metagRoot

F495859

General Info

Members	Datasets	Scaffolds	Average Seq Length
1839	651	1796	141

Family's Representative Sequence

Representative Sequence	3300009553\|Ga0105249_11847213\|Ga0105249_118472131
Length	170
Sequence	MRHGSSGRRLNRTSSHRKALFVNLATALIKHEQITTTLPKAKELRPIVEKLVTLGKRGASEAAALKSAVATAKDEKTRTAVTKSGKGKTLHPRRIALSQLRNDTETVAKLFDTLAPRYANRKGGYTRVLKAGFRFGDNAPMAVIEFIDRDVSAKGKDSGPVQAKAEEATA

Samples

	Sample ID	Description	Type	Environment
1	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
2	2508501050	Microvirga lupini Lut6	Isolate	Nodule
3	2508501114	Microvirga lotononidis WSM3557	Isolate	Nodule
4	2582581279	Caulobacter henricii OK261	Isolate	Rhizosphere
5	2582581280	Caulobacter henricii CF287	Isolate	Rhizosphere
6	2582581293	Caulobacter henricii YR570	Isolate	Rhizosphere
7	2585428106	Caulobacter sp. OV484	Isolate	Rhizosphere
8	2643221545	Caulobacter sp. Root1455	Isolate	Unclassified
9	2643221547	Pseudolabrys sp. Root1462	Isolate	Unclassified
10	2643221552	Caulobacter sp. Root1472	Isolate	Unclassified
11	2643221580	Devosia sp. Root635	Isolate	Unclassified
12	2643221584	Caulobacter sp. Root656	Isolate	Unclassified
13	2643221591	Devosia sp. Root685	Isolate	Unclassified
14	2643221640	Caulobacter sp. Root342	Isolate	Unclassified
15	2643221642	Caulobacter sp. Root343	Isolate	Unclassified
16	2643221674	Devosia sp. Root436	Isolate	Unclassified
17	2643221691	Caulobacter sp. Root487D2Y	Isolate	Unclassified
18	2643221733	Bosea sp. Root381	Isolate	Unclassified
19	2643221734	Bosea sp. Root670	Isolate	Unclassified
20	2643221736	Bosea sp. Root483D1	Isolate	Unclassified
21	2773857925	Microvirga vignae BR3299	Isolate	Unclassified
22	2775506901	Microvirga ossetica V5/3m	Isolate	Unclassified
23	2791355048	Caulobacter flavus CGMCC1 15093	Isolate	Rhizosphere
24	2818991435	Caulobacter henricii 536	Isolate	Unclassified
25	2818991454	Caulobacter rhizosphaerae 3260	Isolate	Rhizosphere
26	2818991467	Bosea vestrisii 3192	Isolate	Unclassified
27	2841760612	Bosea sp. Tri-49	Isolate	Nodule
28	2841911363	Bosea caraganae RCAM04685	Isolate	Nodule
29	2841917233	Bosea caraganae RCAM04680	Isolate	Nodule
30	2843744320	Caulobacter flavus RHGG3	Isolate	Unclassified
31	2844104063	Bosea sp. Tri-39	Isolate	Nodule
32	2849560528	Caulobacter zeae 410	Isolate	Unclassified
33	2849573788	Caulobacter endophyticus 774	Isolate	Unclassified
34	2851153111	Caulobacter radicis 736	Isolate	Unclassified
35	2851182111	Bosea sp. Tri-44	Isolate	Nodule
36	2851246043	Bosea sp. Tri-54	Isolate	Nodule
37	2857504554	Caulobacter sp. R-72291	Isolate	Unclassified
38	2882456835	Microvirga sp. KLBC 81	Isolate	Unclassified
39	2884298095	Microvirga thermotolerans HR1	Isolate	Rhizosphere
40	2898329390	Caulobacter sp. 602-2	Isolate	Rhizosphere
41	2917699015	Bosea sp. F3-2	Isolate	Rhizosphere
42	2928531327	Caulobacter sp. 1776	Isolate	Rhizosphere
43	2939669807	Kaistia defluvii 3207	Isolate	Rhizosphere
44	3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Metagenome	Rhizosphere
45	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
46	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
47	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
48	3300000045	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere	Metagenome	Rhizosphere
49	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
50	3300001430	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5	Metagenome	Rhizosphere
51	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
52	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
53	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
54	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
55	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
56	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
57	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
58	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
59	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
60	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
61	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
62	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
63	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
64	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
65	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
66	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
67	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
68	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
69	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
70	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
71	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
72	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
73	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
74	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
75	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
76	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
77	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
78	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
79	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
80	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
81	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
82	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
83	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
84	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
85	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
86	3300005277	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2)	Metagenome	Rhizosphere
87	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
88	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
89	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
90	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
91	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
92	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
93	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
94	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
95	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
96	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
97	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
98	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
99	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
100	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
101	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
102	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
103	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
104	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
105	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
106	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
107	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
108	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
109	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
110	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
111	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
112	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
113	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
114	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
115	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
116	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
117	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
118	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
119	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
120	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
121	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
122	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
123	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
124	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
125	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
126	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
127	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
128	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
129	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
130	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
131	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
132	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
133	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
134	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
135	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
136	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
137	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
138	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
139	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
140	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
141	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
142	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
143	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
144	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
145	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
146	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
147	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
148	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
149	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
150	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
151	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
152	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
153	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
154	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
155	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
156	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
157	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
158	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
159	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
160	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
161	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
162	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
163	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
164	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
165	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
166	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
167	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
168	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
169	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
170	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
171	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
172	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
173	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
174	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
175	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
176	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
177	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
178	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
179	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
180	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
181	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
182	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
183	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
184	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
185	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
186	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
187	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
188	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
189	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
190	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
191	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
192	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
193	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
194	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
195	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
196	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
197	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
198	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
199	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
200	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
201	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
202	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
203	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
204	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
205	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
206	3300012477	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610	Metagenome	Rhizosphere
207	3300012483	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610	Metagenome	Rhizosphere
208	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
209	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
210	3300012507	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610	Metagenome	Rhizosphere
211	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
212	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
213	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
214	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
215	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
216	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
217	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
218	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
219	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
220	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
221	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
222	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
223	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
224	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
225	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
226	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
227	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
228	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
229	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
230	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
231	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
232	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
233	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
234	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
235	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
236	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
238	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
239	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
240	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
241	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
242	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
243	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
244	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
245	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
246	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
247	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
248	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
249	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
250	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
326	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
328	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
332	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
333	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
334	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
335	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
336	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
337	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
338	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
339	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
340	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
341	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
342	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
343	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
344	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
345	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
346	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
347	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
348	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
349	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
350	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
351	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
352	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
353	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
354	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
355	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
356	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
357	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
358	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
359	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
360	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
361	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
362	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
363	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
364	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
365	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
366	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
367	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
368	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
369	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
370	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
371	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
372	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
373	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
374	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
375	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
376	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
377	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
378	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
379	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
380	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
381	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
382	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
383	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
384	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
385	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
386	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
387	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
388	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
389	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
390	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
391	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
392	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
393	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
394	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
395	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
396	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
397	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
398	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
399	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
400	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
401	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
402	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
403	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
404	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
405	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
406	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
407	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
408	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
409	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
410	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
411	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
412	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
413	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
414	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
415	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
416	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
417	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
418	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
419	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
420	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
421	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
422	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
423	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
424	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
425	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
426	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
427	3300042117	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937	Metagenome	Rhizosphere
428	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
429	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
430	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
431	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
432	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
433	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
434	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
435	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
436	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
437	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
438	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
439	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
440	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
441	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
442	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
443	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
444	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
445	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
446	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
447	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
448	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
449	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
450	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
451	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
452	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
453	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
454	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
455	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
456	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
457	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
458	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
459	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
460	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
461	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
462	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
463	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
464	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
465	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
466	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
467	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
468	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
469	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
470	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
471	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
472	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
473	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
474	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
475	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
476	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
477	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
478	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
479	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
480	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
481	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
482	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
483	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
484	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
485	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
486	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
487	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
488	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
489	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
490	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
491	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
492	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
493	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
494	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
495	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
496	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
497	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
498	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
499	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
500	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
501	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
502	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
503	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
504	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
505	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
506	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
507	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
508	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
509	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
510	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
511	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
512	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
513	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
514	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
515	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
516	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
517	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
518	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
519	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
520	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
521	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
522	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
523	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
524	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
525	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
526	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
527	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
528	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
529	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
530	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
531	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
532	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
533	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
534	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
535	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
536	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
537	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
538	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
539	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
540	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
541	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
542	3300049128	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
543	3300049160	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
544	3300049161	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
545	3300049528	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
546	3300049532	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
547	3300049533	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
548	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
549	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
550	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
551	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
552	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
553	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
554	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
555	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
556	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
557	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
558	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
559	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
560	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
561	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
562	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
563	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
564	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
565	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
566	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
567	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
568	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
569	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
570	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
571	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
572	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
573	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
574	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
575	3300049682	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought	Metagenome	Rhizosphere
576	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
577	3300049688	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought	Metagenome	Rhizosphere
578	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
579	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
580	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
581	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
582	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
583	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
584	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
585	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
586	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
587	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
588	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
589	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
590	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
591	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
592	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
593	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
594	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
595	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
596	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
597	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
598	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
599	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
600	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
601	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
602	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
603	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
604	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
605	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
606	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
607	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
608	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
609	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
610	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
611	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
612	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
613	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
614	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
615	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
616	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
617	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
618	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
619	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
620	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
621	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
622	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
623	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
624	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
625	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
626	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
627	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
628	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
629	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
630	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
631	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
632	3300053724	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere	Metagenome	Endosphere
633	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
634	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
635	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
636	3300059477	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
637	3300059490	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
638	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
639	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
640	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
641	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
642	3300059605	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
643	3300059639	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
644	3300059641	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
645	3300059644	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
646	3300059645	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
647	3300059653	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
648	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
649	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
650	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
651	8057529695	Bosea vestrisii A18/4-2	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	96.19
Metatranscriptomes	1.47
Isolates	2.34

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	7.72
Nodule	0.54
Rhizoplane	5.6
Rhizosphere	82.22
Stem	0
Stem Tuber	0
Unclassified	3.92

