iso_pu_bacteria	2960667422	2960672056	213
327	iso_pu_bacteria	2960674078	2960677997	213
328	iso_pu_bacteria	2960680706	2960684308	213
329	iso_pu_bacteria	2960687367	2960693703	213
330	iso_pu_bacteria	2960693952	2960696658	213
331	iso_pu_bacteria	2964607997	2964609660	213
332	iso_pu_bacteria	2964615318	2964619712	213
333	iso_pu_bacteria	2964615318	2964620919	213
334	iso_pu_bacteria	2964621998	2964626242	213
335	iso_pu_bacteria	2964628898	2964630481	213
336	iso_pu_bacteria	2964636051	2964641164	213
337	iso_pu_bacteria	2964643177	2964645275	213
338	iso_pu_bacteria	2964649959	2964652716	213
339	iso_pu_bacteria	2964656573	2964662356	213
340	iso_pu_bacteria	2964663802	2964666269	213
341	iso_pu_bacteria	2964670856	2964672161	213
342	iso_pu_bacteria	2964678106	2964678284	213
343	iso_pu_bacteria	2964685014	2964686803	213
344	iso_pu_bacteria	2964691889	2964696583	213
345	iso_pu_bacteria	2964698721	2964702180	213
346	iso_pu_bacteria	2964705432	2964712560	213
347	iso_pu_bacteria	2964712639	2964713083	213
348	iso_pu_bacteria	2964719344	2964720198	213
349	iso_pu_bacteria	2967664464	2967666575	213
350	iso_pu_bacteria	2967671571	2967673604	213
351	iso_pu_bacteria	2967678726	2967684852	213
352	iso_pu_bacteria	2967686174	2967689141	213
353	iso_pu_bacteria	2967693043	2967695510	213
354	iso_pu_bacteria	2967699805	2967703055	213
355	iso_pu_bacteria	2967706974	2967713929	213
356	iso_pu_bacteria	2967714385	2967719119	213
357	iso_pu_bacteria	2967721400	2967727164	213
358	iso_pu_bacteria	2967728569	2967731961	213
359	iso_pu_bacteria	2967735183	2967736776	213
360	iso_pu_bacteria	2967742019	2967742840	213
361	iso_pu_bacteria	2967748971	2967749908	213
362	iso_pu_bacteria	2967755722	2967756105	213
363	iso_pu_bacteria	2967755722	2967757917	213
364	iso_pu_bacteria	2967762386	2967769325	213
365	iso_pu_bacteria	2967769361	2967773812	213
366	iso_pu_bacteria	2967775926	2967778509	213
367	iso_pu_bacteria	2970019648	2970020150	213
368	iso_pu_bacteria	2970026789	2970029957	213
369	iso_pu_bacteria	2970033650	2970038858	213
370	iso_pu_bacteria	2970040964	2970045704	213
371	iso_pu_bacteria	2970047711	2970052389	213
372	iso_pu_bacteria	2970054988	2970060940	213
373	iso_pu_bacteria	2970061556	2970062329	213
374	iso_pu_bacteria	2970068827	2970069324	213
375	iso_pu_bacteria	2970076120	2970082352	213
376	iso_pu_bacteria	2970082768	2970086405	213
377	iso_pu_bacteria	2970088815	2970093971	213
378	iso_pu_bacteria	2970095765	2970101794	213
379	iso_pu_bacteria	2970102677	2970103876	213
380	iso_pu_bacteria	2970102677	2970106855	213
381	iso_pu_bacteria	2970109326	2970111465	213
382	iso_pu_bacteria	2970116247	2970122238	213
383	iso_pu_bacteria	2970122695	2970125887	213
384	iso_pu_bacteria	2970129317	2970131919	213
385	iso_pu_bacteria	2970136068	2970137336	213
386	iso_pu_bacteria	2970143518	2970143752	213
387	iso_pu_bacteria	2970149975	2970154426	213
388	iso_pu_bacteria	2970156795	2970157829	213
389	iso_pu_bacteria	2970164137	2970168943	213
390	iso_pu_bacteria	2970170962	2970176819	213
391	iso_pu_bacteria	2970177841	2970180198	213
392	iso_pu_bacteria	2970184632	2970189624	213
393	iso_pu_bacteria	2970191845	2970196903	213
394	iso_pu_bacteria	2977516862	2977522976	213
395	iso_pu_bacteria	2977523885	2977524535	213
396	iso_pu_bacteria	2977530762	2977534645	213
397	iso_pu_bacteria	2977537788	2977542374	213
398	iso_pu_bacteria	2977544691	2977549140	213
399	iso_pu_bacteria	2977551784	2977553332	213
400	iso_pu_bacteria	2977558990	2977559622	213
401	iso_pu_bacteria	2977565890	2977569273	213
402	iso_pu_bacteria	2977572785	2977579447	213
403	iso_pu_bacteria	2977579622	2977585456	213
404	iso_pu_bacteria	3000405567	3000409239	213
405	iso_pu_bacteria	643692032	643827305	213
406	iso_pu_bacteria	648276728	648737070	213
407	iso_pu_bacteria	8002285264	8002290664	213
408	iso_pu_bacteria	8003992118	8003995212	213
409	iso_pu_bacteria	8003999396	8004002929	213
410	iso_pu_bacteria	8049293176	8049296141	213
411	3300005336	Ga0070680_100618395	Ga0070680_1006183952	214
412	3300005530	Ga0070679_100015293	Ga0070679_1000152935	214
413	3300005535	Ga0070684_100060777	Ga0070684_1000607774	214
414	3300005563	Ga0068855_100705349	Ga0068855_1007053492	214
415	3300005577	Ga0068857_100327436	Ga0068857_1003274363	214
416	3300005614	Ga0068856_100019183	Ga0068856_1000191834	214
417	3300009094	Ga0111539_10586855	Ga0111539_105868551	214
418	3300009176	Ga0105242_10523420	Ga0105242_105234202	214
419	3300009545	Ga0105237_10179842	Ga0105237_101798424	214
420	3300010375	Ga0105239_10510813	Ga0105239_105108132	214
421	3300025904	Ga0207647_10154216	Ga0207647_101542162	214
422	3300025914	Ga0207671_10093164	Ga0207671_100931644	214
423	3300025944	Ga0207661_10412974	Ga0207661_104129742	214
424	3300026078	Ga0207702_10137210	Ga0207702_101372103	214
425	3300026116	Ga0207674_10119176	Ga0207674_101191763	214
426	3300031235	Ga0265330_10000050	Ga0265330_1000005029	214
427	3300031238	Ga0265332_10001306	Ga0265332_100013064	214
428	3300031240	Ga0265320_10027303	Ga0265320_100273032	214
429	3300031241	Ga0265325_10026680	Ga0265325_100266802	214
430	3300031242	Ga0265329_10019381	Ga0265329_100193813	214
431	3300031250	Ga0265331_10008335	Ga0265331_100083352	214
432	3300031344	Ga0265316_10000238	Ga0265316_100002389	214
433	3300031344	Ga0265316_10169690	Ga0265316_101696902	214
434	3300031711	Ga0265314_10000112	Ga0265314_1000011290	214
435	3300031712	Ga0265342_10001741	Ga0265342_100017415	214
436	3300045051	Ga0451576_0414838	Ga0451576_0414838_698_1360	214
437	3300050510	nmdc:mga06r32_870925_c1	nmdc:mga06r32_870925_c1_160_804	214
438	3300028800	Ga0265338_10002225	Ga0265338_1000222515	215
439	3300031250	Ga0265331_10052039	Ga0265331_100520392	215
440	3300031344	Ga0265316_10396584	Ga0265316_103965842	215
441	2162886007	SwRhRL2b_contig_1688787	SwRhRL2b_0052.00001890	216
442	3300001979	JGI24740J21852_10096713	JGI24740J21852_100967131	216
443	3300002459	JGI24751J29686_10000048	JGI24751J29686_1000004849	216
444	3300002459	JGI24751J29686_10009557	JGI24751J29686_100095572	216
445	3300003371	JGI26145J50221_1005738	JGI26145J50221_10057381	216
446	3300003781	Ga0055536_1002841	Ga0055536_10028416	216
447	3300003781	Ga0055536_1005538	Ga0055536_10055383	216
448	3300003781	Ga0055536_1015198	Ga0055536_10151983	216
449	3300003791	Ga0055530_10001551	Ga0055530_100015519	216
450	3300003794	Ga0055531_10000923	Ga0055531_1000092314	216
451	3300003794	Ga0055531_10002091	Ga0055531_1000209110	216
452	3300005289	Ga0065704_10000190	Ga0065704_10000190178	216
453	3300005289	Ga0065704_10157746	Ga0065704_101577461	216
454	3300005295	Ga0065707_10090929	Ga0065707_100909292	216
455	3300005327	Ga0070658_10000389	Ga0070658_100003895	216
456	3300005327	Ga0070658_10262717	Ga0070658_102627171	216
457	3300005327	Ga0070658_10377738	Ga0070658_103777381	216
458	3300005340	Ga0070689_100279205	Ga0070689_1002792052	216
459	3300005344	Ga0070661_100005966	Ga0070661_10000596610	216
460	3300005347	Ga0070668_100269174	Ga0070668_1002691742	216
461	3300005353	Ga0070669_100000127	Ga0070669_10000012750	216
462	3300005353	Ga0070669_100001690	Ga0070669_1000016907	216
463	3300005353	Ga0070669_100236977	Ga0070669_1002369772	216
464	3300005355	Ga0070671_100000030	Ga0070671_10000003088	216
465	3300005355	Ga0070671_100000732	Ga0070671_1000007322	216
466	3300005367	Ga0070667_100000198	Ga0070667_10000019844	216
467	3300005367	Ga0070667_100070924	Ga0070667_1000709243	216
468	3300005367	Ga0070667_100098169	Ga0070667_1000981692	216
469	3300005445	Ga0070708_100574866	Ga0070708_1005748662	216
470	3300005468	Ga0070707_100629646	Ga0070707_1006296462	216
471	3300005471	Ga0070698_100416485	Ga0070698_1004164851	216
472	3300005539	Ga0068853_100290940	Ga0068853_1002909401	216
473	3300005544	Ga0070686_100059373	Ga0070686_1000593732	216
474	3300005548	Ga0070665_100030350	Ga0070665_1000303505	216
475	3300005548	Ga0070665_100072911	Ga0070665_1000729113	216
476	3300005563	Ga0068855_100034720	Ga0068855_1000347202	216
477	3300005563	Ga0068855_100153171	Ga0068855_1001531714	216
478	3300005577	Ga0068857_100166171	Ga0068857_1001661712	216
479	3300005577	Ga0068857_100287689	Ga0068857_1002876892	216
480	3300005578	Ga0068854_100001856	Ga0068854_10000185610	216
481	3300005578	Ga0068854_100004954	Ga0068854_1000049546	216
482	3300005578	Ga0068854_100006310	Ga0068854_1000063108	216
483	3300005578	Ga0068854_100044440	Ga0068854_1000444402	216
484	3300005578	Ga0068854_100129907	Ga0068854_1001299073	216
485	3300005614	Ga0068856_100009109	Ga0068856_1000091096	216
486	3300005614	Ga0068856_100110036	Ga0068856_1001100364	216
487	3300005614	Ga0068856_100278731	Ga0068856_1002787312	216
488	3300005616	Ga0068852_100003019	Ga0068852_1000030194	216
489	3300005616	Ga0068852_100068666	Ga0068852_1000686664	216
490	3300005616	Ga0068852_100213065	Ga0068852_1002130652	216
491	3300005617	Ga0068859_100025761	Ga0068859_1000257612	216
492	3300005618	Ga0068864_100060052	Ga0068864_1000600522	216
493	3300005618	Ga0068864_100139625	Ga0068864_1001396252	216
494	3300005834	Ga0068851_10268597	Ga0068851_102685972	216
495	3300005841	Ga0068863_100000196	Ga0068863_10000019617	216
496	3300005841	Ga0068863_100223777	Ga0068863_1002237773	216
497	3300005842	Ga0068858_100019373	Ga0068858_1000193732	216
498	3300005842	Ga0068858_100020404	Ga0068858_1000204043	216
499	3300005842	Ga0068858_100072461	Ga0068858_1000724612	216
500	3300005843	Ga0068860_100000008	Ga0068860_100000008108	216
501	3300005843	Ga0068860_100056447	Ga0068860_1000564472	216
502	3300005843	Ga0068860_100108886	Ga0068860_1001088861	216
503	3300005843	Ga0068860_100112794	Ga0068860_1001127943	216
504	3300005844	Ga0068862_100002041	Ga0068862_1000020419	216
505	3300005844	Ga0068862_100108912	Ga0068862_1001089122	216
506	3300006048	Ga0075363_100008972	Ga0075363_1000089723	216
507	3300006048	Ga0075363_100020688	Ga0075363_1000206883	216
508	3300006051	Ga0075364_10012828	Ga0075364_100128282	216
509	3300006051	Ga0075364_10062860	Ga0075364_100628602	216
510	3300006058	Ga0075432_10000355	Ga0075432_100003552	216
511	3300006177	Ga0075362_10000096	Ga0075362_1000009628	216
512	3300006177	Ga0075362_10009559	Ga0075362_100095592	216
513	3300006186	Ga0075369_10002114	Ga0075369_100021143	216
514	3300006186	Ga0075369_10033849	Ga0075369_100338492	216
515	3300006195	Ga0075366_10000425	Ga0075366_1000042513	216
516	3300006195	Ga0075366_10098320	Ga0075366_100983201	216
517	3300006195	Ga0075366_10106059	Ga0075366_101060592	216
518	3300006353	Ga0075370_10000003	Ga0075370_1000000369	216
519	3300006353	Ga0075370_10285721	Ga0075370_102857212	216
520	3300006931	Ga0097620_100025761	Ga0097620_1000257612	216
521	3300009011	Ga0105251_10005304	Ga0105251_100053043	216
522	3300009011	Ga0105251_10216211	Ga0105251_102162111	216
523	3300009093	Ga0105240_10002881	Ga0105240_1000288116	216
524	3300009093	Ga0105240_10016639	Ga0105240_100166397	216
525	3300009093	Ga0105240_10094436	Ga0105240_100944364	216
526	3300009093	Ga0105240_10136617	Ga0105240_101366172	216
527	3300009093	Ga0105240_10261534	Ga0105240_102615342	216
528	3300009101	Ga0105247_10068802	Ga0105247_100688023	216
529	3300009148	Ga0105243_10027709	Ga0105243_100277093	216
530	3300009174	Ga0105241_11020993	Ga0105241_110209931	216
531	3300009177	Ga0105248_10035124	Ga0105248_100351244	216
532	3300009177	Ga0105248_10071749	Ga0105248_100717493	216
533	3300009177	Ga0105248_10134206	Ga0105248_101342062	216
534	3300009551	Ga0105238_10081952	Ga0105238_100819522	216
535	3300009551	Ga0105238_10156991	Ga0105238_101569914	216
536	3300009553	Ga0105249_10201237	Ga0105249_102012372	216
537	3300013100	Ga0157373_10112542	Ga0157373_101125422	216
538	3300013100	Ga0157373_10205828	Ga0157373_102058282	216
539	3300013102	Ga0157371_10010308	Ga0157371_100103081	216
540	3300013102	Ga0157371_10018320	Ga0157371_100183204	216
541	3300013102	Ga0157371_10165686	Ga0157371_101656862	216
542	3300013102	Ga0157371_10302910	Ga0157371_103029102	216
543	3300013102	Ga0157371_10323556	Ga0157371_103235562	216
544	3300013104	Ga0157370_10019603	Ga0157370_100196035	216
