F495802

General Info

Members Datasets Scaffolds Average Seq Length
1822 488 1782 256

Family's Representative Sequence

Representative Sequence 3300026088|Ga0207641_10638083|Ga0207641_106380832
Length 275
Sequence MDFDDLLFQTNILLRDFPDVLLKYQDKFRYIEEGEGEPLVLLHGLFGALSNFKDLIEYFRHHNKVVVPMLPLFELDILHTSVGGLAKFVHRFIESRGYRDVHLMGNSLGGHVALIHILKHPERIKSLILTGSSGLFENGMGDSYPKRGDYDYIKRKTELTFYDPKMATKELVDEIFEITNNRLKVIKTIALAKSAIRNNLGEELNQIKQPTLLVWGNNDTITPPFVAREFNRLIPNSELHFIDKCGHAPMMEVPDEFNTILHKFLKKQNEPATVA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2738541278 Niastella sp. CF465 Isolate Unclassified
6 2738541283 Pedobacter sp. OK701 Isolate Unclassified
7 2738541284 Pedobacter sp. YR016 Isolate Unclassified
8 2738541302 Pedobacter sp. CF074 Isolate Unclassified
9 2738543023 Pedobacter sp. OK628 Isolate Unclassified
10 2739367651 Pedobacter sp. OK291 Isolate Unclassified
11 2739367656 Pedobacter sp. CF523 Isolate Unclassified
12 2739367663 Pedobacter sp. YR510 Isolate Unclassified
13 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
14 2818991437 Pedobacter terrae 518 Isolate Unclassified
15 2818991444 Filimonas endophytica 3197 Isolate Unclassified
16 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
17 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
18 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
19 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
20 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
21 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
22 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
23 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
24 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
25 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
26 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
27 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
28 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
29 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
30 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
31 2914759650 Rhizosphaericola mali Isolate Rhizosphere
32 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
33 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
34 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
35 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
36 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
37 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
38 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
39 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
40 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
41 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
42 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
43 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
44 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
45 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
46 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
47 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
48 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
49 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
50 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
51 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
54 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
55 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
56 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
57 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
58 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
65 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
66 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
75 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
76 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
77 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
78 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
79 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
80 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
81 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
82 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
83 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
84 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
85 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
86 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
87 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
88 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
89 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
90 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
91 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
94 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
95 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
96 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
97 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
98 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
99 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
100 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
101 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
102 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
103 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
104 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
105 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
106 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
107 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
108 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
109 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
114 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
115 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
116 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
117 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
118 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
119 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
120 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
121 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
122 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
123 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
124 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
125 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
126 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
127 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
128 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
129 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
130 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
131 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
132 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