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	2214828544	2209111006	Bacteria	9115
2	ARcpr5oldR_c000035	3300000041	Bacteria	26838
3	ARcpr5oldR_c013874	3300000041	Bacteria	693
4	ARSoilYngRDRAFT_c00061	3300000042	Bacteria	17682
5	ARcpr5yngRDRAFT_c000075	3300000043	Bacteria	16570
6	ARSoilOldRDRAFT_c000053	3300000044	Bacteria	23841
7	ARCol0oldRDRAFT_c00087	3300000045	Bacteria	7959
8	ARCol0yngRDRAFT_1000025	3300000652	Bacteria	26845
9	ARCol0yngRDRAFT_1012791	3300000652	Bacteria	623
10	JGI24032J14994_101529	3300001430	Bacteria	945
11	JGI24736J21556_1052541	3300001904	Bacteria	628
12	JGI24752J21851_1005842	3300001976	Bacteria	1608
13	JGI24746J21847_1002046	3300001977	Bacteria	3222
14	JGI24746J21847_1040743	3300001977	Bacteria	646
15	JGI24747J21853_1000618	3300001978	Bacteria	2319
16	JGI24739J22299_10009158	3300001989	Bacteria	3694
17	JGI24739J22299_10138012	3300001989	Bacteria	723
18	JGI24737J22298_10000053	3300001990	Bacteria	34054
19	JGI24737J22298_10003938	3300001990	Bacteria	5199
20	JGI24743J22301_10029537	3300001991	Bacteria	1076
21	JGI24743J22301_10056605	3300001991	Bacteria	804
22	JGI24735J21928_10130648	3300002067	Bacteria	724
23	JGI24750J21931_1000316	3300002070	Bacteria	8271
24	JGI24750J21931_1036500	3300002070	Bacteria	736
25	JGI24745J21846_1000643	3300002073	Bacteria	3139
26	JGI24748J21848_1000202	3300002074	Bacteria	7585
27	JGI24748J21848_1019407	3300002074	Bacteria	817
28	JGI24748J21848_1044346	3300002074	Bacteria	571
29	JGI24738J21930_10002704	3300002075	Bacteria	4569
30	JGI24749J21850_1001031	3300002076	Bacteria	3960
31	JGI24749J21850_1001860	3300002076	Bacteria	2985
32	JGI24744J21845_10002303	3300002077	Bacteria	3890
33	JGI24035J26624_1000222	3300002126	Bacteria	5221
34	JGI24033J26618_1000271	3300002155	Bacteria	5703
35	JGI24034J26672_10000885	3300002239	Bacteria	3903
36	JGI24034J26672_10035010	3300002239	Bacteria	829
37	JGI24034J26672_10054528	3300002239	Bacteria	692
38	JGI24742J22300_10001096	3300002244	Bacteria	4195
39	JGI24742J22300_10064289	3300002244	Bacteria	678
40	JGI24751J29686_10066619	3300002459	Bacteria	741
41	JGI25159J45721_1003766	3300002987	Bacteria	5236
42	JGI25151J46595_10080305	3300003187	Bacteria	947
43	JGI25153J46596_10000840	3300003215	Bacteria	18803
44	JGI25153J46596_10038289	3300003215	Bacteria	1514
45	rootL2_10314731	3300003322	Bacteria	1478
46	JGI25160J50197_1050906	3300003354	Bacteria	879
47	Ga0006562J51391_1021791	3300003578	Bacteria	2745
48	Ga0055526_1000275	3300003771	Bacteria	43477
49	Ga0055526_1000920	3300003771	Bacteria	21832
50	Ga0055526_1083877	3300003771	Bacteria	615
51	Ga0055537_1005208	3300003773	Bacteria	3533
52	Ga0055537_1005245	3300003773	Bacteria	3516
53	Ga0055524_1002898	3300003775	Bacteria	8570
54	Ga0055536_1001081	3300003781	Bacteria	17158
55	Ga0055536_1001342	3300003781	Bacteria	15004
56	Ga0055534_1016781	3300003784	Bacteria	1307
57	Ga0055528_1009498	3300003790	Bacteria	4054
58	Ga0055528_1016153	3300003790	Bacteria	2656
59	Ga0055530_10005358	3300003791	Bacteria	6132
60	Ga0055530_10045935	3300003791	Bacteria	1039
61	Ga0055531_10001386	3300003794	Bacteria	17956
62	Ga0055531_10004281	3300003794	Bacteria	8764
63	Ga0055543_1016442	3300004625	Bacteria	1407
64	Ga0065165_1000631	3300005262	Bacteria	51108
65	Ga0065165_1001803	3300005262	Bacteria	21053
66	Ga0065716_1001548	3300005277	Bacteria	7149
67	Ga0065704_10079520	3300005289	Bacteria	4140
68	Ga0065712_10071805	3300005290	Bacteria	5055
69	Ga0065712_10095183	3300005290	Bacteria	2227
70	Ga0065712_10125519	3300005290	Bacteria	1613
71	Ga0065715_10003868	3300005293	Bacteria	9723
72	Ga0065715_10107102	3300005293	Bacteria	2790
73	Ga0065715_10419537	3300005293	Bacteria	849
74	Ga0070658_10000405	3300005327	Bacteria	37355
75	Ga0070658_10012043	3300005327	Bacteria	6946
76	Ga0070658_10090763	3300005327	Bacteria	2517
77	Ga0070676_10002419	3300005328	Bacteria	9571
78	Ga0070676_10055252	3300005328	Bacteria	2342
79	Ga0070676_10370022	3300005328	Bacteria	990
80	Ga0070683_100001083	3300005329	Bacteria	20468
81	Ga0070683_100016861	3300005329	Bacteria	6444
82	Ga0070683_100345160	3300005329	Bacteria	1418
83	Ga0070683_101222606	3300005329	Bacteria	722
84	Ga0070683_101236990	3300005329	Bacteria	718
85	Ga0070690_100037082	3300005330	Bacteria	3070
86	Ga0070690_100094557	3300005330	Bacteria	1972
87	Ga0070690_100484329	3300005330	Bacteria	923
88	Ga0070670_100000958	3300005331	Bacteria	22640
89	Ga0070670_100016356	3300005331	Bacteria	6370
90	Ga0070677_10000959	3300005333	Bacteria	9319
91	Ga0070677_10484401	3300005333	Bacteria	668
92	Ga0068869_100000279	3300005334	Bacteria	27008
93	Ga0068869_100171999	3300005334	Bacteria	1693
94	Ga0070666_10007596	3300005335	Bacteria	6689
95	Ga0070666_10032735	3300005335	Bacteria	3435
96	Ga0070666_10049363	3300005335	Bacteria	2828
97	Ga0070666_10129060	3300005335	Bacteria	1756
98	Ga0070680_100006856	3300005336	Bacteria	8685
99	Ga0070680_100213957	3300005336	Bacteria	1626
100	Ga0070680_100352392	3300005336	Bacteria	1252
101	Ga0070682_100001636	3300005337	Bacteria	12449
102	Ga0070682_100129362	3300005337	Bacteria	1707
103	Ga0070682_100182048	3300005337	Bacteria	1469
104	Ga0068868_100047103	3300005338	Bacteria	3377
105	Ga0068868_100135205	3300005338	Bacteria	2020
106	Ga0068868_100696370	3300005338	Bacteria	909
107	Ga0070660_100000194	3300005339	Bacteria	40512
108	Ga0070660_100000245	3300005339	Bacteria	35915
109	Ga0070660_100015793	3300005339	Bacteria	5462
110	Ga0070660_100028369	3300005339	Bacteria	4187
111	Ga0070660_100063233	3300005339	Bacteria	2877
112	Ga0070660_100230106	3300005339	Bacteria	1508
113	Ga0070660_100291345	3300005339	Bacteria	1337
114	Ga0070660_100577933	3300005339	Bacteria	938
115	Ga0070689_100005690	3300005340	Bacteria	8547
116	Ga0070689_100011434	3300005340	Bacteria	6358
117	Ga0070689_100049911	3300005340	Bacteria	3231
118	Ga0070689_100461167	3300005340	Bacteria	1083
119	Ga0070691_10004019	3300005341	Bacteria	6659
120	Ga0070691_10005769	3300005341	Bacteria	5647
121	Ga0070687_100000348	3300005343	Bacteria	15751
122	Ga0070687_100016285	3300005343	Bacteria	3386
123	Ga0070661_100000017	3300005344	Bacteria	153232
124	Ga0070661_100001887	3300005344	Bacteria	14515
125	Ga0070661_100057639	3300005344	Bacteria	2846
126	Ga0070661_100125850	3300005344	Bacteria	1922
127	Ga0070661_100185229	3300005344	Bacteria	1586
128	Ga0070661_100211232	3300005344	Bacteria	1486
129	Ga0070661_100324615	3300005344	Bacteria	1203
130	Ga0070692_10000101	3300005345	Bacteria	19118
131	Ga0070668_100003604	3300005347	Bacteria	11429
132	Ga0070668_100006389	3300005347	Bacteria	8731
133	Ga0070668_100035298	3300005347	Bacteria	3812
134	Ga0070668_101256697	3300005347	Bacteria	672
135	Ga0070669_100000314	3300005353	Bacteria	37924
136	Ga0070669_100066858	3300005353	Bacteria	2650
137	Ga0070669_100288991	3300005353	Bacteria	1315
138	Ga0070669_101542334	3300005353	Bacteria	578
139	Ga0070675_100000161	3300005354	Bacteria	40950
140	Ga0070675_100060089	3300005354	Bacteria	3137
141	Ga0070675_100366217	3300005354	Bacteria	1281
142	Ga0070675_100989964	3300005354	Bacteria	772
143	Ga0070671_100000313	3300005355	Bacteria	32932
144	Ga0070671_100204120	3300005355	Bacteria	1676
145	Ga0070674_100010750	3300005356	Bacteria	5549
146	Ga0070674_100126801	3300005356	Bacteria	1897
147	Ga0070674_100960273	3300005356	Bacteria	748
148	Ga0070673_100005466	3300005364	Bacteria	8132
149	Ga0070673_100047061	3300005364	Bacteria	3354
150	Ga0070673_100743707	3300005364	Bacteria	903
151	Ga0070688_100000991	3300005365	Bacteria	14237
152	Ga0070688_100004219	3300005365	Bacteria	7469
153	Ga0070688_100158236	3300005365	Bacteria	1555
154	Ga0070688_100246748	3300005365	Bacteria	1270
155	Ga0070688_100595067	3300005365	Bacteria	846
156	Ga0070659_100004960	3300005366	Bacteria	9523
157	Ga0070659_100017906	3300005366	Bacteria	5337
158	Ga0070659_100060508	3300005366	Bacteria	2991
159	Ga0070659_100062678	3300005366	Bacteria	2939
160	Ga0070659_100173891	3300005366	Bacteria	1765
161	Ga0070659_100368689	3300005366	Bacteria	1208
162	Ga0070659_100753650	3300005366	Bacteria	845
163	Ga0070667_100002468	3300005367	Bacteria	16147
164	Ga0070667_100006114	3300005367	Bacteria	10001
165	Ga0070667_100029696	3300005367	Bacteria	4557
166	Ga0070667_100079601	3300005367	Bacteria	2801
167	Ga0070667_100371510	3300005367	Bacteria	1298
168	Ga0070667_100454604	3300005367	Bacteria	1170
169	Ga0070667_101120756	3300005367	Bacteria	736
170	Ga0070703_10294031	3300005406	Bacteria	675
171	Ga0070709_10003934	3300005434	Bacteria	8011
172	Ga0070709_10155424	3300005434	Bacteria	1585
173	Ga0070709_11054020	3300005434	Bacteria	649
174	Ga0070714_100020135	3300005435	Bacteria	5444
175	Ga0070714_100063678	3300005435	Bacteria	3172
176	Ga0070714_100193773	3300005435	Bacteria	1856
177	Ga0070713_100001694	3300005436	Bacteria	14164
178	Ga0070713_100005492	3300005436	Bacteria	8678
179	Ga0070713_100578339	3300005436	Bacteria	1065
180	Ga0070710_10124781	3300005437	Bacteria	1563
181	Ga0070710_10148545	3300005437	Bacteria	1443
182	Ga0070701_10000204	3300005438	Bacteria	18457
183	Ga0070711_100007210	3300005439	Bacteria	6753
184	Ga0070711_100027936	3300005439	Bacteria	3708
185	Ga0070711_100825307	3300005439	Bacteria	788
186	Ga0070705_100004847	3300005440	Bacteria	6546
187	Ga0070705_100119436	3300005440	Bacteria	1699
188	Ga0070705_100550111	3300005440	Bacteria	885
189	Ga0070700_100000856	3300005441	Bacteria	15021
190	Ga0070700_100264673	3300005441	Bacteria	1239
191	Ga0070694_100004005	3300005444	Bacteria	8822
192	Ga0070694_100021165	3300005444	Bacteria	4152
193	Ga0070694_100816170	3300005444	Bacteria	766
194	Ga0070708_100807769	3300005445	Bacteria	882
195	Ga0070663_100000945	3300005455	Bacteria	15785
196	Ga0070663_100025979	3300005455	Bacteria	3960
197	Ga0070663_100173211	3300005455	Bacteria	1669
198	Ga0070663_100525414	3300005455	Bacteria	986
199	Ga0070663_100740194	3300005455	Bacteria	839
200	Ga0070663_101003730	3300005455	Bacteria	726
201	Ga0070678_100002374	3300005456	Bacteria	10296
202	Ga0070678_100027687	3300005456	Bacteria	3852
203	Ga0070662_100016561	3300005457	Bacteria	4951
204	Ga0070662_100070175	3300005457	Bacteria	2581
205	Ga0070662_100774537	3300005457	Bacteria	815
206	Ga0070681_10005192	3300005458	Bacteria	12569
207	Ga0070681_10014751	3300005458	Bacteria	7769
208	Ga0070681_10019257	3300005458	Bacteria	6829
209	Ga0070681_10284907	3300005458	Bacteria	1563
210	Ga0070681_10446991	3300005458	Bacteria	1204
211	Ga0070681_10925106	3300005458	Bacteria	791
212	Ga0068867_100002227	3300005459	Bacteria	13620
213	Ga0068867_100088867	3300005459	Bacteria	2342
214	Ga0068867_100313773	3300005459	Bacteria	1296
215	Ga0068867_101099870	3300005459	Bacteria	725
216	Ga0070685_10015964	3300005466	Bacteria	3995
217	Ga0070685_10110448	3300005466	Bacteria	1692
218	Ga0070685_10439327	3300005466	Bacteria	912
219	Ga0070679_100002050	3300005530	Bacteria	18095
220	Ga0070679_100014413	3300005530	Bacteria	7593
221	Ga0070679_100213700	3300005530	Bacteria	1891
222	Ga0070679_100216920	3300005530	Bacteria	1875
223	Ga0070679_100297286	3300005530	Bacteria	1565
224	Ga0070679_100366055	3300005530	Bacteria	1389
225	Ga0070679_100829968	3300005530	Bacteria	867
226	Ga0070679_101010799	3300005530	Bacteria	776
227	Ga0070684_100000365	3300005535	Bacteria	31110
228	Ga0070684_100087253	3300005535	Bacteria	2770
229	Ga0070684_101939168	3300005535	Bacteria	556
230	Ga0068853_100000888	3300005539	Bacteria	20812
231	Ga0068853_100002095	3300005539	Bacteria	14797
232	Ga0068853_100051852	3300005539	Bacteria	3532
233	Ga0068853_100129423	3300005539	Bacteria	2258
234	Ga0068853_100186047	3300005539	Bacteria	1885
235	Ga0068853_100535399	3300005539	Bacteria	1108
236	Ga0068853_100623874	3300005539	Bacteria	1025
237	Ga0068853_101232420	3300005539	Bacteria	723
238	Ga0068853_101289715	3300005539	Bacteria	706
239	Ga0070672_100133658	3300005543	Bacteria	2041
240	Ga0070672_100137939	3300005543	Bacteria	2009
241	Ga0070672_100427335	3300005543	Bacteria	1138
242	Ga0070686_100002828	3300005544	Bacteria	9562
243	Ga0070686_100007402	3300005544	Bacteria	6123
244	Ga0070686_100030622	3300005544	Bacteria	3283
245	Ga0070686_100087922	3300005544	Bacteria	2072
246	Ga0070695_100001044	3300005545	Bacteria	15130
247	Ga0070695_100012934	3300005545	Bacteria	5010
248	Ga0070695_100097770	3300005545	Bacteria	1971
249	Ga0070696_100020206	3300005546	Bacteria	4514
250	Ga0070696_100020830	3300005546	Bacteria	4443
251	Ga0070696_100090809	3300005546	Bacteria	2174
252	Ga0070696_101263712	3300005546	Bacteria	626
253	Ga0070693_100000905	3300005547	Bacteria	13209
254	Ga0070693_100323539	3300005547	Bacteria	1047
255	Ga0070665_100001301	3300005548	Bacteria	29880
256	Ga0070665_100160855	3300005548	Bacteria	2248
257	Ga0070665_100311311	3300005548	Bacteria	1578
258	Ga0070665_100378688	3300005548	Bacteria	1422
259	Ga0070704_100001366	3300005549	Bacteria	12945
260	Ga0070704_100025213	3300005549	Bacteria	3912
261	Ga0068855_100003629	3300005563	Bacteria	18867
262	Ga0068855_100075649	3300005563	Bacteria	3909
263	Ga0068855_100114453	3300005563	Bacteria	3092
264	Ga0068855_100137323	3300005563	Bacteria	2788
265	Ga0068855_100264372	3300005563	Bacteria	1915
266	Ga0068855_100400837	3300005563	Bacteria	1503
267	Ga0068855_100501488	3300005563	Bacteria	1319
268	Ga0068855_102059004	3300005563	Bacteria	575
269	Ga0070664_100002074	3300005564	Bacteria	16005
270	Ga0070664_100608388	3300005564	Bacteria	1014
271	Ga0070664_100736674	3300005564	Bacteria	919
272	Ga0070664_100850633	3300005564	Bacteria	854
273	Ga0068857_100003594	3300005577	Bacteria	12976
274	Ga0068857_100131678	3300005577	Bacteria	2256
275	Ga0068857_100354734	3300005577	Bacteria	1359
276	Ga0068857_100590871	3300005577	Bacteria	1049
277	Ga0068857_101170800	3300005577	Bacteria	744
278	Ga0068854_100000749	3300005578	Bacteria	19195
279	Ga0068854_100027059	3300005578	Bacteria	3948
280	Ga0068854_100082485	3300005578	Bacteria	2377
281	Ga0068854_100182154	3300005578	Bacteria	1641
282	Ga0068854_100223561	3300005578	Bacteria	1490
283	Ga0068854_100562371	3300005578	Bacteria	969
284	Ga0068854_100783937	3300005578	Bacteria	829
285	Ga0068856_100000902	3300005614	Bacteria	31812
286	Ga0068856_100028895	3300005614	Bacteria	5417
287	Ga0068856_100162783	3300005614	Bacteria	2242
288	Ga0068856_100335526	3300005614	Bacteria	1530
289	Ga0068856_100396437	3300005614	Bacteria	1400
290	Ga0068856_100407308	3300005614	Bacteria	1380
291	Ga0070702_100064678	3300005615	Bacteria	2140
292	Ga0070702_100246552	3300005615	Bacteria	1208
293	Ga0070702_100742900	3300005615	Bacteria	753
294	Ga0068852_100004111	3300005616	Bacteria	10239
295	Ga0068852_100018805	3300005616	Bacteria	5451
296	Ga0068852_100031702	3300005616	Bacteria	4367
297	Ga0068852_100100954	3300005616	Bacteria	2604
298	Ga0068852_100146105	3300005616	Bacteria	2193
299	Ga0068852_100208816	3300005616	Bacteria	1851
300	Ga0068852_100227334	3300005616	Bacteria	1777
301	Ga0068852_100326571	3300005616	Bacteria	1491
302	Ga0068859_100006839	3300005617	Bacteria	11585
303	Ga0068859_100054917	3300005617	Bacteria	4007
304	Ga0068859_100211558	3300005617	Bacteria	2025
305	Ga0068864_100000263	3300005618	Bacteria	47003
306	Ga0068864_100000595	3300005618	Bacteria	30701
307	Ga0068864_100529441	3300005618	Bacteria	1137
308	Ga0068866_10036273	3300005718	Bacteria	2414
309	Ga0068866_10081678	3300005718	Bacteria	1737
310	Ga0068866_10368663	3300005718	Bacteria	918
311	Ga0068861_100000825	3300005719	Bacteria	18722
312	Ga0068861_100021865	3300005719	Bacteria	4601
313	Ga0068851_10002106	3300005834	Bacteria	8757
314	Ga0068851_10341964	3300005834	Bacteria	869
315	Ga0068870_10000112	3300005840	Bacteria	27710
316	Ga0068870_11317301	3300005840	Bacteria	527
317	Ga0068863_100000703	3300005841	Bacteria	33695
318	Ga0068863_100001518	3300005841	Bacteria	22925
319	Ga0068863_100388391	3300005841	Bacteria	1364
320	Ga0068863_100524179	3300005841	Bacteria	1168
321	Ga0068858_100001726	3300005842	Bacteria	22336
322	Ga0068858_100042730	3300005842	Bacteria	4202
323	Ga0068858_100254531	3300005842	Bacteria	1668
324	Ga0068860_100001684	3300005843	Bacteria	23610
325	Ga0068860_100070125	3300005843	Bacteria	3332
326	Ga0068860_100175120	3300005843	Bacteria	2073
327	Ga0068860_101732165	3300005843	Bacteria	647
328	Ga0068860_101927043	3300005843	Bacteria	612
329	Ga0068862_100004649	3300005844	Bacteria	11570
330	Ga0068862_100030534	3300005844	Bacteria	4542
331	Ga0068862_100051035	3300005844	Bacteria	3537
332	Ga0068862_100055325	3300005844	Bacteria	3398
333	Ga0068862_100773640	3300005844	Bacteria	936
334	Ga0068862_100853065	3300005844	Bacteria	893
335	Ga0081455_10000048	3300005937	Bacteria	126551
336	Ga0081455_10013465	3300005937	Bacteria	8080
337	Ga0081455_10033778	3300005937	Bacteria	4592
338	Ga0081455_10042965	3300005937	Bacteria	3960
339	Ga0070717_10016855	3300006028	Bacteria	5671
340	Ga0070717_10044826	3300006028	Bacteria	3614
341	Ga0070717_10144489	3300006028	Bacteria	2054
342	Ga0070717_10371867	3300006028	Bacteria	1281
343	Ga0070717_10653452	3300006028	Bacteria	954
344	Ga0070717_11916714	3300006028	Bacteria	535
345	Ga0075365_10019024	3300006038	Bacteria	4231
346	Ga0075365_10106583	3300006038	Bacteria	1923
347	Ga0075365_10144763	3300006038	Bacteria	1651
348	Ga0075365_10252425	3300006038	Bacteria	1239
349	Ga0075365_10445390	3300006038	Bacteria	914
350	Ga0075368_10035915	3300006042	Bacteria	1935
351	Ga0075363_100020925	3300006048	Bacteria	3286
352	Ga0075363_100320370	3300006048	Bacteria	902
353	Ga0075363_100405458	3300006048	Bacteria	801
354	Ga0075364_10082083	3300006051	Bacteria	2132
355	Ga0075432_10005250	3300006058	Bacteria	4410
356	Ga0070715_10361415	3300006163	Bacteria	796
357	Ga0070715_10581169	3300006163	Bacteria	654
358	Ga0070716_100000346	3300006173	Bacteria	18854
359	Ga0070716_100222150	3300006173	Bacteria	1270
360	Ga0070716_100769423	3300006173	Bacteria	742
361	Ga0070712_100427960	3300006175	Bacteria	1098
362	Ga0070712_101987509	3300006175	Bacteria	509
363	Ga0075362_10126521	3300006177	Bacteria	1213
364	Ga0075362_10153595	3300006177	Bacteria	1105
365	Ga0075362_10310829	3300006177	Bacteria	783
366	Ga0075367_10193023	3300006178	Bacteria	1271
367	Ga0075367_10584569	3300006178	Bacteria	709
368	Ga0075369_10011991	3300006186	Bacteria	3418
369	Ga0075369_10030260	3300006186	Bacteria	2279
370	Ga0075366_10044798	3300006195	Bacteria	2622
371	Ga0097621_100000600	3300006237	Bacteria	25393
372	Ga0097621_100008260	3300006237	Bacteria	7491
373	Ga0075370_10106559	3300006353	Bacteria	1625
374	Ga0075370_10188054	3300006353	Bacteria	1216
375	Ga0075370_10635433	3300006353	Bacteria	648
376	Ga0068871_100000118	3300006358	Bacteria	49211
377	Ga0068871_100003511	3300006358	Bacteria	10792
378	Ga0075428_100006364	3300006844	Bacteria	13140
379	Ga0075430_100000196	3300006846	Bacteria	40930
380	Ga0075431_100001183	3300006847	Bacteria	23547
381	Ga0075433_10000991	3300006852	Bacteria	20176
382	Ga0075433_10028945	3300006852	Bacteria	4714
383	Ga0075433_10163728	3300006852	Bacteria	1979
384	Ga0075433_10233922	3300006852	Bacteria	1631
385	Ga0075434_100001106	3300006871	Bacteria	22102
386	Ga0075434_100080382	3300006871	Bacteria	3256
387	Ga0075434_100104609	3300006871	Bacteria	2840
388	Ga0075434_101596942	3300006871	Bacteria	661
389	Ga0075429_100007323	3300006880	Bacteria	9578
390	Ga0075429_101497641	3300006880	Bacteria	587
391	Ga0068865_100002402	3300006881	Bacteria	11045
392	Ga0068865_100038417	3300006881	Bacteria	3240
393	Ga0068865_100067118	3300006881	Bacteria	2532
394	Ga0068865_100201864	3300006881	Bacteria	1544
395	Ga0075436_100009765	3300006914	Bacteria	6566
396	Ga0075436_100097101	3300006914	Bacteria	2050
397	Ga0075436_100214920	3300006914	Bacteria	1364
398	Ga0075436_100388473	3300006914	Bacteria	1010
399	Ga0097620_100006838	3300006931	Bacteria	11585
400	Ga0097620_100054915	3300006931	Bacteria	4007
401	Ga0097620_100211555	3300006931	Bacteria	2025
402	Ga0079104_1022643	3300006946	Bacteria	1687
403	Ga0075435_100115534	3300007076	Bacteria	2235
404	Ga0075435_100215645	3300007076	Bacteria	1629
405	Ga0075435_100239825	3300007076	Bacteria	1542
406	Ga0075435_100309981	3300007076	Bacteria	1350
407	Ga0075435_100344124	3300007076	Bacteria	1278
408	Ga0075435_100505079	3300007076	Bacteria	1045
409	Ga0099795_10109740	3300007788	Bacteria	1092
410	Ga0105251_10082861	3300009011	Bacteria	1481
411	Ga0105251_10309869	3300009011	Bacteria	716
412	Ga0105250_10222360	3300009092	Bacteria	801
413	Ga0105240_10049745	3300009093	Bacteria	5288
414	Ga0105240_10069122	3300009093	Bacteria	4372
415	Ga0105240_10248193	3300009093	Bacteria	2060
416	Ga0105240_10916279	3300009093	Bacteria	942
417	Ga0105240_11017359	3300009093	Bacteria	885
418	Ga0105240_11251023	3300009093	Bacteria	784
419	Ga0111539_10000683	3300009094	Bacteria	43914
420	Ga0111539_10001167	3300009094	Bacteria	34770
421	Ga0111539_10004804	3300009094	Bacteria	17625
422	Ga0111539_10905048	3300009094	Bacteria	1026
423	Ga0111539_10947505	3300009094	Bacteria	1001
424	Ga0111539_11742734	3300009094	Bacteria	722
425	Ga0111539_13139781	3300009094	Bacteria	533
426	Ga0105245_10001982	3300009098	Bacteria	18594
427	Ga0105245_10064026	3300009098	Bacteria	3323
428	Ga0105245_10565043	3300009098	Bacteria	1161
429	Ga0105245_11262931	3300009098	Bacteria	787
430	Ga0105245_11979628	3300009098	Bacteria	636
431	Ga0105247_10055580	3300009101	Bacteria	2443
432	Ga0114129_10008051	3300009147	Bacteria	15018
433	Ga0114129_10085770	3300009147	Bacteria	4368
434	Ga0114129_10387596	3300009147	Bacteria	1844
435	Ga0114129_10634225	3300009147	Bacteria	1381
436	Ga0105243_10002278	3300009148	Bacteria	16096
437	Ga0105243_10291729	3300009148	Bacteria	1474
438	Ga0105243_10455669	3300009148	Bacteria	1201
439	Ga0105241_10003555	3300009174	Bacteria	11590
440	Ga0105241_10039914	3300009174	Bacteria	3541
441	Ga0105241_10413062	3300009174	Bacteria	1186
442	Ga0105242_10001156	3300009176	Bacteria	20789
443	Ga0105242_10009023	3300009176	Bacteria	7661
444	Ga0105242_10148979	3300009176	Bacteria	2039
445	Ga0105248_10049118	3300009177	Bacteria	4733
446	Ga0105248_10171207	3300009177	Bacteria	2447
447	Ga0105248_13455631	3300009177	Bacteria	501
448	Ga0105237_10044472	3300009545	Bacteria	4471
449	Ga0105237_10111975	3300009545	Bacteria	2721
450	Ga0105237_10130725	3300009545	Bacteria	2505
451	Ga0105237_10379249	3300009545	Bacteria	1419
452	Ga0105237_10805836	3300009545	Bacteria	946
453	Ga0105238_10033303	3300009551	Bacteria	5244
454	Ga0105238_10130434	3300009551	Bacteria	2492
455	Ga0105238_10141219	3300009551	Bacteria	2385
456	Ga0105238_10404006	3300009551	Bacteria	1359
457	Ga0105238_10701334	3300009551	Bacteria	1024
458	Ga0105238_11499181	3300009551	Bacteria	703
459	Ga0105249_10001021	3300009553	Bacteria	24754
460	Ga0105249_10004402	3300009553	Bacteria	12181
461	Ga0105249_10006960	3300009553	Bacteria	9861
462	Ga0105249_10516843	3300009553	Bacteria	1241
463	Ga0105249_11847213	3300009553	Bacteria	677
464	Ga0099796_10002051	3300010159	Bacteria	4301
465	Ga0099796_10005742	3300010159	Bacteria	3119
466	Ga0105239_10048998	3300010375	Bacteria	4632
467	Ga0105239_10810853	3300010375	Bacteria	1073
468	Ga0105239_11157988	3300010375	Bacteria	891
469	Ga0105239_11360476	3300010375	Bacteria	819
470	Ga0105246_10008411	3300011119	Bacteria	6343
471	Ga0105246_10034231	3300011119	Bacteria	3383
472	Ga0105246_10117720	3300011119	Bacteria	1963
473	Ga0105246_10640356	3300011119	Bacteria	924
474	Ga0157336_1008419	3300012477	Bacteria	749
475	Ga0157337_1000692	3300012483	Bacteria	1596
476	Ga0157319_1003618	3300012497	Bacteria	967
477	Ga0157347_1023784	3300012502	Bacteria	732
478	Ga0157342_1025288	3300012507	Bacteria	716
479	Ga0157373_10038612	3300013100	Bacteria	3422
480	Ga0157373_10086510	3300013100	Bacteria	2209
481	Ga0157371_10014106	3300013102	Bacteria	6044
482	Ga0157371_10023273	3300013102	Bacteria	4530
483	Ga0157371_10064446	3300013102	Bacteria	2596
484	Ga0157371_10303470	3300013102	Bacteria	1156
485	Ga0157371_10404139	3300013102	Bacteria	1000
486	Ga0157370_10132979	3300013104	Bacteria	2320
487	Ga0157370_10332176	3300013104	Bacteria	1401
488	Ga0157369_10197999	3300013105	Bacteria	2109
489	Ga0157369_10601071	3300013105	Bacteria	1135
490	Ga0157369_11132995	3300013105	Bacteria	799
491	Ga0157369_11258388	3300013105	Bacteria	755
492	Ga0157369_12301488	3300013105	Bacteria	546
493	Ga0157374_10056369	3300013296	Bacteria	3668
494	Ga0157374_10740492	3300013296	Bacteria	997
495	Ga0157374_11303207	3300013296	Bacteria	748
496	Ga0157378_10002986	3300013297	Bacteria	15027
497	Ga0157378_11783380	3300013297	Bacteria	663
498	Ga0163162_10009279	3300013306	Bacteria	9569
499	Ga0163162_10020735	3300013306	Bacteria	6461
500	Ga0163162_10650339	3300013306	Bacteria	1178
501	Ga0157372_10008348	3300013307	Bacteria	11015
502	Ga0157372_10337572	3300013307	Bacteria	1755
503	Ga0157372_10525128	3300013307	Bacteria	1380
504	Ga0157372_10713418	3300013307	Bacteria	1167
505	Ga0157375_10000508	3300013308	Bacteria	35108
506	Ga0157375_10219570	3300013308	Bacteria	2059
507	Ga0157375_11571436	3300013308	Bacteria	777
508	Ga0163163_10002310	3300014325	Bacteria	16099
509	Ga0163163_10008126	3300014325	Bacteria	9301
510	Ga0163163_10102634	3300014325	Bacteria	2884
511	Ga0157380_10000212	3300014326	Bacteria	34358
512	Ga0157380_10739100	3300014326	Bacteria	994
513	Ga0157380_11311583	3300014326	Bacteria	771
514	Ga0157377_10000287	3300014745	Bacteria	24040
515	Ga0157377_10024735	3300014745	Bacteria	3195
516	Ga0157379_10040541	3300014968	Bacteria	4156
517	Ga0157379_10066845	3300014968	Bacteria	3214
518	Ga0157379_10223529	3300014968	Bacteria	1706
519	Ga0157379_10458243	3300014968	Bacteria	1178
520	Ga0157379_11002299	3300014968	Bacteria	796
521	Ga0157376_10008731	3300014969	Bacteria	7325
522	Ga0157376_12046797	3300014969	Bacteria	611
523	Ga0182006_1198001	3300015261	Bacteria	666
524	Ga0163161_10000415	3300017792	Bacteria	35797
525	Ga0163161_10271692	3300017792	Bacteria	1327
526	Ga0206356_10264681	3300020070	Bacteria	591
527	Ga0206356_11728648	3300020070	Bacteria	506
528	Ga0206352_11051188	3300020078	Bacteria	682
529	Ga0206353_11366343	3300020082	Bacteria	621
530	Ga0213873_10129740	3300021358	Bacteria	746
531	Ga0213872_10059812	3300021361	Bacteria	1724
532	Ga0213876_10032629	3300021384	Bacteria	2746
533	Ga0213876_10245610	3300021384	Bacteria	951
534	Ga0213875_10050853	3300021388	Bacteria	1941
535	Ga0213875_10267217	3300021388	Bacteria	807
536	Ga0209233_1013658	3300025261	Bacteria	2315
537	Ga0209565_1000925	3300025263	Bacteria	15538
538	Ga0207666_1000073	3300025271	Bacteria	16742
539	Ga0207666_1002790	3300025271	Bacteria	2123
540	Ga0209673_1002524	3300025273	Bacteria	12545
541	Ga0209130_1000375	3300025284	Bacteria	50482
542	Ga0207673_1001315	3300025290	Bacteria	2690
543	Ga0209675_1012787	3300025291	Bacteria	2677
544	Ga0209676_1000184	3300025292	Bacteria	143543
545	Ga0209676_1001543	3300025292	Bacteria	20759
546	Ga0209676_1019806	3300025292	Bacteria	2304
547	Ga0209025_1000014	3300025294	Bacteria	865448
548	Ga0209025_1011370	3300025294	Bacteria	5875
549	Ga0209025_1039298	3300025294	Bacteria	2066
550	Ga0209564_1000105	3300025295	Bacteria	218124
551	Ga0209564_1000150	3300025295	Bacteria	170318
552	Ga0209564_1007005	3300025295	Bacteria	5912
553	Ga0209564_1050899	3300025295	Bacteria	1010
554	Ga0209758_1000548	3300025297	Bacteria	59657
555	Ga0209758_1004614	3300025297	Bacteria	11313
556	Ga0209758_1115748	3300025297	Bacteria	733
557	Ga0209050_1000514	3300025298	Bacteria	65226
558	Ga0209050_1001690	3300025298	Bacteria	22129
559	Ga0209256_1000108	3300025299	Bacteria	185884
560	Ga0209256_1000540	3300025299	Bacteria	54759
561	Ga0207426_1029473	3300025302	Bacteria	1809
562	Ga0209051_1013891	3300025303	Bacteria	3797
563	Ga0209257_1000976	3300025304	Bacteria	38920
564	Ga0209257_1001464	3300025304	Bacteria	27851
565	Ga0209257_1005353	3300025304	Bacteria	9073
566	Ga0209257_1035789	3300025304	Bacteria	1532
567	Ga0207697_10000061	3300025315	Bacteria	45271
568	Ga0207697_10004826	3300025315	Bacteria	6369
569	Ga0207697_10238762	3300025315	Bacteria	803
570	Ga0207656_10001058	3300025321	Bacteria	9002
571	Ga0207656_10071473	3300025321	Bacteria	1543
572	Ga0207656_10222190	3300025321	Bacteria	918
573	Ga0207713_1218007	3300025735	Bacteria	576
574	Ga0207653_10002714	3300025885	Bacteria	5629
575	Ga0207682_10000350	3300025893	Bacteria	21096
576	Ga0207692_10086006	3300025898	Bacteria	1693
577	Ga0207692_10290113	3300025898	Bacteria	992
578	Ga0207692_10496143	3300025898	Bacteria	774
579	Ga0207642_10000638	3300025899	Bacteria	10749
580	Ga0207642_10096361	3300025899	Bacteria	1474
581	Ga0207642_10274578	3300025899	Bacteria	967
582	Ga0207710_10003470	3300025900	Bacteria	7022
583	Ga0207710_10067951	3300025900	Bacteria	1629
584	Ga0207688_10000001	3300025901	Bacteria	107505
585	Ga0207688_10029490	3300025901	Bacteria	3021
586	Ga0207688_10128302	3300025901	Bacteria	1485
587	Ga0207688_10693284	3300025901	Bacteria	644
588	Ga0207680_10001817	3300025903	Bacteria	10043
589	Ga0207680_10037262	3300025903	Bacteria	2807
590	Ga0207680_10106561	3300025903	Bacteria	1810
591	Ga0207647_10002852	3300025904	Bacteria	13027
592	Ga0207647_10019026	3300025904	Bacteria	4625
593	Ga0207647_10115053	3300025904	Bacteria	1588
594	Ga0207685_10312076	3300025905	Bacteria	782
595	Ga0207699_10002264	3300025906	Bacteria	9081