545	3300013104	Ga0157370_10042151	Ga0157370_100421514	216
546	3300013105	Ga0157369_10001177	Ga0157369_100011775	216
547	3300013105	Ga0157369_10012443	Ga0157369_100124435	216
548	3300013105	Ga0157369_10017428	Ga0157369_100174288	216
549	3300013105	Ga0157369_10054347	Ga0157369_100543475	216
550	3300013105	Ga0157369_10081688	Ga0157369_100816882	216
551	3300013297	Ga0157378_11113360	Ga0157378_111133602	216
552	3300013306	Ga0163162_10037677	Ga0163162_100376773	216
553	3300013307	Ga0157372_10077500	Ga0157372_100775001	216
554	3300013307	Ga0157372_10081328	Ga0157372_100813285	216
555	3300013307	Ga0157372_11645488	Ga0157372_116454881	216
556	3300014326	Ga0157380_10022685	Ga0157380_100226856	216
557	3300014326	Ga0157380_10208304	Ga0157380_102083042	216
558	3300021358	Ga0213873_10000007	Ga0213873_10000007147	216
559	3300021384	Ga0213876_10000005	Ga0213876_10000005183	216
560	3300025263	Ga0209565_1023619	Ga0209565_10236192	216
561	3300025291	Ga0209675_1000184	Ga0209675_100018461	216
562	3300025292	Ga0209676_1000174	Ga0209676_1000174153	216
563	3300025292	Ga0209676_1000246	Ga0209676_100024625	216
564	3300025292	Ga0209676_1000932	Ga0209676_100093226	216
565	3300025294	Ga0209025_1032475	Ga0209025_10324752	216
566	3300025298	Ga0209050_1000068	Ga0209050_1000068275	216
567	3300025298	Ga0209050_1001213	Ga0209050_100121322	216
568	3300025298	Ga0209050_1040016	Ga0209050_10400162	216
569	3300025304	Ga0209257_1000132	Ga0209257_1000132198	216
570	3300025304	Ga0209257_1000169	Ga0209257_100016936	216
571	3300025304	Ga0209257_1001026	Ga0209257_100102612	216
572	3300025315	Ga0207697_10095175	Ga0207697_100951752	216
573	3300025735	Ga0207713_1149252	Ga0207713_11492521	216
574	3300025893	Ga0207682_10211545	Ga0207682_102115452	216
575	3300025904	Ga0207647_10017454	Ga0207647_100174542	216
576	3300025904	Ga0207647_10034292	Ga0207647_100342925	216
577	3300025909	Ga0207705_10000004	Ga0207705_10000004384	216
578	3300025909	Ga0207705_10000101	Ga0207705_1000010113	216
579	3300025909	Ga0207705_10313682	Ga0207705_103136822	216
580	3300025913	Ga0207695_10003145	Ga0207695_1000314515	216
581	3300025913	Ga0207695_10012466	Ga0207695_100124663	216
582	3300025913	Ga0207695_10018947	Ga0207695_100189475	216
583	3300025919	Ga0207657_10071057	Ga0207657_100710577	216
584	3300025920	Ga0207649_10003307	Ga0207649_100033074	216
585	3300025922	Ga0207646_10021625	Ga0207646_100216254	216
586	3300025923	Ga0207681_10000187	Ga0207681_100001878	216
587	3300025923	Ga0207681_10004998	Ga0207681_100049981	216
588	3300025923	Ga0207681_10226040	Ga0207681_102260402	216
589	3300025924	Ga0207694_10126630	Ga0207694_101266303	216
590	3300025924	Ga0207694_10136396	Ga0207694_101363961	216
591	3300025925	Ga0207650_10063140	Ga0207650_100631403	216
592	3300025931	Ga0207644_10000011	Ga0207644_10000011187	216
593	3300025931	Ga0207644_10000578	Ga0207644_100005782	216
594	3300025931	Ga0207644_10102637	Ga0207644_101026372	216
595	3300025931	Ga0207644_10893406	Ga0207644_108934061	216
596	3300025935	Ga0207709_10244382	Ga0207709_102443822	216
597	3300025936	Ga0207670_10210884	Ga0207670_102108843	216
598	3300025938	Ga0207704_10537857	Ga0207704_105378572	216
599	3300025941	Ga0207711_10102754	Ga0207711_101027542	216
600	3300025941	Ga0207711_10197071	Ga0207711_101970711	216
601	3300025949	Ga0207667_10014134	Ga0207667_100141345	216
602	3300025949	Ga0207667_10016908	Ga0207667_100169089	216
603	3300025949	Ga0207667_10031714	Ga0207667_100317145	216
604	3300025949	Ga0207667_10035304	Ga0207667_100353046	216
605	3300025961	Ga0207712_10500321	Ga0207712_105003212	216
606	3300025972	Ga0207668_10372254	Ga0207668_103722542	216
607	3300025972	Ga0207668_10656640	Ga0207668_106566401	216
608	3300025981	Ga0207640_10001358	Ga0207640_1000135810	216
609	3300025981	Ga0207640_10001696	Ga0207640_100016962	216
610	3300025981	Ga0207640_10015969	Ga0207640_100159692	216
611	3300025981	Ga0207640_10204444	Ga0207640_102044441	216
612	3300025981	Ga0207640_10273048	Ga0207640_102730482	216
613	3300025986	Ga0207658_10001044	Ga0207658_100010446	216
614	3300026035	Ga0207703_10006514	Ga0207703_100065145	216
615	3300026035	Ga0207703_10184695	Ga0207703_101846952	216
616	3300026041	Ga0207639_10167166	Ga0207639_101671663	216
617	3300026041	Ga0207639_10743364	Ga0207639_107433641	216
618	3300026067	Ga0207678_10020075	Ga0207678_100200754	216
619	3300026067	Ga0207678_10185898	Ga0207678_101858983	216
620	3300026078	Ga0207702_10004365	Ga0207702_100043656	216
621	3300026078	Ga0207702_10012315	Ga0207702_100123159	216
622	3300026078	Ga0207702_10066033	Ga0207702_100660332	216
623	3300026078	Ga0207702_10126510	Ga0207702_101265102	216
624	3300026078	Ga0207702_11355968	Ga0207702_113559681	216
625	3300026088	Ga0207641_10003688	Ga0207641_100036882	216
626	3300026088	Ga0207641_10107642	Ga0207641_101076423	216
627	3300026095	Ga0207676_10059674	Ga0207676_100596742	216
628	3300026095	Ga0207676_10066502	Ga0207676_100665022	216
629	3300026095	Ga0207676_10325226	Ga0207676_103252262	216
630	3300026116	Ga0207674_10070213	Ga0207674_100702134	216
631	3300026142	Ga0207698_10000177	Ga0207698_100001772	216
632	3300026142	Ga0207698_10010714	Ga0207698_100107142	216
633	3300026142	Ga0207698_10025015	Ga0207698_100250154	216
634	3300026142	Ga0207698_10344083	Ga0207698_103440832	216
635	3300027111	Ga0209281_1024107	Ga0209281_10241072	216
636	3300027866	Ga0209813_10000096	Ga0209813_1000009627	216
637	3300027876	Ga0209974_10021180	Ga0209974_100211802	216
638	3300028379	Ga0268266_10053488	Ga0268266_100534883	216
639	3300028380	Ga0268265_10011065	Ga0268265_100110654	216
640	3300028380	Ga0268265_10432745	Ga0268265_104327452	216
641	3300028381	Ga0268264_10000018	Ga0268264_10000018424	216
642	3300028381	Ga0268264_10043247	Ga0268264_100432472	216
643	3300028381	Ga0268264_10174093	Ga0268264_101740932	216
644	3300031247	Ga0265340_10052831	Ga0265340_100528312	216
645	3300031251	Ga0265327_10238403	Ga0265327_102384032	216
646	3300031548	Ga0307408_100524312	Ga0307408_1005243122	216
647	3300031595	Ga0265313_10053327	Ga0265313_100533272	216
648	3300031711	Ga0265314_10236426	Ga0265314_102364262	216
649	3300031731	Ga0307405_10001537	Ga0307405_100015372	216
650	3300031731	Ga0307405_10431046	Ga0307405_104310461	216
651	3300031901	Ga0307406_10332974	Ga0307406_103329741	216
652	3300031911	Ga0307412_10005041	Ga0307412_100050414	216
653	3300031911	Ga0307412_10006903	Ga0307412_100069035	216
654	3300031911	Ga0307412_10070680	Ga0307412_100706802	216
655	3300031911	Ga0307412_10215190	Ga0307412_102151902	216
656	3300032002	Ga0307416_100139988	Ga0307416_1001399882	216
657	3300032004	Ga0307414_10000204	Ga0307414_1000020424	216
658	3300032004	Ga0307414_10021581	Ga0307414_100215811	216
659	3300032004	Ga0307414_10131063	Ga0307414_101310632	216
660	3300032004	Ga0307414_10294182	Ga0307414_102941822	216
661	3300032004	Ga0307414_10643792	Ga0307414_106437922	216
662	3300032005	Ga0307411_10000684	Ga0307411_100006849	216
663	3300032005	Ga0307411_10853489	Ga0307411_108534891	216
664	3300032126	Ga0307415_100033282	Ga0307415_1000332822	216
665	3300032126	Ga0307415_100314041	Ga0307415_1003140412	216
666	3300033180	Ga0307510_10229170	Ga0307510_102291701	216
667	3300035691	Ga0373931_0034705	Ga0373931_0034705_1696_2346	216
668	3300037312	Ga0395899_0021460	Ga0395899_0021460_2182_2859	216
669	3300037312	Ga0395899_0046848	Ga0395899_0046848_115_765	216
670	3300037312	Ga0395899_0058238	Ga0395899_0058238_685_1335	216
671	3300037418	Ga0395900_0003576	Ga0395900_0003576_15622_16299	216
672	3300037418	Ga0395900_0061906	Ga0395900_0061906_191_841	216
673	3300037418	Ga0395900_0076608	Ga0395900_0076608_601_1263	216
674	3300037418	Ga0395900_0107472	Ga0395900_0107472_29_679	216
675	3300037418	Ga0395900_0251375	Ga0395900_0251375_84_734	216
676	3300037418	Ga0395900_0277045	Ga0395900_0277045_410_1060	216
677	3300037418	Ga0395900_0412586	Ga0395900_0412586_650_1300	216
678	3300037466	Ga0395898_0004254	Ga0395898_0004254_6377_7027	216
679	3300037466	Ga0395898_0006820	Ga0395898_0006820_11188_11865	216
680	3300037466	Ga0395898_0863938	Ga0395898_0863938_122_772	216
681	3300038443	Ga0395901_0023315	Ga0395901_0023315_3754_4431	216
682	3300038443	Ga0395901_0045692	Ga0395901_0045692_467_1117	216
683	3300039062	Ga0400483_231588	Ga0400483_231588_1403_2053	216
684	3300039437	Ga0436365_0352550	Ga0436365_0352550_10670_11320	216
685	3300039453	Ga0436362_0451893	Ga0436362_0451893_140653_141303	216
686	3300041413	Ga0439465_0129456	Ga0439465_0129456_178_828	216
687	3300042876	Ga0451577_0058360	Ga0451577_0058360_1410_2060	216
688	3300044684	Ga0466966_0002854	Ga0466966_0002854_6154_6846	216
689	3300044693	Ga0466961_0005066	Ga0466961_0005066_6918_7610	216
690	3300044694	Ga0466963_0042941	Ga0466963_0042941_1155_1805	216
691	3300044712	Ga0453684_0150924	Ga0453684_0150924_1591_2241	216
692	3300044712	Ga0453684_0223984	Ga0453684_0223984_98_748	216
693	3300044719	Ga0466971_0005161	Ga0466971_0005161_211_861	216
694	3300044765	Ga0466970_0046274	Ga0466970_0046274_1077_1769	216
695	3300044842	Ga0466957_0000272	Ga0466957_0000272_17093_17785	216
696	3300045049	Ga0466959_0036925	Ga0466959_0036925_2372_3064	216
697	3300045051	Ga0451576_0000023	Ga0451576_0000023_465880_466533	216
698	3300045836	Ga0466958_0000445	Ga0466958_0000445_9887_10579	216
699	3300046453	Ga0495627_002119	Ga0495627_002119_7110_7760	216
700	3300046460	Ga0495638_0261862	Ga0495638_0261862_219_869	216
701	3300046471	Ga0495650_0004291	Ga0495650_0004291_6930_7580	216
702	3300046500	Ga0495596_0000207	Ga0495596_0000207_35147_35797	216
703	3300046500	Ga0495596_0000730	Ga0495596_0000730_13602_14252	216
704	3300046501	Ga0495607_0024796	Ga0495607_0024796_1607_2257	216
705	3300046507	Ga0495606_0019701	Ga0495606_0019701_186_836	216
706	3300046512	Ga0495610_0000018	Ga0495610_0000018_160017_160667	216
707	3300046512	Ga0495610_0001536	Ga0495610_0001536_5618_6268	216
708	3300046512	Ga0495610_0001795	Ga0495610_0001795_7169_7819	216
709	3300046512	Ga0495610_0180340	Ga0495610_0180340_71_721	216
710	3300046515	Ga0495620_0072956	Ga0495620_0072956_78_728	216
711	3300046519	Ga0495632_0001484	Ga0495632_0001484_15976_16626	216
712	3300046522	Ga0495643_0004166	Ga0495643_0004166_3243_3893	216
713	3300046522	Ga0495643_0021749	Ga0495643_0021749_1038_1688	216
714	3300046522	Ga0495643_0041221	Ga0495643_0041221_50_700	216
715	3300046525	Ga0495663_0000735	Ga0495663_0000735_2374_3024	216
716	3300046530	Ga0495654_0048028	Ga0495654_0048028_319_969	216
717	3300046537	Ga0495598_0026609	Ga0495598_0026609_523_1173	216
718	3300046538	Ga0495609_0003837	Ga0495609_0003837_5781_6431	216
719	3300046539	Ga0495621_0009324	Ga0495621_0009324_2068_2718	216
720	3300046558	Ga0495633_0144141	Ga0495633_0144141_64_714	216
721	3300046616	Ga0495668_0000002	Ga0495668_0000002_459230_460015	216
722	3300046616	Ga0495668_0154609	Ga0495668_0154609_545_1195	216
723	3300046660	Ga0495625_0000281	Ga0495625_0000281_76226_76876	216
724	3300046660	Ga0495625_0374173	Ga0495625_0374173_119_769	216
725	3300046692	Ga0495671_0083335	Ga0495671_0083335_109_759	216
726	3300047318	Ga0495636_0032133	Ga0495636_0032133_1057_1707	216
727	3300047445	Ga0495677_0013496	Ga0495677_0013496_1287_1937	216
728	3300047470	Ga0495681_0000792	Ga0495681_0000792_2251_2901	216
729	3300048090	Ga0495615_0000189	Ga0495615_0000189_5393_6043	216
730	3300048091	Ga0495626_0001070	Ga0495626_0001070_6091_6741	216
731	3300048905	Ga0496102_0105129	Ga0496102_0105129_368_1018	216
732	3300048905	Ga0496102_0327545	Ga0496102_0327545_440_1090	216
733	3300048906	Ga0496103_0082459	Ga0496103_0082459_607_1284	216
734	3300048906	Ga0496103_0209669	Ga0496103_0209669_312_962	216
735	3300048907	Ga0496104_0008591	Ga0496104_0008591_3039_3689	216
736	3300048908	Ga0496105_0062819	Ga0496105_0062819_805_1482	216
737	3300048909	Ga0496106_0002120	Ga0496106_0002120_10199_10876	216
738	3300048910	Ga0496107_0036704	Ga0496107_0036704_2298_2975	216
739	3300048911	Ga0496108_0170527	Ga0496108_0170527_1037_1687	216
740	3300048912	Ga0496109_0031851	Ga0496109_0031851_795_1472	216