133 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
138 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
139 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
140 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
141 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
142 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
143 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
160 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
164 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
165 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
169 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
170 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
171 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
172 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
173 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
174 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
175 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
176 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
177 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
178 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
179 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
183 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
184 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
186 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
187 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
188 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
189 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
190 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
191 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
192 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
193 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
198 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
199 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
201 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
261 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
265 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
266 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
267 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
268 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
269 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
270 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
271 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
272 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
273 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
274 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
275 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
276 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
277 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
278 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
279 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
280 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
281 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
282 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
283 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
284 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
285 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
286 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
287 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
288 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
289 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
290 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
291 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
292 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
293 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
294 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
296 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
297 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
298 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
299 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
300 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
301 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
302 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
303 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
304 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
305 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
306 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
307 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
308 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
309 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
310 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
311 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
312 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
313 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
314 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
315 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
316 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
317 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
318 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
319 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
320 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
321 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
322 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
323 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
324 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
325 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
326 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
327 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
328 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
329 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
330 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
331 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
332 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
333 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
334 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
335 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
336 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
337 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
338 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
339 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
340 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
341 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
342 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
343 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
344 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
345 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
346 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
347 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
348 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
349 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
350 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
351 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
352 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
353 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
354 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
355 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
356 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
357 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
358 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
359 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
360 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
361 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
362 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
363 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
364 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
365 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
366 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
367 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
368 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
369 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
370 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
371 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
372 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
373 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
374 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
375 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
376 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
377 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
378 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
379 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
380 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
381 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
382 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
383 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
384 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
385 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
386 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
387 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
388 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
389 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
390 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
391 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
392 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
393 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
394 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
395 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
396 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
397 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
398 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
399 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
400 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
401 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
402 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
403 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
404 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
405 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
406 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
407 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
408 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
409 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
424 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
425 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
426 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
427 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
428 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
429 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
430 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
431 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
432 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
433 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
434 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
435 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
436 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
437 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
438 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
439 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
440 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
441 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
444 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
445 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
446 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
447 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
448 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
449 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
450 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
451 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
452 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
453 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
454 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
455 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
456 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
457 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
458 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
459 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
460 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
461 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
462 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
463 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
464 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
465 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
466 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
467 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
468 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
469 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
470 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
471 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
472 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
473 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
474 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