596	Ga0207699_10031777	3300025906	Bacteria	2968
597	Ga0207699_10068182	3300025906	Bacteria	2166
598	Ga0207699_10218455	3300025906	Bacteria	1300
599	Ga0207699_10804921	3300025906	Bacteria	691
600	Ga0207645_10000222	3300025907	Bacteria	47139
601	Ga0207645_10263469	3300025907	Bacteria	1142
602	Ga0207645_10305684	3300025907	Bacteria	1059
603	Ga0207643_10000009	3300025908	Bacteria	160496
604	Ga0207705_10000276	3300025909	Bacteria	49160
605	Ga0207705_10020427	3300025909	Bacteria	4732
606	Ga0207705_10099871	3300025909	Bacteria	2134
607	Ga0207705_10221485	3300025909	Bacteria	1437
608	Ga0207705_10669120	3300025909	Bacteria	807
609	Ga0207654_10001390	3300025911	Bacteria	12824
610	Ga0207654_10096652	3300025911	Bacteria	1812
611	Ga0207654_10370416	3300025911	Bacteria	990
612	Ga0207654_10494218	3300025911	Bacteria	863
613	Ga0207707_10004174	3300025912	Bacteria	12795
614	Ga0207707_10064823	3300025912	Bacteria	3181
615	Ga0207707_10104970	3300025912	Bacteria	2469
616	Ga0207707_10312325	3300025912	Bacteria	1358
617	Ga0207707_10525871	3300025912	Bacteria	1007
618	Ga0207707_10593105	3300025912	Bacteria	938
619	Ga0207707_10607624	3300025912	Bacteria	925
620	Ga0207707_10977819	3300025912	Bacteria	696
621	Ga0207695_10043881	3300025913	Bacteria	4760
622	Ga0207695_10147597	3300025913	Bacteria	2294
623	Ga0207695_10163502	3300025913	Bacteria	2155
624	Ga0207695_10206235	3300025913	Bacteria	1878
625	Ga0207695_10653995	3300025913	Bacteria	932
626	Ga0207695_10701672	3300025913	Bacteria	892
627	Ga0207671_10019008	3300025914	Bacteria	5263
628	Ga0207671_10243845	3300025914	Bacteria	1412
629	Ga0207671_10404064	3300025914	Bacteria	1086
630	Ga0207671_10499180	3300025914	Bacteria	970
631	Ga0207693_10003519	3300025915	Bacteria	13369
632	Ga0207693_10144575	3300025915	Bacteria	1870
633	Ga0207693_10162848	3300025915	Bacteria	1755
634	Ga0207693_10710764	3300025915	Bacteria	778
635	Ga0207663_10113488	3300025916	Bacteria	1843
636	Ga0207663_10189326	3300025916	Bacteria	1476
637	Ga0207663_10940335	3300025916	Bacteria	692
638	Ga0207660_10000197	3300025917	Bacteria	38486
639	Ga0207660_10000537	3300025917	Bacteria	25426
640	Ga0207660_10019663	3300025917	Bacteria	4519
641	Ga0207662_10001861	3300025918	Bacteria	10377
642	Ga0207662_10002878	3300025918	Bacteria	8720
643	Ga0207657_10000218	3300025919	Bacteria	59661
644	Ga0207657_10000776	3300025919	Bacteria	33868
645	Ga0207657_10006388	3300025919	Bacteria	12240
646	Ga0207657_10012288	3300025919	Bacteria	8460
647	Ga0207657_10044882	3300025919	Bacteria	3882
648	Ga0207657_10144397	3300025919	Bacteria	1942
649	Ga0207657_10176606	3300025919	Bacteria	1728
650	Ga0207657_10699278	3300025919	Bacteria	787
651	Ga0207657_10759755	3300025919	Bacteria	751
652	Ga0207657_11214599	3300025919	Bacteria	572
653	Ga0207649_10000052	3300025920	Bacteria	106800
654	Ga0207649_10001226	3300025920	Bacteria	15405
655	Ga0207649_10077063	3300025920	Bacteria	2147
656	Ga0207649_10097390	3300025920	Bacteria	1940
657	Ga0207649_10123735	3300025920	Bacteria	1747
658	Ga0207649_10154264	3300025920	Bacteria	1585
659	Ga0207649_10227659	3300025920	Bacteria	1332
660	Ga0207652_10001438	3300025921	Bacteria	21098
661	Ga0207652_10294828	3300025921	Bacteria	1464
662	Ga0207652_10297305	3300025921	Bacteria	1457
663	Ga0207652_10381318	3300025921	Bacteria	1272
664	Ga0207652_10524861	3300025921	Bacteria	1065
665	Ga0207652_10671514	3300025921	Bacteria	926
666	Ga0207652_10877780	3300025921	Bacteria	793
667	Ga0207681_10002118	3300025923	Bacteria	12708
668	Ga0207681_10119645	3300025923	Bacteria	1929
669	Ga0207681_10721886	3300025923	Bacteria	829
670	Ga0207694_10008555	3300025924	Bacteria	7728
671	Ga0207694_10076332	3300025924	Bacteria	2624
672	Ga0207694_10243753	3300025924	Bacteria	1469
673	Ga0207694_11201234	3300025924	Bacteria	642
674	Ga0207650_10000883	3300025925	Bacteria	22684
675	Ga0207650_10024267	3300025925	Bacteria	4309
676	Ga0207650_10436394	3300025925	Bacteria	1088
677	Ga0207650_10674417	3300025925	Bacteria	872
678	Ga0207659_10000132	3300025926	Bacteria	43798
679	Ga0207659_10337421	3300025926	Bacteria	1247
680	Ga0207659_10431207	3300025926	Bacteria	1107
681	Ga0207659_10771059	3300025926	Bacteria	826
682	Ga0207659_11572819	3300025926	Bacteria	562
683	Ga0207687_10000174	3300025927	Bacteria	42351
684	Ga0207687_10189901	3300025927	Bacteria	1598
685	Ga0207687_10236067	3300025927	Bacteria	1447
686	Ga0207700_10019653	3300025928	Bacteria	4566
687	Ga0207700_10072092	3300025928	Bacteria	2662
688	Ga0207700_11109419	3300025928	Bacteria	707
689	Ga0207700_11513991	3300025928	Bacteria	595
690	Ga0207700_11842782	3300025928	Bacteria	531
691	Ga0207664_10085622	3300025929	Bacteria	2573
692	Ga0207664_10712993	3300025929	Bacteria	902
693	Ga0207644_10000212	3300025931	Bacteria	40175
694	Ga0207644_10664802	3300025931	Bacteria	867
695	Ga0207690_10000148	3300025932	Bacteria	56244
696	Ga0207690_10008862	3300025932	Bacteria	5970
697	Ga0207690_10063935	3300025932	Bacteria	2511
698	Ga0207690_10167502	3300025932	Bacteria	1643
699	Ga0207690_10501991	3300025932	Bacteria	981
700	Ga0207706_10001360	3300025933	Bacteria	24441
701	Ga0207706_10051128	3300025933	Bacteria	3650
702	Ga0207706_10314205	3300025933	Bacteria	1364
703	Ga0207686_10001289	3300025934	Bacteria	14380
704	Ga0207686_10099016	3300025934	Bacteria	1943
705	Ga0207686_10109446	3300025934	Bacteria	1860
706	Ga0207686_10214206	3300025934	Bacteria	1387
707	Ga0207709_10000530	3300025935	Bacteria	33097
708	Ga0207670_10000523	3300025936	Bacteria	21171
709	Ga0207670_10073230	3300025936	Bacteria	2375
710	Ga0207670_10150162	3300025936	Bacteria	1728
711	Ga0207670_10157414	3300025936	Bacteria	1692
712	Ga0207669_10000235	3300025937	Bacteria	25138
713	Ga0207669_10086587	3300025937	Bacteria	2026
714	Ga0207669_10185539	3300025937	Bacteria	1495
715	Ga0207704_10000198	3300025938	Bacteria	31182
716	Ga0207704_10040926	3300025938	Bacteria	2713
717	Ga0207704_10086432	3300025938	Bacteria	2045
718	Ga0207704_10193367	3300025938	Bacteria	1482
719	Ga0207665_10000273	3300025939	Bacteria	35752
720	Ga0207665_10527795	3300025939	Bacteria	915
721	Ga0207691_10000517	3300025940	Bacteria	38398
722	Ga0207691_10169807	3300025940	Bacteria	1910
723	Ga0207691_10625700	3300025940	Bacteria	910
724	Ga0207711_10011248	3300025941	Bacteria	7435
725	Ga0207711_10153997	3300025941	Bacteria	2076
726	Ga0207711_10279892	3300025941	Bacteria	1536
727	Ga0207689_10000031	3300025942	Bacteria	97131
728	Ga0207689_10120176	3300025942	Bacteria	2162
729	Ga0207689_10130889	3300025942	Bacteria	2065
730	Ga0207689_10573108	3300025942	Bacteria	949
731	Ga0207661_10001228	3300025944	Bacteria	17172
732	Ga0207661_10440919	3300025944	Bacteria	1185
733	Ga0207661_10787459	3300025944	Bacteria	875
734	Ga0207661_11311864	3300025944	Bacteria	665
735	Ga0207679_10000183	3300025945	Bacteria	51645
736	Ga0207679_10160577	3300025945	Bacteria	1840
737	Ga0207679_10578317	3300025945	Bacteria	1010
738	Ga0207679_10832948	3300025945	Bacteria	842
739	Ga0207667_10000122	3300025949	Bacteria	121588
740	Ga0207667_10000877	3300025949	Bacteria	38435
741	Ga0207667_10026409	3300025949	Bacteria	6345
742	Ga0207667_10067567	3300025949	Bacteria	3723
743	Ga0207667_10091715	3300025949	Bacteria	3138
744	Ga0207667_10171795	3300025949	Bacteria	2227
745	Ga0207667_10439812	3300025949	Bacteria	1326
746	Ga0207667_10735736	3300025949	Bacteria	987
747	Ga0207667_11073751	3300025949	Bacteria	789
748	Ga0207667_11142155	3300025949	Bacteria	761
749	Ga0207651_10000051	3300025960	Bacteria	54163
750	Ga0207651_10068977	3300025960	Bacteria	2495
751	Ga0207651_10945912	3300025960	Bacteria	768
752	Ga0207712_10000738	3300025961	Bacteria	24767
753	Ga0207712_10000998	3300025961	Bacteria	20156
754	Ga0207712_10134526	3300025961	Bacteria	1889
755	Ga0207712_10686501	3300025961	Bacteria	893
756	Ga0207712_11247854	3300025961	Bacteria	664
757	Ga0207668_10000363	3300025972	Bacteria	28976
758	Ga0207668_10000664	3300025972	Bacteria	21087
759	Ga0207668_10211119	3300025972	Bacteria	1553
760	Ga0207668_10562151	3300025972	Bacteria	989
761	Ga0207640_10000343	3300025981	Bacteria	30767
762	Ga0207640_10013423	3300025981	Bacteria	4694
763	Ga0207640_10208313	3300025981	Bacteria	1487
764	Ga0207640_10456285	3300025981	Bacteria	1054
765	Ga0207640_11099404	3300025981	Bacteria	703
766	Ga0207640_11190117	3300025981	Bacteria	677
767	Ga0207658_10001253	3300025986	Bacteria	20099
768	Ga0207658_10010402	3300025986	Bacteria	6319
769	Ga0207658_10276641	3300025986	Bacteria	1437
770	Ga0207658_10329744	3300025986	Bacteria	1323
771	Ga0207658_10419544	3300025986	Bacteria	1180
772	Ga0207658_10467669	3300025986	Bacteria	1119
773	Ga0207658_10753124	3300025986	Bacteria	882
774	Ga0207658_10989204	3300025986	Bacteria	767
775	Ga0207658_11438945	3300025986	Bacteria	630
776	Ga0207677_10010253	3300026023	Bacteria	5297
777	Ga0207677_10018951	3300026023	Bacteria	4144
778	Ga0207703_10002904	3300026035	Bacteria	14594
779	Ga0207703_10003217	3300026035	Bacteria	13733
780	Ga0207703_10370263	3300026035	Bacteria	1323
781	Ga0207703_10864440	3300026035	Bacteria	865
782	Ga0207703_11978981	3300026035	Bacteria	559
783	Ga0207639_10001257	3300026041	Bacteria	17164
784	Ga0207639_10004515	3300026041	Bacteria	9386
785	Ga0207639_10029135	3300026041	Bacteria	4039
786	Ga0207639_10161115	3300026041	Bacteria	1891
787	Ga0207639_10381714	3300026041	Bacteria	1265
788	Ga0207639_10404906	3300026041	Bacteria	1230
789	Ga0207639_10539941	3300026041	Bacteria	1069
790	Ga0207678_10000531	3300026067	Bacteria	34761
791	Ga0207678_10028153	3300026067	Bacteria	4907
792	Ga0207678_10033354	3300026067	Bacteria	4486
793	Ga0207678_10237397	3300026067	Bacteria	1561
794	Ga0207708_10012245	3300026075	Bacteria	6395
795	Ga0207708_10015833	3300026075	Bacteria	5659
796	Ga0207708_10403042	3300026075	Bacteria	1131
797	Ga0207708_10616437	3300026075	Bacteria	921
798	Ga0207708_10671167	3300026075	Bacteria	884
799	Ga0207702_10003284	3300026078	Bacteria	14915
800	Ga0207702_10006196	3300026078	Bacteria	10341
801	Ga0207702_10029655	3300026078	Bacteria	4554
802	Ga0207702_10174742	3300026078	Bacteria	1973
803	Ga0207702_10252717	3300026078	Bacteria	1656
804	Ga0207702_10282075	3300026078	Bacteria	1571
805	Ga0207641_10001831	3300026088	Bacteria	20447
806	Ga0207641_10041398	3300026088	Bacteria	3860
807	Ga0207641_10073357	3300026088	Bacteria	2949
808	Ga0207641_10845040	3300026088	Bacteria	907
809	Ga0207641_11121579	3300026088	Bacteria	785
810	Ga0207648_10000581	3300026089	Bacteria	41019
811	Ga0207648_10069434	3300026089	Bacteria	3070
812	Ga0207648_10098521	3300026089	Bacteria	2560
813	Ga0207648_11356443	3300026089	Bacteria	668
814	Ga0207676_10000124	3300026095	Bacteria	67747
815	Ga0207676_10000247	3300026095	Bacteria	47010
816	Ga0207676_10194978	3300026095	Bacteria	1785
817	Ga0207676_11255012	3300026095	Bacteria	735
818	Ga0207674_10000095	3300026116	Bacteria	99278
819	Ga0207674_10070606	3300026116	Bacteria	3511
820	Ga0207674_10607537	3300026116	Bacteria	1056
821	Ga0207674_10614832	3300026116	Bacteria	1049
822	Ga0207674_10864556	3300026116	Bacteria	872
823	Ga0207675_100000414	3300026118	Bacteria	41042
824	Ga0207675_100047953	3300026118	Bacteria	3987
825	Ga0207675_101578759	3300026118	Bacteria	677
826	Ga0207683_10000242	3300026121	Bacteria	48576
827	Ga0207683_10001174	3300026121	Bacteria	23704
828	Ga0207698_10000951	3300026142	Bacteria	16837
829	Ga0207698_10049856	3300026142	Bacteria	3189
830	Ga0207698_10094579	3300026142	Bacteria	2457
831	Ga0207698_10146647	3300026142	Bacteria	2042
832	Ga0207698_10160323	3300026142	Bacteria	1966
833	Ga0207698_10192785	3300026142	Bacteria	1817
834	Ga0207698_10200395	3300026142	Bacteria	1787
835	Ga0207698_10414285	3300026142	Bacteria	1291
836	Ga0207698_10519991	3300026142	Bacteria	1161
837	Ga0207698_10729022	3300026142	Bacteria	988
838	Ga0207698_11200622	3300026142	Bacteria	772
839	Ga0207698_12035554	3300026142	Bacteria	588
840	Ga0209984_1012763	3300027424	Bacteria	1098
841	Ga0209995_1021735	3300027471	Bacteria	1064
842	Ga0209179_1000116	3300027512	Bacteria	9269
843	Ga0210002_1000654	3300027617	Bacteria	4678
844	Ga0210002_1007727	3300027617	Bacteria	1634
845	Ga0209983_1033757	3300027665	Bacteria	1095
846	Ga0209971_1032187	3300027682	Bacteria	1258
847	Ga0209966_1010865	3300027695	Bacteria	1651
848	Ga0209966_1015133	3300027695	Bacteria	1446
849	Ga0209998_10003189	3300027717	Bacteria	3621
850	Ga0209998_10014755	3300027717	Bacteria	1633
851	Ga0209813_10014052	3300027866	Bacteria	2149
852	Ga0209813_10038884	3300027866	Bacteria	1440
853	Ga0209974_10003544	3300027876	Bacteria	5614
854	Ga0209974_10029040	3300027876	Bacteria	1832
855	Ga0209974_10233226	3300027876	Bacteria	688
856	Ga0209974_10439732	3300027876	Bacteria	516
857	Ga0207428_10000037	3300027907	Bacteria	218857
858	Ga0207428_10001217	3300027907	Bacteria	27628
859	Ga0207428_10001773	3300027907	Bacteria	22109
860	Ga0207428_10405681	3300027907	Bacteria	997
861	Ga0268266_10016362	3300028379	Bacteria	6341
862	Ga0268266_10068513	3300028379	Bacteria	3072
863	Ga0268266_10075059	3300028379	Bacteria	2936
864	Ga0268265_10005077	3300028380	Bacteria	9029
865	Ga0268265_10006176	3300028380	Bacteria	8113
866	Ga0268265_10019814	3300028380	Bacteria	4684
867	Ga0268265_10839174	3300028380	Bacteria	898
868	Ga0268265_11675389	3300028380	Bacteria	641
869	Ga0268264_10000383	3300028381	Bacteria	63883
870	Ga0268264_10002331	3300028381	Bacteria	16789
871	Ga0268264_10029317	3300028381	Bacteria	4505
872	Ga0268264_10239095	3300028381	Bacteria	1681
873	Ga0268264_10661396	3300028381	Bacteria	1035
874	Ga0268264_10666933	3300028381	Bacteria	1030
875	Ga0268264_11152722	3300028381	Bacteria	784
876	Ga0268264_11463989	3300028381	Bacteria	694
877	Ga0265326_10018004	3300028558	Bacteria	2034
878	Ga0265334_10039911	3300028573	Bacteria	1841
879	Ga0265334_10179973	3300028573	Bacteria	738
880	Ga0307515_10048582	3300028794	Bacteria	6412
881	Ga0307515_10119387	3300028794	Bacteria	3000
882	Ga0265338_10005387	3300028800	Bacteria	16717
883	Ga0265338_10011450	3300028800	Bacteria	10241
884	Ga0265338_10043919	3300028800	Bacteria	4135
885	Ga0265338_10764697	3300028800	Bacteria	663
886	Ga0265324_10081106	3300029957	Bacteria	1104
887	Ga0265324_10246178	3300029957	Bacteria	607
888	Ga0316182_1304858	3300030745	Bacteria	925
889	Ga0265330_10006274	3300031235	Bacteria	5877
890	Ga0265330_10029834	3300031235	Bacteria	2450
891	Ga0265330_10110543	3300031235	Bacteria	1174
892	Ga0265332_10264253	3300031238	Bacteria	712
893	Ga0265332_10308692	3300031238	Bacteria	653
894	Ga0265328_10000041	3300031239	Bacteria	89398
895	Ga0265328_10000129	3300031239	Bacteria	36422
896	Ga0265328_10010978	3300031239	Bacteria	3631
897	Ga0265328_10031945	3300031239	Bacteria	1955
898	Ga0265328_10129307	3300031239	Bacteria	945
899	Ga0265328_10173158	3300031239	Bacteria	815
900	Ga0265320_10008219	3300031240	Bacteria	6405
901	Ga0265325_10001071	3300031241	Bacteria	19727
902	Ga0265325_10007954	3300031241	Bacteria	6299
903	Ga0265325_10052147	3300031241	Bacteria	2101
904	Ga0265325_10094695	3300031241	Bacteria	1468
905	Ga0265329_10004117	3300031242	Bacteria	6157
906	Ga0265329_10013935	3300031242	Bacteria	2852
907	Ga0265340_10002589	3300031247	Bacteria	10274
908	Ga0265340_10023676	3300031247	Bacteria	3129
909	Ga0265340_10051750	3300031247	Bacteria	1988
910	Ga0265340_10114608	3300031247	Bacteria	1243
911	Ga0265340_10143556	3300031247	Bacteria	1091
912	Ga0265340_10290491	3300031247	Bacteria	726
913	Ga0265339_10008349	3300031249	Bacteria	6595
914	Ga0265339_10011066	3300031249	Bacteria	5573
915	Ga0265339_10013957	3300031249	Bacteria	4859
916	Ga0265339_10017456	3300031249	Bacteria	4251
917	Ga0265339_10030849	3300031249	Bacteria	3033
918	Ga0265339_10233369	3300031249	Bacteria	896
919	Ga0265339_10323811	3300031249	Bacteria	731
920	Ga0265339_10450501	3300031249	Bacteria	597
921	Ga0265331_10005777	3300031250	Bacteria	7414
922	Ga0265331_10012174	3300031250	Bacteria	4672
923	Ga0265331_10154410	3300031250	Bacteria	1042
924	Ga0265331_10166663	3300031250	Bacteria	998
925	Ga0265327_10016517	3300031251	Bacteria	4682
926	Ga0265327_10120391	3300031251	Bacteria	1244
927	Ga0265316_10003918	3300031344	Bacteria	14922
928	Ga0265316_10097867	3300031344	Bacteria	2233
929	Ga0265316_10182937	3300031344	Bacteria	1560
930	Ga0265316_10290017	3300031344	Bacteria	1194
931	Ga0265316_10698386	3300031344	Bacteria	715
932	Ga0265316_10890202	3300031344	Bacteria	622
933	Ga0307408_100063348	3300031548	Bacteria	2705
934	Ga0265313_10002227	3300031595	Bacteria	17059
935	Ga0265313_10004533	3300031595	Bacteria	10604
936	Ga0265313_10021256	3300031595	Bacteria	3554
937	Ga0265313_10084471	3300031595	Bacteria	1436
938	Ga0316579_10024793	3300031691	Bacteria	2703
939	Ga0265314_10031281	3300031711	Bacteria	3932
940	Ga0265314_10034796	3300031711	Bacteria	3676
941	Ga0265314_10046503	3300031711	Bacteria	3061
942	Ga0265314_10049090	3300031711	Bacteria	2957
943	Ga0265314_10081113	3300031711	Bacteria	2139
944	Ga0265314_10091671	3300031711	Bacteria	1977
945	Ga0265314_10196129	3300031711	Bacteria	1197
946	Ga0265314_10495819	3300031711	Bacteria	643
947	Ga0265342_10000448	3300031712	Bacteria	44982
948	Ga0265342_10000677	3300031712	Bacteria	35579
949	Ga0265342_10009052	3300031712	Bacteria	7065
950	Ga0265342_10059225	3300031712	Bacteria	2263
951	Ga0265342_10151659	3300031712	Bacteria	1286
952	Ga0265342_10286746	3300031712	Bacteria	870
953	Ga0265342_10609707	3300031712	Bacteria	550
954	Ga0307405_11126583	3300031731	Bacteria	675
955	Ga0307413_11444643	3300031824	Bacteria	606
956	Ga0307413_11610128	3300031824	Bacteria	577
957	Ga0307410_11696476	3300031852	Bacteria	560
958	Ga0307406_10404465	3300031901	Bacteria	1083
959	Ga0307407_10399047	3300031903	Bacteria	986
960	Ga0307412_10284961	3300031911	Bacteria	1299
961	Ga0307416_100672506	3300032002	Bacteria	1122
962	Ga0307416_101655588	3300032002	Bacteria	745
963	Ga0307416_101791593	3300032002	Bacteria	718
964	Ga0307416_102799131	3300032002	Bacteria	583
965	Ga0307416_103046246	3300032002	Bacteria	561
966	Ga0307416_103667666	3300032002	Bacteria	514
967	Ga0307414_10257614	3300032004	Bacteria	1454
968	Ga0307414_10582031	3300032004	Bacteria	1002
969	Ga0307411_10268064	3300032005	Bacteria	1352
970	Ga0307415_100628951	3300032126	Bacteria	959
971	Ga0307415_101096140	3300032126	Bacteria	745
972	Ga0316593_10171879	3300032168	Bacteria	794
973	Ga0373930_0000352	3300034816	Bacteria	5995
974	Ga0373930_0063301	3300034816	Bacteria	829
975	Ga0373948_0001000	3300034817	Bacteria	3794
976	Ga0373948_0025645	3300034817	Bacteria	1157
977	Ga0373948_0159517	3300034817	Bacteria	568
978	Ga0373950_0000155	3300034818	Bacteria	10219
979	Ga0373950_0056899	3300034818	Bacteria	778
980	Ga0373958_0000136	3300034819	Bacteria	8194
981	Ga0373958_0001575	3300034819	Bacteria	3089
982	Ga0373958_0067234	3300034819	Bacteria	788
983	Ga0373959_0000508	3300034820	Bacteria	7016
984	Ga0373959_0070271	3300034820	Bacteria	790
985	Ga0373938_0000013	3300034957	Bacteria	24269
986	Ga0373938_0001096	3300034957	Bacteria	4356
987	Ga0373938_0038068	3300034957	Bacteria	1059
988	Ga0373926_0011216	3300035083	Bacteria	3013
989	Ga0373926_0015193	3300035083	Bacteria	2624
990	Ga0373926_0148429	3300035083	Bacteria	892
991	Ga0373928_0000255	3300035084	Bacteria	10564
992	Ga0373928_0003373	3300035084	Bacteria	3046
993	Ga0373928_0088192	3300035084	Bacteria	792
994	Ga0373929_0028724	3300035085	Bacteria	1176
995	Ga0373929_0034931	3300035085	Bacteria	1092
996	Ga0373929_0063265	3300035085	Bacteria	871
997	Ga0373929_0164485	3300035085	Bacteria	603
998	Ga0373934_0079384	3300035086	Bacteria	1318
999	Ga0373934_0118102	3300035086	Bacteria	1078
1000	Ga0373940_0000097	3300035088	Bacteria	10516
1001	Ga0373940_0037102	3300035088	Bacteria	1326
1002	Ga0373940_0128423	3300035088	Bacteria	792
1003	Ga0373940_0128805	3300035088	Bacteria	791
1004	Ga0373944_0000533	3300035089	Bacteria	8946
1005	Ga0373944_0025116	3300035089	Bacteria	1752
1006	Ga0373944_0033620	3300035089	Bacteria	1554
1007	Ga0373949_0002652	3300035090	Bacteria	4507
1008	Ga0373949_0010932	3300035090	Bacteria	1994
1009	Ga0373951_0004343	3300035091	Bacteria	3372
1010	Ga0373951_0007211	3300035091	Bacteria	2528
1011	Ga0373951_0072483	3300035091	Bacteria	879
1012	Ga0373951_0110061	3300035091	Bacteria	740
1013	Ga0373952_0001231	3300035092	Bacteria	4667
1014	Ga0373952_0087116	3300035092	Bacteria	806
1015	Ga0373952_0091552	3300035092	Bacteria	790
1016	Ga0373923_0008045	3300035111	Bacteria	3739
1017	Ga0373923_0014573	3300035111	Bacteria	2956
1018	Ga0373923_0187427	3300035111	Bacteria	952
1019	Ga0373923_0237545	3300035111	Bacteria	850
1020	Ga0373923_0389634	3300035111	Bacteria	669
1021	Ga0373932_0000252	3300035112	Bacteria	16339
1022	Ga0373932_0000830	3300035112	Bacteria	9130
1023	Ga0373932_0007039	3300035112	Bacteria	2673
1024	Ga0373932_0243937	3300035112	Bacteria	653
1025	Ga0373936_0014221	3300035113	Bacteria	3041
1026	Ga0373936_0027271	3300035113	Bacteria	2241
1027	Ga0373936_0051334	3300035113	Bacteria	1669
1028	Ga0373939_0001022	3300035114	Bacteria	6895
1029	Ga0373939_0009550	3300035114	Bacteria	2408
1030	Ga0373939_0023589	3300035114	Bacteria	1706
1031	Ga0373941_0000125	3300035115	Bacteria	13305
1032	Ga0373941_0004821	3300035115	Bacteria	3141
1033	Ga0373941_0007140	3300035115	Bacteria	2722
1034	Ga0373945_0027240	3300035116	Bacteria	1995
1035	Ga0373945_0037203	3300035116	Bacteria	1746
1036	Ga0373953_0061917	3300035117	Bacteria	1531
1037	Ga0373953_0155234	3300035117	Bacteria	982
1038	Ga0373954_0002715	3300035118	Bacteria	7451
1039	Ga0373954_0010145	3300035118	Bacteria	4151
1040	Ga0373954_0033215	3300035118	Bacteria	2387
1041	Ga0373954_0197144	3300035118	Bacteria	989
1042	Ga0373956_0008190	3300035119	Bacteria	4230
1043	Ga0373956_0056378	3300035119	Bacteria	1774
1044	Ga0373956_0252511	3300035119	Bacteria	838
1045	Ga0373957_0043564	3300035120	Bacteria	1696
1046	Ga0373957_0056945	3300035120	Bacteria	1506
1047	Ga0373957_0087877	3300035120	Bacteria	1232
1048	Ga0373957_0091036	3300035120	Bacteria	1212
1049	Ga0373960_0000068	3300035121	Bacteria	14664
1050	Ga0373960_0006209	3300035121	Bacteria	2795
1051	Ga0373960_0011227	3300035121	Bacteria	2203
1052	Ga0373960_0060154	3300035121	Bacteria	1150
1053	Ga0373943_0005374	3300035170	Bacteria	5763
1054	Ga0373943_0007567	3300035170	Bacteria	4879
1055	Ga0373943_0013145	3300035170	Bacteria	3735
1056	Ga0373943_0512874	3300035170	Bacteria	701
1057	Ga0373943_0651581	3300035170	Bacteria	622
1058	Ga0373946_0004390	3300035171	Bacteria	5049
1059	Ga0373946_0005848	3300035171	Bacteria	4453
1060	Ga0373946_0010959	3300035171	Bacteria	3370
1061	Ga0373946_0208330	3300035171	Bacteria	939
1062	Ga0373955_0001002	3300035172	Bacteria	11996
1063	Ga0373955_0001818	3300035172	Bacteria	9170
1064	Ga0373955_0003246	3300035172	Bacteria	7124
1065	Ga0373955_0005183	3300035172	Bacteria	5833
1066	Ga0373955_0242640	3300035172	Bacteria	1079
1067	Ga0373955_0513244	3300035172	Bacteria	732
1068	Ga0373955_0694715	3300035172	Bacteria	624
1069	Ga0373955_0764236	3300035172	Bacteria	594
1070	Ga0373942_0003181	3300035207	Bacteria	3884
1071	Ga0373961_0000638	3300035241	Bacteria	12665
1072	Ga0373961_0002001	3300035241	Bacteria	5477
1073	Ga0373961_0011513	3300035241	Bacteria	2196
1074	Ga0373961_0091637	3300035241	Bacteria	972
1075	Ga0373962_0000112	3300035242	Bacteria	16939
1076	Ga0373962_0003469	3300035242	Bacteria	3786
1077	Ga0373962_0007458	3300035242	Bacteria	2678
1078	Ga0373962_0031905	3300035242	Bacteria	1447
1079	Ga0316574_0108769	3300035398	Bacteria	1777
1080	Ga0373924_0012081	3300035410	Bacteria	3220
1081	Ga0373924_0078033	3300035410	Bacteria	1405
1082	Ga0373924_0106294	3300035410	Bacteria	1210
1083	Ga0373924_0358157	3300035410	Bacteria	650
1084	Ga0373931_0000305	3300035691	Bacteria	20657
1085	Ga0373931_0006732	3300035691	Bacteria	5391
1086	Ga0373931_0224059	3300035691	Bacteria	1133
1087	Ga0373931_0276633	3300035691	Bacteria	1029
1088	Ga0373931_0359025	3300035691	Bacteria	914
1089	Ga0373935_0000768	3300035692	Bacteria	17055
1090	Ga0373935_0022201	3300035692	Bacteria	3889
1091	Ga0373935_0033271	3300035692	Bacteria	3207
1092	Ga0373935_0036307	3300035692	Bacteria	3080
1093	Ga0373935_0053480	3300035692	Bacteria	2569
1094	Ga0373927_0007352	3300035695	Bacteria	7456
1095	Ga0373927_0017738	3300035695	Bacteria	4683
1096	Ga0373927_0063626	3300035695	Bacteria	2386
1097	Ga0373933_0002904	3300035724	Bacteria	9576
1098	Ga0373933_0012124	3300035724	Bacteria	4760
1099	Ga0373933_0021109	3300035724	Bacteria	3696
1100	Ga0373933_0032980	3300035724	Bacteria	3010
1101	Ga0373933_0510271	3300035724	Bacteria	788
1102	Ga0373947_0003848	3300035725	Bacteria	8833
1103	Ga0373947_0005394	3300035725	Bacteria	7462
1104	Ga0373947_0024579	3300035725	Bacteria	3510
1105	Ga0373947_0088207	3300035725	Bacteria	1930
1106	Ga0373947_0266574	3300035725	Bacteria	1136
1107	Ga0373947_0529687	3300035725	Bacteria	801
1108	Ga0373937_0000057	3300036401	Bacteria	99491
1109	Ga0373937_0003502	3300036401	Bacteria	13198
1110	Ga0373937_0021076	3300036401	Bacteria	5849
1111	Ga0373937_0046907	3300036401	Bacteria	3952
1112	Ga0373937_0069964	3300036401	Bacteria	3236
1113	Ga0373937_0142147	3300036401	Bacteria	2246
1114	Ga0373937_0372318	3300036401	Bacteria	1354
1115	Ga0373937_0625739	3300036401	Bacteria	1021
1116	Ga0373937_0851768	3300036401	Bacteria	860
1117	Ga0373937_1436612	3300036401	Bacteria	637
1118	Ga0373925_0000435	3300037068	Bacteria	42178
1119	Ga0373925_0003982	3300037068	Bacteria	11261
1120	Ga0373925_0012286	3300037068	Bacteria	6197
1121	Ga0373925_0076792	3300037068	Bacteria	2534
1122	Ga0373925_0088522	3300037068	Bacteria	2364
1123	Ga0373925_0123243	3300037068	Bacteria	2014
1124	Ga0373925_0648895	3300037068	Bacteria	870
1125	Ga0395899_0012605	3300037312	Bacteria	6480
1126	Ga0395899_0054319	3300037312	Bacteria	2964
1127	Ga0395899_0699956	3300037312	Bacteria	635
1128	Ga0395900_0004219	3300037418	Bacteria	15252
1129	Ga0395900_0242018	3300037418	Bacteria	1809
1130	Ga0395900_0513963	3300037418	Bacteria	1146
1131	Ga0395898_0030096	3300037466	Bacteria	5435
1132	Ga0395905_0577546	3300037471	Bacteria	1025
1133	Ga0436364_0205767	3300037853	Bacteria	1624
1134	Ga0436364_0252322	3300037853	Bacteria	712
1135	Ga0436364_0644969	3300037853	Bacteria	1941
1136	Ga0436364_0944764	3300037853	Bacteria	1902
1137	Ga0395901_0009226	3300038443	Bacteria	9996
1138	Ga0395901_0721825	3300038443	Bacteria	992
1139	Ga0395901_1056973	3300038443	Bacteria	784
1140	Ga0395901_1298700	3300038443	Bacteria	689
1141	Ga0237819_04172	3300038705	Bacteria	2422
1142	Ga0436365_0381831	3300039437	Bacteria	800
1143	Ga0436365_0487391	3300039437	Bacteria	1970
1144	Ga0436365_0694219	3300039437	Bacteria	4135
1145	Ga0436365_1056925	3300039437	Bacteria	1508
1146	Ga0436365_1183005	3300039437	Bacteria	635
1147	Ga0436365_1757536	3300039437	Bacteria	1134
1148	Ga0436360_0054431	3300039438	Bacteria	1607
1149	Ga0436360_0394454	3300039438	Bacteria	680
1150	Ga0436361_0019983	3300039447	Bacteria	4926
1151	Ga0436361_0168365	3300039447	Bacteria	1493
1152	Ga0436361_0328026	3300039447	Bacteria	646
1153	Ga0436361_0363438	3300039447	Bacteria	1904
1154	Ga0436363_0503724	3300039450	Bacteria	997
1155	Ga0436363_0524113	3300039450	Bacteria	530
1156	Ga0436363_1284496	3300039450	Bacteria	511
1157	Ga0436363_1642696	3300039450	Bacteria	798
1158	Ga0436362_0342583	3300039453	Bacteria	797
1159	Ga0436362_0669626	3300039453	Bacteria	784
1160	Ga0436362_0719091	3300039453	Bacteria	1852
1161	Ga0439453_0008795	3300041408	Bacteria	1631
1162	Ga0439453_0014329	3300041408	Bacteria	1358
1163	Ga0439453_0060818	3300041408	Bacteria	782
1164	Ga0439453_0134168	3300041408	Bacteria	577
1165	Ga0439465_0139010	3300041413	Bacteria	862
1166	Ga0439465_0222830	3300041413	Bacteria	692
1167	Ga0451795_0221745	3300041456	Bacteria	561
1168	Ga0451802_1484532	3300041460	Bacteria	750
1169	Ga0451843_1462452	3300041509	Bacteria	619
1170	Ga0439441_107480	3300042001	Bacteria	630
1171	Ga0439448_0116540	3300042005	Bacteria	915
1172	Ga0439450_043419	3300042008	Bacteria	1050
1173	Ga0439455_0188987	3300042012	Bacteria	594
1174	Ga0439463_023857	3300042016	Bacteria	1532
1175	Ga0450913_032839	3300042117	Bacteria	518
1176	Ga0439434_0133568	3300042435	Bacteria	815
1177	Ga0439435_0071064	3300042436	Bacteria	1030
1178	Ga0439435_0331469	3300042436	Bacteria	526
1179	Ga0439444_0060071	3300042437	Bacteria	792
1180	Ga0439460_0132233	3300042461	Bacteria	823
1181	Ga0439440_0033599	3300042993	Bacteria	1223
1182	Ga0439440_0174504	3300042993	Bacteria	627
1183	Ga0453683_0907353	3300044673	Bacteria	583
1184	Ga0466966_0333666	3300044684	Bacteria	911
1185	Ga0466966_0819076	3300044684	Bacteria	561
1186	Ga0453684_0054940	3300044712	Bacteria	5182
1187	Ga0466957_0389371	3300044842	Bacteria	952
1188	Ga0466957_0531101	3300044842	Bacteria	818
1189	Ga0466957_0721166	3300044842	Bacteria	705
1190	Ga0466957_1307420	3300044842	Bacteria	526
1191	Ga0466959_0143618	3300045049	Bacteria	1685
1192	Ga0451576_0014613	3300045051	Bacteria	8726
1193	Ga0451576_1301610	3300045051	Bacteria	758
1194	Ga0466958_0268720	3300045836	Bacteria	1092
1195	Ga0466958_1057986	3300045836	Bacteria	530
1196	Ga0466967_1191672	3300045976	Bacteria	759
1197	Ga0495617_113070	3300046452	Bacteria	877
1198	Ga0495592_0000135	3300046454	Bacteria	65590