741	3300048913	Ga0496110_0013292	Ga0496110_0013292_3429_4106	216
742	3300048914	Ga0496111_0058281	Ga0496111_0058281_961_1611	216
743	3300048915	Ga0496112_0283733	Ga0496112_0283733_375_1052	216
744	3300048916	Ga0496113_0060043	Ga0496113_0060043_1466_2143	216
745	3300048917	Ga0496114_0020714	Ga0496114_0020714_3535_4185	216
746	3300048919	Ga0496116_0000028	Ga0496116_0000028_58587_59237	216
747	3300048920	Ga0496117_0087022	Ga0496117_0087022_1145_1795	216
748	3300048920	Ga0496117_0279264	Ga0496117_0279264_120_770	216
749	3300048921	Ga0496118_0055405	Ga0496118_0055405_1300_1950	216
750	3300048921	Ga0496118_0089054	Ga0496118_0089054_921_1571	216
751	3300048924	Ga0496121_0000021	Ga0496121_0000021_347582_348232	216
752	3300048924	Ga0496121_0001600	Ga0496121_0001600_5649_6299	216
753	3300048924	Ga0496121_0002197	Ga0496121_0002197_10290_10940	216
754	3300048925	Ga0496122_0002264	Ga0496122_0002264_6419_7069	216
755	3300048926	Ga0496123_0001766	Ga0496123_0001766_9231_9881	216
756	3300048926	Ga0496123_0007890	Ga0496123_0007890_9075_9725	216
757	3300048927	Ga0496124_0020844	Ga0496124_0020844_4484_5134	216
758	3300048928	Ga0496125_0009483	Ga0496125_0009483_4602_5252	216
759	3300048928	Ga0496125_0081128	Ga0496125_0081128_1707_2357	216
760	3300048929	Ga0496126_0000079	Ga0496126_0000079_183582_184232	216
761	3300048929	Ga0496126_0007606	Ga0496126_0007606_10264_10914	216
762	3300049568	Ga0501031_0032735	Ga0501031_0032735_1120_1770	216
763	3300049571	Ga0501034_0003639	Ga0501034_0003639_998_1648	216
764	3300049573	Ga0501037_0074292	Ga0501037_0074292_167_817	216
765	3300049574	Ga0501038_0064642	Ga0501038_0064642_1026_1676	216
766	3300049580	Ga0501046_0071019	Ga0501046_0071019_934_1584	216
767	3300049581	Ga0501047_0108171	Ga0501047_0108171_455_1105	216
768	3300049582	Ga0501048_0053164	Ga0501048_0053164_752_1402	216
769	3300049822	Ga0501035_0004535	Ga0501035_0004535_1312_1962	216
770	3300049823	Ga0501044_0064411	Ga0501044_0064411_1756_2406	216
771	3300050489	nmdc:mga03683_145_c1	nmdc:mga03683_145_c1_2781_3431	216
772	3300050489	nmdc:mga03683_30_c1	nmdc:mga03683_30_c1_53726_54376	216
773	3300050490	nmdc:mga03n38_155_c1	nmdc:mga03n38_155_c1_3126_3776	216
774	3300050490	nmdc:mga03n38_52865_c1	nmdc:mga03n38_52865_c1_239_889	216
775	3300050491	nmdc:mga00v17_4114_c1	nmdc:mga00v17_4114_c1_1820_2470	216
776	3300050492	nmdc:mga0yw44_40884_c1	nmdc:mga0yw44_40884_c1_786_1436	216
777	3300050493	nmdc:mga0k408_3_c1	nmdc:mga0k408_3_c1_178187_178837	216
778	3300050493	nmdc:mga0k408_63843_c1	nmdc:mga0k408_63843_c1_1374_2024	216
779	3300050494	nmdc:mga06z11_182300_c1	nmdc:mga06z11_182300_c1_200_850	216
780	3300050494	nmdc:mga06z11_785_c1	nmdc:mga06z11_785_c1_8585_9235	216
781	3300050495	nmdc:mga04h51_2040_c1	nmdc:mga04h51_2040_c1_2911_3561	216
782	3300050496	nmdc:mga07m45_325901_c1	nmdc:mga07m45_325901_c1_67_717	216
783	3300050496	nmdc:mga07m45_4_c1	nmdc:mga07m45_4_c1_88508_89158	216
784	3300050496	nmdc:mga07m45_6_c1	nmdc:mga07m45_6_c1_68284_68934	216
785	3300050516	nmdc:mga0sz30_186_c1	nmdc:mga0sz30_186_c1_18683_19333	216
786	3300050516	nmdc:mga0sz30_790_c1	nmdc:mga0sz30_790_c1_9007_9657	216
787	3300053121	Ga0500607_000591	Ga0500607_000591_11915_12565	216
788	3300053121	Ga0500607_000654	Ga0500607_000654_24307_24957	216
789	3300053122	Ga0500608_001900	Ga0500608_001900_5029_5679	216
790	3300053125	Ga0500618_004920	Ga0500618_004920_261_911	216
791	3300053136	Ga0500559_0000300	Ga0500559_0000300_8874_9524	216
792	3300053138	Ga0500564_000236	Ga0500564_000236_7296_7946	216
793	3300053158	Ga0500627_0000015	Ga0500627_0000015_77042_77692	216
794	3300053723	Ga0500567_011863	Ga0500567_011863_1810_2460	216
795	3300053729	Ga0500625_000020	Ga0500625_000020_82178_82828	216
796	3300061719	Ga0466962_0002892	Ga0466962_0002892_1632_2324	216
797	2162886007	SwRhRL2b_contig_1557986	SwRhRL2b_0566.00005250	217
798	3300001904	JGI24736J21556_1000056	JGI24736J21556_100005613	217
799	3300001904	JGI24736J21556_1001338	JGI24736J21556_10013383	217
800	3300001915	JGI24741J21665_1000749	JGI24741J21665_10007498	217
801	3300001976	JGI24752J21851_1000794	JGI24752J21851_10007944	217
802	3300001976	JGI24752J21851_1005077	JGI24752J21851_10050773	217
803	3300001976	JGI24752J21851_1008930	JGI24752J21851_10089302	217
804	3300001979	JGI24740J21852_10003497	JGI24740J21852_100034975	217
805	3300001989	JGI24739J22299_10017443	JGI24739J22299_100174433	217
806	3300001989	JGI24739J22299_10043529	JGI24739J22299_100435292	217
807	3300001989	JGI24739J22299_10069364	JGI24739J22299_100693641	217
808	3300001990	JGI24737J22298_10005958	JGI24737J22298_100059582	217
809	3300001990	JGI24737J22298_10009835	JGI24737J22298_100098351	217
810	3300002067	JGI24735J21928_10002656	JGI24735J21928_100026565	217
811	3300002070	JGI24750J21931_1000004	JGI24750J21931_10000048	217
812	3300002074	JGI24748J21848_1000044	JGI24748J21848_100004426	217
813	3300002075	JGI24738J21930_10001439	JGI24738J21930_100014396	217
814	3300002075	JGI24738J21930_10045506	JGI24738J21930_100455061	217
815	3300002239	JGI24034J26672_10000020	JGI24034J26672_1000002029	217
816	3300002239	JGI24034J26672_10010406	JGI24034J26672_100104062	217
817	3300002244	JGI24742J22300_10012628	JGI24742J22300_100126282	217
818	3300002459	JGI24751J29686_10009126	JGI24751J29686_100091262	217
819	3300002459	JGI24751J29686_10028069	JGI24751J29686_100280692	217
820	3300003187	JGI25151J46595_10048188	JGI25151J46595_100481881	217
821	3300003214	JGI25165J46597_1000351	JGI25165J46597_100035155	217
822	3300003354	JGI25160J50197_1000168	JGI25160J50197_10001686	217
823	3300003374	JGI25161J50226_1001996	JGI25161J50226_10019965	217
824	3300003771	Ga0055526_1012082	Ga0055526_10120822	217
825	3300003775	Ga0055524_1015685	Ga0055524_10156851	217
826	3300003781	Ga0055536_1019079	Ga0055536_10190792	217
827	3300003794	Ga0055531_10027310	Ga0055531_100273102	217
828	3300003911	JGI25405J52794_10061385	JGI25405J52794_100613851	217
829	3300004625	Ga0055543_1000229	Ga0055543_100022915	217
830	3300005262	Ga0065165_1000133	Ga0065165_1000133119	217
831	3300005262	Ga0065165_1001460	Ga0065165_100146020	217
832	3300005288	Ga0065714_10176389	Ga0065714_101763892	217
833	3300005289	Ga0065704_10072226	Ga0065704_100722263	217
834	3300005289	Ga0065704_10072924	Ga0065704_100729246	217
835	3300005289	Ga0065704_10201626	Ga0065704_102016262	217
836	3300005295	Ga0065707_10087167	Ga0065707_100871677	217
837	3300005295	Ga0065707_10115953	Ga0065707_101159532	217
838	3300005295	Ga0065707_10288602	Ga0065707_102886021	217
839	3300005327	Ga0070658_10000001	Ga0070658_10000001220	217
840	3300005327	Ga0070658_10017025	Ga0070658_100170255	217
841	3300005327	Ga0070658_10269221	Ga0070658_102692212	217
842	3300005328	Ga0070676_10001496	Ga0070676_100014965	217
843	3300005329	Ga0070683_100538672	Ga0070683_1005386722	217
844	3300005330	Ga0070690_100000180	Ga0070690_10000018014	217
845	3300005330	Ga0070690_100332717	Ga0070690_1003327171	217
846	3300005331	Ga0070670_100000016	Ga0070670_100000016183	217
847	3300005331	Ga0070670_100002488	Ga0070670_10000248814	217
848	3300005331	Ga0070670_100007633	Ga0070670_1000076335	217
849	3300005331	Ga0070670_100064947	Ga0070670_1000649472	217
850	3300005334	Ga0068869_100300565	Ga0068869_1003005652	217
851	3300005335	Ga0070666_10000027	Ga0070666_1000002763	217
852	3300005335	Ga0070666_10001023	Ga0070666_100010237	217
853	3300005336	Ga0070680_100005786	Ga0070680_10000578610	217
854	3300005336	Ga0070680_100015139	Ga0070680_1000151394	217
855	3300005337	Ga0070682_100017938	Ga0070682_1000179383	217
856	3300005338	Ga0068868_100000752	Ga0068868_10000075218	217
857	3300005338	Ga0068868_100104833	Ga0068868_1001048333	217
858	3300005339	Ga0070660_100000322	Ga0070660_10000032220	217
859	3300005339	Ga0070660_100000862	Ga0070660_10000086212	217
860	3300005339	Ga0070660_100049245	Ga0070660_1000492453	217
861	3300005339	Ga0070660_100055334	Ga0070660_1000553344	217
862	3300005339	Ga0070660_100121834	Ga0070660_1001218343	217
863	3300005340	Ga0070689_100221461	Ga0070689_1002214612	217
864	3300005340	Ga0070689_100497312	Ga0070689_1004973122	217
865	3300005341	Ga0070691_10059236	Ga0070691_100592362	217
866	3300005343	Ga0070687_100165183	Ga0070687_1001651832	217
867	3300005344	Ga0070661_100000189	Ga0070661_1000001898	217
868	3300005344	Ga0070661_100192103	Ga0070661_1001921032	217
869	3300005345	Ga0070692_10000806	Ga0070692_1000080614	217
870	3300005347	Ga0070668_100000123	Ga0070668_10000012332	217
871	3300005347	Ga0070668_100000311	Ga0070668_1000003116	217
872	3300005347	Ga0070668_100010654	Ga0070668_1000106545	217
873	3300005347	Ga0070668_100029700	Ga0070668_1000297002	217
874	3300005347	Ga0070668_100084281	Ga0070668_1000842811	217
875	3300005347	Ga0070668_100102080	Ga0070668_1001020802	217
876	3300005347	Ga0070668_100230973	Ga0070668_1002309732	217
877	3300005347	Ga0070668_100527387	Ga0070668_1005273871	217
878	3300005353	Ga0070669_100000001	Ga0070669_10000000175	217
879	3300005353	Ga0070669_100000099	Ga0070669_10000009952	217
880	3300005353	Ga0070669_100000200	Ga0070669_10000020014	217
881	3300005353	Ga0070669_100026065	Ga0070669_1000260655	217
882	3300005353	Ga0070669_100070225	Ga0070669_1000702252	217
883	3300005353	Ga0070669_100081542	Ga0070669_1000815422	217
884	3300005353	Ga0070669_100147036	Ga0070669_1001470362	217
885	3300005353	Ga0070669_100297993	Ga0070669_1002979931	217
886	3300005354	Ga0070675_100052128	Ga0070675_1000521285	217
887	3300005354	Ga0070675_100252669	Ga0070675_1002526692	217
888	3300005355	Ga0070671_100000007	Ga0070671_100000007193	217
889	3300005355	Ga0070671_100000232	Ga0070671_10000023235	217
890	3300005355	Ga0070671_100019290	Ga0070671_1000192903	217
891	3300005355	Ga0070671_100021460	Ga0070671_1000214602	217
892	3300005364	Ga0070673_100098358	Ga0070673_1000983582	217
893	3300005364	Ga0070673_100518716	Ga0070673_1005187162	217
894	3300005366	Ga0070659_100000032	Ga0070659_10000003247	217
895	3300005366	Ga0070659_100065020	Ga0070659_1000650201	217
896	3300005366	Ga0070659_100065327	Ga0070659_1000653272	217
897	3300005366	Ga0070659_100545779	Ga0070659_1005457792	217
898	3300005367	Ga0070667_100000024	Ga0070667_100000024111	217
899	3300005367	Ga0070667_100000419	Ga0070667_10000041927	217
900	3300005367	Ga0070667_100000670	Ga0070667_10000067020	217
901	3300005367	Ga0070667_100018104	Ga0070667_1000181047	217
902	3300005367	Ga0070667_100029038	Ga0070667_1000290383	217
903	3300005367	Ga0070667_100030696	Ga0070667_1000306964	217
904	3300005367	Ga0070667_100066915	Ga0070667_1000669152	217
905	3300005367	Ga0070667_100067013	Ga0070667_1000670132	217
906	3300005367	Ga0070667_100236572	Ga0070667_1002365722	217
907	3300005367	Ga0070667_100297249	Ga0070667_1002972492	217
908	3300005367	Ga0070667_100410284	Ga0070667_1004102841	217
909	3300005367	Ga0070667_100911391	Ga0070667_1009113911	217
910	3300005438	Ga0070701_10016766	Ga0070701_100167662	217
911	3300005440	Ga0070705_100000119	Ga0070705_10000011943	217
912	3300005440	Ga0070705_100051927	Ga0070705_1000519272	217
913	3300005440	Ga0070705_100105573	Ga0070705_1001055732	217
914	3300005441	Ga0070700_100002199	Ga0070700_1000021996	217
915	3300005445	Ga0070708_100034871	Ga0070708_1000348712	217
916	3300005445	Ga0070708_100358207	Ga0070708_1003582072	217
917	3300005455	Ga0070663_100001752	Ga0070663_1000017523	217
918	3300005455	Ga0070663_100224827	Ga0070663_1002248272	217
919	3300005455	Ga0070663_100500198	Ga0070663_1005001981	217
920	3300005456	Ga0070678_100109921	Ga0070678_1001099212	217
921	3300005456	Ga0070678_100136786	Ga0070678_1001367862	217
922	3300005457	Ga0070662_100108111	Ga0070662_1001081111	217
923	3300005457	Ga0070662_100263976	Ga0070662_1002639762	217
924	3300005458	Ga0070681_10002329	Ga0070681_1000232912	217
925	3300005458	Ga0070681_10062873	Ga0070681_100628733	217
926	3300005466	Ga0070685_10000238	Ga0070685_1000023823	217
927	3300005466	Ga0070685_10124568	Ga0070685_101245682	217
928	3300005471	Ga0070698_101084409	Ga0070698_1010844091	217
929	3300005518	Ga0070699_100002098	Ga0070699_10000209815	217