475 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
476 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
477 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
478 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
479 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
480 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
481 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
482 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
483 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
484 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
485 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
486 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
488 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.26
Metatranscriptomes 0.49
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.38
Nodule 0
Rhizoplane 0.77
Rhizosphere 89.02
Stem 0
Stem Tuber 0
Unclassified 4.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_900390 2162886007 Bacteria 3160
2 ARcpr5yngRDRAFT_c004046 3300000043 Bacteria 1403
3 JGI24736J21556_1011832 3300001904 Bacteria 1417
4 JGI24735J21928_10000013 3300002067 Bacteria 208663
5 JGI24744J21845_10004274 3300002077 Bacteria 2948
6 JGI24744J21845_10007841 3300002077 Bacteria 2204
7 JGI24751J29686_10000514 3300002459 Bacteria 11195
8 JGI25162J39368_1000011 3300002737 Bacteria 379156
9 JGI25162J39368_1000107 3300002737 Bacteria 90782
10 JGI25162J39368_1001539 3300002737 Bacteria 11872
11 JGI25150J39212_1000014 3300002774 Bacteria 170955
12 JGI25159J45721_1031796 3300002987 Unclassified 841
13 JGI25151J46595_10000042 3300003187 Bacteria 170955
14 JGI25165J46597_1000157 3300003214 Bacteria 108987
15 JGI25153J46596_10000009 3300003215 Bacteria 340925
16 rootH1_10057698 3300003316 Bacteria 4718
17 rootH1_10069966 3300003316 Bacteria 11095
18 rootH1_10072769 3300003316 Bacteria 2126
19 rootH2_10005336 3300003320 Bacteria 90063
20 rootH2_10089486 3300003320 Bacteria 11519
21 rootH2_10135214 3300003320 Bacteria 1020
22 rootH2_10135408 3300003320 Bacteria 8807
23 rootH2_10239708 3300003320 Bacteria 3298
24 rootL2_10011714 3300003322 Bacteria 7320
25 rootL2_10034522 3300003322 Bacteria 1219
26 rootL2_10062555 3300003322 Bacteria 13427
27 rootL2_10072205 3300003322 Bacteria 3733
28 rootL2_10082704 3300003322 Unclassified 1177
29 rootL2_10242251 3300003322 Bacteria 2836
30 rootL2_10291845 3300003322 Bacteria 1848
31 rootH1_10045017 3300003323 Bacteria 20986
32 rootH1_10055568 3300003316 Bacteria 3133
33 rootH1_10055568 3300003323 Bacteria 17832
34 rootH1_10067100 3300003323 Unclassified 1783
35 rootH1_10122117 3300003323 Bacteria 6475
36 rootH1_10160751 3300003323 Bacteria 5256
37 rootH1_10163117 3300003323 Bacteria 3031
38 rootH1_10176161 3300003323 Bacteria 1179
39 rootH1_10323063 3300003323 Unclassified 1415
40 JGI25160J50197_1001629 3300003354 Bacteria 11019
41 JGI25160J50197_1011154 3300003354 Unclassified 3204
42 Ga0055536_1000019 3300003781 Bacteria 203087
43 Ga0055530_10000770 3300003791 Bacteria 26722
44 Ga0058859_10680689 3300004798 Bacteria 1151
45 Ga0065165_1000861 3300005262 Bacteria 39684
46 Ga0065714_10003901 3300005288 Bacteria 12762
47 Ga0065714_10005215 3300005288 Bacteria 4077
48 Ga0065714_10010117 3300005288 Bacteria 2461
49 Ga0065714_10023653 3300005288 Bacteria 1307
50 Ga0065714_10072146 3300005288 Bacteria 3335
51 Ga0065714_10084798 3300005288 Bacteria 2170
52 Ga0065704_10000301 3300005289 Bacteria 42046
53 Ga0065704_10008634 3300005289 Bacteria 2581
54 Ga0065704_10111806 3300005289 Unclassified 1948
55 Ga0065704_10256341 3300005289 Bacteria 974
56 Ga0065712_10177389 3300005290 Bacteria 1210
57 Ga0065715_10095897 3300005293 Bacteria 3984
58 Ga0065715_10106495 3300005293 Bacteria 2818
59 Ga0065715_10172051 3300005293 Bacteria 1538
60 Ga0065707_10101033 3300005295 Unclassified 2889
61 Ga0070658_10000028 3300005327 Bacteria 157278
62 Ga0070658_10016538 3300005327 Bacteria 5903
63 Ga0070658_10039485 3300005327 Unclassified 3808
64 Ga0070658_10061402 3300005327 Bacteria 3062
65 Ga0070658_10119415 3300005327 Bacteria 2190
66 Ga0070658_10141055 3300005327 Bacteria 2013
67 Ga0070658_10340798 3300005327 Bacteria 1282
68 Ga0070676_10005029 3300005328 Bacteria 7006
69 Ga0070676_10005673 3300005328 Bacteria 6646
70 Ga0070676_10014015 3300005328 Bacteria 4399
71 Ga0070676_10014253 3300005328 Bacteria 4367
72 Ga0070676_10112938 3300005328 Bacteria 1694
73 Ga0070676_10182001 3300005328 Bacteria 1367
74 Ga0070683_100012644 3300005329 Bacteria 7338
75 Ga0070683_100024392 3300005329 Bacteria 5417
76 Ga0070683_100061333 3300005329 Unclassified 3497
77 Ga0070683_100068007 3300005329 Bacteria 3318
78 Ga0070683_100091702 3300005329 Unclassified 2853
79 Ga0070683_100508679 3300005329 Bacteria 1151
80 Ga0070690_100003978 3300005330 Bacteria 8171
81 Ga0070690_100080114 3300005330 Bacteria 2135
82 Ga0070690_100143156 3300005330 Bacteria 1624
83 Ga0070690_100251784 3300005330 Bacteria 1249
84 Ga0070690_100413144 3300005330 Unclassified 993
85 Ga0070670_100008722 3300005331 Bacteria 8653
86 Ga0070670_100021006 3300005331 Bacteria 5614
87 Ga0070670_100034177 3300005331 Unclassified 4376
88 Ga0070670_100060961 3300005331 Bacteria 3239
89 Ga0070670_100101396 3300005331 Bacteria 2478
90 Ga0070670_100110243 3300005331 Bacteria 2371
91 Ga0070670_100118791 3300005331 Bacteria 2280
92 Ga0070670_100212704 3300005331 Bacteria 1681
93 Ga0070670_100300395 3300005331 Bacteria 1404
94 Ga0070670_100305544 3300005331 Bacteria 1392
95 Ga0070677_10004025 3300005333 Bacteria 4774
96 Ga0070677_10035856 3300005333 Bacteria 1925
97 Ga0068869_100002953 3300005334 Bacteria 10326
98 Ga0068869_100003332 3300005334 Bacteria 9813
99 Ga0068869_100003776 3300005334 Bacteria 9329
100 Ga0068869_100004072 3300005334 Bacteria 9047
101 Ga0068869_100007583 3300005334 Bacteria 6942
102 Ga0068869_100010195 3300005334 Bacteria 6119
103 Ga0068869_100010840 3300005334 Bacteria 5960
104 Ga0068869_100071129 3300005334 Bacteria 2575
105 Ga0068869_100095762 3300005334 Unclassified 2240
106 Ga0068869_100132311 3300005334 Bacteria 1919
107 Ga0068869_100172610 3300005334 Unclassified 1690
108 Ga0068869_100209447 3300005334 Bacteria 1540
109 Ga0070666_10000106 3300005335 Bacteria 57218
110 Ga0070666_10002796 3300005335 Bacteria 10542
111 Ga0070666_10010770 3300005335 Bacteria 5722
112 Ga0070666_10027835 3300005335 Bacteria 3705
113 Ga0070666_10077510 3300005335 Bacteria 2269
114 Ga0070666_10139090 3300005335 Unclassified 1691
115 Ga0070666_10210467 3300005335 Bacteria 1369
116 Ga0070666_10223584 3300005335 Bacteria 1328
117 Ga0070680_100016902 3300005336 Bacteria 5743
118 Ga0070680_100079143 3300005336 Bacteria 2709