1199	Ga0495592_0014401	3300046454	Bacteria	6005
1200	Ga0495592_0017126	3300046454	Bacteria	5503
1201	Ga0495603_0021043	3300046455	Bacteria	3949
1202	Ga0495603_0061331	3300046455	Bacteria	2221
1203	Ga0495603_0227008	3300046455	Bacteria	1077
1204	Ga0495629_0000317	3300046459	Bacteria	41238
1205	Ga0495629_0003401	3300046459	Bacteria	12036
1206	Ga0495629_0324956	3300046459	Bacteria	1051
1207	Ga0495638_0002745	3300046460	Bacteria	14145
1208	Ga0495638_0084415	3300046460	Bacteria	1922
1209	Ga0495641_0011557	3300046461	Bacteria	5018
1210	Ga0495641_0026288	3300046461	Bacteria	2841
1211	Ga0495651_0000205	3300046462	Bacteria	45135
1212	Ga0495651_0003040	3300046462	Bacteria	12936
1213	Ga0495651_0020586	3300046462	Bacteria	5122
1214	Ga0495651_0340482	3300046462	Bacteria	994
1215	Ga0495653_0000120	3300046463	Bacteria	65274
1216	Ga0495653_0052632	3300046463	Bacteria	3119
1217	Ga0495653_0373044	3300046463	Bacteria	913
1218	Ga0495580_0013448	3300046472	Bacteria	6243
1219	Ga0495580_0542180	3300046472	Bacteria	773
1220	Ga0495582_0003003	3300046473	Bacteria	9451
1221	Ga0495582_0024366	3300046473	Bacteria	3310
1222	Ga0495582_0351818	3300046473	Bacteria	848
1223	Ga0495582_0456358	3300046473	Bacteria	738
1224	Ga0495639_0006886	3300046475	Bacteria	4881
1225	Ga0495639_0038520	3300046475	Bacteria	2147
1226	Ga0495639_0493904	3300046475	Bacteria	624
1227	Ga0495639_0538455	3300046475	Bacteria	598
1228	Ga0495662_0001020	3300046476	Bacteria	13726
1229	Ga0495662_0015371	3300046476	Bacteria	3717
1230	Ga0495664_0000023	3300046477	Bacteria	126807
1231	Ga0495664_0004160	3300046477	Bacteria	7901
1232	Ga0495664_0578470	3300046477	Bacteria	668
1233	Ga0495584_0006027	3300046491	Bacteria	6386
1234	Ga0495584_0097248	3300046491	Bacteria	1487
1235	Ga0495584_0139355	3300046491	Bacteria	1231
1236	Ga0495585_0001730	3300046492	Bacteria	16612
1237	Ga0495594_0008463	3300046499	Bacteria	5302
1238	Ga0495594_0176840	3300046499	Bacteria	1214
1239	Ga0495594_0342279	3300046499	Bacteria	852
1240	Ga0495596_0121426	3300046500	Bacteria	1014
1241	Ga0495607_0020303	3300046501	Bacteria	4203
1242	Ga0495607_0500227	3300046501	Bacteria	539
1243	Ga0495583_0075613	3300046506	Bacteria	1473
1244	Ga0495583_0237214	3300046506	Bacteria	734
1245	Ga0495608_0000030	3300046511	Bacteria	145828
1246	Ga0495608_0120650	3300046511	Bacteria	1681
1247	Ga0495608_0121311	3300046511	Bacteria	1676
1248	Ga0495618_0000042	3300046514	Bacteria	96182
1249	Ga0495618_0039990	3300046514	Bacteria	2949
1250	Ga0495618_0082933	3300046514	Bacteria	2048
1251	Ga0495618_0138083	3300046514	Bacteria	1559
1252	Ga0495618_0178398	3300046514	Bacteria	1350
1253	Ga0495618_0317153	3300046514	Bacteria	966
1254	Ga0495628_0000027	3300046516	Bacteria	126537
1255	Ga0495628_0022132	3300046516	Bacteria	5225
1256	Ga0495628_0072969	3300046516	Bacteria	2674
1257	Ga0495628_0542034	3300046516	Bacteria	836
1258	Ga0495628_0609331	3300046516	Bacteria	779
1259	Ga0495630_0004014	3300046517	Bacteria	10299
1260	Ga0495630_0091356	3300046517	Bacteria	2300
1261	Ga0495632_0495598	3300046519	Bacteria	527
1262	Ga0495637_0036132	3300046520	Bacteria	2154
1263	Ga0495643_0047383	3300046522	Bacteria	2328
1264	Ga0495644_0010975	3300046523	Bacteria	3492
1265	Ga0495648_0012655	3300046524	Bacteria	6273
1266	Ga0495663_0061656	3300046525	Bacteria	1180
1267	Ga0495666_0009459	3300046526	Bacteria	4870
1268	Ga0495652_0000041	3300046529	Bacteria	126519
1269	Ga0495652_0008048	3300046529	Bacteria	9659
1270	Ga0495652_0310220	3300046529	Bacteria	1143
1271	Ga0495652_0558340	3300046529	Bacteria	786
1272	Ga0495665_0017086	3300046531	Bacteria	3903
1273	Ga0495665_0058767	3300046531	Bacteria	2030
1274	Ga0495640_0000047	3300046533	Bacteria	64381
1275	Ga0495640_0131077	3300046533	Bacteria	1622
1276	Ga0495640_0578553	3300046533	Bacteria	679
1277	Ga0495586_0058434	3300046535	Bacteria	2094
1278	Ga0495586_0206895	3300046535	Bacteria	1113
1279	Ga0495587_0000025	3300046536	Bacteria	147974
1280	Ga0495587_0031066	3300046536	Bacteria	3236
1281	Ga0495587_0114672	3300046536	Bacteria	1546
1282	Ga0495609_0022599	3300046538	Bacteria	2897
1283	Ga0495597_0055137	3300046542	Bacteria	1744
1284	Ga0495645_0000001	3300046543	Bacteria	657910
1285	Ga0495645_0002505	3300046543	Bacteria	12464
1286	Ga0495645_0323447	3300046543	Bacteria	1001
1287	Ga0495622_0007235	3300046557	Bacteria	5153
1288	Ga0495622_0436722	3300046557	Bacteria	562
1289	Ga0495633_0007680	3300046558	Bacteria	6173
1290	Ga0495667_0000001	3300046559	Bacteria	834831
1291	Ga0495667_0004699	3300046559	Bacteria	9233
1292	Ga0495667_0032623	3300046559	Bacteria	3489
1293	Ga0495667_0036143	3300046559	Bacteria	3298
1294	Ga0495667_0260734	3300046559	Bacteria	1102
1295	Ga0495656_0000517	3300046615	Bacteria	12579
1296	Ga0495656_0042360	3300046615	Bacteria	1906
1297	Ga0495668_0038518	3300046616	Bacteria	2670
1298	Ga0495668_0057851	3300046616	Bacteria	2140
1299	Ga0495634_0085278	3300046642	Bacteria	2058
1300	Ga0495634_0173019	3300046642	Bacteria	1356
1301	Ga0495634_0436160	3300046642	Bacteria	774
1302	Ga0495611_0053712	3300046648	Bacteria	1819
1303	Ga0495625_0179799	3300046660	Bacteria	1407
1304	Ga0495635_0000061	3300046663	Bacteria	66702
1305	Ga0495635_0044863	3300046663	Bacteria	3049
1306	Ga0495635_0066556	3300046663	Bacteria	2471
1307	Ga0495635_0103640	3300046663	Bacteria	1944
1308	Ga0495659_0123690	3300046664	Bacteria	1021
1309	Ga0495659_0570386	3300046664	Bacteria	500
1310	Ga0495588_0047763	3300046674	Bacteria	2198
1311	Ga0495588_0053888	3300046674	Bacteria	2074
1312	Ga0495657_0000204	3300046675	Bacteria	53010
1313	Ga0495657_0009621	3300046675	Bacteria	7320
1314	Ga0495657_0017167	3300046675	Bacteria	5260
1315	Ga0495657_0181867	3300046675	Bacteria	1290
1316	Ga0495657_0202642	3300046675	Bacteria	1209
1317	Ga0495657_0555741	3300046675	Bacteria	666
1318	Ga0495599_0000021	3300046678	Bacteria	127591
1319	Ga0495599_0002367	3300046678	Bacteria	10955
1320	Ga0495623_0001713	3300046679	Bacteria	14738
1321	Ga0495623_0150233	3300046679	Bacteria	1377
1322	Ga0495646_0000043	3300046680	Bacteria	65914
1323	Ga0495646_0032503	3300046680	Bacteria	3247
1324	Ga0495646_0134317	3300046680	Bacteria	1390
1325	Ga0495646_0295019	3300046680	Bacteria	859
1326	Ga0495647_0047507	3300046681	Bacteria	1657
1327	Ga0495647_0355060	3300046681	Bacteria	668
1328	Ga0495658_0000611	3300046683	Bacteria	19408
1329	Ga0495658_0083680	3300046683	Bacteria	1877
1330	Ga0495658_0114401	3300046683	Bacteria	1626
1331	Ga0495658_0197274	3300046683	Bacteria	1253
1332	Ga0495658_0906627	3300046683	Bacteria	563
1333	Ga0495613_0124478	3300046689	Bacteria	1849
1334	Ga0495613_0198512	3300046689	Bacteria	1415
1335	Ga0495613_0437874	3300046689	Bacteria	887
1336	Ga0495613_0633319	3300046689	Bacteria	709
1337	Ga0495624_0100412	3300046690	Bacteria	1782
1338	Ga0495624_0416808	3300046690	Bacteria	805
1339	Ga0495624_0737154	3300046690	Bacteria	584
1340	Ga0495670_0001374	3300046691	Bacteria	11900
1341	Ga0495671_0032249	3300046692	Bacteria	2675
1342	Ga0495649_0569142	3300046694	Bacteria	560
1343	Ga0495600_0000082	3300046809	Bacteria	52098
1344	Ga0495600_0013808	3300046809	Bacteria	5087
1345	Ga0495600_0018919	3300046809	Bacteria	4395
1346	Ga0495600_0107085	3300046809	Bacteria	1821
1347	Ga0495600_0184224	3300046809	Bacteria	1345
1348	Ga0495660_0159182	3300046810	Bacteria	1109
1349	Ga0495581_0041004	3300047315	Bacteria	2679
1350	Ga0495581_0069387	3300047315	Bacteria	2038
1351	Ga0495581_0106059	3300047315	Bacteria	1633
1352	Ga0495604_0000036	3300047317	Bacteria	126707
1353	Ga0495604_0003635	3300047317	Bacteria	12295
1354	Ga0495604_0029576	3300047317	Bacteria	4358
1355	Ga0495604_0083155	3300047317	Bacteria	2393
1356	Ga0495604_0454275	3300047317	Bacteria	837
1357	Ga0495674_0000085	3300047319	Bacteria	65389
1358	Ga0495674_0089412	3300047319	Bacteria	2633
1359	Ga0495674_0129898	3300047319	Bacteria	2123
1360	Ga0495672_0000511	3300047320	Bacteria	44639
1361	Ga0495672_0224826	3300047320	Bacteria	925
1362	Ga0495676_0044524	3300047321	Bacteria	3622
1363	Ga0495676_0136951	3300047321	Bacteria	1759
1364	Ga0495676_0384336	3300047321	Bacteria	933
1365	Ga0495680_0000201	3300047322	Bacteria	64686
1366	Ga0495680_0012190	3300047322	Bacteria	7581
1367	Ga0495680_0033890	3300047322	Bacteria	4131
1368	Ga0495680_0038637	3300047322	Bacteria	3813
1369	Ga0495680_0050922	3300047322	Bacteria	3236
1370	Ga0495680_0064801	3300047322	Bacteria	2801
1371	Ga0495675_0000203	3300047444	Bacteria	43496
1372	Ga0495675_0041119	3300047444	Bacteria	2946
1373	Ga0495675_0402460	3300047444	Bacteria	798
1374	Ga0495677_0073687	3300047445	Bacteria	1274
1375	Ga0495679_090808	3300047446	Bacteria	857
1376	Ga0495673_0053722	3300047469	Bacteria	1755
1377	Ga0495684_0000025	3300047471	Bacteria	127037
1378	Ga0495684_0001009	3300047471	Bacteria	22928
1379	Ga0495684_0175536	3300047471	Bacteria	1591
1380	Ga0495684_0243736	3300047471	Bacteria	1310
1381	Ga0495686_0007217	3300047472	Bacteria	8368
1382	Ga0495686_0094078	3300047472	Bacteria	1817
1383	Ga0495686_0396435	3300047472	Bacteria	742
1384	Ga0495593_0005838	3300047673	Bacteria	7257
1385	Ga0495593_0005893	3300047673	Bacteria	7221
1386	Ga0495593_0006282	3300047673	Bacteria	6973
1387	Ga0495593_0162172	3300047673	Bacteria	1128
1388	Ga0495602_0000097	3300048088	Bacteria	82301
1389	Ga0495602_0011391	3300048088	Bacteria	9196
1390	Ga0495602_0117649	3300048088	Bacteria	2145
1391	Ga0495602_0239024	3300048088	Bacteria	1360
1392	Ga0495614_0010246	3300048089	Bacteria	4134
1393	Ga0495614_0254527	3300048089	Bacteria	804
1394	Ga0496100_0000345	3300048903	Bacteria	22686
1395	Ga0496100_0180397	3300048903	Bacteria	1527
1396	Ga0496100_0193541	3300048903	Bacteria	1478
1397	Ga0496100_0242584	3300048903	Bacteria	1330
1398	Ga0496100_0369324	3300048903	Bacteria	1087
1399	Ga0496101_0000866	3300048904	Bacteria	17903
1400	Ga0496101_0264974	3300048904	Bacteria	1341
1401	Ga0496101_0361872	3300048904	Bacteria	1140
1402	Ga0496101_0405328	3300048904	Bacteria	1074
1403	Ga0496101_0408687	3300048904	Bacteria	1069
1404	Ga0496101_0452816	3300048904	Bacteria	1013
1405	Ga0496102_0001833	3300048905	Bacteria	18355
1406	Ga0496102_0030420	3300048905	Bacteria	4833
1407	Ga0496102_0046253	3300048905	Bacteria	3952
1408	Ga0496102_0057472	3300048905	Bacteria	3552
1409	Ga0496102_0176799	3300048905	Bacteria	2010
1410	Ga0496102_0803992	3300048905	Bacteria	862
1411	Ga0496103_0001022	3300048906	Bacteria	19583
1412	Ga0496103_0059644	3300048906	Bacteria	2370
1413	Ga0496103_0289134	3300048906	Bacteria	1054
1414	Ga0496103_0399451	3300048906	Bacteria	883
1415	Ga0496104_0000399	3300048907	Bacteria	38066
1416	Ga0496104_0000877	3300048907	Bacteria	25894
1417	Ga0496104_0020123	3300048907	Bacteria	6114
1418	Ga0496104_0028161	3300048907	Bacteria	5206
1419	Ga0496104_0104480	3300048907	Bacteria	2714
1420	Ga0496104_0255158	3300048907	Bacteria	1666
1421	Ga0496104_0435820	3300048907	Bacteria	1222
1422	Ga0496105_0034025	3300048908	Bacteria	4189
1423	Ga0496105_0144647	3300048908	Bacteria	1955
1424	Ga0496105_0166560	3300048908	Bacteria	1808
1425	Ga0496105_0206329	3300048908	Bacteria	1603
1426	Ga0496105_0213483	3300048908	Bacteria	1572
1427	Ga0496105_0341514	3300048908	Bacteria	1197
1428	Ga0496105_0809102	3300048908	Bacteria	712
1429	Ga0496105_1141381	3300048908	Bacteria	576
1430	Ga0496106_0002528	3300048909	Bacteria	13620
1431	Ga0496106_0014492	3300048909	Bacteria	5824
1432	Ga0496106_0166826	3300048909	Bacteria	1743
1433	Ga0496107_0002539	3300048910	Bacteria	11894
1434	Ga0496107_0039645	3300048910	Bacteria	3379
1435	Ga0496107_0113078	3300048910	Bacteria	1996
1436	Ga0496107_0176722	3300048910	Bacteria	1585
1437	Ga0496107_0274399	3300048910	Bacteria	1255
1438	Ga0496107_0360567	3300048910	Bacteria	1081
1439	Ga0496107_0387778	3300048910	Bacteria	1039
1440	Ga0496107_0396992	3300048910	Bacteria	1026
1441	Ga0496108_0001133	3300048911	Bacteria	20819
1442	Ga0496108_0003711	3300048911	Bacteria	12246
1443	Ga0496108_0009384	3300048911	Bacteria	7921
1444	Ga0496108_0117709	3300048911	Bacteria	2277
1445	Ga0496108_0382743	3300048911	Bacteria	1228
1446	Ga0496108_0396482	3300048911	Bacteria	1205
1447	Ga0496108_0791657	3300048911	Bacteria	818
1448	Ga0496108_0893726	3300048911	Bacteria	763
1449	Ga0496109_0002269	3300048912	Bacteria	15980
1450	Ga0496109_0012681	3300048912	Bacteria	7283
1451	Ga0496109_0044281	3300048912	Bacteria	4037
1452	Ga0496109_0272494	3300048912	Bacteria	1595
1453	Ga0496109_1802661	3300048912	Bacteria	545
1454	Ga0496110_0019741	3300048913	Bacteria	5678
1455	Ga0496110_0043591	3300048913	Bacteria	3917
1456	Ga0496110_0068875	3300048913	Bacteria	3132
1457	Ga0496110_0271704	3300048913	Bacteria	1543
1458	Ga0496110_0439915	3300048913	Bacteria	1188
1459	Ga0496110_0540426	3300048913	Bacteria	1059
1460	Ga0496111_0002980	3300048914	Bacteria	10376
1461	Ga0496111_0008486	3300048914	Bacteria	6803
1462	Ga0496111_0135867	3300048914	Bacteria	1821
1463	Ga0496111_0149885	3300048914	Bacteria	1730
1464	Ga0496111_0209170	3300048914	Bacteria	1449
1465	Ga0496112_0003321	3300048915	Bacteria	13273
1466	Ga0496112_0008550	3300048915	Bacteria	9174
1467	Ga0496112_0369642	3300048915	Bacteria	1375
1468	Ga0496112_0463092	3300048915	Bacteria	1205
1469	Ga0496112_0635160	3300048915	Bacteria	998
1470	Ga0496112_0671067	3300048915	Bacteria	965
1471	Ga0496113_0001829	3300048916	Bacteria	12109
1472	Ga0496113_0015982	3300048916	Bacteria	5176
1473	Ga0496113_0019559	3300048916	Bacteria	4740
1474	Ga0496113_0148667	3300048916	Bacteria	1847
1475	Ga0496113_0285694	3300048916	Bacteria	1319
1476	Ga0496114_0077790	3300048917	Bacteria	2797
1477	Ga0496114_0106099	3300048917	Bacteria	2403
1478	Ga0496114_0183798	3300048917	Bacteria	1826
1479	Ga0496114_0249959	3300048917	Bacteria	1560
1480	Ga0496114_0391497	3300048917	Bacteria	1231
1481	Ga0496114_1075837	3300048917	Bacteria	689
1482	Ga0496114_1187706	3300048917	Bacteria	649
1483	Ga0496115_0002193	3300048918	Bacteria	13992
1484	Ga0496115_0007162	3300048918	Bacteria	8192
1485	Ga0496115_0014002	3300048918	Bacteria	6071
1486	Ga0496115_0034445	3300048918	Bacteria	4002
1487	Ga0496115_0098395	3300048918	Bacteria	2396
1488	Ga0496115_0144079	3300048918	Bacteria	1966
1489	Ga0496115_0257948	3300048918	Bacteria	1434
1490	Ga0496115_0356775	3300048918	Bacteria	1192
1491	Ga0496115_0392748	3300048918	Bacteria	1126
1492	Ga0496115_0452951	3300048918	Bacteria	1036
1493	Ga0496115_0784717	3300048918	Bacteria	743
1494	Ga0496115_0885270	3300048918	Bacteria	689
1495	Ga0496117_0037011	3300048920	Bacteria	3641
1496	Ga0496117_0215495	3300048920	Bacteria	1073
1497	Ga0496118_0066237	3300048921	Bacteria	2638
1498	Ga0496121_0216801	3300048924	Bacteria	1351
1499	Ga0496121_0395355	3300048924	Bacteria	907
1500	Ga0496121_0736693	3300048924	Bacteria	588
1501	Ga0496122_0157227	3300048925	Bacteria	1392
1502	Ga0496122_0161116	3300048925	Bacteria	1368
1503	Ga0496122_0303175	3300048925	Bacteria	860
1504	Ga0496122_0504694	3300048925	Bacteria	587
1505	Ga0496123_0135767	3300048926	Bacteria	1354
1506	Ga0496123_0197881	3300048926	Bacteria	1033
1507	Ga0496124_0010971	3300048927	Bacteria	9109
1508	Ga0496124_0030584	3300048927	Bacteria	4777
1509	Ga0496124_0171025	3300048927	Bacteria	1683
1510	Ga0496124_0173677	3300048927	Bacteria	1666
1511	Ga0496124_0716498	3300048927	Bacteria	632
1512	Ga0496125_0000815	3300048928	Bacteria	50702
1513	Ga0496125_0022078	3300048928	Bacteria	5917
1514	Ga0496125_0318678	3300048928	Bacteria	944
1515	Ga0496125_0369480	3300048928	Bacteria	850
1516	Ga0496125_0389683	3300048928	Bacteria	818
1517	Ga0496126_0054281	3300048929	Bacteria	3630
1518	Ga0496126_0219569	3300048929	Bacteria	1597
1519	Ga0496126_1147949	3300048929	Bacteria	574
1520	Ga0501308_060407	3300049128	Bacteria	571
1521	Ga0501304_043822	3300049160	Bacteria	506
1522	Ga0501305_076125	3300049161	Bacteria	597
1523	Ga0501312_043260	3300049528	Bacteria	741
1524	Ga0501316_063370	3300049532	Bacteria	550
1525	Ga0501317_096120	3300049533	Bacteria	529
1526	Ga0501317_102039	3300049533	Bacteria	519
1527	Ga0501031_0044229	3300049568	Bacteria	2906
1528	Ga0501031_0089158	3300049568	Bacteria	2011
1529	Ga0501031_0259451	3300049568	Bacteria	1129
1530	Ga0501032_0306783	3300049569	Bacteria	1026
1531	Ga0501032_0496206	3300049569	Bacteria	780
1532	Ga0501033_0162832	3300049570	Bacteria	1605
1533	Ga0501033_0865184	3300049570	Bacteria	609
1534	Ga0501034_0017100	3300049571	Bacteria	7439
1535	Ga0501034_0028263	3300049571	Bacteria	5705
1536	Ga0501034_0035161	3300049571	Bacteria	5081
1537	Ga0501034_0045161	3300049571	Bacteria	4452
1538	Ga0501034_0059993	3300049571	Bacteria	3821
1539	Ga0501034_0074577	3300049571	Bacteria	3400
1540	Ga0501034_0164528	3300049571	Bacteria	2187
1541	Ga0501034_0330449	3300049571	Bacteria	1456
1542	Ga0501034_0376836	3300049571	Bacteria	1344
1543	Ga0501034_0396800	3300049571	Bacteria	1303
1544	Ga0501036_0006277	3300049572	Bacteria	9643
1545	Ga0501036_0193525	3300049572	Bacteria	1711
1546	Ga0501036_0289151	3300049572	Bacteria	1371
1547	Ga0501037_0005033	3300049573	Bacteria	9616
1548	Ga0501037_0205303	3300049573	Bacteria	1391
1549	Ga0501037_0217006	3300049573	Bacteria	1347
1550	Ga0501037_0478780	3300049573	Bacteria	846
1551	Ga0501038_0009647	3300049574	Bacteria	8855
1552	Ga0501038_0086394	3300049574	Bacteria	2635
1553	Ga0501038_0188711	3300049574	Bacteria	1659
1554	Ga0501038_0301119	3300049574	Bacteria	1258
1555	Ga0501038_0535474	3300049574	Bacteria	892
1556	Ga0501038_0578538	3300049574	Bacteria	852
1557	Ga0501038_0869031	3300049574	Bacteria	667
1558	Ga0501038_1361742	3300049574	Bacteria	511
1559	Ga0501039_0015523	3300049575	Bacteria	5830
1560	Ga0501039_0494319	3300049575	Bacteria	961
1561	Ga0501039_1187375	3300049575	Bacteria	590
1562	Ga0501040_0587228	3300049576	Bacteria	805
1563	Ga0501041_0978155	3300049577	Bacteria	544
1564	Ga0501042_0284530	3300049578	Bacteria	1194
1565	Ga0501043_0018192	3300049579	Bacteria	5510
1566	Ga0501043_0870287	3300049579	Bacteria	648
1567	Ga0501046_0021621	3300049580	Bacteria	5308
1568	Ga0501047_0018326	3300049581	Bacteria	6709
1569	Ga0501047_0038088	3300049581	Bacteria	4651
1570	Ga0501047_0052152	3300049581	Bacteria	3953
1571	Ga0501047_0056481	3300049581	Bacteria	3796
1572	Ga0501047_0234259	3300049581	Bacteria	1688
1573	Ga0501047_0256543	3300049581	Bacteria	1597
1574	Ga0501047_0627937	3300049581	Bacteria	895
1575	Ga0501047_1222742	3300049581	Bacteria	565
1576	Ga0501048_0001942	3300049582	Bacteria	15692
1577	Ga0501048_0831914	3300049582	Bacteria	663
1578	Ga0501048_1178055	3300049582	Bacteria	551
1579	Ga0501067_0020601	3300049583	Bacteria	3649
1580	Ga0501067_0067901	3300049583	Bacteria	1974
1581	Ga0501067_0345398	3300049583	Bacteria	829
1582	Ga0501068_0045969	3300049584	Bacteria	2631
1583	Ga0501069_0004632	3300049585	Bacteria	7112
1584	Ga0501069_0051908	3300049585	Bacteria	2283
1585	Ga0501069_0109271	3300049585	Bacteria	1574
1586	Ga0501069_0155597	3300049585	Bacteria	1315
1587	Ga0501069_0406166	3300049585	Bacteria	806
1588	Ga0501070_0055589	3300049586	Bacteria	3280
1589	Ga0501070_0058346	3300049586	Bacteria	3199
1590	Ga0501070_0856088	3300049586	Bacteria	711
1591	Ga0501071_0097130	3300049587	Bacteria	2169
1592	Ga0501071_0118739	3300049587	Bacteria	1959
1593	Ga0501072_0033699	3300049588	Bacteria	4013
1594	Ga0501072_0078628	3300049588	Bacteria	2612
1595	Ga0501072_1562509	3300049588	Bacteria	509
1596	Ga0501073_0006036	3300049589	Bacteria	9035
1597	Ga0501073_0023299	3300049589	Bacteria	4446
1598	Ga0501073_0044209	3300049589	Bacteria	3139
1599	Ga0501073_0173804	3300049589	Bacteria	1491
1600	Ga0501073_0316571	3300049589	Bacteria	1077
1601	Ga0501073_0536794	3300049589	Bacteria	808
1602	Ga0501073_0577110	3300049589	Bacteria	777
1603	Ga0501073_0603619	3300049589	Bacteria	758
1604	Ga0501074_0008431	3300049590	Bacteria	7474
1605	Ga0501074_0152430	3300049590	Bacteria	1652
1606	Ga0501074_0718808	3300049590	Bacteria	705
1607	Ga0501074_1310616	3300049590	Bacteria	507
1608	Ga0501075_1387914	3300049591	Bacteria	532
1609	Ga0501076_0032903	3300049592	Bacteria	4048
1610	Ga0501076_0271538	3300049592	Bacteria	1389
1611	Ga0501076_0739393	3300049592	Bacteria	812
1612	Ga0501077_0318577	3300049593	Bacteria	991
1613	Ga0501238_022058	3300049671	Bacteria	904
1614	Ga0501252_002651	3300049682	Bacteria	1794
1615	Ga0501257_007763	3300049686	Bacteria	2400
1616	Ga0501259_124286	3300049688	Bacteria	617
1617	Ga0501079_0026251	3300049741	Bacteria	4465
1618	Ga0501079_0373286	3300049741	Bacteria	1118
1619	Ga0501079_0394953	3300049741	Bacteria	1085
1620	Ga0501080_0002877	3300049742	Bacteria	15135
1621	Ga0501080_0008869	3300049742	Bacteria	9143
1622	Ga0501080_0215833	3300049742	Bacteria	1757
1623	Ga0501080_0795608	3300049742	Bacteria	830
1624	Ga0501080_0973203	3300049742	Bacteria	737
1625	Ga0501081_0018544	3300049743	Bacteria	4624
1626	Ga0501083_0007208	3300049744	Bacteria	7895
1627	Ga0501083_0013341	3300049744	Bacteria	5746
1628	Ga0501083_0076737	3300049744	Bacteria	2217
1629	Ga0501083_0394364	3300049744	Bacteria	900
1630	Ga0501035_0028257	3300049822	Bacteria	5120
1631	Ga0501035_0261515	3300049822	Bacteria	1467
1632	Ga0501035_0620322	3300049822	Bacteria	879
1633	Ga0501035_0900453	3300049822	Bacteria	701
1634	Ga0501044_0000222	3300049823	Bacteria	71930
1635	Ga0501044_0032851	3300049823	Bacteria	5454
1636	Ga0501044_0118609	3300049823	Bacteria	2649
1637	Ga0501044_0204488	3300049823	Bacteria	1932
1638	Ga0501044_0205841	3300049823	Bacteria	1924
1639	Ga0501044_0216880	3300049823	Bacteria	1865
1640	Ga0501045_0028002	3300049824	Bacteria	4064
1641	Ga0501045_1016510	3300049824	Bacteria	608
1642	nmdc:mga03683_412912_c1	3300050489	Bacteria	646
1643	nmdc:mga03683_80179_c1	3300050489	Bacteria	1408
1644	nmdc:mga03683_91269_c1	3300050489	Bacteria	1328
1645	nmdc:mga03n38_215403_c1	3300050490	Bacteria	1000
1646	nmdc:mga03n38_290157_c1	3300050490	Bacteria	876
1647	nmdc:mga03n38_456252_c1	3300050490	Bacteria	712
1648	nmdc:mga00v17_172349_c1	3300050491	Bacteria	1395
1649	nmdc:mga00v17_37044_c1	3300050491	Bacteria	2910
1650	nmdc:mga0yw44_63063_c1	3300050492	Bacteria	2278
1651	nmdc:mga0yw44_845368_c1	3300050492	Bacteria	621
1652	nmdc:mga0k408_103646_c1	3300050493	Bacteria	1678
1653	nmdc:mga0k408_36414_c1	3300050493	Bacteria	2824
1654	nmdc:mga06z11_175512_c1	3300050494	Bacteria	1233
1655	nmdc:mga06z11_337521_c1	3300050494	Bacteria	901
1656	nmdc:mga06z11_35990_c1	3300050494	Bacteria	2441
1657	nmdc:mga06z11_415759_c1	3300050494	Bacteria	810
1658	nmdc:mga06z11_907162_c1	3300050494	Bacteria	537
1659	nmdc:mga07m45_2489_c2	3300050496	Bacteria	6555
1660	nmdc:mga07m45_24989_c1	3300050496	Bacteria	3275
1661	nmdc:mga07m45_25099_c1	3300050496	Bacteria	3267
1662	nmdc:mga07m45_563328_c1	3300050496	Bacteria	659
1663	nmdc:mga07m45_693828_c1	3300050496	Bacteria	586
1664	nmdc:mga07m45_793523_c1	3300050496	Bacteria	543
1665	nmdc:mga05p37_162775_c1	3300050507	Bacteria	2724
1666	nmdc:mga05p37_1975_c1	3300050507	Bacteria	23914
1667	nmdc:mga05p37_5025_c1	3300050507	Bacteria	15503
1668	nmdc:mga05p37_893783_c1	3300050507	Bacteria	959
1669	nmdc:mga09592_1370_c1	3300050508	Bacteria	19524
1670	nmdc:mga0qj67_969_c1	3300050509	Bacteria	19753
1671	nmdc:mga06r32_638_c1	3300050510	Bacteria	30472
1672	nmdc:mga08y16_1126520_c1	3300050511	Bacteria	759
1673	nmdc:mga08y16_1304471_c1	3300050511	Bacteria	692
1674	nmdc:mga08y16_3117_c1	3300050511	Bacteria	17166
1675	nmdc:mga08y16_333_c1	3300050511	Bacteria	42807
1676	nmdc:mga08y16_549_c1	3300050511	Bacteria	34756
1677	nmdc:mga08y16_739259_c1	3300050511	Bacteria	981
1678	nmdc:mga0n895_1174_c1	3300050512	Bacteria	19193
1679	nmdc:mga0n895_127923_c1	3300050512	Bacteria	2564
1680	nmdc:mga0n895_159244_c1	3300050512	Bacteria	2289
1681	nmdc:mga0n895_1799787_c1	3300050512	Bacteria	573
1682	nmdc:mga0n895_1864573_c1	3300050512	Bacteria	561
1683	nmdc:mga0n895_418422_c1	3300050512	Bacteria	1355
1684	nmdc:mga0rr50_121755_c1	3300050513	Bacteria	2078
1685	nmdc:mga0rr50_177346_c1	3300050513	Bacteria	1740
1686	nmdc:mga0rr50_20520_c1	3300050513	Bacteria	4491
1687	nmdc:mga0rr50_246623_c1	3300050513	Bacteria	1482
1688	nmdc:mga08x19_152157_c1	3300050514	Bacteria	1567
1689	nmdc:mga08x19_152425_c1	3300050514	Bacteria	1566
1690	nmdc:mga08x19_164402_c1	3300050514	Bacteria	1508
1691	nmdc:mga0a205_11094_c1	3300050515	Bacteria	8291
1692	nmdc:mga0a205_313758_c1	3300050515	Bacteria	1440
1693	nmdc:mga0a205_745_c1	3300050515	Bacteria	26246
1694	nmdc:mga0a205_809912_c1	3300050515	Bacteria	784
1695	nmdc:mga0sz30_139834_c1	3300050516	Bacteria	1069
1696	nmdc:mga0sz30_1523_c1	3300050516	Bacteria	8254
1697	Ga0495601_0000025	3300053077	Bacteria	127736
1698	Ga0495601_0002429	3300053077	Bacteria	10574
1699	Ga0495601_0003251	3300053077	Bacteria	9279
1700	Ga0495601_0006672	3300053077	Bacteria	6756
1701	Ga0495601_0015608	3300053077	Bacteria	4591
1702	Ga0495601_0033390	3300053077	Bacteria	3206
1703	Ga0495601_0590776	3300053077	Bacteria	713
1704	Ga0495612_0000052	3300053078	Bacteria	53001
1705	Ga0495612_0003265	3300053078	Bacteria	6726
1706	Ga0495612_0016703	3300053078	Bacteria	2941
1707	Ga0495595_0000041	3300053084	Bacteria	67592
1708	Ga0495595_0001632	3300053084	Bacteria	8770
1709	Ga0495595_0003026	3300053084	Bacteria	6649
1710	Ga0495595_0003749	3300053084	Bacteria	6044
1711	Ga0495595_0007744	3300053084	Bacteria	4400
1712	Ga0495595_0157212	3300053084	Bacteria	1120
1713	Ga0495595_0325185	3300053084	Bacteria	774
1714	Ga0495619_0000035	3300053085	Bacteria	126262
1715	Ga0495619_0000430	3300053085	Bacteria	28482
1716	Ga0495619_0001615	3300053085	Bacteria	14835
1717	Ga0495619_0003330	3300053085	Bacteria	10388
1718	Ga0495619_0003962	3300053085	Bacteria	9503
1719	Ga0495619_0016465	3300053085	Bacteria	4680
1720	Ga0495619_0062233	3300053085	Bacteria	2484
1721	Ga0495619_0109718	3300053085	Bacteria	1884
1722	Ga0495619_0177532	3300053085	Bacteria	1473
1723	Ga0500643_009343	3300053087	Bacteria	3752
1724	Ga0500643_035265	3300053087	Bacteria	1501
1725	Ga0500644_0000193	3300053088	Bacteria	37831
1726	Ga0500641_0001231	3300053096	Bacteria	9101
1727	Ga0500641_0019738	3300053096	Bacteria	2551
1728	Ga0500641_0212125	3300053096	Bacteria	823
1729	Ga0500650_0286245	3300053098	Bacteria	732
1730	Ga0500556_0001817	3300053104	Bacteria	7828
1731	Ga0500557_049331	3300053105	Bacteria	1345
1732	Ga0500562_002416	3300053108	Bacteria	4687
1733	Ga0500562_020719	3300053108	Bacteria	1707
1734	Ga0500562_055079	3300053108	Bacteria	1066
1735	Ga0500593_180859	3300053117	Bacteria	783
1736	Ga0500594_0272539	3300053118	Bacteria	565
1737	Ga0500595_129634	3300053119	Bacteria	710
1738	Ga0500597_168416	3300053120	Bacteria	934
1739	Ga0500597_299251	3300053120	Bacteria	642
1740	Ga0500607_097760	3300053121	Bacteria	1464
1741	Ga0500608_000222	3300053122	Bacteria	22331
1742	Ga0500608_032919	3300053122	Bacteria	2465
1743	Ga0500655_040446	3300053133	Bacteria	914
1744	Ga0500658_0183479	3300053134	Bacteria	953
1745	Ga0500559_0069871	3300053136	Bacteria	1579
1746	Ga0500564_000135	3300053138	Bacteria	19069
1747	Ga0500568_0191959	3300053139	Bacteria	749
1748	Ga0500568_0310927	3300053139	Bacteria	572
1749	Ga0500573_0436875	3300053140	Bacteria	609
1750	Ga0500577_0487507	3300053142	Bacteria	538
1751	Ga0500604_0073229	3300053151	Bacteria	1096
1752	Ga0500616_0018884	3300053153	Bacteria	3894
1753	Ga0500616_0055424	3300053153	Bacteria	2073
1754	Ga0500616_0251165	3300053153	Bacteria	755
1755	Ga0500622_0018987	3300053156	Bacteria	3652
1756	Ga0500622_0031276	3300053156	Bacteria	2793
1757	Ga0500622_0259722	3300053156	Bacteria	758
1758	Ga0500622_0332574	3300053156	Bacteria	636
1759	Ga0500633_0260188	3300053160	Bacteria	644
1760	Ga0500639_135971	3300053163	Bacteria	1157
1761	Ga0500636_0002681	3300053177	Bacteria	9896
1762	Ga0500636_0050033	3300053177	Bacteria	2458
1763	Ga0500570_205192	3300053724	Bacteria	591
1764	Ga0500645_001278	3300053730	Bacteria	13167
1765	Ga0500645_005648	3300053730	Bacteria	4571
1766	Ga0501084_0031488	3300054114	Bacteria	4434
1767	Ga0501084_0046145	3300054114	Bacteria	3649
1768	Ga0501084_0211737	3300054114	Bacteria	1635
1769	Ga0501084_0266259	3300054114	Bacteria	1447
1770	Ga0501084_0533359	3300054114	Bacteria	992
1771	Ga0501084_0637288	3300054114	Bacteria	900
1772	Ga0590071_031157	3300059421	Bacteria	1271
1773	Ga0590071_168461	3300059421	Bacteria	572
1774	Ga0587084_068909	3300059477	Bacteria	664
1775	Ga0587066_017027	3300059490	Bacteria	1153
1776	Ga0587066_052768	3300059490	Bacteria	806
1777	Ga0587073_0081450	3300059492	Bacteria	804
1778	Ga0587077_040649	3300059493	Bacteria	932
1779	Ga0587090_032665	3300059510	Bacteria	879
1780	Ga0587091_109908	3300059511	Bacteria	657
1781	Ga0587106_121370	3300059605	Bacteria	555
1782	Ga0587062_032404	3300059639	Bacteria	808
1783	Ga0587068_119057	3300059641	Bacteria	571
1784	Ga0587075_067349	3300059644	Bacteria	658
1785	Ga0587076_040798	3300059645	Bacteria	867
1786	Ga0587108_026425	3300059653	Bacteria	576
1787	Ga0587111_0194114	3300060346	Bacteria	572
1788	Ga0501082_0007607	3300060353	Bacteria	9343
1789	Ga0501082_0029272	3300060353	Bacteria	4743
1790	Ga0501082_0085662	3300060353	Bacteria	2717
1791	Ga0501082_0119601	3300060353	Bacteria	2283
1792	Ga0501082_0568885	3300060353	Bacteria	991
1793	Ga0501082_0575178	3300060353	Bacteria	986
1794	Ga0501082_1138811	3300060353	Bacteria	682
1795	Ga0530510_0176391	3300061734	Bacteria	1584
1796	Ga0530510_1029242	3300061734	Bacteria	630