930	3300005530	Ga0070679_100000019	Ga0070679_10000001932	217
931	3300005530	Ga0070679_100049279	Ga0070679_1000492793	217
932	3300005536	Ga0070697_100162826	Ga0070697_1001628262	217
933	3300005539	Ga0068853_100001057	Ga0068853_10000105713	217
934	3300005539	Ga0068853_100012722	Ga0068853_1000127225	217
935	3300005539	Ga0068853_100048244	Ga0068853_1000482443	217
936	3300005539	Ga0068853_100252068	Ga0068853_1002520683	217
937	3300005539	Ga0068853_100584819	Ga0068853_1005848192	217
938	3300005544	Ga0070686_100000010	Ga0070686_100000010107	217
939	3300005544	Ga0070686_100000490	Ga0070686_1000004909	217
940	3300005544	Ga0070686_100042784	Ga0070686_1000427842	217
941	3300005545	Ga0070695_100000607	Ga0070695_10000060715	217
942	3300005545	Ga0070695_100075134	Ga0070695_1000751342	217
943	3300005546	Ga0070696_100009985	Ga0070696_1000099853	217
944	3300005546	Ga0070696_100085009	Ga0070696_1000850092	217
945	3300005548	Ga0070665_100000254	Ga0070665_10000025471	217
946	3300005548	Ga0070665_100006633	Ga0070665_1000066337	217
947	3300005548	Ga0070665_100158115	Ga0070665_1001581151	217
948	3300005549	Ga0070704_100009975	Ga0070704_1000099753	217
949	3300005563	Ga0068855_100006131	Ga0068855_1000061317	217
950	3300005563	Ga0068855_100168326	Ga0068855_1001683262	217
951	3300005563	Ga0068855_100292817	Ga0068855_1002928173	217
952	3300005563	Ga0068855_100818865	Ga0068855_1008188652	217
953	3300005564	Ga0070664_100058822	Ga0070664_1000588225	217
954	3300005564	Ga0070664_100267782	Ga0070664_1002677821	217
955	3300005564	Ga0070664_100407974	Ga0070664_1004079741	217
956	3300005564	Ga0070664_100558761	Ga0070664_1005587612	217
957	3300005577	Ga0068857_100044211	Ga0068857_1000442113	217
958	3300005577	Ga0068857_100076769	Ga0068857_1000767692	217
959	3300005577	Ga0068857_100317317	Ga0068857_1003173172	217
960	3300005577	Ga0068857_100460888	Ga0068857_1004608881	217
961	3300005578	Ga0068854_100163281	Ga0068854_1001632812	217
962	3300005578	Ga0068854_100445446	Ga0068854_1004454461	217
963	3300005578	Ga0068854_101153238	Ga0068854_1011532381	217
964	3300005614	Ga0068856_100032811	Ga0068856_1000328112	217
965	3300005614	Ga0068856_100560854	Ga0068856_1005608541	217
966	3300005615	Ga0070702_100036806	Ga0070702_1000368063	217
967	3300005616	Ga0068852_100081130	Ga0068852_1000811304	217
968	3300005616	Ga0068852_100204024	Ga0068852_1002040242	217
969	3300005617	Ga0068859_100000222	Ga0068859_10000022253	217
970	3300005617	Ga0068859_100000294	Ga0068859_10000029447	217
971	3300005617	Ga0068859_100022229	Ga0068859_1000222295	217
972	3300005617	Ga0068859_100051974	Ga0068859_1000519745	217
973	3300005617	Ga0068859_100055919	Ga0068859_1000559194	217
974	3300005617	Ga0068859_100171135	Ga0068859_1001711352	217
975	3300005617	Ga0068859_100255605	Ga0068859_1002556053	217
976	3300005617	Ga0068859_100330351	Ga0068859_1003303512	217
977	3300005617	Ga0068859_100619609	Ga0068859_1006196092	217
978	3300005618	Ga0068864_100000017	Ga0068864_100000017105	217
979	3300005618	Ga0068864_100009428	Ga0068864_1000094288	217
980	3300005618	Ga0068864_100084583	Ga0068864_1000845833	217
981	3300005719	Ga0068861_100000046	Ga0068861_10000004644	217
982	3300005719	Ga0068861_100015706	Ga0068861_1000157065	217
983	3300005719	Ga0068861_100018517	Ga0068861_1000185173	217
984	3300005719	Ga0068861_100635869	Ga0068861_1006358692	217
985	3300005834	Ga0068851_10029689	Ga0068851_100296892	217
986	3300005834	Ga0068851_10059004	Ga0068851_100590042	217
987	3300005834	Ga0068851_10140369	Ga0068851_101403692	217
988	3300005834	Ga0068851_10231449	Ga0068851_102314492	217
989	3300005834	Ga0068851_10243243	Ga0068851_102432431	217
990	3300005840	Ga0068870_10045372	Ga0068870_100453723	217
991	3300005840	Ga0068870_10184607	Ga0068870_101846072	217
992	3300005841	Ga0068863_100000018	Ga0068863_10000001823	217
993	3300005841	Ga0068863_100000020	Ga0068863_10000002020	217
994	3300005841	Ga0068863_100000082	Ga0068863_10000008235	217
995	3300005841	Ga0068863_100000775	Ga0068863_10000077521	217
996	3300005841	Ga0068863_100212920	Ga0068863_1002129202	217
997	3300005841	Ga0068863_100657692	Ga0068863_1006576922	217
998	3300005842	Ga0068858_100000530	Ga0068858_10000053026	217
999	3300005842	Ga0068858_100012035	Ga0068858_1000120355	217
1000	3300005842	Ga0068858_100048778	Ga0068858_1000487783	217
1001	3300005842	Ga0068858_100172457	Ga0068858_1001724572	217
1002	3300005842	Ga0068858_100581063	Ga0068858_1005810631	217
1003	3300005843	Ga0068860_100000080	Ga0068860_100000080106	217
1004	3300005843	Ga0068860_100001501	Ga0068860_1000015015	217
1005	3300005843	Ga0068860_100002576	Ga0068860_1000025762	217
1006	3300005843	Ga0068860_100035390	Ga0068860_1000353903	217
1007	3300005843	Ga0068860_100089367	Ga0068860_1000893673	217
1008	3300005843	Ga0068860_100166956	Ga0068860_1001669562	217
1009	3300005843	Ga0068860_100332652	Ga0068860_1003326522	217
1010	3300005844	Ga0068862_100000010	Ga0068862_100000010206	217
1011	3300005844	Ga0068862_100000115	Ga0068862_10000011560	217
1012	3300005844	Ga0068862_100000561	Ga0068862_10000056123	217
1013	3300005844	Ga0068862_100003132	Ga0068862_1000031325	217
1014	3300005844	Ga0068862_100007340	Ga0068862_1000073402	217
1015	3300005844	Ga0068862_100024680	Ga0068862_1000246803	217
1016	3300005844	Ga0068862_100060831	Ga0068862_1000608315	217
1017	3300005844	Ga0068862_100204331	Ga0068862_1002043312	217
1018	3300005844	Ga0068862_100415095	Ga0068862_1004150952	217
1019	3300005937	Ga0081455_10000545	Ga0081455_1000054542	217
1020	3300005985	Ga0081539_10009174	Ga0081539_100091745	217
1021	3300005985	Ga0081539_10015931	Ga0081539_100159315	217
1022	3300006038	Ga0075365_10021827	Ga0075365_100218273	217
1023	3300006038	Ga0075365_10029436	Ga0075365_100294362	217
1024	3300006038	Ga0075365_10053041	Ga0075365_100530412	217
1025	3300006038	Ga0075365_10175865	Ga0075365_101758652	217
1026	3300006042	Ga0075368_10000060	Ga0075368_1000006015	217
1027	3300006042	Ga0075368_10015017	Ga0075368_100150172	217
1028	3300006048	Ga0075363_100016644	Ga0075363_1000166442	217
1029	3300006048	Ga0075363_100025410	Ga0075363_1000254101	217
1030	3300006051	Ga0075364_10005216	Ga0075364_100052163	217
1031	3300006177	Ga0075362_10001731	Ga0075362_100017313	217
1032	3300006178	Ga0075367_10000630	Ga0075367_100006303	217
1033	3300006178	Ga0075367_10001769	Ga0075367_100017693	217
1034	3300006178	Ga0075367_10164371	Ga0075367_101643712	217
1035	3300006186	Ga0075369_10077528	Ga0075369_100775281	217
1036	3300006237	Ga0097621_100116213	Ga0097621_1001162133	217
1037	3300006353	Ga0075370_10147531	Ga0075370_101475311	217
1038	3300006358	Ga0068871_100022855	Ga0068871_1000228552	217
1039	3300006358	Ga0068871_100339466	Ga0068871_1003394662	217
1040	3300006846	Ga0075430_100131931	Ga0075430_1001319311	217
1041	3300006847	Ga0075431_100064416	Ga0075431_1000644162	217
1042	3300006847	Ga0075431_100264559	Ga0075431_1002645591	217
1043	3300006880	Ga0075429_100106194	Ga0075429_1001061943	217
1044	3300006880	Ga0075429_100117239	Ga0075429_1001172393	217
1045	3300006881	Ga0068865_100069669	Ga0068865_1000696692	217
1046	3300006881	Ga0068865_100315722	Ga0068865_1003157221	217
1047	3300006931	Ga0097620_100000222	Ga0097620_1000002223	217
1048	3300006931	Ga0097620_100000294	Ga0097620_10000029447	217
1049	3300006931	Ga0097620_100022229	Ga0097620_1000222295	217
1050	3300006931	Ga0097620_100051977	Ga0097620_1000519775	217
1051	3300006931	Ga0097620_100055918	Ga0097620_1000559182	217
1052	3300006931	Ga0097620_100171129	Ga0097620_1001711292	217
1053	3300006931	Ga0097620_100255616	Ga0097620_1002556162	217
1054	3300006931	Ga0097620_100330333	Ga0097620_1003303332	217
1055	3300006931	Ga0097620_100619515	Ga0097620_1006195152	217
1056	3300006946	Ga0079104_1000183	Ga0079104_100018342	217
1057	3300006946	Ga0079104_1000992	Ga0079104_100099220	217
1058	3300006946	Ga0079104_1056242	Ga0079104_10562421	217
1059	3300009011	Ga0105251_10002397	Ga0105251_1000239713	217
1060	3300009011	Ga0105251_10030194	Ga0105251_100301942	217
1061	3300009011	Ga0105251_10049245	Ga0105251_100492452	217
1062	3300009092	Ga0105250_10012137	Ga0105250_100121372	217
1063	3300009093	Ga0105240_10010741	Ga0105240_100107417	217
1064	3300009093	Ga0105240_10341272	Ga0105240_103412722	217
1065	3300009094	Ga0111539_10024146	Ga0111539_100241467	217
1066	3300009098	Ga0105245_10320627	Ga0105245_103206271	217
1067	3300009098	Ga0105245_10566328	Ga0105245_105663282	217
1068	3300009098	Ga0105245_11175393	Ga0105245_111753931	217
1069	3300009101	Ga0105247_10020031	Ga0105247_100200314	217
1070	3300009101	Ga0105247_10041107	Ga0105247_100411072	217
1071	3300009101	Ga0105247_10179814	Ga0105247_101798141	217
1072	3300009101	Ga0105247_10198861	Ga0105247_101988611	217
1073	3300009101	Ga0105247_10296319	Ga0105247_102963192	217
1074	3300009147	Ga0114129_10029871	Ga0114129_100298716	217
1075	3300009148	Ga0105243_10197750	Ga0105243_101977502	217
1076	3300009174	Ga0105241_10042303	Ga0105241_100423033	217
1077	3300009174	Ga0105241_10180470	Ga0105241_101804703	217
1078	3300009174	Ga0105241_10396049	Ga0105241_103960492	217
1079	3300009176	Ga0105242_10343111	Ga0105242_103431112	217
1080	3300009177	Ga0105248_10000215	Ga0105248_100002153	217
1081	3300009177	Ga0105248_10001231	Ga0105248_1000123120	217
1082	3300009177	Ga0105248_10002326	Ga0105248_1000232615	217
1083	3300009177	Ga0105248_10016810	Ga0105248_100168107	217
1084	3300009177	Ga0105248_10202730	Ga0105248_102027301	217
1085	3300009545	Ga0105237_10058598	Ga0105237_100585983	217
1086	3300009545	Ga0105237_10096672	Ga0105237_100966722	217
1087	3300009545	Ga0105237_10159871	Ga0105237_101598712	217
1088	3300009545	Ga0105237_10173109	Ga0105237_101731092	217
1089	3300009551	Ga0105238_10004082	Ga0105238_100040823	217
1090	3300009551	Ga0105238_10131536	Ga0105238_101315363	217
1091	3300009551	Ga0105238_10252022	Ga0105238_102520223	217
1092	3300009553	Ga0105249_10000064	Ga0105249_1000006465	217
1093	3300009553	Ga0105249_10000489	Ga0105249_1000048930	217
1094	3300009553	Ga0105249_10025940	Ga0105249_100259406	217
1095	3300009553	Ga0105249_10049341	Ga0105249_100493413	217
1096	3300009553	Ga0105249_10200296	Ga0105249_102002962	217
1097	3300009553	Ga0105249_10290767	Ga0105249_102907672	217
1098	3300009978	Ga0105148_100414	Ga0105148_1004146	217
1099	3300010375	Ga0105239_10132871	Ga0105239_101328713	217
1100	3300010375	Ga0105239_10179411	Ga0105239_101794114	217
1101	3300010375	Ga0105239_10219656	Ga0105239_102196562	217
1102	3300010375	Ga0105239_10240013	Ga0105239_102400132	217
1103	3300010375	Ga0105239_10290950	Ga0105239_102909502	217
1104	3300010375	Ga0105239_10711593	Ga0105239_107115932	217
1105	3300011119	Ga0105246_10295250	Ga0105246_102952502	217
1106	3300011119	Ga0105246_10371629	Ga0105246_103716292	217
1107	3300013100	Ga0157373_10196794	Ga0157373_101967941	217
1108	3300013100	Ga0157373_10266256	Ga0157373_102662562	217
1109	3300013102	Ga0157371_10346820	Ga0157371_103468201	217
1110	3300013104	Ga0157370_10008526	Ga0157370_100085267	217
1111	3300013104	Ga0157370_10113455	Ga0157370_101134552	217
1112	3300013105	Ga0157369_10001892	Ga0157369_100018922	217
1113	3300013105	Ga0157369_10012700	Ga0157369_100127004	217
1114	3300013105	Ga0157369_10173990	Ga0157369_101739902	217
1115	3300013249	Ga0171463_1004	Ga0171463_100483	217
1116	3300013296	Ga0157374_10029857	Ga0157374_100298571	217
1117	3300013296	Ga0157374_10491344	Ga0157374_104913441	217
1118	3300013297	Ga0157378_10396307	Ga0157378_103963072	217
1119	3300013306	Ga0163162_10003521	Ga0163162_100035216	217
1120	3300013306	Ga0163162_10032252	Ga0163162_100322523	217
1121	3300013307	Ga0157372_10154004	Ga0157372_101540041	217
1122	3300013307	Ga0157372_10373530	Ga0157372_103735303	217
1123	3300013308	Ga0157375_10098321	Ga0157375_100983215	217
1124	3300013308	Ga0157375_10586843	Ga0157375_105868432	217
1125	3300013308	Ga0157375_10800404	Ga0157375_108004042	217
1126	3300014325	Ga0163163_10016014	Ga0163163_100160142	217
1127	3300014325	Ga0163163_10096613	Ga0163163_100966132	217
1128	3300014325	Ga0163163_10103678	Ga0163163_101036784	217