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300002074	JGI24748J21848_1044346	JGI24748J21848_10443461	112
2	3300053153	Ga0500616_0251165	Ga0500616_0251165_196_546	116
3	3300048918	Ga0496115_0885270	Ga0496115_0885270_89_442	117
4	3300050496	nmdc:mga07m45_793523_c1	nmdc:mga07m45_793523_c1_94_447	117
5	3300048918	Ga0496115_0034445	Ga0496115_0034445_578_934	118
6	3300049574	Ga0501038_0535474	Ga0501038_0535474_173_529	118
7	3300049581	Ga0501047_0052152	Ga0501047_0052152_493_855	118
8	3300053087	Ga0500643_009343	Ga0500643_009343_18_374	118
9	3300053087	Ga0500643_035265	Ga0500643_035265_18_374	118
10	3300053120	Ga0500597_299251	Ga0500597_299251_129_620	118
11	3300053156	Ga0500622_0031276	Ga0500622_0031276_2370_2726	118
12	3300014325	Ga0163163_10102634	Ga0163163_101026342	119
13	3300046500	Ga0495596_0121426	Ga0495596_0121426_278_637	119
14	3300049533	Ga0501317_102039	Ga0501317_102039_22_387	119
15	3300049574	Ga0501038_1361742	Ga0501038_1361742_11_376	119
16	3300042117	Ga0450913_032839	Ga0450913_032839_134_505	121
17	3300049572	Ga0501036_0193525	Ga0501036_0193525_1043_1411	121
18	3300049576	Ga0501040_0587228	Ga0501040_0587228_420_791	121
19	3300049587	Ga0501071_0097130	Ga0501071_0097130_665_1033	121
20	3300054114	Ga0501084_0637288	Ga0501084_0637288_450_818	121
21	3300010159	Ga0099796_10005742	Ga0099796_100057422	122
22	3300035118	Ga0373954_0197144	Ga0373954_0197144_104_472	122
23	3300035172	Ga0373955_0764236	Ga0373955_0764236_108_476	122
24	3300035724	Ga0373933_0510271	Ga0373933_0510271_261_629	122
25	3300036401	Ga0373937_0046907	Ga0373937_0046907_909_1277	122
26	3300037068	Ga0373925_0648895	Ga0373925_0648895_182_550	122
27	3300046454	Ga0495592_0017126	Ga0495592_0017126_3864_4232	122
28	3300046475	Ga0495639_0493904	Ga0495639_0493904_151_519	122
29	3300046514	Ga0495618_0178398	Ga0495618_0178398_224_592	122
30	3300046533	Ga0495640_0578553	Ga0495640_0578553_113_481	122
31	3300046535	Ga0495586_0206895	Ga0495586_0206895_430_798	122
32	3300046559	Ga0495667_0032623	Ga0495667_0032623_2125_2493	122
33	3300046642	Ga0495634_0173019	Ga0495634_0173019_671_1039	122
34	3300046663	Ga0495635_0066556	Ga0495635_0066556_47_415	122
35	3300046675	Ga0495657_0202642	Ga0495657_0202642_182_550	122
36	3300046809	Ga0495600_0184224	Ga0495600_0184224_32_400	122
37	3300047322	Ga0495680_0038637	Ga0495680_0038637_963_1331	122
38	3300053077	Ga0495601_0006672	Ga0495601_0006672_2293_2661	122
39	3300053084	Ga0495595_0001632	Ga0495595_0001632_4426_4794	122
40	3300053085	Ga0495619_0003962	Ga0495619_0003962_8504_8872	122
41	3300035120	Ga0373957_0087877	Ga0373957_0087877_731_1102	123
42	3300038443	Ga0395901_0721825	Ga0395901_0721825_601_972	123
43	3300046664	Ga0495659_0570386	Ga0495659_0570386_98_469	123
44	3300053085	Ga0495619_0016465	Ga0495619_0016465_4277_4648	123
45	3300034818	Ga0373950_0056899	Ga0373950_0056899_385_759	124
46	3300034820	Ga0373959_0070271	Ga0373959_0070271_393_767	124
47	3300035398	Ga0316574_0108769	Ga0316574_0108769_1378_1764	124
48	3300042008	Ga0439450_043419	Ga0439450_043419_647_1021	124
49	3300046473	Ga0495582_0351818	Ga0495582_0351818_16_390	124
50	3300047320	Ga0495672_0224826	Ga0495672_0224826_527_904	124
51	3300048089	Ga0495614_0254527	Ga0495614_0254527_410_784	124
52	3300048915	Ga0496112_0635160	Ga0496112_0635160_268_642	124
53	3300049581	Ga0501047_0627937	Ga0501047_0627937_232_606	124
54	3300053119	Ga0500595_129634	Ga0500595_129634_19_393	124
55	3300009093	Ga0105240_11017359	Ga0105240_110173591	128
56	3300049824	Ga0501045_1016510	Ga0501045_1016510_100_540	130
57	iso_pu_bacteria	2582581279	2585150074	133
58	iso_pu_bacteria	2582581280	2585155403	133
59	iso_pu_bacteria	2582581293	2585199187	133
60	iso_pu_bacteria	2585428106	2587919530	133
61	iso_pu_bacteria	2643221545	2643747970	133
62	iso_pu_bacteria	2643221552	2643781683	133
63	iso_pu_bacteria	2643221584	2643931623	133
64	iso_pu_bacteria	2643221640	2644226539	133
65	iso_pu_bacteria	2643221642	2644236027	133
66	iso_pu_bacteria	2643221691	2644507927	133
67	iso_pu_bacteria	2643221733	2644729076	133
68	iso_pu_bacteria	2643221734	2644735433	133
69	iso_pu_bacteria	2791355048	2792463736	133
70	iso_pu_bacteria	2818991435	2819536840	133
71	iso_pu_bacteria	2818991454	2819646001	133
72	iso_pu_bacteria	2818991467	2819720945	133
73	iso_pu_bacteria	2841911363	2841913406	133
74	iso_pu_bacteria	2841917233	2841919153	133
75	iso_pu_bacteria	2843744320	2843747109	133
76	iso_pu_bacteria	2849560528	2849560648	133
77	iso_pu_bacteria	2849573788	2849578489	133
78	iso_pu_bacteria	2851153111	2851154268	133
79	iso_pu_bacteria	2857504554	2857509541	133
80	iso_pu_bacteria	2898329390	2898331328	133
81	iso_pu_bacteria	2917699015	2917699291	133
82	iso_pu_bacteria	2928531327	2928535730	133
83	iso_pu_bacteria	2643221736	2644747729	134
84	iso_pu_bacteria	2841760612	2841761404	134
85	iso_pu_bacteria	2844104063	2844104429	134
86	iso_pu_bacteria	2851182111	2851184476	134
87	iso_pu_bacteria	2851246043	2851247417	134
88	iso_pu_bacteria	8057529695	8057530412	134
89	3300009093	Ga0105240_10069122	Ga0105240_100691222	135
90	3300009147	Ga0114129_10387596	Ga0114129_103875962	135
91	3300015261	Ga0182006_1198001	Ga0182006_11980011	135
92	3300021358	Ga0213873_10129740	Ga0213873_101297402	135
93	3300021361	Ga0213872_10059812	Ga0213872_100598122	135
94	3300025913	Ga0207695_10163502	Ga0207695_101635022	135
95	3300039437	Ga0436365_0381831	Ga0436365_0381831_43_453	135
96	3300039447	Ga0436361_0019983	Ga0436361_0019983_2232_2639	135
97	3300050507	nmdc:mga05p37_162775_c1	nmdc:mga05p37_162775_c1_409_816	135
98	3300005339	Ga0070660_100028369	Ga0070660_1000283697	136
99	3300005366	Ga0070659_100060508	Ga0070659_1000605084	136
100	3300005458	Ga0070681_10014751	Ga0070681_100147519	136
101	3300005530	Ga0070679_100014413	Ga0070679_1000144136	136
102	3300005539	Ga0068853_100535399	Ga0068853_1005353991	136
103	3300005563	Ga0068855_100400837	Ga0068855_1004008372	136
104	3300005616	Ga0068852_100146105	Ga0068852_1001461052	136
105	3300025909	Ga0207705_10099871	Ga0207705_100998713	136
106	3300025912	Ga0207707_10607624	Ga0207707_106076242	136
107	3300025917	Ga0207660_10000537	Ga0207660_1000053735	136
108	3300025919	Ga0207657_10006388	Ga0207657_1000638811	136
109	3300025921	Ga0207652_10524861	Ga0207652_105248611	136
110	3300025932	Ga0207690_10008862	Ga0207690_100088627	136
111	3300025949	Ga0207667_10026409	Ga0207667_100264091	136
112	3300026041	Ga0207639_10404906	Ga0207639_104049062	136
113	3300026089	Ga0207648_10069434	Ga0207648_100694342	136
114	3300026142	Ga0207698_10146647	Ga0207698_101466472	136
115	3300028558	Ga0265326_10018004	Ga0265326_100180043	136
116	3300028573	Ga0265334_10039911	Ga0265334_100399112	136
117	3300028800	Ga0265338_10011450	Ga0265338_1001145011	136
118	3300031251	Ga0265327_10120391	Ga0265327_101203912	136
119	3300031711	Ga0265314_10196129	Ga0265314_101961292	136
120	3300039438	Ga0436360_0054431	Ga0436360_0054431_853_1263	136
121	3300039453	Ga0436362_0342583	Ga0436362_0342583_129_539	136
122	3300046694	Ga0495649_0569142	Ga0495649_0569142_101_517	136
123	3300048903	Ga0496100_0193541	Ga0496100_0193541_715_1125	136
124	3300048904	Ga0496101_0405328	Ga0496101_0405328_208_618	136
125	3300048912	Ga0496109_1802661	Ga0496109_1802661_80_490	136
126	3300048929	Ga0496126_1147949	Ga0496126_1147949_67_477	136
127	3300053140	Ga0500573_0436875	Ga0500573_0436875_20_430	136
128	3300059605	Ga0587106_121370	Ga0587106_121370_134_544	136
129	3300059639	Ga0587062_032404	Ga0587062_032404_12_422	136
130	iso_pu_bacteria	2508501050	2508735887	136
131	iso_pu_bacteria	2508501114	2509078211	136
132	iso_pu_bacteria	2643221591	2643963595	136
133	iso_pu_bacteria	2773857925	2774868355	136
134	iso_pu_bacteria	2775506901	2776259160	136
135	iso_pu_bacteria	2882456835	2882459701	136
136	iso_pu_bacteria	2884298095	2884300429	136
137	3300000652	ARCol0yngRDRAFT_1012791	ARCol0yngRDRAFT_10127911	137
138	3300003215	JGI25153J46596_10038289	JGI25153J46596_100382891	137
139	3300003578	Ga0006562J51391_1021791	Ga0006562J51391_10217914	137
140	3300003771	Ga0055526_1000275	Ga0055526_100027546	137
141	3300003771	Ga0055526_1000920	Ga0055526_10009202	137
142	3300003771	Ga0055526_1083877	Ga0055526_10838771	137
143	3300003773	Ga0055537_1005208	Ga0055537_10052083	137
144	3300003773	Ga0055537_1005245	Ga0055537_10052453	137
145	3300003775	Ga0055524_1002898	Ga0055524_10028981	137
146	3300003781	Ga0055536_1001081	Ga0055536_100108122	137
147	3300003781	Ga0055536_1001342	Ga0055536_100134219	137
148	3300003784	Ga0055534_1016781	Ga0055534_10167811	137
149	3300003790	Ga0055528_1009498	Ga0055528_10094983	137
150	3300003790	Ga0055528_1016153	Ga0055528_10161532	137
151	3300003791	Ga0055530_10005358	Ga0055530_100053581	137
152	3300003791	Ga0055530_10045935	Ga0055530_100459351	137
153	3300003794	Ga0055531_10001386	Ga0055531_1000138623	137
154	3300003794	Ga0055531_10004281	Ga0055531_100042812	137
155	3300004625	Ga0055543_1016442	Ga0055543_10164422	137
156	3300005262	Ga0065165_1001803	Ga0065165_100180310	137
157	3300005333	Ga0070677_10484401	Ga0070677_104844011	137
158	3300005353	Ga0070669_100288991	Ga0070669_1002889911	137
159	3300005353	Ga0070669_101542334	Ga0070669_1015423341	137
160	3300005367	Ga0070667_100454604	Ga0070667_1004546042	137
161	3300005367	Ga0070667_101120756	Ga0070667_1011207561	137
162	3300005535	Ga0070684_101939168	Ga0070684_1019391681	137
163	3300005564	Ga0070664_100850633	Ga0070664_1008506331	137
164	3300005577	Ga0068857_101170800	Ga0068857_1011708001	137
165	3300005614	Ga0068856_100335526	Ga0068856_1003355262	137
166	3300005618	Ga0068864_100529441	Ga0068864_1005294412	137
167	3300005843	Ga0068860_100070125	Ga0068860_1000701256	137
168	3300005844	Ga0068862_100030534	Ga0068862_1000305344	137
169	3300005844	Ga0068862_100853065	Ga0068862_1008530652	137
170	3300005937	Ga0081455_10033778	Ga0081455_100337786	137
171	3300006175	Ga0070712_101987509	Ga0070712_1019875091	137
172	3300006177	Ga0075362_10126521	Ga0075362_101265212	137
173	3300006186	Ga0075369_10011991	Ga0075369_100119912	137
174	3300006880	Ga0075429_101497641	Ga0075429_1014976411	137
175	3300009093	Ga0105240_10049745	Ga0105240_100497452	137
176	3300009098	Ga0105245_10565043	Ga0105245_105650432	137
177	3300009148	Ga0105243_10455669	Ga0105243_104556692	137
178	3300009176	Ga0105242_10148979	Ga0105242_101489792	137
179	3300009545	Ga0105237_10379249	Ga0105237_103792491	137
180	3300010375	Ga0105239_10810853	Ga0105239_108108531	137
181	3300012497	Ga0157319_1003618	Ga0157319_10036181	137
182	3300013306	Ga0163162_10650339	Ga0163162_106503392	137
183	3300014325	Ga0163163_10002310	Ga0163163_1000231023	137
184	3300014969	Ga0157376_12046797	Ga0157376_120467971	137
185	3300020070	Ga0206356_11728648	Ga0206356_117286481	137
186	3300021384	Ga0213876_10032629	Ga0213876_100326294	137
187	3300025263	Ga0209565_1000925	Ga0209565_100092525	137
188	3300025273	Ga0209673_1002524	Ga0209673_10025244	137
189	3300025291	Ga0209675_1012787	Ga0209675_10127871	137
190	3300025292	Ga0209676_1000184	Ga0209676_10001842	137
191	3300025292	Ga0209676_1001543	Ga0209676_10015432	137
192	3300025292	Ga0209676_1019806	Ga0209676_10198063	137
193	3300025294	Ga0209025_1000014	Ga0209025_100001423	137
194	3300025294	Ga0209025_1039298	Ga0209025_10392982	137
195	3300025295	Ga0209564_1000105	Ga0209564_10001052	137
196	3300025295	Ga0209564_1000150	Ga0209564_1000150173	137
197	3300025295	Ga0209564_1007005	Ga0209564_10070054	137
198	3300025295	Ga0209564_1050899	Ga0209564_10508992	137
199	3300025297	Ga0209758_1004614	Ga0209758_10046143	137
200	3300025297	Ga0209758_1115748	Ga0209758_11157482	137
201	3300025298	Ga0209050_1000514	Ga0209050_10005142	137
202	3300025298	Ga0209050_1001690	Ga0209050_100169024	137
203	3300025299	Ga0209256_1000108	Ga0209256_1000108173	137
204	3300025299	Ga0209256_1000540	Ga0209256_100054043	137
205	3300025303	Ga0209051_1013891	Ga0209051_10138915	137
206	3300025304	Ga0209257_1000976	Ga0209257_100097626	137
207	3300025304	Ga0209257_1001464	Ga0209257_100146425	137
208	3300025304	Ga0209257_1005353	Ga0209257_100535313	137
209	3300025304	Ga0209257_1035789	Ga0209257_10357893	137
210	3300025927	Ga0207687_10189901	Ga0207687_101899012	137
211	3300025934	Ga0207686_10109446	Ga0207686_101094461	137
212	3300025942	Ga0207689_10573108	Ga0207689_105731081	137
213	3300025945	Ga0207679_10160577	Ga0207679_101605772	137
214	3300025961	Ga0207712_10686501	Ga0207712_106865012	137
215	3300025986	Ga0207658_10467669	Ga0207658_104676692	137
216	3300025986	Ga0207658_10753124	Ga0207658_107531242	137
217	3300026078	Ga0207702_10252717	Ga0207702_102527171	137
218	3300026095	Ga0207676_11255012	Ga0207676_112550122	137
219	3300028380	Ga0268265_11675389	Ga0268265_116753892	137
220	3300028381	Ga0268264_10029317	Ga0268264_100293175	137
221	3300028794	Ga0307515_10048582	Ga0307515_100485826	137
222	3300028794	Ga0307515_10119387	Ga0307515_101193872	137
223	3300029957	Ga0265324_10081106	Ga0265324_100811061	137
224	3300031235	Ga0265330_10110543	Ga0265330_101105431	137
225	3300031239	Ga0265328_10000041	Ga0265328_1000004171	137
226	3300031239	Ga0265328_10000129	Ga0265328_1000012929	137
227	3300031239	Ga0265328_10010978	Ga0265328_100109786	137
228	3300031239	Ga0265328_10173158	Ga0265328_101731581	137
229	3300031241	Ga0265325_10094695	Ga0265325_100946952	137
230	3300031242	Ga0265329_10004117	Ga0265329_100041178	137
231	3300031247	Ga0265340_10114608	Ga0265340_101146082	137
232	3300031249	Ga0265339_10030849	Ga0265339_100308494	137
233	3300031250	Ga0265331_10005777	Ga0265331_100057776	137
234	3300031250	Ga0265331_10154410	Ga0265331_101544102	137
235	3300031250	Ga0265331_10166663	Ga0265331_101666632	137
236	3300031251	Ga0265327_10016517	Ga0265327_100165175	137
237	3300031344	Ga0265316_10003918	Ga0265316_1000391813	137
238	3300031344	Ga0265316_10097867	Ga0265316_100978671	137
239	3300031344	Ga0265316_10698386	Ga0265316_106983862	137
240	3300031548	Ga0307408_100063348	Ga0307408_1000633486	137
241	3300031712	Ga0265342_10059225	Ga0265342_100592254	137
242	3300031824	Ga0307413_11444643	Ga0307413_114446431	137
243	3300032002	Ga0307416_103667666	Ga0307416_1036676661	137
244	3300032004	Ga0307414_10582031	Ga0307414_105820312	137
245	3300035112	Ga0373932_0243937	Ga0373932_0243937_146_559	137
246	3300035121	Ga0373960_0011227	Ga0373960_0011227_1564_1983	137
247	3300035170	Ga0373943_0512874	Ga0373943_0512874_244_657	137
248	3300035242	Ga0373962_0007458	Ga0373962_0007458_275_694	137
249	3300035691	Ga0373931_0276633	Ga0373931_0276633_237_656	137
250	3300035691	Ga0373931_0359025	Ga0373931_0359025_151_564	137
251	3300035695	Ga0373927_0063626	Ga0373927_0063626_1515_1928	137
252	3300035725	Ga0373947_0266574	Ga0373947_0266574_638_1051	137
253	3300036401	Ga0373937_0851768	Ga0373937_0851768_249_662	137
254	3300037068	Ga0373925_0123243	Ga0373925_0123243_1391_1804	137
255	3300037853	Ga0436364_0252322	Ga0436364_0252322_157_582	137
256	3300039437	Ga0436365_0694219	Ga0436365_0694219_3357_3770	137
257	3300039438	Ga0436360_0394454	Ga0436360_0394454_244_657	137
258	3300039450	Ga0436363_0503724	Ga0436363_0503724_190_615	137
259	3300041460	Ga0451802_1484532	Ga0451802_1484532_179_592	137
260	3300044684	Ga0466966_0333666	Ga0466966_0333666_100_525	137
261	3300044842	Ga0466957_0531101	Ga0466957_0531101_281_706	137
262	3300044842	Ga0466957_0721166	Ga0466957_0721166_164_589	137
263	3300045049	Ga0466959_0143618	Ga0466959_0143618_107_532	137
264	3300045836	Ga0466958_0268720	Ga0466958_0268720_442_867	137
265	3300046455	Ga0495603_0227008	Ga0495603_0227008_73_486	137
266	3300046460	Ga0495638_0002745	Ga0495638_0002745_1107_1520	137
267	3300046460	Ga0495638_0084415	Ga0495638_0084415_91_504	137
268	3300046519	Ga0495632_0495598	Ga0495632_0495598_86_505	137
269	3300046522	Ga0495643_0047383	Ga0495643_0047383_951_1367	137
270	3300046524	Ga0495648_0012655	Ga0495648_0012655_2618_3031	137
271	3300046542	Ga0495597_0055137	Ga0495597_0055137_1303_1716	137
272	3300046616	Ga0495668_0038518	Ga0495668_0038518_287_700	137
273	3300046616	Ga0495668_0057851	Ga0495668_0057851_1709_2122	137
274	3300046660	Ga0495625_0179799	Ga0495625_0179799_770_1183	137
275	3300046664	Ga0495659_0123690	Ga0495659_0123690_107_520	137
276	3300046810	Ga0495660_0159182	Ga0495660_0159182_635_1051	137
277	3300047315	Ga0495581_0069387	Ga0495581_0069387_874_1287	137
278	3300047320	Ga0495672_0000511	Ga0495672_0000511_30463_30882	137
279	3300047469	Ga0495673_0053722	Ga0495673_0053722_1066_1479	137
280	3300047472	Ga0495686_0396435	Ga0495686_0396435_77_505	137
281	3300048903	Ga0496100_0369324	Ga0496100_0369324_11_424	137
282	3300048905	Ga0496102_0030420	Ga0496102_0030420_827_1240	137
283	3300048907	Ga0496104_0028161	Ga0496104_0028161_1630_2043	137
284	3300048908	Ga0496105_0034025	Ga0496105_0034025_1512_1925	137
285	3300048908	Ga0496105_0809102	Ga0496105_0809102_131_544	137
286	3300048910	Ga0496107_0360567	Ga0496107_0360567_219_632	137
287	3300048911	Ga0496108_0001133	Ga0496108_0001133_13530_13943	137
288	3300048911	Ga0496108_0893726	Ga0496108_0893726_243_656	137
289	3300048912	Ga0496109_0012681	Ga0496109_0012681_6075_6488	137
290	3300048913	Ga0496110_0043591	Ga0496110_0043591_2855_3268	137
291	3300048913	Ga0496110_0439915	Ga0496110_0439915_202_615	137
292	3300048914	Ga0496111_0002980	Ga0496111_0002980_785_1198	137
293	3300048915	Ga0496112_0008550	Ga0496112_0008550_5777_6190	137
294	3300048916	Ga0496113_0001829	Ga0496113_0001829_6693_7106	137
295	3300048917	Ga0496114_0249959	Ga0496114_0249959_923_1336	137
296	3300048917	Ga0496114_1075837	Ga0496114_1075837_242_655	137
297	3300048917	Ga0496114_1187706	Ga0496114_1187706_154_570	137
298	3300048918	Ga0496115_0002193	Ga0496115_0002193_5967_6380	137
299	3300048918	Ga0496115_0144079	Ga0496115_0144079_1265_1678	137
300	3300048920	Ga0496117_0037011	Ga0496117_0037011_1686_2102	137
301	3300048920	Ga0496117_0215495	Ga0496117_0215495_585_1001	137
302	3300048921	Ga0496118_0066237	Ga0496118_0066237_2085_2501	137
303	3300048924	Ga0496121_0216801	Ga0496121_0216801_321_734	137
304	3300048925	Ga0496122_0157227	Ga0496122_0157227_586_1002	137
305	3300048925	Ga0496122_0303175	Ga0496122_0303175_202_618	137
306	3300048926	Ga0496123_0135767	Ga0496123_0135767_482_898	137
307	3300048926	Ga0496123_0197881	Ga0496123_0197881_395_808	137
308	3300048927	Ga0496124_0010971	Ga0496124_0010971_1289_1702	137
309	3300048927	Ga0496124_0171025	Ga0496124_0171025_452_868	137
310	3300048927	Ga0496124_0716498	Ga0496124_0716498_97_513	137
311	3300048928	Ga0496125_0022078	Ga0496125_0022078_5335_5748	137
312	3300048928	Ga0496125_0369480	Ga0496125_0369480_94_510	137
313	3300048928	Ga0496125_0389683	Ga0496125_0389683_45_461	137
314	3300048929	Ga0496126_0054281	Ga0496126_0054281_2448_2861	137
315	3300048929	Ga0496126_0219569	Ga0496126_0219569_1101_1517	137
316	3300049571	Ga0501034_0035161	Ga0501034_0035161_3242_3658	137
317	3300049574	Ga0501038_0869031	Ga0501038_0869031_185_601	137
318	3300049583	Ga0501067_0345398	Ga0501067_0345398_170_589	137
319	3300049589	Ga0501073_0316571	Ga0501073_0316571_636_1049	137
320	3300049591	Ga0501075_1387914	Ga0501075_1387914_24_443	137
321	3300049686	Ga0501257_007763	Ga0501257_007763_1277_1690	137
322	3300049742	Ga0501080_0008869	Ga0501080_0008869_3500_3919	137
323	3300049744	Ga0501083_0394364	Ga0501083_0394364_193_612	137
324	3300050489	nmdc:mga03683_412912_c1	nmdc:mga03683_412912_c1_170_583	137
325	3300050496	nmdc:mga07m45_563328_c1	nmdc:mga07m45_563328_c1_38_451	137
326	3300050496	nmdc:mga07m45_693828_c1	nmdc:mga07m45_693828_c1_61_474	137
327	3300050516	nmdc:mga0sz30_1523_c1	nmdc:mga0sz30_1523_c1_6398_6811	137
328	3300053088	Ga0500644_0000193	Ga0500644_0000193_26194_26607	137
329	3300053096	Ga0500641_0001231	Ga0500641_0001231_7843_8256	137
330	3300053096	Ga0500641_0212125	Ga0500641_0212125_355_768	137
331	3300053098	Ga0500650_0286245	Ga0500650_0286245_49_462	137
332	3300053104	Ga0500556_0001817	Ga0500556_0001817_563_976	137
333	3300053105	Ga0500557_049331	Ga0500557_049331_835_1248	137
334	3300053108	Ga0500562_020719	Ga0500562_020719_1208_1621	137
335	3300053117	Ga0500593_180859	Ga0500593_180859_55_468	137
336	3300053118	Ga0500594_0272539	Ga0500594_0272539_54_473	137
337	3300053121	Ga0500607_097760	Ga0500607_097760_157_573	137
338	3300053122	Ga0500608_000222	Ga0500608_000222_10525_10938	137
339	3300053122	Ga0500608_032919	Ga0500608_032919_130_546	137
340	3300053133	Ga0500655_040446	Ga0500655_040446_415_828	137
341	3300053136	Ga0500559_0069871	Ga0500559_0069871_775_1188	137
342	3300053138	Ga0500564_000135	Ga0500564_000135_413_826	137
343	3300053139	Ga0500568_0191959	Ga0500568_0191959_112_525	137
344	3300053142	Ga0500577_0487507	Ga0500577_0487507_39_452	137
345	3300053151	Ga0500604_0073229	Ga0500604_0073229_85_498	137
346	3300053153	Ga0500616_0018884	Ga0500616_0018884_349_765	137
347	3300053153	Ga0500616_0055424	Ga0500616_0055424_478_891	137
348	3300053156	Ga0500622_0018987	Ga0500622_0018987_2589_3002	137
349	3300053156	Ga0500622_0259722	Ga0500622_0259722_310_723	137
350	3300053156	Ga0500622_0332574	Ga0500622_0332574_95_511	137
351	3300053160	Ga0500633_0260188	Ga0500633_0260188_14_427	137
352	3300053177	Ga0500636_0002681	Ga0500636_0002681_5483_5899	137
353	3300053730	Ga0500645_001278	Ga0500645_001278_10501_10914	137
354	3300053730	Ga0500645_005648	Ga0500645_005648_2871_3284	137
355	3300059421	Ga0590071_031157	Ga0590071_031157_759_1178	137
356	3300059490	Ga0587066_017027	Ga0587066_017027_717_1133	137
357	3300059493	Ga0587077_040649	Ga0587077_040649_499_915	137
358	3300059510	Ga0587090_032665	Ga0587090_032665_450_866	137
359	3300059641	Ga0587068_119057	Ga0587068_119057_17_430	137
360	3300060353	Ga0501082_0007607	Ga0501082_0007607_1459_1878	137
361	iso_pu_bacteria	2643221580	2643911605	137
362	iso_pu_bacteria	2643221674	2644410397	137
363	3300002987	JGI25159J45721_1003766	JGI25159J45721_10037665	138
364	3300003187	JGI25151J46595_10080305	JGI25151J46595_100803051	138
365	3300003354	JGI25160J50197_1050906	JGI25160J50197_10509062	138
366	3300005262	Ga0065165_1000631	Ga0065165_100063132	138
367	3300005331	Ga0070670_100000958	Ga0070670_10000095830	138
368	3300005335	Ga0070666_10129060	Ga0070666_101290602	138
369	3300005347	Ga0070668_100006389	Ga0070668_1000063892	138
370	3300005367	Ga0070667_100002468	Ga0070667_10000246817	138
371	3300005439	Ga0070711_100825307	Ga0070711_1008253071	138
372	3300005548	Ga0070665_100001301	Ga0070665_1000013012	138
373	3300005618	Ga0068864_100000263	Ga0068864_10000026339	138
374	3300005841	Ga0068863_100001518	Ga0068863_10000151825	138
375	3300005842	Ga0068858_100001726	Ga0068858_1000017265	138
376	3300005843	Ga0068860_100001684	Ga0068860_10000168427	138
377	3300005844	Ga0068862_100051035	Ga0068862_1000510354	138
378	3300006038	Ga0075365_10445390	Ga0075365_104453901	138
379	3300006177	Ga0075362_10153595	Ga0075362_101535952	138
380	3300009011	Ga0105251_10309869	Ga0105251_103098691	138
381	3300009553	Ga0105249_10004402	Ga0105249_1000440212	138
382	3300012507	Ga0157342_1025288	Ga0157342_10252881	138
383	3300014968	Ga0157379_10223529	Ga0157379_102235292	138
384	3300021388	Ga0213875_10050853	Ga0213875_100508531	138
385	3300021388	Ga0213875_10267217	Ga0213875_102672171	138
386	3300025284	Ga0209130_1000375	Ga0209130_100037544	138
387	3300025294	Ga0209025_1011370	Ga0209025_10113705	138
388	3300025302	Ga0207426_1029473	Ga0207426_10294732	138
389	3300025903	Ga0207680_10106561	Ga0207680_101065612	138
390	3300025906	Ga0207699_10804921	Ga0207699_108049211	138
391	3300025925	Ga0207650_10000883	Ga0207650_100008838	138
392	3300025961	Ga0207712_10000998	Ga0207712_100009988	138
393	3300025972	Ga0207668_10000363	Ga0207668_100003635	138
394	3300025986	Ga0207658_10001253	Ga0207658_100012536	138
395	3300026035	Ga0207703_10003217	Ga0207703_1000321711	138
396	3300026088	Ga0207641_10073357	Ga0207641_100733574	138
397	3300026095	Ga0207676_10000247	Ga0207676_1000024739	138
398	3300028379	Ga0268266_10075059	Ga0268266_100750594	138
399	3300028380	Ga0268265_10005077	Ga0268265_100050771	138
400	3300028381	Ga0268264_10000383	Ga0268264_1000038329	138
401	3300031239	Ga0265328_10031945	Ga0265328_100319452	138
402	3300031247	Ga0265340_10143556	Ga0265340_101435561	138
403	3300031247	Ga0265340_10290491	Ga0265340_102904911	138
404	3300031249	Ga0265339_10233369	Ga0265339_102333691	138
405	3300032002	Ga0307416_103046246	Ga0307416_1030462461	138
406	3300037853	Ga0436364_0205767	Ga0436364_0205767_1004_1420	138
407	3300037853	Ga0436364_0644969	Ga0436364_0644969_1339_1755	138
408	3300038705	Ga0237819_04172	Ga0237819_04172_44_463	138
409	3300039437	Ga0436365_1757536	Ga0436365_1757536_79_495	138
410	3300039447	Ga0436361_0168365	Ga0436361_0168365_1011_1427	138
411	3300039450	Ga0436363_0524113	Ga0436363_0524113_77_493	138
412	3300039450	Ga0436363_1642696	Ga0436363_1642696_304_720	138
413	3300041456	Ga0451795_0221745	Ga0451795_0221745_82_498	138
414	3300041509	Ga0451843_1462452	Ga0451843_1462452_69_485	138
415	3300044842	Ga0466957_0389371	Ga0466957_0389371_265_681	138
416	3300048905	Ga0496102_0046253	Ga0496102_0046253_2371_2787	138
417	3300048917	Ga0496114_0391497	Ga0496114_0391497_506_922	138
418	3300049528	Ga0501312_043260	Ga0501312_043260_306_722	138
419	3300049583	Ga0501067_0067901	Ga0501067_0067901_1383_1805	138
420	3300049585	Ga0501069_0051908	Ga0501069_0051908_1798_2220	138
421	3300049588	Ga0501072_0033699	Ga0501072_0033699_3156_3578	138
422	3300049589	Ga0501073_0044209	Ga0501073_0044209_2550_2972	138
423	3300049590	Ga0501074_1310616	Ga0501074_1310616_70_492	138
424	3300049742	Ga0501080_0215833	Ga0501080_0215833_1176_1598	138
425	3300049744	Ga0501083_0076737	Ga0501083_0076737_143_565	138
426	3300050494	nmdc:mga06z11_907162_c1	nmdc:mga06z11_907162_c1_15_434	138
427	3300053085	Ga0495619_0062233	Ga0495619_0062233_31_447	138
428	3300053108	Ga0500562_002416	Ga0500562_002416_356_772	138
429	3300054114	Ga0501084_0031488	Ga0501084_0031488_1265_1687	138
430	3300059490	Ga0587066_052768	Ga0587066_052768_14_430	138
431	3300059645	Ga0587076_040798	Ga0587076_040798_21_437	138
432	3300059653	Ga0587108_026425	Ga0587108_026425_142_561	138
433	3300060353	Ga0501082_0568885	Ga0501082_0568885_217_639	138
434	iso_pu_bacteria	2643221547	2643755804	138
435	iso_pu_bacteria	2939669807	2939671368	138
436	3300005327	Ga0070658_10000405	Ga0070658_100004054	139
437	3300005339	Ga0070660_100000194	Ga0070660_1000001946	139
438	3300005339	Ga0070660_100230106	Ga0070660_1002301062	139
439	3300005344	Ga0070661_100185229	Ga0070661_1001852293	139
440	3300005344	Ga0070661_100211232	Ga0070661_1002112323	139
441	3300005354	Ga0070675_100366217	Ga0070675_1003662172	139
442	3300005366	Ga0070659_100173891	Ga0070659_1001738914	139
443	3300005366	Ga0070659_100753650	Ga0070659_1007536501	139
444	3300005563	Ga0068855_100003629	Ga0068855_1000036293	139
445	3300005578	Ga0068854_100182154	Ga0068854_1001821542	139
446	3300005578	Ga0068854_100562371	Ga0068854_1005623712	139
447	3300005843	Ga0068860_101732165	Ga0068860_1017321651	139
448	3300006946	Ga0079104_1022643	Ga0079104_10226432	139
449	3300009147	Ga0114129_10008051	Ga0114129_1000805128	139
450	3300009553	Ga0105249_11847213	Ga0105249_118472131	139
451	3300013100	Ga0157373_10086510	Ga0157373_100865104	139
452	3300013102	Ga0157371_10014106	Ga0157371_100141064	139
453	3300013308	Ga0157375_11571436	Ga0157375_115714362	139
454	3300017792	Ga0163161_10271692	Ga0163161_102716921	139
455	3300020078	Ga0206352_11051188	Ga0206352_110511882	139
456	3300021384	Ga0213876_10245610	Ga0213876_102456102	139
457	3300025904	Ga0207647_10115053	Ga0207647_101150532	139
458	3300025909	Ga0207705_10000276	Ga0207705_100002764	139
459	3300025919	Ga0207657_10000218	Ga0207657_1000021827	139
460	3300025920	Ga0207649_10227659	Ga0207649_102276592	139
461	3300025929	Ga0207664_10085622	Ga0207664_100856221	139
462	3300025949	Ga0207667_10000122	Ga0207667_1000012282	139
463	3300025981	Ga0207640_10456285	Ga0207640_104562851	139
464	3300025981	Ga0207640_11099404	Ga0207640_110994041	139
465	3300028381	Ga0268264_10661396	Ga0268264_106613962	139
466	3300028381	Ga0268264_11463989	Ga0268264_114639891	139
467	3300030745	Ga0316182_1304858	Ga0316182_13048582	139
468	3300031238	Ga0265332_10264253	Ga0265332_102642531	139
469	3300031242	Ga0265329_10013935	Ga0265329_100139353	139
470	3300031247	Ga0265340_10002589	Ga0265340_100025895	139
471	3300031249	Ga0265339_10008349	Ga0265339_100083494	139
472	3300031249	Ga0265339_10017456	Ga0265339_100174566	139
473	3300031250	Ga0265331_10012174	Ga0265331_100121741	139
474	3300031344	Ga0265316_10290017	Ga0265316_102900172	139
475	3300031711	Ga0265314_10046503	Ga0265314_100465034	139
476	3300031711	Ga0265314_10049090	Ga0265314_100490902	139
477	3300031712	Ga0265342_10000448	Ga0265342_1000044832	139
478	3300031911	Ga0307412_10284961	Ga0307412_102849612	139
479	3300032002	Ga0307416_102799131	Ga0307416_1027991311	139
480	3300037418	Ga0395900_0513963	Ga0395900_0513963_598_1017	139
481	3300037471	Ga0395905_0577546	Ga0395905_0577546_287_706	139
482	3300037853	Ga0436364_0944764	Ga0436364_0944764_611_1030	139
483	3300039437	Ga0436365_0487391	Ga0436365_0487391_957_1376	139
484	3300039437	Ga0436365_1183005	Ga0436365_1183005_32_451	139
485	3300039453	Ga0436362_0669626	Ga0436362_0669626_102_521	139
486	3300039453	Ga0436362_0719091	Ga0436362_0719091_495_914	139
487	3300041408	Ga0439453_0060818	Ga0439453_0060818_98_517	139
488	3300041413	Ga0439465_0222830	Ga0439465_0222830_198_617	139
489	3300047472	Ga0495686_0007217	Ga0495686_0007217_6962_7381	139
490	3300048903	Ga0496100_0242584	Ga0496100_0242584_634_1053	139
491	3300048904	Ga0496101_0408687	Ga0496101_0408687_157_576	139
492	3300048906	Ga0496103_0399451	Ga0496103_0399451_225_644	139
493	3300048907	Ga0496104_0020123	Ga0496104_0020123_3805_4224	139
494	3300048908	Ga0496105_0166560	Ga0496105_0166560_191_610	139
495	3300048910	Ga0496107_0387778	Ga0496107_0387778_436_855	139
496	3300048910	Ga0496107_0396992	Ga0496107_0396992_503_922	139
497	3300048911	Ga0496108_0396482	Ga0496108_0396482_680_1099	139
498	3300048912	Ga0496109_0272494	Ga0496109_0272494_1068_1487	139
499	3300048913	Ga0496110_0540426	Ga0496110_0540426_400_819	139
500	3300048914	Ga0496111_0209170	Ga0496111_0209170_237_656	139
501	3300048917	Ga0496114_0183798	Ga0496114_0183798_390_809	139
502	3300048918	Ga0496115_0098395	Ga0496115_0098395_186_605	139
503	3300048918	Ga0496115_0452951	Ga0496115_0452951_457_876	139
504	3300049579	Ga0501043_0870287	Ga0501043_0870287_111_530	139
505	3300050507	nmdc:mga05p37_5025_c1	nmdc:mga05p37_5025_c1_808_1227	139
506	3300053177	Ga0500636_0050033	Ga0500636_0050033_1858_2418	139
507	3300059492	Ga0587073_0081450	Ga0587073_0081450_363_782	139
508	3300059644	Ga0587075_067349	Ga0587075_067349_182_601	139
509	3300005327	Ga0070658_10012043	Ga0070658_100120434	140
510	3300005339	Ga0070660_100063233	Ga0070660_1000632332	140
511	3300005344	Ga0070661_100057639	Ga0070661_1000576391	140
512	3300005366	Ga0070659_100062678	Ga0070659_1000626783	140
513	3300005459	Ga0068867_101099870	Ga0068867_1010998701	140
514	3300005539	Ga0068853_100051852	Ga0068853_1000518526	140
515	3300005563	Ga0068855_100501488	Ga0068855_1005014882	140
516	3300005563	Ga0068855_102059004	Ga0068855_1020590041	140
517	3300005578	Ga0068854_100027059	Ga0068854_1000270592	140
518	3300005614	Ga0068856_100162783	Ga0068856_1001627831	140
519	3300005616	Ga0068852_100018805	Ga0068852_1000188051	140
520	3300005616	Ga0068852_100208816	Ga0068852_1002088162	140
521	3300005616	Ga0068852_100326571	Ga0068852_1003265712	140
522	3300006028	Ga0070717_10371867	Ga0070717_103718672	140
523	3300006028	Ga0070717_11916714	Ga0070717_119167141	140
524	3300006871	Ga0075434_100104609	Ga0075434_1001046092	140
525	3300006914	Ga0075436_100097101	Ga0075436_1000971011	140
526	3300007076	Ga0075435_100309981	Ga0075435_1003099812	140
527	3300009093	Ga0105240_11251023	Ga0105240_112510231	140
528	3300009177	Ga0105248_13455631	Ga0105248_134556311	140
529	3300009551	Ga0105238_11499181	Ga0105238_114991812	140
530	3300013102	Ga0157371_10023273	Ga0157371_100232734	140
531	3300013105	Ga0157369_11258388	Ga0157369_112583882	140
532	3300013105	Ga0157369_12301488	Ga0157369_123014881	140
533	3300013307	Ga0157372_10525128	Ga0157372_105251282	140
534	3300014968	Ga0157379_11002299	Ga0157379_110022992	140
535	3300025901	Ga0207688_10128302	Ga0207688_101283022	140
536	3300025909	Ga0207705_10020427	Ga0207705_100204276	140
537	3300025911	Ga0207654_10494218	Ga0207654_104942181	140
538	3300025912	Ga0207707_10312325	Ga0207707_103123252	140
539	3300025913	Ga0207695_10043881	Ga0207695_100438813	140
540	3300025914	Ga0207671_10404064	Ga0207671_104040642	140
541	3300025915	Ga0207693_10162848	Ga0207693_101628482	140
542	3300025919	Ga0207657_10044882	Ga0207657_100448822	140
543	3300025920	Ga0207649_10077063	Ga0207649_100770633	140
544	3300025920	Ga0207649_10097390	Ga0207649_100973901	140
545	3300025924	Ga0207694_11201234	Ga0207694_112012341	140
546	3300025928	Ga0207700_11109419	Ga0207700_111094192	140
547	3300025932	Ga0207690_10063935	Ga0207690_100639352	140
548	3300025949	Ga0207667_10000877	Ga0207667_100008775	140
549	3300025949	Ga0207667_10439812	Ga0207667_104398122	140
550	3300025949	Ga0207667_10735736	Ga0207667_107357361	140
551	3300025986	Ga0207658_11438945	Ga0207658_114389451	140
552	3300026041	Ga0207639_10029135	Ga0207639_100291352	140
553	3300026041	Ga0207639_10539941	Ga0207639_105399411	140
554	3300026067	Ga0207678_10237397	Ga0207678_102373972	140
555	3300026075	Ga0207708_10671167	Ga0207708_106711671	140
556	3300026078	Ga0207702_10006196	Ga0207702_100061964	140
557	3300026088	Ga0207641_10845040	Ga0207641_108450402	140
558	3300026089	Ga0207648_11356443	Ga0207648_113564432	140
559	3300026116	Ga0207674_10607537	Ga0207674_106075371	140
560	3300026118	Ga0207675_101578759	Ga0207675_1015787591	140
561	3300026142	Ga0207698_10049856	Ga0207698_100498563	140
562	3300026142	Ga0207698_10192785	Ga0207698_101927853	140
563	3300026142	Ga0207698_10414285	Ga0207698_104142852	140
564	3300027665	Ga0209983_1033757	Ga0209983_10337572	140
565	3300027876	Ga0209974_10029040	Ga0209974_100290402	140
566	3300028800	Ga0265338_10005387	Ga0265338_1000538728	140
567	3300031239	Ga0265328_10129307	Ga0265328_101293072	140
568	3300031344	Ga0265316_10182937	Ga0265316_101829372	140
569	3300031711	Ga0265314_10031281	Ga0265314_100312813	140
570	3300031711	Ga0265314_10034796	Ga0265314_100347965	140
571	3300031712	Ga0265342_10609707	Ga0265342_106097071	140
572	3300031731	Ga0307405_11126583	Ga0307405_111265831	140
573	3300031824	Ga0307413_11610128	Ga0307413_116101281	140
574	3300031852	Ga0307410_11696476	Ga0307410_116964761	140
575	3300031901	Ga0307406_10404465	Ga0307406_104044652	140
576	3300031903	Ga0307407_10399047	Ga0307407_103990472	140
577	3300032002	Ga0307416_100672506	Ga0307416_1006725062	140
578	3300032004	Ga0307414_10257614	Ga0307414_102576142	140
579	3300032005	Ga0307411_10268064	Ga0307411_102680642	140
580	3300032126	Ga0307415_100628951	Ga0307415_1006289512	140
581	3300032126	Ga0307415_101096140	Ga0307415_1010961401	140
582	3300035170	Ga0373943_0651581	Ga0373943_0651581_107_529	140
583	3300035692	Ga0373935_0053480	Ga0373935_0053480_363_785	140
584	3300035725	Ga0373947_0529687	Ga0373947_0529687_245_667	140
585	3300037068	Ga0373925_0012286	Ga0373925_0012286_1596_2018	140
586	3300037312	Ga0395899_0012605	Ga0395899_0012605_1449_1871	140
587	3300037312	Ga0395899_0699956	Ga0395899_0699956_66_488	140
588	3300037418	Ga0395900_0242018	Ga0395900_0242018_1191_1613	140
589	3300038443	Ga0395901_1056973	Ga0395901_1056973_166_588	140
590	3300038443	Ga0395901_1298700	Ga0395901_1298700_229_651	140
591	3300039450	Ga0436363_1284496	Ga0436363_1284496_11_439	140
592	3300046499	Ga0495594_0342279	Ga0495594_0342279_409_831	140
593	3300046683	Ga0495658_0197274	Ga0495658_0197274_228_650	140
594	3300046689	Ga0495613_0198512	Ga0495613_0198512_689_1111	140
595	3300046690	Ga0495624_0737154	Ga0495624_0737154_97_519	140
596	3300048903	Ga0496100_0180397	Ga0496100_0180397_169_591	140
597	3300048904	Ga0496101_0452816	Ga0496101_0452816_437_859	140
598	3300048905	Ga0496102_0057472	Ga0496102_0057472_255_677	140
599	3300048907	Ga0496104_0435820	Ga0496104_0435820_17_439	140
600	3300048908	Ga0496105_0206329	Ga0496105_0206329_1160_1582	140
601	3300048910	Ga0496107_0274399	Ga0496107_0274399_279_701	140
602	3300048914	Ga0496111_0149885	Ga0496111_0149885_458_880	140
603	3300048915	Ga0496112_0671067	Ga0496112_0671067_36_458	140
604	3300048918	Ga0496115_0356775	Ga0496115_0356775_141_563	140
605	3300048924	Ga0496121_0736693	Ga0496121_0736693_34_456	140
606	3300048925	Ga0496122_0161116	Ga0496122_0161116_466_888	140
607	3300048925	Ga0496122_0504694	Ga0496122_0504694_36_458	140
608	3300048927	Ga0496124_0030584	Ga0496124_0030584_2732_3154	140
609	3300048928	Ga0496125_0000815	Ga0496125_0000815_24373_24795	140
610	3300048928	Ga0496125_0318678	Ga0496125_0318678_121_543	140
611	3300049128	Ga0501308_060407	Ga0501308_060407_30_452	140
612	3300049160	Ga0501304_043822	Ga0501304_043822_66_488	140
613	3300049161	Ga0501305_076125	Ga0501305_076125_10_432	140
614	3300049532	Ga0501316_063370	Ga0501316_063370_108_530	140
615	3300049568	Ga0501031_0259451	Ga0501031_0259451_460_882	140
616	3300049569	Ga0501032_0306783	Ga0501032_0306783_321_743	140
617	3300049570	Ga0501033_0865184	Ga0501033_0865184_61_492	140
618	3300049571	Ga0501034_0017100	Ga0501034_0017100_592_1014	140
619	3300049571	Ga0501034_0028263	Ga0501034_0028263_869_1291	140
620	3300049571	Ga0501034_0045161	Ga0501034_0045161_1270_1692	140
621	3300049571	Ga0501034_0074577	Ga0501034_0074577_142_564	140
622	3300049571	Ga0501034_0330449	Ga0501034_0330449_254_685	140
623	3300049571	Ga0501034_0376836	Ga0501034_0376836_97_519	140
624	3300049573	Ga0501037_0205303	Ga0501037_0205303_383_805	140
625	3300049574	Ga0501038_0578538	Ga0501038_0578538_393_824	140
626	3300049575	Ga0501039_0494319	Ga0501039_0494319_375_800	140
627	3300049581	Ga0501047_1222742	Ga0501047_1222742_78_509	140
628	3300049585	Ga0501069_0109271	Ga0501069_0109271_608_1030	140
629	3300049592	Ga0501076_0271538	Ga0501076_0271538_785_1210	140
630	3300049671	Ga0501238_022058	Ga0501238_022058_214_636	140
631	3300049682	Ga0501252_002651	Ga0501252_002651_209_631	140
632	3300049688	Ga0501259_124286	Ga0501259_124286_27_449	140
633	3300049742	Ga0501080_0795608	Ga0501080_0795608_28_450	140
634	3300049822	Ga0501035_0261515	Ga0501035_0261515_439_870	140
635	3300049823	Ga0501044_0204488	Ga0501044_0204488_1168_1593	140
636	3300049823	Ga0501044_0216880	Ga0501044_0216880_871_1302	140
637	3300050489	nmdc:mga03683_91269_c1	nmdc:mga03683_91269_c1_380_802	140
638	3300050490	nmdc:mga03n38_290157_c1	nmdc:mga03n38_290157_c1_115_537	140
639	3300050492	nmdc:mga0yw44_845368_c1	nmdc:mga0yw44_845368_c1_76_498	140
640	3300050496	nmdc:mga07m45_25099_c1	nmdc:mga07m45_25099_c1_2257_2679	140
641	3300050511	nmdc:mga08y16_1304471_c1	nmdc:mga08y16_1304471_c1_114_536	140
642	3300050514	nmdc:mga08x19_164402_c1	nmdc:mga08x19_164402_c1_1062_1484	140
643	3300053077	Ga0495601_0590776	Ga0495601_0590776_72_494	140
644	3300003322	rootL2_10314731	rootL2_103147312	141
645	3300005328	Ga0070676_10055252	Ga0070676_100552522	141
646	3300005329	Ga0070683_100345160	Ga0070683_1003451601	141
647	3300005337	Ga0070682_100129362	Ga0070682_1001293622	141
648	3300005344	Ga0070661_100001887	Ga0070661_10000188717	141
649	3300005455	Ga0070663_100525414	Ga0070663_1005254142	141
650	3300005539	Ga0068853_100000888	Ga0068853_10000088828	141
651	3300005539	Ga0068853_101232420	Ga0068853_1012324201	141
652	3300005563	Ga0068855_100075649	Ga0068855_1000756492	141
653	3300005577	Ga0068857_100131678	Ga0068857_1001316782	141
654	3300005578	Ga0068854_100082485	Ga0068854_1000824852	141
655	3300005614	Ga0068856_100028895	Ga0068856_1000288954	141
656	3300005616	Ga0068852_100031702	Ga0068852_1000317024	141
657	3300005834	Ga0068851_10002106	Ga0068851_100021066	141
658	3300006028	Ga0070717_10653452	Ga0070717_106534522	141
659	3300009174	Ga0105241_10039914	Ga0105241_100399143	141
660	3300009551	Ga0105238_10033303	Ga0105238_100333034	141
661	3300009551	Ga0105238_10701334	Ga0105238_107013342	141
662	3300010375	Ga0105239_11157988	Ga0105239_111579881	141
663	3300013297	Ga0157378_11783380	Ga0157378_117833802	141
664	3300025321	Ga0207656_10001058	Ga0207656_100010586	141
665	3300025911	Ga0207654_10370416	Ga0207654_103704162	141
666	3300025913	Ga0207695_10147597	Ga0207695_101475973	141
667	3300025914	Ga0207671_10499180	Ga0207671_104991802	141
668	3300025919	Ga0207657_11214599	Ga0207657_112145991	141
669	3300025920	Ga0207649_10001226	Ga0207649_100012269	141
670	3300025924	Ga0207694_10008555	Ga0207694_100085557	141
671	3300025944	Ga0207661_10440919	Ga0207661_104409192	141
672	3300025949	Ga0207667_10171795	Ga0207667_101717952	141
673	3300025981	Ga0207640_10013423	Ga0207640_100134236	141
674	3300026041	Ga0207639_10004515	Ga0207639_100045159	141
675	3300026078	Ga0207702_10029655	Ga0207702_100296554	141
676	3300026116	Ga0207674_10070606	Ga0207674_100706065	141
677	3300026142	Ga0207698_10094579	Ga0207698_100945792	141
678	3300027866	Ga0209813_10038884	Ga0209813_100388842	141
679	3300027876	Ga0209974_10439732	Ga0209974_104397321	141
680	3300028573	Ga0265334_10179973	Ga0265334_101799732	141
681	3300028800	Ga0265338_10764697	Ga0265338_107646972	141
682	3300031235	Ga0265330_10006274	Ga0265330_100062745	141
683	3300031238	Ga0265332_10308692	Ga0265332_103086922	141
684	3300031240	Ga0265320_10008219	Ga0265320_100082198	141
685	3300031241	Ga0265325_10007954	Ga0265325_100079542	141
686	3300031249	Ga0265339_10011066	Ga0265339_100110665	141
687	3300031595	Ga0265313_10002227	Ga0265313_1000222714	141
688	3300031711	Ga0265314_10081113	Ga0265314_100811133	141
689	3300031711	Ga0265314_10091671	Ga0265314_100916712	141
690	3300031712	Ga0265342_10151659	Ga0265342_101516592	141
691	3300035113	Ga0373936_0014221	Ga0373936_0014221_2183_2608	141
692	3300036401	Ga0373937_0625739	Ga0373937_0625739_195_620	141
693	3300039447	Ga0436361_0328026	Ga0436361_0328026_79_504	141
694	3300046477	Ga0495664_0578470	Ga0495664_0578470_108_533	141
695	3300046506	Ga0495583_0075613	Ga0495583_0075613_531_956	141
696	3300046529	Ga0495652_0558340	Ga0495652_0558340_341_766	141
697	3300048088	Ga0495602_0239024	Ga0495602_0239024_123_548	141
698	3300049577	Ga0501041_0978155	Ga0501041_0978155_38_466	141
699	3300049589	Ga0501073_0536794	Ga0501073_0536794_191_622	141
700	3300050490	nmdc:mga03n38_215403_c1	nmdc:mga03n38_215403_c1_42_467	141
701	3300050491	nmdc:mga00v17_172349_c1	nmdc:mga00v17_172349_c1_757_1182	141
702	3300050493	nmdc:mga0k408_36414_c1	nmdc:mga0k408_36414_c1_186_611	141
703	3300050494	nmdc:mga06z11_35990_c1	nmdc:mga06z11_35990_c1_1140_1565	141
704	3300053108	Ga0500562_055079	Ga0500562_055079_148_573	141
705	3300053139	Ga0500568_0310927	Ga0500568_0310927_115_540	141
706	3300053163	Ga0500639_135971	Ga0500639_135971_164_589	141
707	3300053724	Ga0500570_205192	Ga0500570_205192_20_445	141
708	3300059421	Ga0590071_168461	Ga0590071_168461_75_500	141
709	3300060346	Ga0587111_0194114	Ga0587111_0194114_18_452	141
710	3300061734	Ga0530510_0176391	Ga0530510_0176391_459_887	141
711	3300003215	JGI25153J46596_10000840	JGI25153J46596_1000084019	142
712	3300005327	Ga0070658_10090763	Ga0070658_100907633	142
713	3300005329	Ga0070683_101222606	Ga0070683_1012226061	142
714	3300005336	Ga0070680_100352392	Ga0070680_1003523922	142
715	3300005339	Ga0070660_100577933	Ga0070660_1005779332	142
716	3300005366	Ga0070659_100368689	Ga0070659_1003686892	142
717	3300005435	Ga0070714_100020135	Ga0070714_1000201356	142
718	3300005530	Ga0070679_100216920	Ga0070679_1002169202	142
719	3300005530	Ga0070679_100297286	Ga0070679_1002972862	142
720	3300005530	Ga0070679_100829968	Ga0070679_1008299681	142
721	3300005539	Ga0068853_100129423	Ga0068853_1001294232	142
722	3300005546	Ga0070696_101263712	Ga0070696_1012637121	142
723	3300005563	Ga0068855_100137323	Ga0068855_1001373234	142
724	3300005563	Ga0068855_100264372	Ga0068855_1002643722	142
725	3300005614	Ga0068856_100407308	Ga0068856_1004073081	142
726	3300005616	Ga0068852_100100954	Ga0068852_1001009542	142
727	3300005616	Ga0068852_100227334	Ga0068852_1002273342	142
728	3300005840	Ga0068870_11317301	Ga0068870_113173011	142
729	3300006038	Ga0075365_10144763	Ga0075365_101447631	142
730	3300006178	Ga0075367_10584569	Ga0075367_105845691	142
731	3300006353	Ga0075370_10635433	Ga0075370_106354331	142
732	3300009093	Ga0105240_10916279	Ga0105240_109162792	142
733	3300009094	Ga0111539_10947505	Ga0111539_109475052	142
734	3300009098	Ga0105245_11262931	Ga0105245_112629312	142
735	3300009545	Ga0105237_10805836	Ga0105237_108058362	142
736	3300009551	Ga0105238_10130434	Ga0105238_101304342	142
737	3300013102	Ga0157371_10303470	Ga0157371_103034702	142
738	3300013104	Ga0157370_10332176	Ga0157370_103321762	142
739	3300013105	Ga0157369_10601071	Ga0157369_106010712	142
740	3300013307	Ga0157372_10713418	Ga0157372_107134182	142
741	3300020070	Ga0206356_10264681	Ga0206356_102646811	142
742	3300020082	Ga0206353_11366343	Ga0206353_113663431	142
743	3300025261	Ga0209233_1013658	Ga0209233_10136583	142
744	3300025297	Ga0209758_1000548	Ga0209758_100054833	142
745	3300025909	Ga0207705_10221485	Ga0207705_102214852	142
746	3300025909	Ga0207705_10669120	Ga0207705_106691202	142
747	3300025912	Ga0207707_10104970	Ga0207707_101049703	142
748	3300025912	Ga0207707_10977819	Ga0207707_109778192	142
749	3300025913	Ga0207695_10653995	Ga0207695_106539951	142
750	3300025913	Ga0207695_10701672	Ga0207695_107016722	142
751	3300025915	Ga0207693_10144575	Ga0207693_101445753	142
752	3300025919	Ga0207657_10012288	Ga0207657_100122887	142
753	3300025919	Ga0207657_10699278	Ga0207657_106992782	142
754	3300025921	Ga0207652_10294828	Ga0207652_102948282	142
755	3300025921	Ga0207652_10671514	Ga0207652_106715141	142
756	3300025921	Ga0207652_10877780	Ga0207652_108777801	142
757	3300025924	Ga0207694_10243753	Ga0207694_102437532	142
758	3300025932	Ga0207690_10501991	Ga0207690_105019912	142
759	3300025944	Ga0207661_11311864	Ga0207661_113118641	142
760	3300025949	Ga0207667_10067567	Ga0207667_100675672	142
761	3300025949	Ga0207667_11142155	Ga0207667_111421552	142
762	3300025986	Ga0207658_10989204	Ga0207658_109892041	142
763	3300026041	Ga0207639_10381714	Ga0207639_103817142	142
764	3300026078	Ga0207702_10174742	Ga0207702_101747422	142
765	3300026116	Ga0207674_10864556	Ga0207674_108645561	142
766	3300026142	Ga0207698_10200395	Ga0207698_102003952	142
767	3300026142	Ga0207698_10729022	Ga0207698_107290221	142
768	3300026142	Ga0207698_11200622	Ga0207698_112006222	142
769	3300028800	Ga0265338_10043919	Ga0265338_100439196	142
770	3300029957	Ga0265324_10246178	Ga0265324_102461781	142
771	3300031235	Ga0265330_10029834	Ga0265330_100298343	142
772	3300031241	Ga0265325_10052147	Ga0265325_100521472	142
773	3300031247	Ga0265340_10023676	Ga0265340_100236762	142
774	3300031249	Ga0265339_10013957	Ga0265339_100139576	142
775	3300031249	Ga0265339_10323811	Ga0265339_103238112	142
776	3300031344	Ga0265316_10890202	Ga0265316_108902021	142
777	3300031595	Ga0265313_10084471	Ga0265313_100844712	142
778	3300031712	Ga0265342_10000677	Ga0265342_1000067716	142
779	3300031712	Ga0265342_10009052	Ga0265342_100090526	142
780	3300032002	Ga0307416_101791593	Ga0307416_1017915932	142
781	3300035086	Ga0373934_0079384	Ga0373934_0079384_17_445	142
782	3300035111	Ga0373923_0237545	Ga0373923_0237545_211_639	142
783	3300035118	Ga0373954_0010145	Ga0373954_0010145_2446_2874	142
784	3300035172	Ga0373955_0001818	Ga0373955_0001818_8679_9107	142
785	3300035410	Ga0373924_0358157	Ga0373924_0358157_38_466	142
786	3300035724	Ga0373933_0032980	Ga0373933_0032980_375_803	142
787	3300036401	Ga0373937_0003502	Ga0373937_0003502_11098_11526	142
788	3300037312	Ga0395899_0054319	Ga0395899_0054319_865_1293	142
789	3300037418	Ga0395900_0004219	Ga0395900_0004219_1587_2015	142
790	3300037466	Ga0395898_0030096	Ga0395898_0030096_4158_4586	142
791	3300038443	Ga0395901_0009226	Ga0395901_0009226_93_521	142
792	3300039437	Ga0436365_1056925	Ga0436365_1056925_639_1070	142
793	3300039447	Ga0436361_0363438	Ga0436361_0363438_258_686	142
794	3300041408	Ga0439453_0008795	Ga0439453_0008795_577_1008	142
795	3300041413	Ga0439465_0139010	Ga0439465_0139010_120_548	142
796	3300042001	Ga0439441_107480	Ga0439441_107480_85_513	142
797	3300042436	Ga0439435_0331469	Ga0439435_0331469_18_449	142
798	3300042437	Ga0439444_0060071	Ga0439444_0060071_164_595	142
799	3300044684	Ga0466966_0819076	Ga0466966_0819076_63_491	142
800	3300044842	Ga0466957_1307420	Ga0466957_1307420_57_485	142
801	3300045836	Ga0466958_1057986	Ga0466958_1057986_63_491	142
802	3300045976	Ga0466967_1191672	Ga0466967_1191672_319_747	142
803	3300046462	Ga0495651_0340482	Ga0495651_0340482_10_438	142
804	3300046511	Ga0495608_0121311	Ga0495608_0121311_561_989	142
805	3300046516	Ga0495628_0609331	Ga0495628_0609331_168_596	142
806	3300046559	Ga0495667_0036143	Ga0495667_0036143_2355_2783	142
807	3300046663	Ga0495635_0103640	Ga0495635_0103640_1146_1574	142
808	3300046675	Ga0495657_0017167	Ga0495657_0017167_3629_4057	142
809	3300046680	Ga0495646_0295019	Ga0495646_0295019_410_838	142
810	3300047317	Ga0495604_0083155	Ga0495604_0083155_1482_1910	142
811	3300047322	Ga0495680_0064801	Ga0495680_0064801_1042_1470	142
812	3300047471	Ga0495684_0175536	Ga0495684_0175536_860_1288	142
813	3300047472	Ga0495686_0094078	Ga0495686_0094078_561_989	142
814	3300048088	Ga0495602_0117649	Ga0495602_0117649_1672_2100	142
815	3300048927	Ga0496124_0173677	Ga0496124_0173677_544_975	142
816	3300049533	Ga0501317_096120	Ga0501317_096120_87_515	142
817	3300049568	Ga0501031_0044229	Ga0501031_0044229_59_487	142
818	3300049569	Ga0501032_0496206	Ga0501032_0496206_81_509	142
819	3300049571	Ga0501034_0059993	Ga0501034_0059993_2182_2610	142
820	3300049573	Ga0501037_0478780	Ga0501037_0478780_242_670	142
821	3300049574	Ga0501038_0086394	Ga0501038_0086394_1976_2404	142
822	3300049575	Ga0501039_1187375	Ga0501039_1187375_77_505	142
823	3300049581	Ga0501047_0038088	Ga0501047_0038088_283_711	142
824	3300049581	Ga0501047_0056481	Ga0501047_0056481_943_1371	142
825	3300049581	Ga0501047_0256543	Ga0501047_0256543_703_1131	142
826	3300049582	Ga0501048_0831914	Ga0501048_0831914_190_618	142
827	3300049586	Ga0501070_0856088	Ga0501070_0856088_133_561	142
828	3300049588	Ga0501072_0078628	Ga0501072_0078628_327_755	142
829	3300049589	Ga0501073_0023299	Ga0501073_0023299_3121_3549	142
830	3300049590	Ga0501074_0152430	Ga0501074_0152430_44_472	142
831	3300049742	Ga0501080_0973203	Ga0501080_0973203_284_712	142
832	3300049744	Ga0501083_0007208	Ga0501083_0007208_403_831	142
833	3300049822	Ga0501035_0620322	Ga0501035_0620322_300_728	142
834	3300049823	Ga0501044_0118609	Ga0501044_0118609_1933_2361	142
835	3300049823	Ga0501044_0205841	Ga0501044_0205841_282_710	142
836	3300050492	nmdc:mga0yw44_63063_c1	nmdc:mga0yw44_63063_c1_1047_1478	142
837	3300050494	nmdc:mga06z11_415759_c1	nmdc:mga06z11_415759_c1_28_456	142
838	3300050511	nmdc:mga08y16_739259_c1	nmdc:mga08y16_739259_c1_538_966	142
839	3300050512	nmdc:mga0n895_1799787_c1	nmdc:mga0n895_1799787_c1_24_452	142
840	3300053077	Ga0495601_0003251	Ga0495601_0003251_1725_2153	142
841	3300053078	Ga0495612_0016703	Ga0495612_0016703_1565_1993	142
842	3300053084	Ga0495595_0003026	Ga0495595_0003026_1471_1899	142
843	3300053096	Ga0500641_0019738	Ga0500641_0019738_1184_1612	142
844	3300054114	Ga0501084_0211737	Ga0501084_0211737_907_1335	142
845	3300054114	Ga0501084_0533359	Ga0501084_0533359_410_838	142
846	3300059511	Ga0587091_109908	Ga0587091_109908_202_639	142
847	3300060353	Ga0501082_0029272	Ga0501082_0029272_974_1402	142
848	2209111006	2214828544	2213866900	143
849	3300000041	ARcpr5oldR_c000035	ARcpr5oldR_00003511	143
850	3300000041	ARcpr5oldR_c013874	ARcpr5oldR_0138741	143
851	3300000042	ARSoilYngRDRAFT_c00061	ARSoilYngRDRAFT_000614	143
852	3300000043	ARcpr5yngRDRAFT_c000075	ARcpr5yngRDRAFT_00007523	143
853	3300000044	ARSoilOldRDRAFT_c000053	ARSoilOldRDRAFT_00005323	143
854	3300000045	ARCol0oldRDRAFT_c00087	ARCol0oldRDRAFT_0008713	143
855	3300000652	ARCol0yngRDRAFT_1000025	ARCol0yngRDRAFT_100002527	143
856	3300001430	JGI24032J14994_101529	JGI24032J14994_1015291	143
857	3300001904	JGI24736J21556_1052541	JGI24736J21556_10525411	143
858	3300001976	JGI24752J21851_1005842	JGI24752J21851_10058422	143
859	3300001977	JGI24746J21847_1002046	JGI24746J21847_10020465	143
860	3300001977	JGI24746J21847_1040743	JGI24746J21847_10407431	143
861	3300001978	JGI24747J21853_1000618	JGI24747J21853_10006183	143
862	3300001989	JGI24739J22299_10009158	JGI24739J22299_100091583	143
863	3300001989	JGI24739J22299_10138012	JGI24739J22299_101380122	143
864	3300001990	JGI24737J22298_10000053	JGI24737J22298_1000005336	143
865	3300001990	JGI24737J22298_10003938	JGI24737J22298_100039382	143
866	3300001991	JGI24743J22301_10029537	JGI24743J22301_100295372	143
867	3300001991	JGI24743J22301_10056605	JGI24743J22301_100566051	143
868	3300002067	JGI24735J21928_10130648	JGI24735J21928_101306481	143
869	3300002070	JGI24750J21931_1000316	JGI24750J21931_10003166	143
870	3300002070	JGI24750J21931_1036500	JGI24750J21931_10365002	143
871	3300002073	JGI24745J21846_1000643	JGI24745J21846_10006435	143
872	3300002074	JGI24748J21848_1000202	JGI24748J21848_10002026	143
873	3300002074	JGI24748J21848_1019407	JGI24748J21848_10194071	143
874	3300002075	JGI24738J21930_10002704	JGI24738J21930_100027044	143
875	3300002076	JGI24749J21850_1001031	JGI24749J21850_10010313	143
876	3300002076	JGI24749J21850_1001860	JGI24749J21850_10018601	143
877	3300002077	JGI24744J21845_10002303	JGI24744J21845_100023032	143
878	3300002126	JGI24035J26624_1000222	JGI24035J26624_10002226	143
879	3300002155	JGI24033J26618_1000271	JGI24033J26618_10002714	143
880	3300002239	JGI24034J26672_10000885	JGI24034J26672_100008852	143
881	3300002239	JGI24034J26672_10035010	JGI24034J26672_100350101	143
882	3300002239	JGI24034J26672_10054528	JGI24034J26672_100545281	143
883	3300002244	JGI24742J22300_10001096	JGI24742J22300_100010964	143
884	3300002244	JGI24742J22300_10064289	JGI24742J22300_100642891	143
885	3300002459	JGI24751J29686_10066619	JGI24751J29686_100666192	143
886	3300005277	Ga0065716_1001548	Ga0065716_10015485	143
887	3300005289	Ga0065704_10079520	Ga0065704_100795202	143
888	3300005290	Ga0065712_10071805	Ga0065712_100718054	143
889	3300005290	Ga0065712_10095183	Ga0065712_100951832	143
890	3300005290	Ga0065712_10125519	Ga0065712_101255191	143
891	3300005293	Ga0065715_10003868	Ga0065715_100038682	143
892	3300005293	Ga0065715_10107102	Ga0065715_101071022	143
893	3300005293	Ga0065715_10419537	Ga0065715_104195371	143
894	3300005328	Ga0070676_10002419	Ga0070676_100024193	143
895	3300005328	Ga0070676_10370022	Ga0070676_103700222	143
896	3300005329	Ga0070683_100001083	Ga0070683_10000108317	143
897	3300005329	Ga0070683_100016861	Ga0070683_1000168616	143
898	3300005329	Ga0070683_101236990	Ga0070683_1012369901	143
899	3300005330	Ga0070690_100037082	Ga0070690_1000370822	143
900	3300005330	Ga0070690_100094557	Ga0070690_1000945572	143
901	3300005330	Ga0070690_100484329	Ga0070690_1004843291	143
902	3300005331	Ga0070670_100016356	Ga0070670_1000163564	143
903	3300005333	Ga0070677_10000959	Ga0070677_100009599	143
904	3300005334	Ga0068869_100000279	Ga0068869_1000002792	143
905	3300005334	Ga0068869_100171999	Ga0068869_1001719992	143
906	3300005335	Ga0070666_10007596	Ga0070666_100075964	143
907	3300005335	Ga0070666_10032735	Ga0070666_100327352	143
908	3300005335	Ga0070666_10049363	Ga0070666_100493632	143
909	3300005336	Ga0070680_100006856	Ga0070680_1000068566	143
910	3300005336	Ga0070680_100213957	Ga0070680_1002139572	143
911	3300005337	Ga0070682_100001636	Ga0070682_1000016366	143
912	3300005337	Ga0070682_100182048	Ga0070682_1001820482	143
913	3300005338	Ga0068868_100047103	Ga0068868_1000471034	143
914	3300005338	Ga0068868_100135205	Ga0068868_1001352052	143
915	3300005338	Ga0068868_100696370	Ga0068868_1006963702	143
916	3300005339	Ga0070660_100000245	Ga0070660_10000024534	143
917	3300005339	Ga0070660_100015793	Ga0070660_1000157932	143
918	3300005339	Ga0070660_100291345	Ga0070660_1002913452	143
919	3300005340	Ga0070689_100005690	Ga0070689_1000056904	143
920	3300005340	Ga0070689_100011434	Ga0070689_1000114343	143
921	3300005340	Ga0070689_100049911	Ga0070689_1000499113	143
922	3300005340	Ga0070689_100461167	Ga0070689_1004611672	143
923	3300005341	Ga0070691_10004019	Ga0070691_100040195	143
924	3300005341	Ga0070691_10005769	Ga0070691_100057694	143
925	3300005343	Ga0070687_100000348	Ga0070687_1000003486	143
926	3300005343	Ga0070687_100016285	Ga0070687_1000162852	143
927	3300005344	Ga0070661_100000017	Ga0070661_100000017163	143
928	3300005344	Ga0070661_100125850	Ga0070661_1001258502	143
929	3300005344	Ga0070661_100324615	Ga0070661_1003246152	143
930	3300005345	Ga0070692_10000101	Ga0070692_100001016	143
931	3300005347	Ga0070668_100003604	Ga0070668_1000036042	143
932	3300005347	Ga0070668_100035298	Ga0070668_1000352983	143
933	3300005347	Ga0070668_101256697	Ga0070668_1012566971	143
934	3300005353	Ga0070669_100000314	Ga0070669_10000031437	143
935	3300005353	Ga0070669_100066858	Ga0070669_1000668582	143
936	3300005354	Ga0070675_100000161	Ga0070675_10000016137	143
937	3300005354	Ga0070675_100060089	Ga0070675_1000600893	143
938	3300005354	Ga0070675_100989964	Ga0070675_1009899641	143
939	3300005355	Ga0070671_100000313	Ga0070671_10000031336	143
940	3300005355	Ga0070671_100204120	Ga0070671_1002041202	143
941	3300005356	Ga0070674_100010750	Ga0070674_1000107502	143
942	3300005356	Ga0070674_100126801	Ga0070674_1001268012	143
943	3300005356	Ga0070674_100960273	Ga0070674_1009602731	143
944	3300005364	Ga0070673_100005466	Ga0070673_1000054667	143
945	3300005364	Ga0070673_100047061	Ga0070673_1000470613	143
946	3300005364	Ga0070673_100743707	Ga0070673_1007437072	143
947	3300005365	Ga0070688_100000991	Ga0070688_10000099110	143
948	3300005365	Ga0070688_100004219	Ga0070688_1000042197	143
949	3300005365	Ga0070688_100158236	Ga0070688_1001582362	143
950	3300005365	Ga0070688_100246748	Ga0070688_1002467482	143
951	3300005365	Ga0070688_100595067	Ga0070688_1005950671	143
952	3300005366	Ga0070659_100004960	Ga0070659_10000496010	143
953	3300005366	Ga0070659_100017906	Ga0070659_1000179062	143
954	3300005367	Ga0070667_100006114	Ga0070667_10000611414	143
955	3300005367	Ga0070667_100029696	Ga0070667_1000296964	143
956	3300005367	Ga0070667_100079601	Ga0070667_1000796012	143
957	3300005367	Ga0070667_100371510	Ga0070667_1003715102	143
958	3300005406	Ga0070703_10294031	Ga0070703_102940311	143
959	3300005434	Ga0070709_10003934	Ga0070709_100039344	143
960	3300005434	Ga0070709_10155424	Ga0070709_101554242	143
961	3300005434	Ga0070709_11054020	Ga0070709_110540201	143
962	3300005435	Ga0070714_100063678	Ga0070714_1000636784	143
963	3300005435	Ga0070714_100193773	Ga0070714_1001937732	143
964	3300005436	Ga0070713_100001694	Ga0070713_10000169422	143
965	3300005436	Ga0070713_100005492	Ga0070713_1000054929	143
966	3300005436	Ga0070713_100578339	Ga0070713_1005783391	143
967	3300005437	Ga0070710_10124781	Ga0070710_101247812	143
968	3300005437	Ga0070710_10148545	Ga0070710_101485452	143
969	3300005438	Ga0070701_10000204	Ga0070701_1000020413	143
970	3300005439	Ga0070711_100007210	Ga0070711_1000072103	143
971	3300005439	Ga0070711_100027936	Ga0070711_1000279364	143
972	3300005440	Ga0070705_100004847	Ga0070705_1000048473	143
973	3300005440	Ga0070705_100119436	Ga0070705_1001194362	143
974	3300005440	Ga0070705_100550111	Ga0070705_1005501111	143
975	3300005441	Ga0070700_100000856	Ga0070700_1000008566	143
976	3300005441	Ga0070700_100264673	Ga0070700_1002646732	143
977	3300005444	Ga0070694_100004005	Ga0070694_1000040058	143
978	3300005444	Ga0070694_100021165	Ga0070694_1000211653	143
979	3300005444	Ga0070694_100816170	Ga0070694_1008161702	143
980	3300005445	Ga0070708_100807769	Ga0070708_1008077692	143
981	3300005455	Ga0070663_100000945	Ga0070663_1000009456	143
982	3300005455	Ga0070663_100025979	Ga0070663_1000259794	143
983	3300005455	Ga0070663_100173211	Ga0070663_1001732112	143
984	3300005455	Ga0070663_100740194	Ga0070663_1007401941	143
985	3300005455	Ga0070663_101003730	Ga0070663_1010037302	143
986	3300005456	Ga0070678_100002374	Ga0070678_1000023742	143
987	3300005456	Ga0070678_100027687	Ga0070678_1000276873	143
988	3300005457	Ga0070662_100016561	Ga0070662_1000165614	143
989	3300005457	Ga0070662_100070175	Ga0070662_1000701752	143
990	3300005457	Ga0070662_100774537	Ga0070662_1007745372	143
991	3300005458	Ga0070681_10005192	Ga0070681_1000519210	143
992	3300005458	Ga0070681_10019257	Ga0070681_100192574	143
993	3300005458	Ga0070681_10284907	Ga0070681_102849072	143
994	3300005458	Ga0070681_10446991	Ga0070681_104469912	143
995	3300005458	Ga0070681_10925106	Ga0070681_109251062	143
996	3300005459	Ga0068867_100002227	Ga0068867_1000022276	143
997	3300005459	Ga0068867_100088867	Ga0068867_1000888672	143
998	3300005459	Ga0068867_100313773	Ga0068867_1003137732	143
999	3300005466	Ga0070685_10015964	Ga0070685_100159642	143
1000	3300005466	Ga0070685_10110448	Ga0070685_101104482	143
1001	3300005466	Ga0070685_10439327	Ga0070685_104393271	143
1002	3300005530	Ga0070679_100002050	Ga0070679_1000020503	143
1003	3300005530	Ga0070679_100213700	Ga0070679_1002137002	143
1004	3300005530	Ga0070679_100366055	Ga0070679_1003660552	143
1005	3300005530	Ga0070679_101010799	Ga0070679_1010107992	143
1006	3300005535	Ga0070684_100000365	Ga0070684_10000036530	143
1007	3300005535	Ga0070684_100087253	Ga0070684_1000872533	143
1008	3300005539	Ga0068853_100002095	Ga0068853_1000020956	143
1009	3300005539	Ga0068853_100186047	Ga0068853_1001860472	143
1010	3300005539	Ga0068853_100623874	Ga0068853_1006238741	143
1011	3300005539	Ga0068853_101289715	Ga0068853_1012897152	143
1012	3300005543	Ga0070672_100133658	Ga0070672_1001336582	143
1013	3300005543	Ga0070672_100137939	Ga0070672_1001379392	143
1014	3300005543	Ga0070672_100427335	Ga0070672_1004273352	143
1015	3300005544	Ga0070686_100002828	Ga0070686_1000028285	143
1016	3300005544	Ga0070686_100007402	Ga0070686_1000074026	143
1017	3300005544	Ga0070686_100030622	Ga0070686_1000306222	143
1018	3300005544	Ga0070686_100087922	Ga0070686_1000879222	143
1019	3300005545	Ga0070695_100001044	Ga0070695_10000104414	143
1020	3300005545	Ga0070695_100012934	Ga0070695_1000129342	143
1021	3300005545	Ga0070695_100097770	Ga0070695_1000977702	143
1022	3300005546	Ga0070696_100020206	Ga0070696_1000202062	143
1023	3300005546	Ga0070696_100020830	Ga0070696_1000208304	143
1024	3300005546	Ga0070696_100090809	Ga0070696_1000908092	143
1025	3300005547	Ga0070693_100000905	Ga0070693_10000090512	143
1026	3300005547	Ga0070693_100323539	Ga0070693_1003235392	143
1027	3300005548	Ga0070665_100160855	Ga0070665_1001608552	143
1028	3300005548	Ga0070665_100311311	Ga0070665_1003113112	143
1029	3300005548	Ga0070665_100378688	Ga0070665_1003786882	143
1030	3300005549	Ga0070704_100001366	Ga0070704_10000136610	143
1031	3300005549	Ga0070704_100025213	Ga0070704_1000252134	143
1032	3300005563	Ga0068855_100114453	Ga0068855_1001144533	143
1033	3300005564	Ga0070664_100002074	Ga0070664_1000020749	143
1034	3300005564	Ga0070664_100608388	Ga0070664_1006083882	143
1035	3300005564	Ga0070664_100736674	Ga0070664_1007366742	143
1036	3300005577	Ga0068857_100003594	Ga0068857_10000359410	143
1037	3300005577	Ga0068857_100354734	Ga0068857_1003547342	143
1038	3300005577	Ga0068857_100590871	Ga0068857_1005908712	143
1039	3300005578	Ga0068854_100000749	Ga0068854_1000007496	143
1040	3300005578	Ga0068854_100223561	Ga0068854_1002235612	143
1041	3300005578	Ga0068854_100783937	Ga0068854_1007839372	143
1042	3300005614	Ga0068856_100000902	Ga0068856_10000090227	143
1043	3300005614	Ga0068856_100396437	Ga0068856_1003964372	143
1044	3300005615	Ga0070702_100064678	Ga0070702_1000646782	143
1045	3300005615	Ga0070702_100246552	Ga0070702_1002465522	143
1046	3300005615	Ga0070702_100742900	Ga0070702_1007429001	143
1047	3300005616	Ga0068852_100004111	Ga0068852_1000041117	143
1048	3300005617	Ga0068859_100006839	Ga0068859_1000068395	143
1049	3300005617	Ga0068859_100054917	Ga0068859_1000549172	143
1050	3300005617	Ga0068859_100211558	Ga0068859_1002115583	143
1051	3300005618	Ga0068864_100000595	Ga0068864_10000059511	143
1052	3300005718	Ga0068866_10036273	Ga0068866_100362733	143
1053	3300005718	Ga0068866_10081678	Ga0068866_100816782	143
1054	3300005718	Ga0068866_10368663	Ga0068866_103686632	143
1055	3300005719	Ga0068861_100000825	Ga0068861_1000008256	143
1056	3300005719	Ga0068861_100021865	Ga0068861_1000218654	143
1057	3300005834	Ga0068851_10341964	Ga0068851_103419642	143
1058	3300005840	Ga0068870_10000112	Ga0068870_1000011223	143
1059	3300005841	Ga0068863_100000703	Ga0068863_1000007032	143
1060	3300005841	Ga0068863_100388391	Ga0068863_1003883912	143
1061	3300005841	Ga0068863_100524179	Ga0068863_1005241792	143
1062	3300005842	Ga0068858_100042730	Ga0068858_1000427305	143
1063	3300005842	Ga0068858_100254531	Ga0068858_1002545312	143
1064	3300005843	Ga0068860_100175120	Ga0068860_1001751202	143
1065	3300005843	Ga0068860_101927043	Ga0068860_1019270431	143
1066	3300005844	Ga0068862_100004649	Ga0068862_1000046494	143
1067	3300005844	Ga0068862_100055325	Ga0068862_1000553252	143
1068	3300005844	Ga0068862_100773640	Ga0068862_1007736402	143
1069	3300005937	Ga0081455_10000048	Ga0081455_1000004864	143
1070	3300005937	Ga0081455_10013465	Ga0081455_100134655	143
1071	3300005937	Ga0081455_10042965	Ga0081455_100429653	143
1072	3300006028	Ga0070717_10016855	Ga0070717_100168552	143
1073	3300006028	Ga0070717_10044826	Ga0070717_100448266	143
1074	3300006028	Ga0070717_10144489	Ga0070717_101444891	143
1075	3300006038	Ga0075365_10019024	Ga0075365_100190243	143
1076	3300006038	Ga0075365_10106583	Ga0075365_101065832	143
1077	3300006038	Ga0075365_10252425	Ga0075365_102524252	143
1078	3300006042	Ga0075368_10035915	Ga0075368_100359152	143
1079	3300006048	Ga0075363_100020925	Ga0075363_1000209255	143
1080	3300006048	Ga0075363_100320370	Ga0075363_1003203702	143
1081	3300006048	Ga0075363_100405458	Ga0075363_1004054581	143
1082	3300006051	Ga0075364_10082083	Ga0075364_100820832	143
1083	3300006058	Ga0075432_10005250	Ga0075432_100052502	143
1084	3300006163	Ga0070715_10361415	Ga0070715_103614152	143
1085	3300006163	Ga0070715_10581169	Ga0070715_105811692	143
1086	3300006173	Ga0070716_100000346	Ga0070716_10000034624	143
1087	3300006173	Ga0070716_100222150	Ga0070716_1002221502	143
1088	3300006173	Ga0070716_100769423	Ga0070716_1007694231	143
1089	3300006175	Ga0070712_100427960	Ga0070712_1004279601	143
1090	3300006177	Ga0075362_10310829	Ga0075362_103108292	143
1091	3300006178	Ga0075367_10193023	Ga0075367_101930232	143
1092	3300006186	Ga0075369_10030260	Ga0075369_100302602	143
1093	3300006195	Ga0075366_10044798	Ga0075366_100447982	143
1094	3300006237	Ga0097621_100000600	Ga0097621_1000006005	143
1095	3300006237	Ga0097621_100008260	Ga0097621_1000082604	143
1096	3300006353	Ga0075370_10106559	Ga0075370_101065593	143
1097	3300006353	Ga0075370_10188054	Ga0075370_101880542	143
1098	3300006358	Ga0068871_100000118	Ga0068871_10000011827	143
1099	3300006358	Ga0068871_100003511	Ga0068871_1000035113	143
1100	3300006844	Ga0075428_100006364	Ga0075428_10000636419	143
1101	3300006846	Ga0075430_100000196	Ga0075430_10000019621	143
1102	3300006847	Ga0075431_100001183	Ga0075431_10000118319	143
1103	3300006852	Ga0075433_10000991	Ga0075433_1000099118	143
1104	3300006852	Ga0075433_10028945	Ga0075433_100289454	143
1105	3300006852	Ga0075433_10163728	Ga0075433_101637282	143
1106	3300006852	Ga0075433_10233922	Ga0075433_102339221	143
1107	3300006871	Ga0075434_100001106	Ga0075434_10000110621	143
1108	3300006871	Ga0075434_100080382	Ga0075434_1000803822	143
1109	3300006871	Ga0075434_101596942	Ga0075434_1015969421	143
1110	3300006880	Ga0075429_100007323	Ga0075429_10000732310	143
1111	3300006881	Ga0068865_100002402	Ga0068865_1000024026	143
1112	3300006881	Ga0068865_100038417	Ga0068865_1000384172	143
1113	3300006881	Ga0068865_100067118	Ga0068865_1000671183	143
1114	3300006881	Ga0068865_100201864	Ga0068865_1002018642	143
1115	3300006914	Ga0075436_100009765	Ga0075436_1000097656	143
1116	3300006914	Ga0075436_100214920	Ga0075436_1002149202	143
1117	3300006914	Ga0075436_100388473	Ga0075436_1003884732	143
1118	3300006931	Ga0097620_100006838	Ga0097620_10000683810	143
1119	3300006931	Ga0097620_100054915	Ga0097620_1000549153	143
1120	3300006931	Ga0097620_100211555	Ga0097620_1002115552	143
1121	3300007076	Ga0075435_100115534	Ga0075435_1001155342	143
1122	3300007076	Ga0075435_100215645	Ga0075435_1002156452	143
1123	3300007076	Ga0075435_100239825	Ga0075435_1002398252	143
1124	3300007076	Ga0075435_100344124	Ga0075435_1003441242	143
1125	3300007076	Ga0075435_100505079	Ga0075435_1005050792	143
1126	3300007788	Ga0099795_10109740	Ga0099795_101097402	143
1127	3300009011	Ga0105251_10082861	Ga0105251_100828612	143
1128	3300009092	Ga0105250_10222360	Ga0105250_102223601	143
1129	3300009093	Ga0105240_10248193	Ga0105240_102481932	143
1130	3300009094	Ga0111539_10000683	Ga0111539_1000068333	143
1131	3300009094	Ga0111539_10001167	Ga0111539_1000116735	143
1132	3300009094	Ga0111539_10004804	Ga0111539_1000480412	143
1133	3300009094	Ga0111539_10905048	Ga0111539_109050482	143
1134	3300009094	Ga0111539_11742734	Ga0111539_117427342	143
1135	3300009094	Ga0111539_13139781	Ga0111539_131397811	143
1136	3300009098	Ga0105245_10001982	Ga0105245_1000198212	143
1137	3300009098	Ga0105245_10064026	Ga0105245_100640261	143
1138	3300009098	Ga0105245_11979628	Ga0105245_119796281	143
1139	3300009101	Ga0105247_10055580	Ga0105247_100555801	143
1140	3300009147	Ga0114129_10085770	Ga0114129_100857702	143
1141	3300009147	Ga0114129_10634225	Ga0114129_106342252	143
1142	3300009148	Ga0105243_10002278	Ga0105243_100022786	143
1143	3300009148	Ga0105243_10291729	Ga0105243_102917292	143
1144	3300009174	Ga0105241_10003555	Ga0105241_1000355512	143
1145	3300009174	Ga0105241_10413062	Ga0105241_104130623	143
1146	3300009176	Ga0105242_10001156	Ga0105242_1000115620	143
1147	3300009176	Ga0105242_10009023	Ga0105242_100090235	143
1148	3300009177	Ga0105248_10049118	Ga0105248_100491184	143
1149	3300009177	Ga0105248_10171207	Ga0105248_101712072	143
1150	3300009545	Ga0105237_10044472	Ga0105237_100444724	143
1151	3300009545	Ga0105237_10111975	Ga0105237_101119753	143
1152	3300009545	Ga0105237_10130725	Ga0105237_101307253	143
1153	3300009551	Ga0105238_10141219	Ga0105238_101412192	143
1154	3300009551	Ga0105238_10404006	Ga0105238_104040062	143
1155	3300009553	Ga0105249_10001021	Ga0105249_1000102120	143
1156	3300009553	Ga0105249_10006960	Ga0105249_100069602	143
1157	3300009553	Ga0105249_10516843	Ga0105249_105168432	143
1158	3300010159	Ga0099796_10002051	Ga0099796_100020513	143
1159	3300010375	Ga0105239_10048998	Ga0105239_100489982	143
1160	3300010375	Ga0105239_11360476	Ga0105239_113604762	143
1161	3300011119	Ga0105246_10008411	Ga0105246_100084112	143
1162	3300011119	Ga0105246_10034231	Ga0105246_100342314	143
1163	3300011119	Ga0105246_10117720	Ga0105246_101177202	143
1164	3300011119	Ga0105246_10640356	Ga0105246_106403562	143
1165	3300012477	Ga0157336_1008419	Ga0157336_10084191	143
1166	3300012483	Ga0157337_1000692	Ga0157337_10006922	143
1167	3300012502	Ga0157347_1023784	Ga0157347_10237842	143
1168	3300013100	Ga0157373_10038612	Ga0157373_100386122	143
1169	3300013102	Ga0157371_10064446	Ga0157371_100644463	143
1170	3300013102	Ga0157371_10404139	Ga0157371_104041391	143
1171	3300013104	Ga0157370_10132979	Ga0157370_101329793	143
1172	3300013105	Ga0157369_10197999	Ga0157369_101979992	143
1173	3300013105	Ga0157369_11132995	Ga0157369_111329951	143
1174	3300013296	Ga0157374_10056369	Ga0157374_100563694	143
1175	3300013296	Ga0157374_10740492	Ga0157374_107404922	143
1176	3300013296	Ga0157374_11303207	Ga0157374_113032071	143
1177	3300013297	Ga0157378_10002986	Ga0157378_100029862	143
1178	3300013306	Ga0163162_10009279	Ga0163162_100092796	143
1179	3300013306	Ga0163162_10020735	Ga0163162_100207353	143
1180	3300013307	Ga0157372_10008348	Ga0157372_100083482	143
1181	3300013307	Ga0157372_10337572	Ga0157372_103375722	143
1182	3300013308	Ga0157375_10000508	Ga0157375_100005082	143
1183	3300013308	Ga0157375_10219570	Ga0157375_102195702	143
1184	3300014325	Ga0163163_10008126	Ga0163163_100081269	143
1185	3300014326	Ga0157380_10000212	Ga0157380_1000021235	143
1186	3300014326	Ga0157380_10739100	Ga0157380_107391002	143
1187	3300014326	Ga0157380_11311583	Ga0157380_113115831	143
1188	3300014745	Ga0157377_10000287	Ga0157377_1000028726	143
1189	3300014745	Ga0157377_10024735	Ga0157377_100247352	143
1190	3300014968	Ga0157379_10040541	Ga0157379_100405412	143
1191	3300014968	Ga0157379_10066845	Ga0157379_100668453	143
1192	3300014968	Ga0157379_10458243	Ga0157379_104582432	143
1193	3300014969	Ga0157376_10008731	Ga0157376_100087317	143
1194	3300017792	Ga0163161_10000415	Ga0163161_1000041522	143
1195	3300025271	Ga0207666_1000073	Ga0207666_100007313	143
1196	3300025271	Ga0207666_1002790	Ga0207666_10027902	143
1197	3300025290	Ga0207673_1001315	Ga0207673_10013154	143
1198	3300025315	Ga0207697_10000061	Ga0207697_1000006148	143
1199	3300025315	Ga0207697_10004826	Ga0207697_100048266	143
1200	3300025315	Ga0207697_10238762	Ga0207697_102387621	143
1201	3300025321	Ga0207656_10071473	Ga0207656_100714732	143
1202	3300025321	Ga0207656_10222190	Ga0207656_102221902	143
1203	3300025735	Ga0207713_1218007	Ga0207713_12180071	143
1204	3300025885	Ga0207653_10002714	Ga0207653_100027146	143
1205	3300025893	Ga0207682_10000350	Ga0207682_1000035028	143
1206	3300025898	Ga0207692_10086006	Ga0207692_100860062	143
1207	3300025898	Ga0207692_10290113	Ga0207692_102901132	143
1208	3300025898	Ga0207692_10496143	Ga0207692_104961432	143
1209	3300025899	Ga0207642_10000638	Ga0207642_100006384	143
1210	3300025899	Ga0207642_10096361	Ga0207642_100963611	143
1211	3300025899	Ga0207642_10274578	Ga0207642_102745782	143
1212	3300025900	Ga0207710_10003470	Ga0207710_100034702	143
1213	3300025900	Ga0207710_10067951	Ga0207710_100679512	143
1214	3300025901	Ga0207688_10000001	Ga0207688_10000001105	143
1215	3300025901	Ga0207688_10029490	Ga0207688_100294902	143
1216	3300025901	Ga0207688_10693284	Ga0207688_106932841	143
1217	3300025903	Ga0207680_10001817	Ga0207680_100018172	143
1218	3300025903	Ga0207680_10037262	Ga0207680_100372622	143
1219	3300025904	Ga0207647_10002852	Ga0207647_1000285211	143
1220	3300025904	Ga0207647_10019026	Ga0207647_100190262	143
1221	3300025905	Ga0207685_10312076	Ga0207685_103120762	143
1222	3300025906	Ga0207699_10002264	Ga0207699_1000226414	143
1223	3300025906	Ga0207699_10031777	Ga0207699_100317772	143
1224	3300025906	Ga0207699_10068182	Ga0207699_100681823	143
1225	3300025906	Ga0207699_10218455	Ga0207699_102184552	143
1226	3300025907	Ga0207645_10000222	Ga0207645_1000022238	143
1227	3300025907	Ga0207645_10263469	Ga0207645_102634692	143
1228	3300025907	Ga0207645_10305684	Ga0207645_103056842	143
1229	3300025908	Ga0207643_10000009	Ga0207643_1000000932	143
1230	3300025911	Ga0207654_10001390	Ga0207654_100013903	143
1231	3300025911	Ga0207654_10096652	Ga0207654_100966522	143
1232	3300025912	Ga0207707_10004174	Ga0207707_100041742	143
1233	3300025912	Ga0207707_10064823	Ga0207707_100648232	143
1234	3300025912	Ga0207707_10525871	Ga0207707_105258712	143
1235	3300025912	Ga0207707_10593105	Ga0207707_105931052	143
1236	3300025913	Ga0207695_10206235	Ga0207695_102062352	143
1237	3300025914	Ga0207671_10019008	Ga0207671_100190084	143
1238	3300025914	Ga0207671_10243845	Ga0207671_102438452	143
1239	3300025915	Ga0207693_10003519	Ga0207693_1000351912	143
1240	3300025915	Ga0207693_10710764	Ga0207693_107107641	143
1241	3300025916	Ga0207663_10113488	Ga0207663_101134882	143
1242	3300025916	Ga0207663_10189326	Ga0207663_101893261	143
1243	3300025916	Ga0207663_10940335	Ga0207663_109403352	143
1244	3300025917	Ga0207660_10000197	Ga0207660_1000019720	143
1245	3300025917	Ga0207660_10019663	Ga0207660_100196636	143
1246	3300025918	Ga0207662_10001861	Ga0207662_100018612	143
1247	3300025918	Ga0207662_10002878	Ga0207662_100028782	143
1248	3300025919	Ga0207657_10000776	Ga0207657_1000077636	143
1249	3300025919	Ga0207657_10144397	Ga0207657_101443972	143
1250	3300025919	Ga0207657_10176606	Ga0207657_101766062	143
1251	3300025919	Ga0207657_10759755	Ga0207657_107597552	143
1252	3300025920	Ga0207649_10000052	Ga0207649_1000005298	143
1253	3300025920	Ga0207649_10123735	Ga0207649_101237352	143