1129	3300014326	Ga0157380_10000086	Ga0157380_100000868	217
1130	3300014326	Ga0157380_10058715	Ga0157380_100587153	217
1131	3300014326	Ga0157380_10064619	Ga0157380_100646194	217
1132	3300014326	Ga0157380_10207721	Ga0157380_102077212	217
1133	3300014326	Ga0157380_10345138	Ga0157380_103451382	217
1134	3300014326	Ga0157380_10476256	Ga0157380_104762562	217
1135	3300014326	Ga0157380_10493005	Ga0157380_104930052	217
1136	3300014326	Ga0157380_10758359	Ga0157380_107583591	217
1137	3300014326	Ga0157380_11185511	Ga0157380_111855111	217
1138	3300014968	Ga0157379_10002697	Ga0157379_1000269716	217
1139	3300014968	Ga0157379_10039739	Ga0157379_100397392	217
1140	3300014968	Ga0157379_10063845	Ga0157379_100638452	217
1141	3300014968	Ga0157379_10164262	Ga0157379_101642623	217
1142	3300014969	Ga0157376_10667281	Ga0157376_106672812	217
1143	3300015690	Ga0183363_1122	Ga0183363_112210	217
1144	3300017792	Ga0163161_10000110	Ga0163161_1000011063	217
1145	3300017792	Ga0163161_10008263	Ga0163161_1000826310	217
1146	3300017792	Ga0163161_10183416	Ga0163161_101834161	217
1147	3300017792	Ga0163161_10185602	Ga0163161_101856022	217
1148	3300017792	Ga0163161_10253754	Ga0163161_102537542	217
1149	3300020069	Ga0197907_10060642	Ga0197907_100606421	217
1150	3300020075	Ga0206349_1077304	Ga0206349_10773041	217
1151	3300020081	Ga0206354_10699577	Ga0206354_106995774	217
1152	3300020082	Ga0206353_10986306	Ga0206353_109863064	217
1153	3300021320	Ga0214544_1002508	Ga0214544_100250822	217
1154	3300021321	Ga0214542_1000008	Ga0214542_1000008214	217
1155	3300021321	Ga0214542_1019024	Ga0214542_10190242	217
1156	3300021327	Ga0214543_1000031	Ga0214543_1000031145	217
1157	3300021327	Ga0214543_1000053	Ga0214543_100005365	217
1158	3300021384	Ga0213876_10000332	Ga0213876_1000033215	217
1159	3300021384	Ga0213876_10021798	Ga0213876_100217982	217
1160	3300021384	Ga0213876_10040362	Ga0213876_100403623	217
1161	3300021388	Ga0213875_10000043	Ga0213875_1000004394	217
1162	3300022467	Ga0224712_10132250	Ga0224712_101322502	217
1163	3300022739	Ga0228711_1000050	Ga0228711_100005047	217
1164	3300022740	Ga0228710_1000063	Ga0228710_100006347	217
1165	3300025208	Ga0209436_100736	Ga0209436_10073610	217
1166	3300025261	Ga0209233_1000310	Ga0209233_100031052	217
1167	3300025284	Ga0209130_1000027	Ga0209130_100002782	217
1168	3300025292	Ga0209676_1009932	Ga0209676_10099322	217
1169	3300025294	Ga0209025_1000241	Ga0209025_1000241135	217
1170	3300025294	Ga0209025_1016415	Ga0209025_10164153	217
1171	3300025295	Ga0209564_1000111	Ga0209564_100011183	217
1172	3300025297	Ga0209758_1080404	Ga0209758_10804042	217
1173	3300025299	Ga0209256_1000132	Ga0209256_100013271	217
1174	3300025299	Ga0209256_1000361	Ga0209256_10003615	217
1175	3300025299	Ga0209256_1001681	Ga0209256_10016814	217
1176	3300025302	Ga0207426_1000072	Ga0207426_1000072233	217
1177	3300025303	Ga0209051_1008097	Ga0209051_10080974	217
1178	3300025304	Ga0209257_1011053	Ga0209257_10110534	217
1179	3300025315	Ga0207697_10000041	Ga0207697_1000004131	217
1180	3300025315	Ga0207697_10029068	Ga0207697_100290682	217
1181	3300025321	Ga0207656_10005239	Ga0207656_100052393	217
1182	3300025321	Ga0207656_10026913	Ga0207656_100269132	217
1183	3300025321	Ga0207656_10072562	Ga0207656_100725622	217
1184	3300025711	Ga0207696_1005798	Ga0207696_10057983	217
1185	3300025735	Ga0207713_1002993	Ga0207713_10029936	217
1186	3300025735	Ga0207713_1012106	Ga0207713_10121062	217
1187	3300025885	Ga0207653_10005411	Ga0207653_100054114	217
1188	3300025893	Ga0207682_10003496	Ga0207682_100034966	217
1189	3300025900	Ga0207710_10030160	Ga0207710_100301602	217
1190	3300025900	Ga0207710_10092772	Ga0207710_100927722	217
1191	3300025900	Ga0207710_10182121	Ga0207710_101821211	217
1192	3300025903	Ga0207680_10000009	Ga0207680_10000009109	217
1193	3300025903	Ga0207680_10004663	Ga0207680_100046632	217
1194	3300025903	Ga0207680_10006477	Ga0207680_100064777	217
1195	3300025904	Ga0207647_10000684	Ga0207647_1000068421	217
1196	3300025904	Ga0207647_10044401	Ga0207647_100444013	217
1197	3300025904	Ga0207647_10083383	Ga0207647_100833833	217
1198	3300025904	Ga0207647_10088910	Ga0207647_100889102	217
1199	3300025907	Ga0207645_10002747	Ga0207645_1000274715	217
1200	3300025908	Ga0207643_10017186	Ga0207643_100171864	217
1201	3300025908	Ga0207643_10068905	Ga0207643_100689053	217
1202	3300025909	Ga0207705_10000002	Ga0207705_100000021659	217
1203	3300025909	Ga0207705_10071261	Ga0207705_100712612	217
1204	3300025909	Ga0207705_10223126	Ga0207705_102231262	217
1205	3300025910	Ga0207684_10177054	Ga0207684_101770543	217
1206	3300025911	Ga0207654_10002488	Ga0207654_100024887	217
1207	3300025911	Ga0207654_10052787	Ga0207654_100527872	217
1208	3300025912	Ga0207707_10196156	Ga0207707_101961561	217
1209	3300025913	Ga0207695_10003071	Ga0207695_1000307116	217
1210	3300025913	Ga0207695_10010486	Ga0207695_100104865	217
1211	3300025913	Ga0207695_10054054	Ga0207695_100540543	217
1212	3300025913	Ga0207695_10336104	Ga0207695_103361042	217
1213	3300025914	Ga0207671_10001965	Ga0207671_1000196511	217
1214	3300025914	Ga0207671_10030797	Ga0207671_100307973	217
1215	3300025914	Ga0207671_10134699	Ga0207671_101346992	217
1216	3300025914	Ga0207671_10189092	Ga0207671_101890921	217
1217	3300025917	Ga0207660_10000211	Ga0207660_1000021134	217
1218	3300025917	Ga0207660_10003076	Ga0207660_1000307613	217
1219	3300025917	Ga0207660_10154941	Ga0207660_101549412	217
1220	3300025918	Ga0207662_10121883	Ga0207662_101218832	217
1221	3300025918	Ga0207662_10252349	Ga0207662_102523492	217
1222	3300025919	Ga0207657_10000601	Ga0207657_1000060129	217
1223	3300025919	Ga0207657_10009551	Ga0207657_100095517	217
1224	3300025919	Ga0207657_10011456	Ga0207657_100114569	217
1225	3300025919	Ga0207657_10020585	Ga0207657_100205852	217
1226	3300025919	Ga0207657_10043161	Ga0207657_100431612	217
1227	3300025919	Ga0207657_10056808	Ga0207657_100568083	217
1228	3300025920	Ga0207649_10000055	Ga0207649_100000557	217
1229	3300025920	Ga0207649_10790482	Ga0207649_107904821	217
1230	3300025921	Ga0207652_10000004	Ga0207652_10000004377	217
1231	3300025921	Ga0207652_10125648	Ga0207652_101256481	217
1232	3300025921	Ga0207652_10219734	Ga0207652_102197341	217
1233	3300025921	Ga0207652_10455790	Ga0207652_104557901	217
1234	3300025923	Ga0207681_10000002	Ga0207681_10000002928	217
1235	3300025923	Ga0207681_10000106	Ga0207681_1000010634	217
1236	3300025923	Ga0207681_10002411	Ga0207681_100024119	217
1237	3300025923	Ga0207681_10035146	Ga0207681_100351462	217
1238	3300025923	Ga0207681_10064787	Ga0207681_100647873	217
1239	3300025923	Ga0207681_10156431	Ga0207681_101564312	217
1240	3300025923	Ga0207681_10197089	Ga0207681_101970891	217
1241	3300025924	Ga0207694_10004071	Ga0207694_100040715	217
1242	3300025924	Ga0207694_10077182	Ga0207694_100771823	217
1243	3300025924	Ga0207694_10102422	Ga0207694_101024223	217
1244	3300025924	Ga0207694_10317942	Ga0207694_103179422	217
1245	3300025925	Ga0207650_10000196	Ga0207650_1000019619	217
1246	3300025925	Ga0207650_10012542	Ga0207650_100125425	217
1247	3300025925	Ga0207650_10322186	Ga0207650_103221862	217
1248	3300025925	Ga0207650_10514953	Ga0207650_105149532	217
1249	3300025926	Ga0207659_10031858	Ga0207659_100318585	217
1250	3300025926	Ga0207659_10040891	Ga0207659_100408913	217
1251	3300025927	Ga0207687_10002140	Ga0207687_1000214020	217
1252	3300025927	Ga0207687_11076690	Ga0207687_110766901	217
1253	3300025931	Ga0207644_10000002	Ga0207644_10000002868	217
1254	3300025931	Ga0207644_10000025	Ga0207644_1000002514	217
1255	3300025931	Ga0207644_10003436	Ga0207644_100034369	217
1256	3300025931	Ga0207644_10031976	Ga0207644_100319765	217
1257	3300025931	Ga0207644_10044046	Ga0207644_100440463	217
1258	3300025932	Ga0207690_10000001	Ga0207690_10000001784	217
1259	3300025932	Ga0207690_10005587	Ga0207690_100055876	217
1260	3300025932	Ga0207690_10043558	Ga0207690_100435582	217
1261	3300025932	Ga0207690_10068996	Ga0207690_100689962	217
1262	3300025933	Ga0207706_10007566	Ga0207706_100075669	217
1263	3300025933	Ga0207706_10090790	Ga0207706_100907904	217
1264	3300025933	Ga0207706_10123155	Ga0207706_101231553	217
1265	3300025933	Ga0207706_10140896	Ga0207706_101408963	217
1266	3300025933	Ga0207706_10822891	Ga0207706_108228911	217
1267	3300025935	Ga0207709_10104202	Ga0207709_101042022	217
1268	3300025935	Ga0207709_10305790	Ga0207709_103057901	217
1269	3300025936	Ga0207670_10092675	Ga0207670_100926753	217
1270	3300025937	Ga0207669_10048639	Ga0207669_100486392	217
1271	3300025938	Ga0207704_10032881	Ga0207704_100328814	217
1272	3300025940	Ga0207691_10278647	Ga0207691_102786472	217
1273	3300025941	Ga0207711_10000031	Ga0207711_10000031207	217
1274	3300025941	Ga0207711_10005829	Ga0207711_100058293	217
1275	3300025941	Ga0207711_10017455	Ga0207711_100174553	217
1276	3300025942	Ga0207689_10073777	Ga0207689_100737772	217
1277	3300025945	Ga0207679_10038735	Ga0207679_100387355	217
1278	3300025945	Ga0207679_10231894	Ga0207679_102318942	217
1279	3300025945	Ga0207679_11033710	Ga0207679_110337101	217
1280	3300025949	Ga0207667_10001563	Ga0207667_1000156312	217
1281	3300025949	Ga0207667_10055392	Ga0207667_100553924	217
1282	3300025949	Ga0207667_10117136	Ga0207667_101171363	217
1283	3300025949	Ga0207667_10156307	Ga0207667_101563073	217
1284	3300025949	Ga0207667_10279985	Ga0207667_102799852	217
1285	3300025949	Ga0207667_11261288	Ga0207667_112612881	217
1286	3300025960	Ga0207651_10096617	Ga0207651_100966173	217
1287	3300025960	Ga0207651_10654462	Ga0207651_106544621	217
1288	3300025960	Ga0207651_10667745	Ga0207651_106677451	217
1289	3300025961	Ga0207712_10000044	Ga0207712_10000044106	217
1290	3300025961	Ga0207712_10000550	Ga0207712_100005507	217
1291	3300025961	Ga0207712_10004547	Ga0207712_1000454710	217
1292	3300025961	Ga0207712_10012890	Ga0207712_100128906	217
1293	3300025961	Ga0207712_10019135	Ga0207712_100191355	217
1294	3300025961	Ga0207712_10424280	Ga0207712_104242802	217
1295	3300025961	Ga0207712_10483165	Ga0207712_104831651	217
1296	3300025972	Ga0207668_10000021	Ga0207668_1000002153	217
1297	3300025972	Ga0207668_10000085	Ga0207668_1000008513	217
1298	3300025972	Ga0207668_10001463	Ga0207668_100014635	217
1299	3300025972	Ga0207668_10004580	Ga0207668_100045808	217
1300	3300025972	Ga0207668_10004701	Ga0207668_100047017	217
1301	3300025972	Ga0207668_10006338	Ga0207668_100063382	217
1302	3300025972	Ga0207668_10110910	Ga0207668_101109101	217
1303	3300025972	Ga0207668_10143367	Ga0207668_101433672	217
1304	3300025972	Ga0207668_10170133	Ga0207668_101701332	217
1305	3300025972	Ga0207668_10308252	Ga0207668_103082521	217
1306	3300025972	Ga0207668_10336078	Ga0207668_103360782	217
1307	3300025972	Ga0207668_10460035	Ga0207668_104600352	217
1308	3300025981	Ga0207640_10001622	Ga0207640_100016222	217
1309	3300025981	Ga0207640_10022787	Ga0207640_100227873	217
1310	3300025981	Ga0207640_10054864	Ga0207640_100548643	217
1311	3300025981	Ga0207640_10273057	Ga0207640_102730572	217
1312	3300025981	Ga0207640_10978437	Ga0207640_109784371	217
1313	3300025986	Ga0207658_10000022	Ga0207658_1000002269	217
1314	3300025986	Ga0207658_10000221	Ga0207658_100002216	217
1315	3300025986	Ga0207658_10000443	Ga0207658_1000044327	217
1316	3300025986	Ga0207658_10004594	Ga0207658_100045944	217
1317	3300025986	Ga0207658_10005503	Ga0207658_1000550311	217
1318	3300025986	Ga0207658_10043342	Ga0207658_100433425	217
1319	3300025986	Ga0207658_10043992	Ga0207658_100439922	217
1320	3300025986	Ga0207658_10099713	Ga0207658_100997132	217
1321	3300025986	Ga0207658_10346174	Ga0207658_103461742	217
1322	3300025986	Ga0207658_10961924	Ga0207658_109619241	217
1323	3300026023	Ga0207677_10000422	Ga0207677_1000042211	217
1324	3300026023	Ga0207677_10107049	Ga0207677_101070493	217
1325	3300026035	Ga0207703_10003167	Ga0207703_1000316718	217
1326	3300026035	Ga0207703_10032025	Ga0207703_100320251	217
1327	3300026035	Ga0207703_10076414	Ga0207703_100764142	217
1328	3300026035	Ga0207703_10627392	Ga0207703_106273922	217
1329	3300026041	Ga0207639_10002194	Ga0207639_1000219410	217