1254	3300025920	Ga0207649_10154264	Ga0207649_101542642	143
1255	3300025921	Ga0207652_10001438	Ga0207652_1000143815	143
1256	3300025921	Ga0207652_10297305	Ga0207652_102973052	143
1257	3300025921	Ga0207652_10381318	Ga0207652_103813182	143
1258	3300025923	Ga0207681_10002118	Ga0207681_100021186	143
1259	3300025923	Ga0207681_10119645	Ga0207681_101196452	143
1260	3300025923	Ga0207681_10721886	Ga0207681_107218861	143
1261	3300025924	Ga0207694_10076332	Ga0207694_100763322	143
1262	3300025925	Ga0207650_10024267	Ga0207650_100242672	143
1263	3300025925	Ga0207650_10436394	Ga0207650_104363942	143
1264	3300025925	Ga0207650_10674417	Ga0207650_106744171	143
1265	3300025926	Ga0207659_10000132	Ga0207659_1000013216	143
1266	3300025926	Ga0207659_10337421	Ga0207659_103374212	143
1267	3300025926	Ga0207659_10431207	Ga0207659_104312072	143
1268	3300025926	Ga0207659_10771059	Ga0207659_107710592	143
1269	3300025926	Ga0207659_11572819	Ga0207659_115728191	143
1270	3300025927	Ga0207687_10000174	Ga0207687_1000017415	143
1271	3300025927	Ga0207687_10236067	Ga0207687_102360672	143
1272	3300025928	Ga0207700_10019653	Ga0207700_100196534	143
1273	3300025928	Ga0207700_10072092	Ga0207700_100720923	143
1274	3300025928	Ga0207700_11513991	Ga0207700_115139911	143
1275	3300025928	Ga0207700_11842782	Ga0207700_118427821	143
1276	3300025929	Ga0207664_10712993	Ga0207664_107129931	143
1277	3300025931	Ga0207644_10000212	Ga0207644_1000021220	143
1278	3300025931	Ga0207644_10664802	Ga0207644_106648022	143
1279	3300025932	Ga0207690_10000148	Ga0207690_1000014862	143
1280	3300025932	Ga0207690_10167502	Ga0207690_101675022	143
1281	3300025933	Ga0207706_10001360	Ga0207706_100013602	143
1282	3300025933	Ga0207706_10051128	Ga0207706_100511282	143
1283	3300025933	Ga0207706_10314205	Ga0207706_103142052	143
1284	3300025934	Ga0207686_10001289	Ga0207686_1000128911	143
1285	3300025934	Ga0207686_10099016	Ga0207686_100990162	143
1286	3300025934	Ga0207686_10214206	Ga0207686_102142062	143
1287	3300025935	Ga0207709_10000530	Ga0207709_1000053015	143
1288	3300025936	Ga0207670_10000523	Ga0207670_1000052316	143
1289	3300025936	Ga0207670_10073230	Ga0207670_100732303	143
1290	3300025936	Ga0207670_10150162	Ga0207670_101501622	143
1291	3300025936	Ga0207670_10157414	Ga0207670_101574141	143
1292	3300025937	Ga0207669_10000235	Ga0207669_1000023532	143
1293	3300025937	Ga0207669_10086587	Ga0207669_100865873	143
1294	3300025937	Ga0207669_10185539	Ga0207669_101855392	143
1295	3300025938	Ga0207704_10000198	Ga0207704_1000019831	143
1296	3300025938	Ga0207704_10040926	Ga0207704_100409263	143
1297	3300025938	Ga0207704_10086432	Ga0207704_100864322	143
1298	3300025938	Ga0207704_10193367	Ga0207704_101933672	143
1299	3300025939	Ga0207665_10000273	Ga0207665_1000027324	143
1300	3300025939	Ga0207665_10527795	Ga0207665_105277952	143
1301	3300025940	Ga0207691_10000517	Ga0207691_100005176	143
1302	3300025940	Ga0207691_10169807	Ga0207691_101698072	143
1303	3300025940	Ga0207691_10625700	Ga0207691_106257002	143
1304	3300025941	Ga0207711_10011248	Ga0207711_100112482	143
1305	3300025941	Ga0207711_10153997	Ga0207711_101539972	143
1306	3300025941	Ga0207711_10279892	Ga0207711_102798922	143
1307	3300025942	Ga0207689_10000031	Ga0207689_1000003184	143
1308	3300025942	Ga0207689_10120176	Ga0207689_101201762	143
1309	3300025942	Ga0207689_10130889	Ga0207689_101308891	143
1310	3300025944	Ga0207661_10001228	Ga0207661_1000122810	143
1311	3300025944	Ga0207661_10787459	Ga0207661_107874592	143
1312	3300025945	Ga0207679_10000183	Ga0207679_1000018333	143
1313	3300025945	Ga0207679_10578317	Ga0207679_105783171	143
1314	3300025945	Ga0207679_10832948	Ga0207679_108329482	143
1315	3300025949	Ga0207667_10091715	Ga0207667_100917153	143
1316	3300025949	Ga0207667_11073751	Ga0207667_110737511	143
1317	3300025960	Ga0207651_10000051	Ga0207651_1000005133	143
1318	3300025960	Ga0207651_10068977	Ga0207651_100689772	143
1319	3300025960	Ga0207651_10945912	Ga0207651_109459122	143
1320	3300025961	Ga0207712_10000738	Ga0207712_1000073820	143
1321	3300025961	Ga0207712_10134526	Ga0207712_101345262	143
1322	3300025961	Ga0207712_11247854	Ga0207712_112478542	143
1323	3300025972	Ga0207668_10000664	Ga0207668_1000066415	143
1324	3300025972	Ga0207668_10211119	Ga0207668_102111192	143
1325	3300025972	Ga0207668_10562151	Ga0207668_105621512	143
1326	3300025981	Ga0207640_10000343	Ga0207640_100003436	143
1327	3300025981	Ga0207640_10208313	Ga0207640_102083132	143
1328	3300025981	Ga0207640_11190117	Ga0207640_111901171	143
1329	3300025986	Ga0207658_10010402	Ga0207658_100104025	143
1330	3300025986	Ga0207658_10276641	Ga0207658_102766412	143
1331	3300025986	Ga0207658_10329744	Ga0207658_103297442	143
1332	3300025986	Ga0207658_10419544	Ga0207658_104195442	143
1333	3300026023	Ga0207677_10010253	Ga0207677_100102536	143
1334	3300026023	Ga0207677_10018951	Ga0207677_100189515	143
1335	3300026035	Ga0207703_10002904	Ga0207703_100029047	143
1336	3300026035	Ga0207703_10370263	Ga0207703_103702632	143
1337	3300026035	Ga0207703_10864440	Ga0207703_108644402	143
1338	3300026035	Ga0207703_11978981	Ga0207703_119789811	143
1339	3300026041	Ga0207639_10001257	Ga0207639_1000125715	143
1340	3300026041	Ga0207639_10161115	Ga0207639_101611152	143
1341	3300026067	Ga0207678_10000531	Ga0207678_100005312	143
1342	3300026067	Ga0207678_10028153	Ga0207678_100281534	143
1343	3300026067	Ga0207678_10033354	Ga0207678_100333542	143
1344	3300026075	Ga0207708_10012245	Ga0207708_100122455	143
1345	3300026075	Ga0207708_10015833	Ga0207708_100158335	143
1346	3300026075	Ga0207708_10403042	Ga0207708_104030422	143
1347	3300026075	Ga0207708_10616437	Ga0207708_106164372	143
1348	3300026078	Ga0207702_10003284	Ga0207702_100032846	143
1349	3300026078	Ga0207702_10282075	Ga0207702_102820752	143
1350	3300026088	Ga0207641_10001831	Ga0207641_1000183128	143
1351	3300026088	Ga0207641_10041398	Ga0207641_100413985	143
1352	3300026088	Ga0207641_11121579	Ga0207641_111215792	143
1353	3300026089	Ga0207648_10000581	Ga0207648_1000058136	143
1354	3300026089	Ga0207648_10098521	Ga0207648_100985212	143
1355	3300026095	Ga0207676_10000124	Ga0207676_1000012450	143
1356	3300026095	Ga0207676_10194978	Ga0207676_101949782	143
1357	3300026116	Ga0207674_10000095	Ga0207674_100000952	143
1358	3300026116	Ga0207674_10614832	Ga0207674_106148322	143
1359	3300026118	Ga0207675_100000414	Ga0207675_10000041436	143
1360	3300026118	Ga0207675_100047953	Ga0207675_1000479534	143
1361	3300026121	Ga0207683_10000242	Ga0207683_1000024227	143
1362	3300026121	Ga0207683_10001174	Ga0207683_1000117427	143
1363	3300026142	Ga0207698_10000951	Ga0207698_1000095113	143
1364	3300026142	Ga0207698_10160323	Ga0207698_101603233	143
1365	3300026142	Ga0207698_10519991	Ga0207698_105199911	143
1366	3300026142	Ga0207698_12035554	Ga0207698_120355541	143
1367	3300027424	Ga0209984_1012763	Ga0209984_10127632	143
1368	3300027471	Ga0209995_1021735	Ga0209995_10217352	143
1369	3300027512	Ga0209179_1000116	Ga0209179_10001161	143
1370	3300027617	Ga0210002_1000654	Ga0210002_10006542	143
1371	3300027617	Ga0210002_1007727	Ga0210002_10077272	143
1372	3300027682	Ga0209971_1032187	Ga0209971_10321872	143
1373	3300027695	Ga0209966_1010865	Ga0209966_10108651	143
1374	3300027695	Ga0209966_1015133	Ga0209966_10151332	143
1375	3300027717	Ga0209998_10003189	Ga0209998_100031892	143
1376	3300027717	Ga0209998_10014755	Ga0209998_100147552	143
1377	3300027866	Ga0209813_10014052	Ga0209813_100140522	143
1378	3300027876	Ga0209974_10003544	Ga0209974_100035445	143
1379	3300027876	Ga0209974_10233226	Ga0209974_102332261	143
1380	3300027907	Ga0207428_10000037	Ga0207428_10000037199	143
1381	3300027907	Ga0207428_10001217	Ga0207428_100012174	143
1382	3300027907	Ga0207428_10001773	Ga0207428_100017736	143
1383	3300027907	Ga0207428_10405681	Ga0207428_104056812	143
1384	3300028379	Ga0268266_10016362	Ga0268266_100163625	143
1385	3300028379	Ga0268266_10068513	Ga0268266_100685132	143
1386	3300028380	Ga0268265_10006176	Ga0268265_100061766	143
1387	3300028380	Ga0268265_10019814	Ga0268265_100198142	143
1388	3300028380	Ga0268265_10839174	Ga0268265_108391741	143
1389	3300028381	Ga0268264_10002331	Ga0268264_1000233113	143
1390	3300028381	Ga0268264_10239095	Ga0268264_102390952	143
1391	3300028381	Ga0268264_10666933	Ga0268264_106669332	143
1392	3300028381	Ga0268264_11152722	Ga0268264_111527221	143
1393	3300031241	Ga0265325_10001071	Ga0265325_1000107128	143
1394	3300031247	Ga0265340_10051750	Ga0265340_100517503	143
1395	3300031249	Ga0265339_10450501	Ga0265339_104505011	143
1396	3300031595	Ga0265313_10004533	Ga0265313_100045333	143
1397	3300031595	Ga0265313_10021256	Ga0265313_100212562	143
1398	3300031691	Ga0316579_10024793	Ga0316579_100247933	143
1399	3300031711	Ga0265314_10495819	Ga0265314_104958191	143
1400	3300031712	Ga0265342_10286746	Ga0265342_102867462	143
1401	3300032002	Ga0307416_101655588	Ga0307416_1016555882	143
1402	3300032168	Ga0316593_10171879	Ga0316593_101718792	143
1403	3300034816	Ga0373930_0000352	Ga0373930_0000352_4462_4893	143
1404	3300034816	Ga0373930_0063301	Ga0373930_0063301_262_693	143
1405	3300034817	Ga0373948_0001000	Ga0373948_0001000_554_985	143
1406	3300034817	Ga0373948_0025645	Ga0373948_0025645_713_1144	143
1407	3300034817	Ga0373948_0159517	Ga0373948_0159517_99_530	143
1408	3300034818	Ga0373950_0000155	Ga0373950_0000155_1554_1985	143
1409	3300034819	Ga0373958_0000136	Ga0373958_0000136_298_729	143
1410	3300034819	Ga0373958_0001575	Ga0373958_0001575_1524_1955	143
1411	3300034819	Ga0373958_0067234	Ga0373958_0067234_121_552	143
1412	3300034820	Ga0373959_0000508	Ga0373959_0000508_3318_3749	143
1413	3300034957	Ga0373938_0000013	Ga0373938_0000013_10738_11169	143
1414	3300034957	Ga0373938_0001096	Ga0373938_0001096_3873_4304	143
1415	3300034957	Ga0373938_0038068	Ga0373938_0038068_383_814	143
1416	3300035083	Ga0373926_0011216	Ga0373926_0011216_377_808	143
1417	3300035083	Ga0373926_0015193	Ga0373926_0015193_2052_2507	143
1418	3300035083	Ga0373926_0148429	Ga0373926_0148429_260_691	143
1419	3300035084	Ga0373928_0000255	Ga0373928_0000255_756_1187	143
1420	3300035084	Ga0373928_0003373	Ga0373928_0003373_263_694	143
1421	3300035084	Ga0373928_0088192	Ga0373928_0088192_75_506	143
1422	3300035085	Ga0373929_0028724	Ga0373929_0028724_552_983	143
1423	3300035085	Ga0373929_0034931	Ga0373929_0034931_166_597	143
1424	3300035085	Ga0373929_0063265	Ga0373929_0063265_97_528	143
1425	3300035085	Ga0373929_0164485	Ga0373929_0164485_115_546	143
1426	3300035086	Ga0373934_0118102	Ga0373934_0118102_179_610	143
1427	3300035088	Ga0373940_0000097	Ga0373940_0000097_4758_5189	143
1428	3300035088	Ga0373940_0037102	Ga0373940_0037102_524_955	143
1429	3300035088	Ga0373940_0128423	Ga0373940_0128423_309_740	143
1430	3300035088	Ga0373940_0128805	Ga0373940_0128805_236_667	143
1431	3300035089	Ga0373944_0000533	Ga0373944_0000533_268_699	143
1432	3300035089	Ga0373944_0025116	Ga0373944_0025116_1163_1594	143
1433	3300035089	Ga0373944_0033620	Ga0373944_0033620_486_917	143
1434	3300035090	Ga0373949_0002652	Ga0373949_0002652_1779_2210	143
1435	3300035090	Ga0373949_0010932	Ga0373949_0010932_593_1024	143
1436	3300035091	Ga0373951_0004343	Ga0373951_0004343_674_1105	143
1437	3300035091	Ga0373951_0007211	Ga0373951_0007211_1855_2286	143
1438	3300035091	Ga0373951_0072483	Ga0373951_0072483_166_597	143
1439	3300035091	Ga0373951_0110061	Ga0373951_0110061_70_501	143
1440	3300035092	Ga0373952_0001231	Ga0373952_0001231_3868_4299	143
1441	3300035092	Ga0373952_0087116	Ga0373952_0087116_241_672	143
1442	3300035092	Ga0373952_0091552	Ga0373952_0091552_292_723	143
1443	3300035111	Ga0373923_0008045	Ga0373923_0008045_1142_1573	143
1444	3300035111	Ga0373923_0014573	Ga0373923_0014573_870_1325	143
1445	3300035111	Ga0373923_0187427	Ga0373923_0187427_448_879	143
1446	3300035111	Ga0373923_0389634	Ga0373923_0389634_75_506	143
1447	3300035112	Ga0373932_0000252	Ga0373932_0000252_8993_9424	143
1448	3300035112	Ga0373932_0000830	Ga0373932_0000830_2631_3062	143
1449	3300035112	Ga0373932_0007039	Ga0373932_0007039_190_621	143
1450	3300035113	Ga0373936_0027271	Ga0373936_0027271_1465_1896	143
1451	3300035113	Ga0373936_0051334	Ga0373936_0051334_783_1214	143
1452	3300035114	Ga0373939_0001022	Ga0373939_0001022_3787_4218	143
1453	3300035114	Ga0373939_0009550	Ga0373939_0009550_1425_1856	143
1454	3300035114	Ga0373939_0023589	Ga0373939_0023589_1145_1576	143
1455	3300035115	Ga0373941_0000125	Ga0373941_0000125_4317_4748	143
1456	3300035115	Ga0373941_0004821	Ga0373941_0004821_467_898	143
1457	3300035115	Ga0373941_0007140	Ga0373941_0007140_672_1103	143
1458	3300035116	Ga0373945_0027240	Ga0373945_0027240_1005_1436	143
1459	3300035116	Ga0373945_0037203	Ga0373945_0037203_935_1390	143
1460	3300035117	Ga0373953_0061917	Ga0373953_0061917_644_1099	143
1461	3300035117	Ga0373953_0155234	Ga0373953_0155234_509_940	143
1462	3300035118	Ga0373954_0002715	Ga0373954_0002715_4689_5144	143
1463	3300035118	Ga0373954_0033215	Ga0373954_0033215_1124_1555	143
1464	3300035119	Ga0373956_0008190	Ga0373956_0008190_2238_2669	143
1465	3300035119	Ga0373956_0056378	Ga0373956_0056378_1094_1525	143
1466	3300035119	Ga0373956_0252511	Ga0373956_0252511_315_770	143
1467	3300035120	Ga0373957_0043564	Ga0373957_0043564_865_1296	143
1468	3300035120	Ga0373957_0056945	Ga0373957_0056945_896_1351	143
1469	3300035120	Ga0373957_0091036	Ga0373957_0091036_565_996	143
1470	3300035121	Ga0373960_0000068	Ga0373960_0000068_1762_2193	143
1471	3300035121	Ga0373960_0006209	Ga0373960_0006209_1041_1472	143
1472	3300035121	Ga0373960_0060154	Ga0373960_0060154_572_1003	143
1473	3300035170	Ga0373943_0005374	Ga0373943_0005374_2977_3408	143
1474	3300035170	Ga0373943_0007567	Ga0373943_0007567_1578_2009	143
1475	3300035170	Ga0373943_0013145	Ga0373943_0013145_3025_3480	143
1476	3300035171	Ga0373946_0004390	Ga0373946_0004390_3998_4429	143
1477	3300035171	Ga0373946_0005848	Ga0373946_0005848_1253_1684	143
1478	3300035171	Ga0373946_0010959	Ga0373946_0010959_324_779	143
1479	3300035171	Ga0373946_0208330	Ga0373946_0208330_334_765	143
1480	3300035172	Ga0373955_0001002	Ga0373955_0001002_8862_9317	143
1481	3300035172	Ga0373955_0003246	Ga0373955_0003246_3629_4060	143
1482	3300035172	Ga0373955_0005183	Ga0373955_0005183_4488_4919	143
1483	3300035172	Ga0373955_0242640	Ga0373955_0242640_588_1019	143
1484	3300035172	Ga0373955_0513244	Ga0373955_0513244_216_647	143
1485	3300035172	Ga0373955_0694715	Ga0373955_0694715_174_605	143
1486	3300035207	Ga0373942_0003181	Ga0373942_0003181_2990_3421	143
1487	3300035241	Ga0373961_0000638	Ga0373961_0000638_8229_8660	143
1488	3300035241	Ga0373961_0002001	Ga0373961_0002001_3171_3602	143
1489	3300035241	Ga0373961_0011513	Ga0373961_0011513_332_763	143
1490	3300035241	Ga0373961_0091637	Ga0373961_0091637_432_863	143
1491	3300035242	Ga0373962_0000112	Ga0373962_0000112_3100_3531	143
1492	3300035242	Ga0373962_0003469	Ga0373962_0003469_16_447	143
1493	3300035242	Ga0373962_0031905	Ga0373962_0031905_945_1376	143
1494	3300035410	Ga0373924_0012081	Ga0373924_0012081_863_1318	143
1495	3300035410	Ga0373924_0078033	Ga0373924_0078033_747_1178	143
1496	3300035410	Ga0373924_0106294	Ga0373924_0106294_334_765	143
1497	3300035691	Ga0373931_0000305	Ga0373931_0000305_16788_17219	143
1498	3300035691	Ga0373931_0006732	Ga0373931_0006732_3147_3578	143
1499	3300035691	Ga0373931_0224059	Ga0373931_0224059_124_555	143
1500	3300035692	Ga0373935_0000768	Ga0373935_0000768_2000_2455	143
1501	3300035692	Ga0373935_0022201	Ga0373935_0022201_855_1286	143
1502	3300035692	Ga0373935_0033271	Ga0373935_0033271_541_972	143
1503	3300035692	Ga0373935_0036307	Ga0373935_0036307_2124_2555	143
1504	3300035695	Ga0373927_0007352	Ga0373927_0007352_1155_1586	143
1505	3300035695	Ga0373927_0017738	Ga0373927_0017738_1829_2284	143
1506	3300035724	Ga0373933_0002904	Ga0373933_0002904_1742_2197	143
1507	3300035724	Ga0373933_0012124	Ga0373933_0012124_2106_2537	143
1508	3300035724	Ga0373933_0021109	Ga0373933_0021109_2166_2597	143
1509	3300035725	Ga0373947_0003848	Ga0373947_0003848_4264_4695	143
1510	3300035725	Ga0373947_0005394	Ga0373947_0005394_2887_3342	143
1511	3300035725	Ga0373947_0024579	Ga0373947_0024579_785_1216	143
1512	3300035725	Ga0373947_0088207	Ga0373947_0088207_445_876	143
1513	3300036401	Ga0373937_0000057	Ga0373937_0000057_6021_6476	143
1514	3300036401	Ga0373937_0021076	Ga0373937_0021076_4790_5221	143
1515	3300036401	Ga0373937_0069964	Ga0373937_0069964_44_475	143
1516	3300036401	Ga0373937_0142147	Ga0373937_0142147_128_559	143
1517	3300036401	Ga0373937_0372318	Ga0373937_0372318_710_1141	143
1518	3300036401	Ga0373937_1436612	Ga0373937_1436612_133_564	143
1519	3300037068	Ga0373925_0000435	Ga0373925_0000435_34160_34615	143
1520	3300037068	Ga0373925_0003982	Ga0373925_0003982_5046_5477	143
1521	3300037068	Ga0373925_0076792	Ga0373925_0076792_1115_1546	143
1522	3300037068	Ga0373925_0088522	Ga0373925_0088522_1619_2050	143
1523	3300041408	Ga0439453_0014329	Ga0439453_0014329_605_1036	143
1524	3300041408	Ga0439453_0134168	Ga0439453_0134168_123_554	143
1525	3300042005	Ga0439448_0116540	Ga0439448_0116540_21_452	143
1526	3300042012	Ga0439455_0188987	Ga0439455_0188987_44_475	143
1527	3300042016	Ga0439463_023857	Ga0439463_023857_505_936	143
1528	3300042435	Ga0439434_0133568	Ga0439434_0133568_317_748	143
1529	3300042436	Ga0439435_0071064	Ga0439435_0071064_354_785	143
1530	3300042461	Ga0439460_0132233	Ga0439460_0132233_135_566	143
1531	3300042993	Ga0439440_0033599	Ga0439440_0033599_765_1196	143
1532	3300042993	Ga0439440_0174504	Ga0439440_0174504_177_611	143
1533	3300044673	Ga0453683_0907353	Ga0453683_0907353_46_477	143
1534	3300044712	Ga0453684_0054940	Ga0453684_0054940_1545_1976	143
1535	3300045051	Ga0451576_0014613	Ga0451576_0014613_4790_5221	143
1536	3300045051	Ga0451576_1301610	Ga0451576_1301610_95_526	143
1537	3300046452	Ga0495617_113070	Ga0495617_113070_99_530	143
1538	3300046454	Ga0495592_0000135	Ga0495592_0000135_14593_15048	143
1539	3300046454	Ga0495592_0014401	Ga0495592_0014401_2062_2493	143
1540	3300046455	Ga0495603_0021043	Ga0495603_0021043_1482_1913	143
1541	3300046455	Ga0495603_0061331	Ga0495603_0061331_231_662	143
1542	3300046459	Ga0495629_0000317	Ga0495629_0000317_29081_29512	143
1543	3300046459	Ga0495629_0003401	Ga0495629_0003401_3311_3766	143
1544	3300046459	Ga0495629_0324956	Ga0495629_0324956_176_607	143
1545	3300046461	Ga0495641_0011557	Ga0495641_0011557_1192_1623	143
1546	3300046461	Ga0495641_0026288	Ga0495641_0026288_1070_1501	143
1547	3300046462	Ga0495651_0000205	Ga0495651_0000205_10565_11020	143
1548	3300046462	Ga0495651_0003040	Ga0495651_0003040_3985_4416	143
1549	3300046462	Ga0495651_0020586	Ga0495651_0020586_3894_4325	143
1550	3300046463	Ga0495653_0000120	Ga0495653_0000120_14621_15076	143
1551	3300046463	Ga0495653_0052632	Ga0495653_0052632_314_745	143
1552	3300046463	Ga0495653_0373044	Ga0495653_0373044_26_457	143
1553	3300046472	Ga0495580_0013448	Ga0495580_0013448_4514_4945	143
1554	3300046472	Ga0495580_0542180	Ga0495580_0542180_307_738	143
1555	3300046473	Ga0495582_0003003	Ga0495582_0003003_8213_8644	143
1556	3300046473	Ga0495582_0024366	Ga0495582_0024366_2166_2597	143
1557	3300046473	Ga0495582_0456358	Ga0495582_0456358_97_528	143
1558	3300046475	Ga0495639_0006886	Ga0495639_0006886_2093_2524	143
1559	3300046475	Ga0495639_0038520	Ga0495639_0038520_692_1123	143
1560	3300046475	Ga0495639_0538455	Ga0495639_0538455_152_583	143
1561	3300046476	Ga0495662_0001020	Ga0495662_0001020_3675_4130	143
1562	3300046476	Ga0495662_0015371	Ga0495662_0015371_2542_2973	143
1563	3300046477	Ga0495664_0000023	Ga0495664_0000023_111732_112187	143
1564	3300046477	Ga0495664_0004160	Ga0495664_0004160_4144_4575	143
1565	3300046491	Ga0495584_0006027	Ga0495584_0006027_4258_4689	143
1566	3300046491	Ga0495584_0097248	Ga0495584_0097248_676_1107	143
1567	3300046491	Ga0495584_0139355	Ga0495584_0139355_346_780	143
1568	3300046492	Ga0495585_0001730	Ga0495585_0001730_7741_8172	143
1569	3300046499	Ga0495594_0008463	Ga0495594_0008463_1059_1490	143
1570	3300046499	Ga0495594_0176840	Ga0495594_0176840_224_655	143
1571	3300046501	Ga0495607_0020303	Ga0495607_0020303_3403_3834	143
1572	3300046501	Ga0495607_0500227	Ga0495607_0500227_68_502	143
1573	3300046506	Ga0495583_0237214	Ga0495583_0237214_268_699	143
1574	3300046511	Ga0495608_0000030	Ga0495608_0000030_111177_111632	143
1575	3300046511	Ga0495608_0120650	Ga0495608_0120650_1020_1451	143
1576	3300046514	Ga0495618_0000042	Ga0495618_0000042_14621_15076	143
1577	3300046514	Ga0495618_0039990	Ga0495618_0039990_528_959	143
1578	3300046514	Ga0495618_0082933	Ga0495618_0082933_909_1340	143
1579	3300046514	Ga0495618_0138083	Ga0495618_0138083_487_918	143
1580	3300046514	Ga0495618_0317153	Ga0495618_0317153_62_493	143
1581	3300046516	Ga0495628_0000027	Ga0495628_0000027_14598_15053	143
1582	3300046516	Ga0495628_0022132	Ga0495628_0022132_645_1076	143
1583	3300046516	Ga0495628_0072969	Ga0495628_0072969_2017_2448	143
1584	3300046516	Ga0495628_0542034	Ga0495628_0542034_277_708	143
1585	3300046517	Ga0495630_0004014	Ga0495630_0004014_7840_8295	143
1586	3300046517	Ga0495630_0091356	Ga0495630_0091356_753_1184	143
1587	3300046520	Ga0495637_0036132	Ga0495637_0036132_301_732	143
1588	3300046523	Ga0495644_0010975	Ga0495644_0010975_847_1278	143
1589	3300046525	Ga0495663_0061656	Ga0495663_0061656_638_1069	143
1590	3300046526	Ga0495666_0009459	Ga0495666_0009459_2133_2564	143
1591	3300046529	Ga0495652_0000041	Ga0495652_0000041_111444_111899	143
1592	3300046529	Ga0495652_0008048	Ga0495652_0008048_393_824	143
1593	3300046529	Ga0495652_0310220	Ga0495652_0310220_37_468	143
1594	3300046531	Ga0495665_0017086	Ga0495665_0017086_1307_1738	143
1595	3300046531	Ga0495665_0058767	Ga0495665_0058767_1048_1503	143
1596	3300046533	Ga0495640_0000047	Ga0495640_0000047_14621_15076	143
1597	3300046533	Ga0495640_0131077	Ga0495640_0131077_449_880	143
1598	3300046535	Ga0495586_0058434	Ga0495586_0058434_809_1240	143
1599	3300046536	Ga0495587_0000025	Ga0495587_0000025_34198_34653	143
1600	3300046536	Ga0495587_0031066	Ga0495587_0031066_2729_3160	143
1601	3300046536	Ga0495587_0114672	Ga0495587_0114672_553_984	143
1602	3300046538	Ga0495609_0022599	Ga0495609_0022599_2374_2805	143
1603	3300046543	Ga0495645_0000001	Ga0495645_0000001_546037_546492	143
1604	3300046543	Ga0495645_0002505	Ga0495645_0002505_7625_8056	143
1605	3300046543	Ga0495645_0323447	Ga0495645_0323447_39_470	143
1606	3300046557	Ga0495622_0007235	Ga0495622_0007235_538_969	143
1607	3300046557	Ga0495622_0436722	Ga0495622_0436722_14_445	143
1608	3300046558	Ga0495633_0007680	Ga0495633_0007680_1292_1723	143
1609	3300046559	Ga0495667_0000001	Ga0495667_0000001_819232_819687	143
1610	3300046559	Ga0495667_0004699	Ga0495667_0004699_2035_2466	143
1611	3300046559	Ga0495667_0260734	Ga0495667_0260734_45_476	143
1612	3300046615	Ga0495656_0000517	Ga0495656_0000517_7986_8417	143
1613	3300046615	Ga0495656_0042360	Ga0495656_0042360_466_900	143
1614	3300046642	Ga0495634_0085278	Ga0495634_0085278_1297_1728	143
1615	3300046642	Ga0495634_0436160	Ga0495634_0436160_72_503	143
1616	3300046648	Ga0495611_0053712	Ga0495611_0053712_1138_1569	143
1617	3300046663	Ga0495635_0000061	Ga0495635_0000061_14621_15076	143
1618	3300046663	Ga0495635_0044863	Ga0495635_0044863_1478_1909	143
1619	3300046674	Ga0495588_0047763	Ga0495588_0047763_1735_2166	143
1620	3300046674	Ga0495588_0053888	Ga0495588_0053888_909_1340	143
1621	3300046675	Ga0495657_0000204	Ga0495657_0000204_50491_50946	143
1622	3300046675	Ga0495657_0009621	Ga0495657_0009621_3195_3626	143
1623	3300046675	Ga0495657_0181867	Ga0495657_0181867_50_481	143
1624	3300046675	Ga0495657_0555741	Ga0495657_0555741_124_555	143
1625	3300046678	Ga0495599_0000021	Ga0495599_0000021_15145_15600	143
1626	3300046678	Ga0495599_0002367	Ga0495599_0002367_385_816	143
1627	3300046679	Ga0495623_0001713	Ga0495623_0001713_2614_3069	143
1628	3300046679	Ga0495623_0150233	Ga0495623_0150233_862_1293	143
1629	3300046680	Ga0495646_0000043	Ga0495646_0000043_15145_15600	143
1630	3300046680	Ga0495646_0032503	Ga0495646_0032503_52_483	143
1631	3300046680	Ga0495646_0134317	Ga0495646_0134317_408_839	143
1632	3300046681	Ga0495647_0047507	Ga0495647_0047507_1150_1581	143
1633	3300046681	Ga0495647_0355060	Ga0495647_0355060_65_496	143
1634	3300046683	Ga0495658_0000611	Ga0495658_0000611_10170_10601	143
1635	3300046683	Ga0495658_0083680	Ga0495658_0083680_1130_1585	143
1636	3300046683	Ga0495658_0114401	Ga0495658_0114401_1055_1504	143
1637	3300046683	Ga0495658_0906627	Ga0495658_0906627_37_468	143
1638	3300046689	Ga0495613_0124478	Ga0495613_0124478_642_1073	143
1639	3300046689	Ga0495613_0437874	Ga0495613_0437874_194_625	143
1640	3300046689	Ga0495613_0633319	Ga0495613_0633319_120_575	143
1641	3300046690	Ga0495624_0100412	Ga0495624_0100412_1112_1567	143
1642	3300046690	Ga0495624_0416808	Ga0495624_0416808_139_570	143
1643	3300046691	Ga0495670_0001374	Ga0495670_0001374_8257_8688	143
1644	3300046692	Ga0495671_0032249	Ga0495671_0032249_2156_2587	143
1645	3300046809	Ga0495600_0000082	Ga0495600_0000082_37023_37478	143
1646	3300046809	Ga0495600_0013808	Ga0495600_0013808_611_1042	143
1647	3300046809	Ga0495600_0018919	Ga0495600_0018919_3934_4365	143
1648	3300046809	Ga0495600_0107085	Ga0495600_0107085_1077_1508	143
1649	3300047315	Ga0495581_0041004	Ga0495581_0041004_2153_2608	143
1650	3300047315	Ga0495581_0106059	Ga0495581_0106059_396_827	143
1651	3300047317	Ga0495604_0000036	Ga0495604_0000036_14616_15071	143
1652	3300047317	Ga0495604_0003635	Ga0495604_0003635_11412_11843	143
1653	3300047317	Ga0495604_0029576	Ga0495604_0029576_1418_1849	143
1654	3300047317	Ga0495604_0454275	Ga0495604_0454275_342_773	143
1655	3300047319	Ga0495674_0000085	Ga0495674_0000085_50314_50769	143
1656	3300047319	Ga0495674_0089412	Ga0495674_0089412_1986_2417	143
1657	3300047319	Ga0495674_0129898	Ga0495674_0129898_939_1370	143
1658	3300047321	Ga0495676_0044524	Ga0495676_0044524_3174_3605	143
1659	3300047321	Ga0495676_0136951	Ga0495676_0136951_572_1003	143
1660	3300047321	Ga0495676_0384336	Ga0495676_0384336_103_558	143
1661	3300047322	Ga0495680_0000201	Ga0495680_0000201_49611_50066	143
1662	3300047322	Ga0495680_0012190	Ga0495680_0012190_3139_3570	143
1663	3300047322	Ga0495680_0033890	Ga0495680_0033890_2438_2869	143
1664	3300047322	Ga0495680_0050922	Ga0495680_0050922_640_1071	143
1665	3300047444	Ga0495675_0000203	Ga0495675_0000203_14594_15049	143
1666	3300047444	Ga0495675_0041119	Ga0495675_0041119_1376_1807	143
1667	3300047444	Ga0495675_0402460	Ga0495675_0402460_185_616	143
1668	3300047445	Ga0495677_0073687	Ga0495677_0073687_77_508	143
1669	3300047446	Ga0495679_090808	Ga0495679_090808_67_498	143
1670	3300047471	Ga0495684_0000025	Ga0495684_0000025_111962_112417	143
1671	3300047471	Ga0495684_0001009	Ga0495684_0001009_13586_14017	143
1672	3300047471	Ga0495684_0243736	Ga0495684_0243736_96_527	143
1673	3300047673	Ga0495593_0005838	Ga0495593_0005838_2026_2457	143
1674	3300047673	Ga0495593_0005893	Ga0495593_0005893_3130_3585	143
1675	3300047673	Ga0495593_0006282	Ga0495593_0006282_6309_6740	143
1676	3300047673	Ga0495593_0162172	Ga0495593_0162172_139_570	143
1677	3300048088	Ga0495602_0000097	Ga0495602_0000097_66510_66965	143
1678	3300048088	Ga0495602_0011391	Ga0495602_0011391_7419_7850	143
1679	3300048089	Ga0495614_0010246	Ga0495614_0010246_3564_3995	143
1680	3300048903	Ga0496100_0000345	Ga0496100_0000345_9179_9610	143
1681	3300048904	Ga0496101_0000866	Ga0496101_0000866_4620_5051	143
1682	3300048904	Ga0496101_0264974	Ga0496101_0264974_399_830	143
1683	3300048904	Ga0496101_0361872	Ga0496101_0361872_688_1119	143
1684	3300048905	Ga0496102_0001833	Ga0496102_0001833_5867_6298	143
1685	3300048905	Ga0496102_0176799	Ga0496102_0176799_361_792	143
1686	3300048905	Ga0496102_0803992	Ga0496102_0803992_410_841	143
1687	3300048906	Ga0496103_0001022	Ga0496103_0001022_6428_6859	143
1688	3300048906	Ga0496103_0059644	Ga0496103_0059644_415_846	143
1689	3300048906	Ga0496103_0289134	Ga0496103_0289134_313_744	143
1690	3300048907	Ga0496104_0000399	Ga0496104_0000399_23076_23507	143
1691	3300048907	Ga0496104_0000877	Ga0496104_0000877_6747_7181	143
1692	3300048907	Ga0496104_0104480	Ga0496104_0104480_1877_2308	143
1693	3300048907	Ga0496104_0255158	Ga0496104_0255158_1040_1471	143
1694	3300048908	Ga0496105_0144647	Ga0496105_0144647_951_1382	143
1695	3300048908	Ga0496105_0213483	Ga0496105_0213483_121_555	143
1696	3300048908	Ga0496105_0341514	Ga0496105_0341514_232_663	143
1697	3300048908	Ga0496105_1141381	Ga0496105_1141381_22_453	143
1698	3300048909	Ga0496106_0002528	Ga0496106_0002528_4306_4737	143
1699	3300048909	Ga0496106_0014492	Ga0496106_0014492_739_1170	143
1700	3300048909	Ga0496106_0166826	Ga0496106_0166826_925_1356	143
1701	3300048910	Ga0496107_0002539	Ga0496107_0002539_5996_6427	143
1702	3300048910	Ga0496107_0039645	Ga0496107_0039645_1747_2178	143
1703	3300048910	Ga0496107_0113078	Ga0496107_0113078_797_1228	143
1704	3300048910	Ga0496107_0176722	Ga0496107_0176722_972_1403	143
1705	3300048911	Ga0496108_0003711	Ga0496108_0003711_6768_7199	143
1706	3300048911	Ga0496108_0009384	Ga0496108_0009384_306_737	143
1707	3300048911	Ga0496108_0117709	Ga0496108_0117709_1342_1773	143
1708	3300048911	Ga0496108_0382743	Ga0496108_0382743_776_1207	143
1709	3300048911	Ga0496108_0791657	Ga0496108_0791657_151_585	143
1710	3300048912	Ga0496109_0002269	Ga0496109_0002269_11387_11818	143
1711	3300048912	Ga0496109_0044281	Ga0496109_0044281_889_1320	143
1712	3300048913	Ga0496110_0019741	Ga0496110_0019741_423_854	143
1713	3300048913	Ga0496110_0068875	Ga0496110_0068875_2680_3111	143
1714	3300048913	Ga0496110_0271704	Ga0496110_0271704_357_788	143
1715	3300048914	Ga0496111_0008486	Ga0496111_0008486_4892_5323	143
1716	3300048914	Ga0496111_0135867	Ga0496111_0135867_1012_1443	143
1717	3300048915	Ga0496112_0003321	Ga0496112_0003321_10657_11088	143
1718	3300048915	Ga0496112_0369642	Ga0496112_0369642_923_1354	143
1719	3300048915	Ga0496112_0463092	Ga0496112_0463092_275_706	143
1720	3300048916	Ga0496113_0015982	Ga0496113_0015982_3887_4318	143
1721	3300048916	Ga0496113_0019559	Ga0496113_0019559_3428_3859	143
1722	3300048916	Ga0496113_0148667	Ga0496113_0148667_1070_1504	143
1723	3300048916	Ga0496113_0285694	Ga0496113_0285694_415_846	143
1724	3300048917	Ga0496114_0077790	Ga0496114_0077790_1818_2249	143
1725	3300048917	Ga0496114_0106099	Ga0496114_0106099_984_1415	143
1726	3300048918	Ga0496115_0007162	Ga0496115_0007162_3696_4127	143
1727	3300048918	Ga0496115_0014002	Ga0496115_0014002_415_846	143
1728	3300048918	Ga0496115_0257948	Ga0496115_0257948_959_1390	143
1729	3300048918	Ga0496115_0392748	Ga0496115_0392748_621_1055	143
1730	3300048918	Ga0496115_0784717	Ga0496115_0784717_287_718	143
1731	3300048924	Ga0496121_0395355	Ga0496121_0395355_398_829	143
1732	3300049568	Ga0501031_0089158	Ga0501031_0089158_333_764	143
1733	3300049570	Ga0501033_0162832	Ga0501033_0162832_832_1263	143
1734	3300049571	Ga0501034_0164528	Ga0501034_0164528_410_841	143
1735	3300049571	Ga0501034_0396800	Ga0501034_0396800_428_859	143
1736	3300049572	Ga0501036_0006277	Ga0501036_0006277_1826_2257	143
1737	3300049572	Ga0501036_0289151	Ga0501036_0289151_407_838	143
1738	3300049573	Ga0501037_0005033	Ga0501037_0005033_7359_7790	143
1739	3300049573	Ga0501037_0217006	Ga0501037_0217006_591_1022	143
1740	3300049574	Ga0501038_0009647	Ga0501038_0009647_5178_5609	143
1741	3300049574	Ga0501038_0188711	Ga0501038_0188711_289_720	143
1742	3300049574	Ga0501038_0301119	Ga0501038_0301119_22_453	143
1743	3300049575	Ga0501039_0015523	Ga0501039_0015523_106_537	143
1744	3300049578	Ga0501042_0284530	Ga0501042_0284530_94_525	143
1745	3300049579	Ga0501043_0018192	Ga0501043_0018192_1372_1803	143
1746	3300049580	Ga0501046_0021621	Ga0501046_0021621_3247_3678	143
1747	3300049581	Ga0501047_0018326	Ga0501047_0018326_3247_3678	143
1748	3300049581	Ga0501047_0234259	Ga0501047_0234259_23_454	143
1749	3300049582	Ga0501048_0001942	Ga0501048_0001942_5728_6159	143
1750	3300049582	Ga0501048_1178055	Ga0501048_1178055_34_465	143
1751	3300049583	Ga0501067_0020601	Ga0501067_0020601_2157_2588	143
1752	3300049584	Ga0501068_0045969	Ga0501068_0045969_1698_2129	143
1753	3300049585	Ga0501069_0004632	Ga0501069_0004632_5350_5781	143
1754	3300049585	Ga0501069_0155597	Ga0501069_0155597_490_921	143
1755	3300049585	Ga0501069_0406166	Ga0501069_0406166_28_459	143
1756	3300049586	Ga0501070_0055589	Ga0501070_0055589_2537_2968	143
1757	3300049586	Ga0501070_0058346	Ga0501070_0058346_1025_1456	143
1758	3300049587	Ga0501071_0118739	Ga0501071_0118739_450_881	143
1759	3300049588	Ga0501072_1562509	Ga0501072_1562509_13_444	143
1760	3300049589	Ga0501073_0006036	Ga0501073_0006036_5358_5789	143
1761	3300049589	Ga0501073_0173804	Ga0501073_0173804_402_845	143
1762	3300049589	Ga0501073_0577110	Ga0501073_0577110_184_615	143
1763	3300049589	Ga0501073_0603619	Ga0501073_0603619_277_708	143
1764	3300049590	Ga0501074_0008431	Ga0501074_0008431_3254_3685	143
1765	3300049590	Ga0501074_0718808	Ga0501074_0718808_50_484	143
1766	3300049592	Ga0501076_0032903	Ga0501076_0032903_1703_2134	143
1767	3300049592	Ga0501076_0739393	Ga0501076_0739393_138_572	143
1768	3300049593	Ga0501077_0318577	Ga0501077_0318577_537_968	143
1769	3300049741	Ga0501079_0026251	Ga0501079_0026251_1084_1515	143
1770	3300049741	Ga0501079_0373286	Ga0501079_0373286_35_466	143
1771	3300049741	Ga0501079_0394953	Ga0501079_0394953_435_869	143
1772	3300049742	Ga0501080_0002877	Ga0501080_0002877_7417_7848	143
1773	3300049743	Ga0501081_0018544	Ga0501081_0018544_3988_4419	143
1774	3300049744	Ga0501083_0013341	Ga0501083_0013341_4072_4503	143
1775	3300049822	Ga0501035_0028257	Ga0501035_0028257_1530_1961	143
1776	3300049822	Ga0501035_0900453	Ga0501035_0900453_182_613	143
1777	3300049823	Ga0501044_0000222	Ga0501044_0000222_32926_33357	143
1778	3300049823	Ga0501044_0032851	Ga0501044_0032851_3494_3925	143
1779	3300049824	Ga0501045_0028002	Ga0501045_0028002_299_730	143
1780	3300050489	nmdc:mga03683_80179_c1	nmdc:mga03683_80179_c1_150_581	143
1781	3300050490	nmdc:mga03n38_456252_c1	nmdc:mga03n38_456252_c1_256_687	143
1782	3300050491	nmdc:mga00v17_37044_c1	nmdc:mga00v17_37044_c1_2344_2775	143
1783	3300050493	nmdc:mga0k408_103646_c1	nmdc:mga0k408_103646_c1_1076_1507	143
1784	3300050494	nmdc:mga06z11_175512_c1	nmdc:mga06z11_175512_c1_591_1022	143
1785	3300050494	nmdc:mga06z11_337521_c1	nmdc:mga06z11_337521_c1_422_853	143
1786	3300050496	nmdc:mga07m45_2489_c2	nmdc:mga07m45_2489_c2_3000_3431	143
1787	3300050496	nmdc:mga07m45_24989_c1	nmdc:mga07m45_24989_c1_2617_3048	143
1788	3300050507	nmdc:mga05p37_1975_c1	nmdc:mga05p37_1975_c1_1180_1611	143
1789	3300050507	nmdc:mga05p37_893783_c1	nmdc:mga05p37_893783_c1_213_644	143
1790	3300050508	nmdc:mga09592_1370_c1	nmdc:mga09592_1370_c1_766_1197	143
1791	3300050509	nmdc:mga0qj67_969_c1	nmdc:mga0qj67_969_c1_14179_14610	143
1792	3300050510	nmdc:mga06r32_638_c1	nmdc:mga06r32_638_c1_19751_20182	143
1793	3300050511	nmdc:mga08y16_1126520_c1	nmdc:mga08y16_1126520_c1_130_561	143
1794	3300050511	nmdc:mga08y16_3117_c1	nmdc:mga08y16_3117_c1_12471_12902	143
1795	3300050511	nmdc:mga08y16_333_c1	nmdc:mga08y16_333_c1_9167_9598	143
1796	3300050511	nmdc:mga08y16_549_c1	nmdc:mga08y16_549_c1_20147_20578	143
1797	3300050512	nmdc:mga0n895_1174_c1	nmdc:mga0n895_1174_c1_10299_10730	143
1798	3300050512	nmdc:mga0n895_127923_c1	nmdc:mga0n895_127923_c1_746_1177	143
1799	3300050512	nmdc:mga0n895_159244_c1	nmdc:mga0n895_159244_c1_1180_1611	143
1800	3300050512	nmdc:mga0n895_1864573_c1	nmdc:mga0n895_1864573_c1_34_468	143
1801	3300050512	nmdc:mga0n895_418422_c1	nmdc:mga0n895_418422_c1_764_1195	143
1802	3300050513	nmdc:mga0rr50_121755_c1	nmdc:mga0rr50_121755_c1_688_1119	143
1803	3300050513	nmdc:mga0rr50_177346_c1	nmdc:mga0rr50_177346_c1_567_998	143
1804	3300050513	nmdc:mga0rr50_20520_c1	nmdc:mga0rr50_20520_c1_3851_4282	143
1805	3300050513	nmdc:mga0rr50_246623_c1	nmdc:mga0rr50_246623_c1_517_948	143
1806	3300050514	nmdc:mga08x19_152157_c1	nmdc:mga08x19_152157_c1_819_1250	143
1807	3300050514	nmdc:mga08x19_152425_c1	nmdc:mga08x19_152425_c1_114_545	143
1808	3300050515	nmdc:mga0a205_11094_c1	nmdc:mga0a205_11094_c1_113_544	143
1809	3300050515	nmdc:mga0a205_313758_c1	nmdc:mga0a205_313758_c1_690_1121	143
1810	3300050515	nmdc:mga0a205_745_c1	nmdc:mga0a205_745_c1_20800_21231	143
1811	3300050515	nmdc:mga0a205_809912_c1	nmdc:mga0a205_809912_c1_62_493	143
1812	3300050516	nmdc:mga0sz30_139834_c1	nmdc:mga0sz30_139834_c1_280_711	143
1813	3300053077	Ga0495601_0000025	Ga0495601_0000025_14599_15054	143
1814	3300053077	Ga0495601_0002429	Ga0495601_0002429_3581_4012	143
1815	3300053077	Ga0495601_0015608	Ga0495601_0015608_2864_3295	143
1816	3300053077	Ga0495601_0033390	Ga0495601_0033390_69_500	143
1817	3300053078	Ga0495612_0000052	Ga0495612_0000052_51654_52109	143
1818	3300053078	Ga0495612_0003265	Ga0495612_0003265_5306_5737	143
1819	3300053084	Ga0495595_0000041	Ga0495595_0000041_51797_52252	143
1820	3300053084	Ga0495595_0003749	Ga0495595_0003749_567_998	143
1821	3300053084	Ga0495595_0007744	Ga0495595_0007744_2891_3322	143
1822	3300053084	Ga0495595_0157212	Ga0495595_0157212_184_615	143
1823	3300053084	Ga0495595_0325185	Ga0495595_0325185_152_583	143
1824	3300053085	Ga0495619_0000035	Ga0495619_0000035_14621_15076	143
1825	3300053085	Ga0495619_0000430	Ga0495619_0000430_25648_26079	143
1826	3300053085	Ga0495619_0001615	Ga0495619_0001615_7827_8258	143
1827	3300053085	Ga0495619_0003330	Ga0495619_0003330_9643_10074	143
1828	3300053085	Ga0495619_0109718	Ga0495619_0109718_831_1262	143
1829	3300053085	Ga0495619_0177532	Ga0495619_0177532_364_795	143
1830	3300053120	Ga0500597_168416	Ga0500597_168416_161_592	143
1831	3300053134	Ga0500658_0183479	Ga0500658_0183479_504_935	143
1832	3300054114	Ga0501084_0046145	Ga0501084_0046145_498_929	143
1833	3300054114	Ga0501084_0266259	Ga0501084_0266259_38_469	143
1834	3300059477	Ga0587084_068909	Ga0587084_068909_96_542	143
1835	3300060353	Ga0501082_0085662	Ga0501082_0085662_153_584	143
1836	3300060353	Ga0501082_0119601	Ga0501082_0119601_1471_1902	143
1837	3300060353	Ga0501082_0575178	Ga0501082_0575178_291_725	143
1838	3300060353	Ga0501082_1138811	Ga0501082_1138811_34_465	143
1839	3300061734	Ga0530510_1029242	Ga0530510_1029242_11_442	143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01196