1330	3300026041	Ga0207639_10002874	Ga0207639_1000287410	217
1331	3300026041	Ga0207639_10005970	Ga0207639_100059706	217
1332	3300026041	Ga0207639_10010464	Ga0207639_100104643	217
1333	3300026041	Ga0207639_10012207	Ga0207639_100122073	217
1334	3300026041	Ga0207639_10065912	Ga0207639_100659123	217
1335	3300026041	Ga0207639_10128790	Ga0207639_101287904	217
1336	3300026041	Ga0207639_10314662	Ga0207639_103146622	217
1337	3300026067	Ga0207678_10000853	Ga0207678_1000085310	217
1338	3300026067	Ga0207678_10005788	Ga0207678_100057888	217
1339	3300026067	Ga0207678_10016703	Ga0207678_100167037	217
1340	3300026067	Ga0207678_10047741	Ga0207678_100477413	217
1341	3300026075	Ga0207708_10000550	Ga0207708_100005504	217
1342	3300026075	Ga0207708_10642138	Ga0207708_106421381	217
1343	3300026078	Ga0207702_10001379	Ga0207702_1000137919	217
1344	3300026078	Ga0207702_10164242	Ga0207702_101642423	217
1345	3300026088	Ga0207641_10000001	Ga0207641_10000001971	217
1346	3300026088	Ga0207641_10000002	Ga0207641_10000002280	217
1347	3300026088	Ga0207641_10000047	Ga0207641_10000047182	217
1348	3300026088	Ga0207641_10000139	Ga0207641_1000013969	217
1349	3300026088	Ga0207641_10007788	Ga0207641_100077889	217
1350	3300026088	Ga0207641_10018708	Ga0207641_100187087	217
1351	3300026088	Ga0207641_10165900	Ga0207641_101659002	217
1352	3300026095	Ga0207676_10000005	Ga0207676_10000005528	217
1353	3300026095	Ga0207676_10003902	Ga0207676_100039022	217
1354	3300026095	Ga0207676_10119760	Ga0207676_101197602	217
1355	3300026116	Ga0207674_10004313	Ga0207674_100043133	217
1356	3300026116	Ga0207674_10007279	Ga0207674_1000727913	217
1357	3300026116	Ga0207674_10008215	Ga0207674_100082158	217
1358	3300026116	Ga0207674_10016841	Ga0207674_100168412	217
1359	3300026116	Ga0207674_10107070	Ga0207674_101070701	217
1360	3300026116	Ga0207674_10165266	Ga0207674_101652661	217
1361	3300026116	Ga0207674_10462960	Ga0207674_104629601	217
1362	3300026118	Ga0207675_100000122	Ga0207675_10000012244	217
1363	3300026118	Ga0207675_100000207	Ga0207675_10000020720	217
1364	3300026118	Ga0207675_100003225	Ga0207675_10000322513	217
1365	3300026118	Ga0207675_100174064	Ga0207675_1001740642	217
1366	3300026118	Ga0207675_100596644	Ga0207675_1005966442	217
1367	3300026121	Ga0207683_10263625	Ga0207683_102636252	217
1368	3300026142	Ga0207698_10044874	Ga0207698_100448743	217
1369	3300026142	Ga0207698_10105807	Ga0207698_101058072	217
1370	3300026142	Ga0207698_10463093	Ga0207698_104630932	217
1371	3300027111	Ga0209281_1000030	Ga0209281_1000030357	217
1372	3300027111	Ga0209281_1000295	Ga0209281_100029564	217
1373	3300027111	Ga0209281_1001983	Ga0209281_10019838	217
1374	3300027665	Ga0209983_1039177	Ga0209983_10391772	217
1375	3300027666	Ga0209282_1000004	Ga0209282_1000004357	217
1376	3300027866	Ga0209813_10000021	Ga0209813_100000211	217
1377	3300027866	Ga0209813_10015570	Ga0209813_100155703	217
1378	3300027866	Ga0209813_10025790	Ga0209813_100257902	217
1379	3300027866	Ga0209813_10073837	Ga0209813_100738371	217
1380	3300028379	Ga0268266_10000069	Ga0268266_10000069109	217
1381	3300028379	Ga0268266_10000354	Ga0268266_1000035460	217
1382	3300028379	Ga0268266_10002635	Ga0268266_1000263514	217
1383	3300028379	Ga0268266_10028160	Ga0268266_100281602	217
1384	3300028379	Ga0268266_10046502	Ga0268266_100465024	217
1385	3300028379	Ga0268266_10074969	Ga0268266_100749695	217
1386	3300028379	Ga0268266_10118718	Ga0268266_101187182	217
1387	3300028379	Ga0268266_10287221	Ga0268266_102872211	217
1388	3300028380	Ga0268265_10000003	Ga0268265_10000003710	217
1389	3300028380	Ga0268265_10000100	Ga0268265_1000010015	217
1390	3300028380	Ga0268265_10000789	Ga0268265_100007895	217
1391	3300028380	Ga0268265_10001727	Ga0268265_100017275	217
1392	3300028380	Ga0268265_10002565	Ga0268265_100025655	217
1393	3300028380	Ga0268265_10021824	Ga0268265_100218242	217
1394	3300028380	Ga0268265_10044474	Ga0268265_100444743	217
1395	3300028380	Ga0268265_10047300	Ga0268265_100473004	217
1396	3300028380	Ga0268265_10108239	Ga0268265_101082391	217
1397	3300028381	Ga0268264_10000071	Ga0268264_1000007154	217
1398	3300028381	Ga0268264_10000131	Ga0268264_10000131106	217
1399	3300028381	Ga0268264_10008283	Ga0268264_100082832	217
1400	3300028381	Ga0268264_10056108	Ga0268264_100561083	217
1401	3300028381	Ga0268264_10105213	Ga0268264_101052132	217
1402	3300028381	Ga0268264_10138887	Ga0268264_101388872	217
1403	3300028381	Ga0268264_10287928	Ga0268264_102879282	217
1404	3300028794	Ga0307515_10000377	Ga0307515_1000037757	217
1405	3300028794	Ga0307515_10004005	Ga0307515_1000400522	217
1406	3300031247	Ga0265340_10188979	Ga0265340_101889791	217
1407	3300031456	Ga0307513_10005946	Ga0307513_100059469	217
1408	3300031548	Ga0307408_100018749	Ga0307408_1000187492	217
1409	3300031548	Ga0307408_100022433	Ga0307408_1000224335	217
1410	3300031548	Ga0307408_100046710	Ga0307408_1000467103	217
1411	3300031548	Ga0307408_100088304	Ga0307408_1000883042	217
1412	3300031548	Ga0307408_100164072	Ga0307408_1001640723	217
1413	3300031548	Ga0307408_100191094	Ga0307408_1001910942	217
1414	3300031548	Ga0307408_101122957	Ga0307408_1011229571	217
1415	3300031665	Ga0316575_10107306	Ga0316575_101073061	217
1416	3300031711	Ga0265314_10117321	Ga0265314_101173212	217
1417	3300031712	Ga0265342_10385906	Ga0265342_103859061	217
1418	3300031727	Ga0316576_10199604	Ga0316576_101996042	217
1419	3300031731	Ga0307405_10004902	Ga0307405_100049025	217
1420	3300031731	Ga0307405_10012236	Ga0307405_100122366	217
1421	3300031731	Ga0307405_10103345	Ga0307405_101033453	217
1422	3300031731	Ga0307405_10146728	Ga0307405_101467282	217
1423	3300031731	Ga0307405_10198422	Ga0307405_101984222	217
1424	3300031731	Ga0307405_10217534	Ga0307405_102175343	217
1425	3300031731	Ga0307405_10233229	Ga0307405_102332292	217
1426	3300031731	Ga0307405_10436441	Ga0307405_104364412	217
1427	3300031824	Ga0307413_10002752	Ga0307413_100027528	217
1428	3300031824	Ga0307413_10005591	Ga0307413_100055916	217
1429	3300031824	Ga0307413_10132503	Ga0307413_101325032	217
1430	3300031824	Ga0307413_10302056	Ga0307413_103020561	217
1431	3300031824	Ga0307413_10351181	Ga0307413_103511812	217
1432	3300031824	Ga0307413_10733489	Ga0307413_107334891	217
1433	3300031852	Ga0307410_10003874	Ga0307410_100038744	217
1434	3300031852	Ga0307410_10005467	Ga0307410_100054675	217
1435	3300031852	Ga0307410_10006201	Ga0307410_100062015	217
1436	3300031852	Ga0307410_10038711	Ga0307410_100387112	217
1437	3300031852	Ga0307410_10041754	Ga0307410_100417542	217
1438	3300031852	Ga0307410_10117229	Ga0307410_101172293	217
1439	3300031852	Ga0307410_10340984	Ga0307410_103409842	217
1440	3300031852	Ga0307410_10382111	Ga0307410_103821112	217
1441	3300031852	Ga0307410_10433175	Ga0307410_104331751	217
1442	3300031852	Ga0307410_10852901	Ga0307410_108529011	217
1443	3300031901	Ga0307406_10010001	Ga0307406_100100015	217
1444	3300031901	Ga0307406_10030887	Ga0307406_100308875	217
1445	3300031901	Ga0307406_10133407	Ga0307406_101334071	217
1446	3300031901	Ga0307406_10137327	Ga0307406_101373273	217
1447	3300031901	Ga0307406_10174354	Ga0307406_101743541	217
1448	3300031901	Ga0307406_10218271	Ga0307406_102182712	217
1449	3300031903	Ga0307407_10011471	Ga0307407_100114715	217
1450	3300031903	Ga0307407_10027744	Ga0307407_100277441	217
1451	3300031903	Ga0307407_10074907	Ga0307407_100749073	217
1452	3300031903	Ga0307407_10128090	Ga0307407_101280902	217
1453	3300031903	Ga0307407_10237939	Ga0307407_102379392	217
1454	3300031911	Ga0307412_10004881	Ga0307412_100048819	217
1455	3300031911	Ga0307412_10009161	Ga0307412_100091618	217
1456	3300031911	Ga0307412_10071362	Ga0307412_100713622	217
1457	3300031911	Ga0307412_10103107	Ga0307412_101031072	217
1458	3300031911	Ga0307412_10120999	Ga0307412_101209992	217
1459	3300031911	Ga0307412_10160050	Ga0307412_101600502	217
1460	3300031911	Ga0307412_10172012	Ga0307412_101720121	217
1461	3300031911	Ga0307412_10220488	Ga0307412_102204883	217
1462	3300031911	Ga0307412_10287843	Ga0307412_102878432	217
1463	3300031911	Ga0307412_10326305	Ga0307412_103263052	217
1464	3300031911	Ga0307412_10402063	Ga0307412_104020632	217
1465	3300031911	Ga0307412_10676361	Ga0307412_106763611	217
1466	3300031967	Ga0315914_1000001	Ga0315914_100000126	217
1467	3300031995	Ga0307409_100004073	Ga0307409_1000040733	217
1468	3300031995	Ga0307409_100004490	Ga0307409_1000044906	217
1469	3300031995	Ga0307409_100061859	Ga0307409_1000618593	217
1470	3300031995	Ga0307409_100070637	Ga0307409_1000706374	217
1471	3300031995	Ga0307409_100092536	Ga0307409_1000925362	217
1472	3300031995	Ga0307409_100380876	Ga0307409_1003808762	217
1473	3300031995	Ga0307409_100420500	Ga0307409_1004205002	217
1474	3300031995	Ga0307409_100667466	Ga0307409_1006674662	217
1475	3300031995	Ga0307409_100727287	Ga0307409_1007272872	217
1476	3300031995	Ga0307409_100871350	Ga0307409_1008713501	217
1477	3300032002	Ga0307416_100021704	Ga0307416_1000217043	217
1478	3300032002	Ga0307416_100091449	Ga0307416_1000914493	217
1479	3300032002	Ga0307416_100161772	Ga0307416_1001617723	217
1480	3300032002	Ga0307416_100272654	Ga0307416_1002726542	217
1481	3300032002	Ga0307416_100274683	Ga0307416_1002746832	217
1482	3300032002	Ga0307416_100393027	Ga0307416_1003930272	217
1483	3300032002	Ga0307416_100405603	Ga0307416_1004056032	217
1484	3300032002	Ga0307416_100461514	Ga0307416_1004615141	217
1485	3300032002	Ga0307416_100540880	Ga0307416_1005408802	217
1486	3300032002	Ga0307416_100549950	Ga0307416_1005499502	217
1487	3300032004	Ga0307414_10000420	Ga0307414_1000042020	217
1488	3300032004	Ga0307414_10025123	Ga0307414_100251235	217
1489	3300032004	Ga0307414_10034553	Ga0307414_100345534	217
1490	3300032004	Ga0307414_10054709	Ga0307414_100547095	217
1491	3300032004	Ga0307414_10075773	Ga0307414_100757733	217
1492	3300032004	Ga0307414_10167659	Ga0307414_101676592	217
1493	3300032004	Ga0307414_10177758	Ga0307414_101777583	217
1494	3300032004	Ga0307414_10275403	Ga0307414_102754032	217
1495	3300032004	Ga0307414_10342353	Ga0307414_103423531	217
1496	3300032004	Ga0307414_10418829	Ga0307414_104188292	217
1497	3300032005	Ga0307411_10003503	Ga0307411_100035032	217
1498	3300032005	Ga0307411_10003978	Ga0307411_100039784	217
1499	3300032005	Ga0307411_10085555	Ga0307411_100855553	217
1500	3300032005	Ga0307411_10126989	Ga0307411_101269892	217
1501	3300032005	Ga0307411_10172654	Ga0307411_101726542	217
1502	3300032005	Ga0307411_10345638	Ga0307411_103456381	217
1503	3300032005	Ga0307411_10432329	Ga0307411_104323292	217
1504	3300032126	Ga0307415_100002358	Ga0307415_1000023585	217
1505	3300032126	Ga0307415_100027841	Ga0307415_1000278413	217
1506	3300032126	Ga0307415_100047678	Ga0307415_1000476782	217
1507	3300032126	Ga0307415_100153234	Ga0307415_1001532343	217
1508	3300032126	Ga0307415_100234066	Ga0307415_1002340662	217
1509	3300032126	Ga0307415_100334029	Ga0307415_1003340291	217
1510	3300032126	Ga0307415_100395678	Ga0307415_1003956782	217
1511	3300032126	Ga0307415_100436897	Ga0307415_1004368972	217
1512	3300033180	Ga0307510_10036797	Ga0307510_100367974	217
1513	3300033180	Ga0307510_10084916	Ga0307510_100849162	217
1514	3300033430	Ga0315913_1000024	Ga0315913_100002466	217
1515	3300033464	Ga0315915_1000002	Ga0315915_1000002358	217
1516	3300035115	Ga0373941_0075547	Ga0373941_0075547_129_782	217
1517	3300036647	Ga0316582_0117706	Ga0316582_0117706_180_833	217
1518	3300036712	Ga0316584_0620695	Ga0316584_0620695_77_730	217
1519	3300037068	Ga0373925_0523917	Ga0373925_0523917_213_944	217
1520	3300037312	Ga0395899_0120923	Ga0395899_0120923_1002_1658	217
1521	3300037418	Ga0395900_0000056	Ga0395900_0000056_128366_129019	217
1522	3300037418	Ga0395900_0311822	Ga0395900_0311822_639_1295	217
1523	3300037466	Ga0395898_0000114	Ga0395898_0000114_128357_129010	217
1524	3300037466	Ga0395898_0053702	Ga0395898_0053702_2079_2732	217
1525	3300037466	Ga0395898_0056597	Ga0395898_0056597_2485_3141	217
1526	3300037471	Ga0395905_0000053	Ga0395905_0000053_84059_84712	217
1527	3300037471	Ga0395905_0006173	Ga0395905_0006173_2603_3256	217
1528	3300037471	Ga0395905_0664012	Ga0395905_0664012_39_692	217
1529	3300037853	Ga0436364_0413139	Ga0436364_0413139_149918_150595	217
1530	3300037853	Ga0436364_1376717	Ga0436364_1376717_164_817	217
1531	3300038443	Ga0395901_0000037	Ga0395901_0000037_128366_129019	217
1532	3300038443	Ga0395901_0005237	Ga0395901_0005237_9891_10544	217
1533	3300038443	Ga0395901_0046540	Ga0395901_0046540_2071_2724	217
1534	3300038443	Ga0395901_0059527	Ga0395901_0059527_1406_2059	217
1535	3300038443	Ga0395901_0144269	Ga0395901_0144269_1442_2095	217
1536	3300038443	Ga0395901_0423548	Ga0395901_0423548_63_716	217
1537	3300039062	Ga0400483_008249	Ga0400483_008249_1244_1897	217
1538	3300039062	Ga0400483_017669	Ga0400483_017669_1492_2148	217
1539	3300039062	Ga0400483_162951	Ga0400483_162951_4305_4988	217
1540	3300039062	Ga0400483_265059	Ga0400483_265059_10372_11028	217
1541	3300039062	Ga0400483_278053	Ga0400483_278053_317_970	217
1542	3300039437	Ga0436365_0010969	Ga0436365_0010969_33592_34377	217
1543	3300039437	Ga0436365_0651625	Ga0436365_0651625_5001_5654	217
1544	3300039437	Ga0436365_1449958	Ga0436365_1449958_1012_1665	217
1545	3300039450	Ga0436363_0105200	Ga0436363_0105200_70_723	217
1546	3300041404	Ga0439436_0000865	Ga0439436_0000865_896_1549	217
1547	3300041404	Ga0439436_0085954	Ga0439436_0085954_35_688	217
1548	3300041410	Ga0439461_0076768	Ga0439461_0076768_34_687	217
1549	3300041411	Ga0439466_0059865	Ga0439466_0059865_306_959	217
1550	3300041413	Ga0439465_0001683	Ga0439465_0001683_5997_6650	217
1551	3300041413	Ga0439465_0043414	Ga0439465_0043414_162_815	217
1552	3300041460	Ga0451802_0633343	Ga0451802_0633343_111_764	217
1553	3300042006	Ga0439432_096240	Ga0439432_096240_52_705	217
1554	3300042007	Ga0439449_0022203	Ga0439449_0022203_516_1169	217
1555	3300042007	Ga0439449_0108600	Ga0439449_0108600_235_888	217
1556	3300042122	Ga0450920_010864	Ga0450920_010864_887_1540	217
1557	3300042145	Ga0450906_006482	Ga0450906_006482_1054_1707	217
1558	3300042185	Ga0450909_006004	Ga0450909_006004_411_1064	217
1559	3300042435	Ga0439434_0020182	Ga0439434_0020182_394_1047	217
1560	3300042531	Ga0450918_001164	Ga0450918_001164_2197_2850	217
1561	3300044684	Ga0466966_0000010	Ga0466966_0000010_15146_15841	217
1562	3300045051	Ga0451576_0006550	Ga0451576_0006550_7165_7818	217
1563	3300046460	Ga0495638_0000033	Ga0495638_0000033_40637_41290	217
1564	3300046460	Ga0495638_0016462	Ga0495638_0016462_3552_4205	217
1565	3300046506	Ga0495583_0001255	Ga0495583_0001255_19680_20333	217
1566	3300046513	Ga0495616_0000017	Ga0495616_0000017_131399_132052	217
1567	3300046515	Ga0495620_0079138	Ga0495620_0079138_294_947	217
1568	3300046519	Ga0495632_0004620	Ga0495632_0004620_6594_7247	217
1569	3300046523	Ga0495644_0121231	Ga0495644_0121231_144_797	217
1570	3300046524	Ga0495648_0000014	Ga0495648_0000014_247076_247729	217
1571	3300046530	Ga0495654_0000224	Ga0495654_0000224_20280_20933	217
1572	3300046542	Ga0495597_0169486	Ga0495597_0169486_34_765	217
1573	3300046557	Ga0495622_0001865	Ga0495622_0001865_4394_5047	217
1574	3300046558	Ga0495633_0023564	Ga0495633_0023564_798_1451	217
1575	3300046616	Ga0495668_0001200	Ga0495668_0001200_18826_19479	217
1576	3300046616	Ga0495668_0006297	Ga0495668_0006297_447_1100	217
1577	3300046616	Ga0495668_0041677	Ga0495668_0041677_971_1702	217
1578	3300046616	Ga0495668_0085862	Ga0495668_0085862_305_961	217
1579	3300046660	Ga0495625_0043237	Ga0495625_0043237_2367_3020	217
1580	3300046660	Ga0495625_0063446	Ga0495625_0063446_800_1453	217
1581	3300046684	Ga0495669_0115111	Ga0495669_0115111_372_1025	217
1582	3300046692	Ga0495671_0000019	Ga0495671_0000019_41002_41655	217
1583	3300046692	Ga0495671_0006805	Ga0495671_0006805_5871_6524	217
1584	3300046692	Ga0495671_0088932	Ga0495671_0088932_97_750	217
1585	3300046794	Ga0495589_0126160	Ga0495589_0126160_447_1100	217
1586	3300047469	Ga0495673_0000042	Ga0495673_0000042_40775_41428	217
1587	3300047472	Ga0495686_0031715	Ga0495686_0031715_2590_3243	217
1588	3300047472	Ga0495686_0038094	Ga0495686_0038094_2136_2789	217
1589	3300048903	Ga0496100_0013760	Ga0496100_0013760_1155_1808	217
1590	3300048903	Ga0496100_0090575	Ga0496100_0090575_346_1002	217
1591	3300048904	Ga0496101_0004345	Ga0496101_0004345_6951_7604	217
1592	3300048904	Ga0496101_0075461	Ga0496101_0075461_1018_1674	217
1593	3300048904	Ga0496101_0304211	Ga0496101_0304211_52_705	217
1594	3300048905	Ga0496102_0000043	Ga0496102_0000043_104759_105412	217
1595	3300048905	Ga0496102_0002267	Ga0496102_0002267_7874_8527	217
1596	3300048905	Ga0496102_0009621	Ga0496102_0009621_5988_6641	217
1597	3300048905	Ga0496102_0040621	Ga0496102_0040621_974_1630	217
1598	3300048906	Ga0496103_0000086	Ga0496103_0000086_5161_5814	217
1599	3300048906	Ga0496103_0000984	Ga0496103_0000984_3421_4074	217
1600	3300048906	Ga0496103_0001691	Ga0496103_0001691_5794_6447	217
1601	3300048906	Ga0496103_0019211	Ga0496103_0019211_1432_2088	217
1602	3300048907	Ga0496104_0000111	Ga0496104_0000111_66740_67393	217
1603	3300048907	Ga0496104_0009219	Ga0496104_0009219_252_908	217
1604	3300048907	Ga0496104_0012409	Ga0496104_0012409_6501_7157	217
1605	3300048907	Ga0496104_0125274	Ga0496104_0125274_602_1255	217
1606	3300048908	Ga0496105_0000253	Ga0496105_0000253_28795_29448	217
1607	3300048908	Ga0496105_0180852	Ga0496105_0180852_798_1454	217
1608	3300048908	Ga0496105_0250107	Ga0496105_0250107_585_1241	217
1609	3300048908	Ga0496105_0251424	Ga0496105_0251424_623_1276	217
1610	3300048908	Ga0496105_0312052	Ga0496105_0312052_391_1044	217
1611	3300048909	Ga0496106_0014116	Ga0496106_0014116_4368_5024	217
1612	3300048909	Ga0496106_0140165	Ga0496106_0140165_575_1231	217
1613	3300048910	Ga0496107_0002330	Ga0496107_0002330_7011_7667	217
1614	3300048910	Ga0496107_0004104	Ga0496107_0004104_994_1650	217
1615	3300048911	Ga0496108_0136690	Ga0496108_0136690_604_1260	217
1616	3300048911	Ga0496108_0321397	Ga0496108_0321397_81_734	217
1617	3300048912	Ga0496109_0464930	Ga0496109_0464930_122_778	217
1618	3300048913	Ga0496110_0064028	Ga0496110_0064028_2165_2818	217
1619	3300048913	Ga0496110_0224915	Ga0496110_0224915_255_911	217
1620	3300048914	Ga0496111_0011464	Ga0496111_0011464_740_1393	217
1621	3300048914	Ga0496111_0051475	Ga0496111_0051475_2163_2819	217
1622	3300048914	Ga0496111_0302488	Ga0496111_0302488_197_853	217
1623	3300048914	Ga0496111_0435653	Ga0496111_0435653_76_732	217
1624	3300048915	Ga0496112_0010329	Ga0496112_0010329_1987_2640	217
1625	3300048915	Ga0496112_0108095	Ga0496112_0108095_1213_1869	217
1626	3300048915	Ga0496112_0116406	Ga0496112_0116406_495_1151	217
1627	3300048916	Ga0496113_0005870	Ga0496113_0005870_1429_2082	217
1628	3300048916	Ga0496113_0044476	Ga0496113_0044476_1804_2460	217
1629	3300048916	Ga0496113_0785899	Ga0496113_0785899_47_703	217
1630	3300048917	Ga0496114_0045791	Ga0496114_0045791_2936_3592	217
1631	3300048917	Ga0496114_0235989	Ga0496114_0235989_848_1504	217
1632	3300048917	Ga0496114_0439095	Ga0496114_0439095_459_1115	217
1633	3300048918	Ga0496115_0001232	Ga0496115_0001232_2652_3308	217
1634	3300048918	Ga0496115_0030599	Ga0496115_0030599_167_823	217
1635	3300048918	Ga0496115_0201653	Ga0496115_0201653_948_1604	217
1636	3300048919	Ga0496116_0001567	Ga0496116_0001567_5071_5724	217
1637	3300048919	Ga0496116_0021480	Ga0496116_0021480_1409_2062	217
1638	3300048919	Ga0496116_0041726	Ga0496116_0041726_1640_2299	217
1639	3300048919	Ga0496116_0058088	Ga0496116_0058088_147_800	217
1640	3300048920	Ga0496117_0000104	Ga0496117_0000104_104759_105412	217
1641	3300048920	Ga0496117_0007404	Ga0496117_0007404_6274_6927	217
1642	3300048920	Ga0496117_0010122	Ga0496117_0010122_2828_3481	217
1643	3300048920	Ga0496117_0018112	Ga0496117_0018112_3887_4540	217
1644	3300048920	Ga0496117_0046532	Ga0496117_0046532_519_1172	217
1645	3300048921	Ga0496118_0000080	Ga0496118_0000080_83790_84443	217
1646	3300048921	Ga0496118_0001361	Ga0496118_0001361_19385_20038	217
1647	3300048921	Ga0496118_0008328	Ga0496118_0008328_6274_6927	217
1648	3300048921	Ga0496118_0017494	Ga0496118_0017494_4977_5630	217
1649	3300048921	Ga0496118_0037527	Ga0496118_0037527_1389_2042	217
1650	3300048922	Ga0496119_0000288	Ga0496119_0000288_8091_8744	217
1651	3300048922	Ga0496119_0015384	Ga0496119_0015384_3081_3734	217
1652	3300048922	Ga0496119_0023466	Ga0496119_0023466_2468_3121	217
1653	3300048923	Ga0496120_0006043	Ga0496120_0006043_2110_2763	217
1654	3300048923	Ga0496120_0112406	Ga0496120_0112406_124_777	217
1655	3300048924	Ga0496121_0017762	Ga0496121_0017762_3543_4196	217
1656	3300048924	Ga0496121_0148470	Ga0496121_0148470_754_1407	217
1657	3300048924	Ga0496121_0233451	Ga0496121_0233451_558_1211	217
1658	3300048925	Ga0496122_0000858	Ga0496122_0000858_52620_53273	217
1659	3300048925	Ga0496122_0003115	Ga0496122_0003115_6695_7348	217
1660	3300048925	Ga0496122_0079524	Ga0496122_0079524_1364_2017	217
1661	3300048925	Ga0496122_0150520	Ga0496122_0150520_578_1231	217
1662	3300048925	Ga0496122_0208342	Ga0496122_0208342_432_1085	217
1663	3300048926	Ga0496123_0001259	Ga0496123_0001259_7923_8576	217
1664	3300048926	Ga0496123_0001920	Ga0496123_0001920_10489_11142	217
1665	3300048926	Ga0496123_0089708	Ga0496123_0089708_274_927	217
1666	3300048927	Ga0496124_0000093	Ga0496124_0000093_83790_84443	217
1667	3300048927	Ga0496124_0009666	Ga0496124_0009666_6839_7492	217
1668	3300048927	Ga0496124_0016615	Ga0496124_0016615_3327_3980	217
1669	3300048928	Ga0496125_0003360	Ga0496125_0003360_12579_13232	217
1670	3300048928	Ga0496125_0022921	Ga0496125_0022921_1595_2248	217
1671	3300048928	Ga0496125_0027431	Ga0496125_0027431_3484_4137	217
1672	3300048928	Ga0496125_0052300	Ga0496125_0052300_1429_2082	217
1673	3300048928	Ga0496125_0056750	Ga0496125_0056750_2457_3110	217
1674	3300048928	Ga0496125_0077159	Ga0496125_0077159_1472_2125	217
1675	3300048928	Ga0496125_0174765	Ga0496125_0174765_180_833	217
1676	3300048928	Ga0496125_0192058	Ga0496125_0192058_360_1013	217
1677	3300048929	Ga0496126_0000028	Ga0496126_0000028_207592_208245	217
1678	3300048929	Ga0496126_0019474	Ga0496126_0019474_3510_4163	217
1679	3300048929	Ga0496126_0054168	Ga0496126_0054168_792_1445	217
1680	3300048929	Ga0496126_0125474	Ga0496126_0125474_339_992	217
1681	3300048929	Ga0496126_0330968	Ga0496126_0330968_546_1199	217
1682	3300049513	Ga0501290_000062	Ga0501290_000062_8969_9622	217
1683	3300049513	Ga0501290_003528	Ga0501290_003528_1245_1898	217
1684	3300049515	Ga0501292_000029	Ga0501292_000029_32007_32660	217
1685	3300049517	Ga0501294_001323	Ga0501294_001323_681_1334	217
1686	3300049523	Ga0501300_003443	Ga0501300_003443_1414_2067	217
1687	3300049530	Ga0501314_008934	Ga0501314_008934_244_897	217
1688	3300049533	Ga0501317_019422	Ga0501317_019422_103_756	217
1689	3300049550	Ga0501334_06261	Ga0501334_06261_96_749	217
1690	3300049568	Ga0501031_0000064	Ga0501031_0000064_32056_32709	217
1691	3300049568	Ga0501031_0122571	Ga0501031_0122571_523_1176	217
1692	3300049569	Ga0501032_0000006	Ga0501032_0000006_19005_19658	217
1693	3300049569	Ga0501032_0514560	Ga0501032_0514560_61_717	217
1694	3300049570	Ga0501033_0000053	Ga0501033_0000053_32056_32709	217
1695	3300049570	Ga0501033_0489790	Ga0501033_0489790_171_827	217
1696	3300049571	Ga0501034_0000030	Ga0501034_0000030_215472_216125	217
1697	3300049571	Ga0501034_0000046	Ga0501034_0000046_89353_90009	217
1698	3300049571	Ga0501034_0022255	Ga0501034_0022255_5682_6335	217
1699	3300049571	Ga0501034_0023831	Ga0501034_0023831_4102_4758	217
1700	3300049571	Ga0501034_0076912	Ga0501034_0076912_598_1254	217
1701	3300049571	Ga0501034_0121607	Ga0501034_0121607_354_1007	217
1702	3300049571	Ga0501034_0182284	Ga0501034_0182284_1195_1851	217
1703	3300049572	Ga0501036_0000003	Ga0501036_0000003_242070_242723	217
1704	3300049572	Ga0501036_0108631	Ga0501036_0108631_127_783	217
1705	3300049573	Ga0501037_0000003	Ga0501037_0000003_242070_242723	217
1706	3300049573	Ga0501037_0003482	Ga0501037_0003482_1541_2197	217
1707	3300049573	Ga0501037_0065062	Ga0501037_0065062_1040_1693	217
1708	3300049574	Ga0501038_0000004	Ga0501038_0000004_242070_242723	217
1709	3300049574	Ga0501038_0001831	Ga0501038_0001831_11102_11758	217