Ribosomal_L17

Ribosomal protein L17

20

147

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4v4p-assembly1.cif.gz_A0	crystal structure of 70s ribosome with thrs operator and trnas.	0.9564	15	116
4v48-assembly1.cif.gz_AL	real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome	0.948	19	116
7p7q-assembly1.cif.gz_Q	e. faecalis 70s ribosome bound by poxta-eq2, high-resolution combined volume	0.9399	8	116
6ddd-assembly1.cif.gz_Z	structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-5	0.939	8	116
7as8-assembly1.cif.gz_R	bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo	0.937	8	116

ID	Description	Score	Start	End	Superfamily
1vt2N01	Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17	0.975	13	115	3.90.1030.10
1vt2N01	Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17	0.9658	13	115	3.90.1030.10
1vs8N01	Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17	0.9629	15	115	3.90.1030.10
1vs8N01	Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17	0.9359	15	115	3.90.1030.10
af_Q9W0S6_31_138_3.90.1030.10	Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17	0.917	20	118	3.90.1030.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2D8ZND3-F1-model_v4	50S ribosomal protein L17	0.9981	20	126	GO:0003735 GO:0006412 GO:0022625
AF-A0A836VM16-F1-model_v4	50S ribosomal protein L17	0.9947	16	126	GO:0003735 GO:0006412 GO:0022625
AF-A0A662XWL3-F1-model_v4	Ribosomal protein L17	0.9919	24	119	GO:0003735 GO:0006412 GO:0022625
AF-A0A2E8AKT5-F1-model_v4	50S ribosomal protein L17	0.9877	20	129	GO:0003735 GO:0006412 GO:0022625
AF-W0AJZ6-F1-model_v4	50S ribosomal protein L17	0.9867	24	134	GO:0003735 GO:0006412 GO:0022625

Feature Viewer

pLDDT	pTM	Quality
84.98	0.75	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495859

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01196

Ribosomal_L17

Ribosomal protein L17

20

147

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map