1710	3300049574	Ga0501038_0147521	Ga0501038_0147521_195_848	217
1711	3300049575	Ga0501039_0000008	Ga0501039_0000008_242070_242723	217
1712	3300049575	Ga0501039_0000311	Ga0501039_0000311_29265_29921	217
1713	3300049575	Ga0501039_0153709	Ga0501039_0153709_349_1002	217
1714	3300049575	Ga0501039_0374228	Ga0501039_0374228_293_946	217
1715	3300049576	Ga0501040_0002088	Ga0501040_0002088_408_1061	217
1716	3300049576	Ga0501040_0005395	Ga0501040_0005395_4733_5386	217
1717	3300049576	Ga0501040_0036448	Ga0501040_0036448_2542_3195	217
1718	3300049576	Ga0501040_0062718	Ga0501040_0062718_1181_1837	217
1719	3300049577	Ga0501041_0180557	Ga0501041_0180557_622_1278	217
1720	3300049577	Ga0501041_0371884	Ga0501041_0371884_142_795	217
1721	3300049578	Ga0501042_0002577	Ga0501042_0002577_8752_9405	217
1722	3300049578	Ga0501042_0045625	Ga0501042_0045625_42_698	217
1723	3300049579	Ga0501043_0000365	Ga0501043_0000365_17838_18491	217
1724	3300049579	Ga0501043_0028255	Ga0501043_0028255_2964_3620	217
1725	3300049580	Ga0501046_0003188	Ga0501046_0003188_3528_4184	217
1726	3300049580	Ga0501046_0003639	Ga0501046_0003639_4381_5037	217
1727	3300049580	Ga0501046_0103008	Ga0501046_0103008_1394_2047	217
1728	3300049580	Ga0501046_0167800	Ga0501046_0167800_484_1140	217
1729	3300049581	Ga0501047_0000241	Ga0501047_0000241_36817_37473	217
1730	3300049581	Ga0501047_0001197	Ga0501047_0001197_4780_5433	217
1731	3300049581	Ga0501047_0128991	Ga0501047_0128991_1429_2085	217
1732	3300049581	Ga0501047_0492510	Ga0501047_0492510_180_836	217
1733	3300049582	Ga0501048_0000651	Ga0501048_0000651_14618_15274	217
1734	3300049582	Ga0501048_0132958	Ga0501048_0132958_318_974	217
1735	3300049583	Ga0501067_0001053	Ga0501067_0001053_188_844	217
1736	3300049583	Ga0501067_0004641	Ga0501067_0004641_4538_5194	217
1737	3300049584	Ga0501068_0036993	Ga0501068_0036993_1154_1807	217
1738	3300049585	Ga0501069_0103570	Ga0501069_0103570_927_1580	217
1739	3300049586	Ga0501070_0004657	Ga0501070_0004657_6360_7016	217
1740	3300049586	Ga0501070_0009239	Ga0501070_0009239_1275_1928	217
1741	3300049586	Ga0501070_0126752	Ga0501070_0126752_956_1609	217
1742	3300049586	Ga0501070_0132440	Ga0501070_0132440_798_1454	217
1743	3300049586	Ga0501070_0220911	Ga0501070_0220911_487_1143	217
1744	3300049586	Ga0501070_0434082	Ga0501070_0434082_171_827	217
1745	3300049588	Ga0501072_0736858	Ga0501072_0736858_19_672	217
1746	3300049589	Ga0501073_0009730	Ga0501073_0009730_5727_6383	217
1747	3300049589	Ga0501073_0018554	Ga0501073_0018554_3752_4408	217
1748	3300049589	Ga0501073_0122765	Ga0501073_0122765_47_700	217
1749	3300049590	Ga0501074_0114503	Ga0501074_0114503_117_770	217
1750	3300049590	Ga0501074_0208747	Ga0501074_0208747_616_1272	217
1751	3300049591	Ga0501075_0015713	Ga0501075_0015713_1470_2126	217
1752	3300049591	Ga0501075_0198108	Ga0501075_0198108_420_1076	217
1753	3300049592	Ga0501076_0015335	Ga0501076_0015335_779_1435	217
1754	3300049592	Ga0501076_0122515	Ga0501076_0122515_794_1450	217
1755	3300049592	Ga0501076_0749309	Ga0501076_0749309_142_795	217
1756	3300049593	Ga0501077_0077652	Ga0501077_0077652_521_1177	217
1757	3300049654	Ga0501207_029545	Ga0501207_029545_122_775	217
1758	3300049661	Ga0501217_070585	Ga0501217_070585_201_854	217
1759	3300049662	Ga0501222_003433	Ga0501222_003433_368_1021	217
1760	3300049663	Ga0501223_000002	Ga0501223_000002_139566_140219	217
1761	3300049663	Ga0501223_000487	Ga0501223_000487_5457_6110	217
1762	3300049663	Ga0501223_002755	Ga0501223_002755_2911_3564	217
1763	3300049663	Ga0501223_009848	Ga0501223_009848_794_1447	217
1764	3300049664	Ga0501224_000016	Ga0501224_000016_7202_7855	217
1765	3300049664	Ga0501224_001795	Ga0501224_001795_525_1178	217
1766	3300049668	Ga0501233_025280	Ga0501233_025280_503_1156	217
1767	3300049669	Ga0501235_026484	Ga0501235_026484_385_1038	217
1768	3300049675	Ga0501243_025684	Ga0501243_025684_282_935	217
1769	3300049686	Ga0501257_000007	Ga0501257_000007_52518_53171	217
1770	3300049688	Ga0501259_006721	Ga0501259_006721_1091_1744	217
1771	3300049705	Ga0501225_0000444	Ga0501225_0000444_3163_3816	217
1772	3300049705	Ga0501225_0000716	Ga0501225_0000716_6672_7325	217
1773	3300049705	Ga0501225_0003234	Ga0501225_0003234_2482_3135	217
1774	3300049705	Ga0501225_0017916	Ga0501225_0017916_931_1584	217
1775	3300049705	Ga0501225_0056210	Ga0501225_0056210_223_876	217
1776	3300049707	Ga0501234_001907	Ga0501234_001907_1395_2048	217
1777	3300049741	Ga0501079_0006189	Ga0501079_0006189_8074_8730	217
1778	3300049741	Ga0501079_0204379	Ga0501079_0204379_525_1178	217
1779	3300049741	Ga0501079_0301366	Ga0501079_0301366_453_1109	217
1780	3300049741	Ga0501079_0722449	Ga0501079_0722449_23_676	217
1781	3300049742	Ga0501080_0000052	Ga0501080_0000052_18110_18766	217
1782	3300049742	Ga0501080_0019942	Ga0501080_0019942_1254_1910	217
1783	3300049742	Ga0501080_0024836	Ga0501080_0024836_3092_3814	217
1784	3300049742	Ga0501080_0142433	Ga0501080_0142433_1472_2128	217
1785	3300049742	Ga0501080_0420915	Ga0501080_0420915_434_1090	217
1786	3300049743	Ga0501081_0638596	Ga0501081_0638596_132_788	217
1787	3300049744	Ga0501083_0009057	Ga0501083_0009057_206_862	217
1788	3300049744	Ga0501083_0078482	Ga0501083_0078482_575_1231	217
1789	3300049775	Ga0501279_000002	Ga0501279_000002_173543_174196	217
1790	3300049776	Ga0501280_000003	Ga0501280_000003_42950_43603	217
1791	3300049777	Ga0501281_00109	Ga0501281_00109_7765_8418	217
1792	3300049778	Ga0501282_000402	Ga0501282_000402_1273_1926	217
1793	3300049822	Ga0501035_0000006	Ga0501035_0000006_244366_245034	217
1794	3300049822	Ga0501035_0000031	Ga0501035_0000031_142883_143536	217
1795	3300049822	Ga0501035_0000104	Ga0501035_0000104_15343_15999	217
1796	3300049822	Ga0501035_0174718	Ga0501035_0174718_47_703	217
1797	3300049822	Ga0501035_0238330	Ga0501035_0238330_397_1050	217
1798	3300049823	Ga0501044_0000008	Ga0501044_0000008_242070_242723	217
1799	3300049823	Ga0501044_0000020	Ga0501044_0000020_91191_91847	217
1800	3300049823	Ga0501044_0147186	Ga0501044_0147186_132_788	217
1801	3300049823	Ga0501044_0187815	Ga0501044_0187815_225_878	217
1802	3300049853	Ga0501226_000020	Ga0501226_000020_62276_62929	217
1803	3300050490	nmdc:mga03n38_121722_c1	nmdc:mga03n38_121722_c1_306_962	217
1804	3300050490	nmdc:mga03n38_66692_c1	nmdc:mga03n38_66692_c1_372_1028	217
1805	3300050491	nmdc:mga00v17_27055_c1	nmdc:mga00v17_27055_c1_547_1203	217
1806	3300050491	nmdc:mga00v17_326940_c1	nmdc:mga00v17_326940_c1_75_728	217
1807	3300050492	nmdc:mga0yw44_38084_c1	nmdc:mga0yw44_38084_c1_438_1091	217
1808	3300050492	nmdc:mga0yw44_4389_c1	nmdc:mga0yw44_4389_c1_3284_3940	217
1809	3300050492	nmdc:mga0yw44_474902_c1	nmdc:mga0yw44_474902_c1_74_730	217
1810	3300050492	nmdc:mga0yw44_57379_c1	nmdc:mga0yw44_57379_c1_455_1108	217
1811	3300050494	nmdc:mga06z11_126_c1	nmdc:mga06z11_126_c1_7888_8544	217
1812	3300050494	nmdc:mga06z11_22_c1	nmdc:mga06z11_22_c1_19719_20372	217
1813	3300050494	nmdc:mga06z11_3088_c1	nmdc:mga06z11_3088_c1_985_1641	217
1814	3300050495	nmdc:mga04h51_1116_c2	nmdc:mga04h51_1116_c2_620_1276	217
1815	3300050495	nmdc:mga04h51_163_c1	nmdc:mga04h51_163_c1_10805_11458	217
1816	3300050495	nmdc:mga04h51_24145_c1	nmdc:mga04h51_24145_c1_384_1040	217
1817	3300050496	nmdc:mga07m45_49890_c1	nmdc:mga07m45_49890_c1_523_1176	217
1818	3300050507	nmdc:mga05p37_45245_c1	nmdc:mga05p37_45245_c1_118_774	217
1819	3300050508	nmdc:mga09592_517704_c1	nmdc:mga09592_517704_c1_64_720	217
1820	3300050509	nmdc:mga0qj67_168920_c1	nmdc:mga0qj67_168920_c1_932_1585	217
1821	3300050509	nmdc:mga0qj67_60645_c1	nmdc:mga0qj67_60645_c1_1945_2601	217
1822	3300050509	nmdc:mga0qj67_809215_c1	nmdc:mga0qj67_809215_c1_71_724	217
1823	3300050510	nmdc:mga06r32_171553_c1	nmdc:mga06r32_171553_c1_201_857	217
1824	3300050511	nmdc:mga08y16_64332_c1	nmdc:mga08y16_64332_c1_2381_3037	217
1825	3300050516	nmdc:mga0sz30_70841_c1	nmdc:mga0sz30_70841_c1_562_1215	217
1826	3300053087	Ga0500643_000375	Ga0500643_000375_3533_4186	217
1827	3300053087	Ga0500643_000783	Ga0500643_000783_9971_10624	217
1828	3300053087	Ga0500643_002356	Ga0500643_002356_4034_4687	217
1829	3300053090	Ga0500646_0103702	Ga0500646_0103702_226_879	217
1830	3300053093	Ga0500651_0002827	Ga0500651_0002827_6928_7659	217
1831	3300053108	Ga0500562_035667	Ga0500562_035667_153_806	217
1832	3300053116	Ga0500592_001209	Ga0500592_001209_709_1362	217
1833	3300053118	Ga0500594_0005302	Ga0500594_0005302_247_900	217
1834	3300053119	Ga0500595_020001	Ga0500595_020001_601_1257	217
1835	3300053125	Ga0500618_010106	Ga0500618_010106_132_863	217
1836	3300053130	Ga0500642_0008568	Ga0500642_0008568_2450_3181	217
1837	3300053133	Ga0500655_000037	Ga0500655_000037_25506_26237	217
1838	3300053136	Ga0500559_0010893	Ga0500559_0010893_939_1592	217
1839	3300053139	Ga0500568_0000005	Ga0500568_0000005_101502_102158	217
1840	3300053151	Ga0500604_0147294	Ga0500604_0147294_54_707	217
1841	3300053153	Ga0500616_0006756	Ga0500616_0006756_334_990	217
1842	3300053153	Ga0500616_0009010	Ga0500616_0009010_3157_3813	217
1843	3300053153	Ga0500616_0022520	Ga0500616_0022520_1210_1863	217
1844	3300053153	Ga0500616_0106097	Ga0500616_0106097_180_836	217
1845	3300053156	Ga0500622_0004929	Ga0500622_0004929_5674_6405	217
1846	3300053157	Ga0500624_000038	Ga0500624_000038_86191_86844	217
1847	3300053157	Ga0500624_000042	Ga0500624_000042_52400_53053	217
1848	3300053158	Ga0500627_0000105	Ga0500627_0000105_26031_26684	217
1849	3300053158	Ga0500627_0012150	Ga0500627_0012150_1499_2221	217
1850	3300053177	Ga0500636_0003715	Ga0500636_0003715_6284_6943	217
1851	3300053178	Ga0500637_0000047	Ga0500637_0000047_6620_7273	217
1852	3300053727	Ga0500611_000864	Ga0500611_000864_2033_2686	217
1853	3300053730	Ga0500645_005183	Ga0500645_005183_4172_4825	217
1854	3300053735	Ga0500596_011916	Ga0500596_011916_639_1292	217
1855	3300054114	Ga0501084_0014933	Ga0501084_0014933_1143_1799	217
1856	3300060353	Ga0501082_0008216	Ga0501082_0008216_2942_3598	217
1857	3300060353	Ga0501082_0151871	Ga0501082_0151871_242_895	217
1858	3300060353	Ga0501082_0166790	Ga0501082_0166790_1069_1725	217
1859	3300060353	Ga0501082_0771017	Ga0501082_0771017_104_760	217
1860	3300060353	Ga0501082_0947832	Ga0501082_0947832_30_683	217
1861	3300061734	Ga0530510_0130896	Ga0530510_0130896_881_1537	217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

2

207

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1vpx-assembly2.cif.gz_L	crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution	0.9913	1	207
1vpx-assembly1.cif.gz_D	crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution	0.9908	1	207
1vpx-assembly2.cif.gz_N	crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution	0.9902	1	205
1vpx-assembly1.cif.gz_H	crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution	0.9899	1	207
1vpx-assembly2.cif.gz_M	crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution	0.9885	1	203

ID	Description	Score	Start	End	Superfamily
3r8rB00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.98	1	210	3.20.20.70
3r8rB00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9664	1	210	3.20.20.70
1l6wA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9528	1	216	3.20.20.70
1l6wA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9443	1	216	3.20.20.70
af_A0A1L1QZF2_1_286_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9025	1	192	3.20.20.70

ID	Description	Score	Start	End	GO Terms
AF-A0A442LUU8-F1-model_v4	Fructose-6-phosphate aldolase	1.009	54	123	GO:0005975
AF-A0A3C1YWL9-F1-model_v4	Fructose-6-phosphate aldolase	1.003	109	189	GO:0005975
AF-A0A530QW44-F1-model_v4	Fructose-6-phosphate aldolase	1.002	1	124	GO:0005975
AF-A0A530KQ01-F1-model_v4	Fructose-6-phosphate aldolase	1.001	1	106	GO:0005975
AF-A0A7Y7CND4-F1-model_v4	Fructose-6-phosphate aldolase	1	1	170	GO:0005737 GO:0005975 GO:0016832

Feature Viewer

pLDDT	pTM	Quality
96.63	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495912

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

2

207

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map