119 Ga0070680_100093643 3300005336 Unclassified 2489
120 Ga0070680_100139222 3300005336 Bacteria 2034
121 Ga0070682_100000019 3300005337 Bacteria 220844
122 Ga0070682_100009574 3300005337 Bacteria 5485
123 Ga0070682_100016818 3300005337 Bacteria 4256
124 Ga0070682_100043551 3300005337 Bacteria 2776
125 Ga0070682_100075427 3300005337 Bacteria 2169
126 Ga0070682_100337389 3300005337 Unclassified 1119
127 Ga0068868_100000112 3300005338 Bacteria 50817
128 Ga0068868_100006802 3300005338 Bacteria 8119
129 Ga0068868_100007286 3300005338 Bacteria 7868
130 Ga0068868_100012873 3300005338 Bacteria 6120
131 Ga0068868_100013907 3300005338 Bacteria 5918
132 Ga0068868_100019003 3300005338 Bacteria 5143
133 Ga0068868_100031334 3300005338 Bacteria 4084
134 Ga0068868_100055050 3300005338 Bacteria 3138
135 Ga0068868_100158563 3300005338 Bacteria 1867
136 Ga0068868_100179422 3300005338 Unclassified 1756
137 Ga0070660_100008501 3300005339 Bacteria 7183
138 Ga0070660_100024596 3300005339 Bacteria 4468
139 Ga0070660_100025079 3300005339 Bacteria 4430
140 Ga0070660_100030203 3300005339 Bacteria 4064
141 Ga0070660_100263205 3300005339 Bacteria 1408
142 Ga0070689_100019767 3300005340 Bacteria 4984
143 Ga0070689_100067244 3300005340 Bacteria 2793
144 Ga0070689_100124129 3300005340 Bacteria 2065
145 Ga0070691_10016281 3300005341 Unclassified 3416
146 Ga0070691_10079580 3300005341 Bacteria 1602
147 Ga0070687_100251787 3300005343 Unclassified 1098
148 Ga0070661_100007958 3300005344 Bacteria 7321
149 Ga0070661_100008722 3300005344 Bacteria 7018
150 Ga0070661_100034349 3300005344 Bacteria 3677
151 Ga0070661_100174991 3300005344 Unclassified 1631
152 Ga0070692_10128107 3300005345 Bacteria 1423
153 Ga0070692_10155983 3300005345 Bacteria 1304
154 Ga0070668_100000518 3300005347 Bacteria 25501
155 Ga0070668_100029487 3300005347 Bacteria 4168
156 Ga0070668_100044040 3300005347 Bacteria 3422
157 Ga0070668_100047046 3300005347 Bacteria 3316
158 Ga0070668_100087339 3300005347 Bacteria 2453
159 Ga0070668_100429418 3300005347 Bacteria 1132
160 Ga0070669_100007803 3300005353 Bacteria 7647
161 Ga0070669_100010226 3300005353 Bacteria 6665
162 Ga0070669_100039836 3300005353 Bacteria 3415
163 Ga0070669_100075618 3300005353 Bacteria 2498
164 Ga0070669_100182959 3300005353 Bacteria 1640
165 Ga0070669_100232433 3300005353 Unclassified 1462
166 Ga0070669_100234426 3300005353 Bacteria 1456
167 Ga0070675_100008660 3300005354 Bacteria 7900
168 Ga0070675_100039942 3300005354 Unclassified 3830
169 Ga0070675_100157982 3300005354 Bacteria 1948
170 Ga0070675_100807236 3300005354 Unclassified 858
171 Ga0070671_100012602 3300005355 Bacteria 6811
172 Ga0070671_100013595 3300005355 Bacteria 6565
173 Ga0070671_100023118 3300005355 Bacteria 5082
174 Ga0070671_100036023 3300005355 Bacteria 4102
175 Ga0070671_100046263 3300005355 Bacteria 3619
176 Ga0070671_100066579 3300005355 Bacteria 3002
177 Ga0070671_100107672 3300005355 Bacteria 2340
178 Ga0070671_100120675 3300005355 Unclassified 2206
179 Ga0070674_100010772 3300005356 Bacteria 5544
180 Ga0070674_100492620 3300005356 Bacteria 1019
181 Ga0070674_100525397 3300005356 Bacteria 989
182 Ga0070673_100000916 3300005364 Bacteria 16669
183 Ga0070673_100001100 3300005364 Bacteria 15481
184 Ga0070673_100001738 3300005364 Bacteria 12969
185 Ga0070673_100015805 3300005364 Bacteria 5316
186 Ga0070673_100022702 3300005364 Unclassified 4571
187 Ga0070673_100026755 3300005364 Bacteria 4265
188 Ga0070673_100029457 3300005364 Bacteria 4094
189 Ga0070673_100058990 3300005364 Bacteria 3037
190 Ga0070673_100189874 3300005364 Bacteria 1764
191 Ga0070673_100298128 3300005364 Unclassified 1418
192 Ga0070673_100408999 3300005364 Unclassified 1215
193 Ga0070688_100001727 3300005365 Bacteria 10890
194 Ga0070688_100069096 3300005365 Bacteria 2254
195 Ga0070688_100193069 3300005365 Bacteria 1420
196 Ga0070688_100200837 3300005365 Bacteria 1395
197 Ga0070659_100000648 3300005366 Bacteria 25427
198 Ga0070659_100007387 3300005366 Bacteria 7983
199 Ga0070659_100020487 3300005366 Bacteria 5024
200 Ga0070659_100033730 3300005366 Bacteria 3979
201 Ga0070659_100037729 3300005366 Bacteria 3767
202 Ga0070659_100051464 3300005366 Bacteria 3238
203 Ga0070659_100075065 3300005366 Bacteria 2694
204 Ga0070659_100135643 3300005366 Unclassified 2001
205 Ga0070659_100142698 3300005366 Unclassified 1950
206 Ga0070667_100001056 3300005367 Bacteria 25169
207 Ga0070667_100005421 3300005367 Bacteria 10659
208 Ga0070667_100017871 3300005367 Bacteria 5878
209 Ga0070667_100018530 3300005367 Bacteria 5775
210 Ga0070667_100023305 3300005367 Bacteria 5135
211 Ga0070667_100047560 3300005367 Bacteria 3609
212 Ga0070667_100057251 3300005367 Bacteria 3294
213 Ga0070667_100065006 3300005367 Unclassified 3097
214 Ga0070667_100113747 3300005367 Unclassified 2349
215 Ga0070667_100157688 3300005367 Unclassified 1997
216 Ga0070667_100311192 3300005367 Bacteria 1420
217 Ga0070667_100374647 3300005367 Bacteria 1292
218 Ga0070667_100655185 3300005367 Bacteria 970
219 Ga0070701_10226615 3300005438 Bacteria 1117
220 Ga0070700_100132413 3300005441 Bacteria 1684
221 Ga0070700_100454781 3300005441 Bacteria 975
222 Ga0070663_100019054 3300005455 Bacteria 4513
223 Ga0070663_100036245 3300005455 Bacteria 3426
224 Ga0070663_100589676 3300005455 Bacteria 933
225 Ga0070678_100010010 3300005456 Bacteria 5769
226 Ga0070678_100011580 3300005456 Bacteria 5447
227 Ga0070678_100031450 3300005456 Bacteria 3662
228 Ga0070678_100156646 3300005456 Bacteria 1841
229 Ga0070678_100197839 3300005456 Bacteria 1657
230 Ga0070678_100206875 3300005456 Unclassified 1623
231 Ga0070678_100265143 3300005456 Bacteria 1446
232 Ga0070678_100631427 3300005456 Bacteria 959
233 Ga0070662_100000014 3300005457 Bacteria 110124
234 Ga0070662_100003721 3300005457 Bacteria 9544
235 Ga0070662_100004869 3300005457 Bacteria 8519
236 Ga0070662_100010077 3300005457 Bacteria 6191
237 Ga0070662_100060152 3300005457 Bacteria 2769
238 Ga0070662_100082916 3300005457 Unclassified 2392
239 Ga0070662_100094047 3300005457 Bacteria 2256
240 Ga0070662_100167404 3300005457 Bacteria 1723
241 Ga0070662_100196833 3300005457 Unclassified 1597
242 Ga0070662_100725614 3300005457 Bacteria 842
243 Ga0070681_10026227 3300005458 Bacteria 5858
244 Ga0070681_10040908 3300005458 Bacteria 4644
245 Ga0070681_10042951 3300005458 Bacteria 4529
246 Ga0070681_10269908 3300005458 Bacteria 1613
247 Ga0070681_10327177 3300005458 Unclassified 1442
248 Ga0070681_10333205 3300005458 Bacteria 1427
249 Ga0068867_100003104 3300005459 Bacteria 11707
250 Ga0068867_100004645 3300005459 Bacteria 9662
251 Ga0068867_100006101 3300005459 Bacteria 8530
252 Ga0068867_100016823 3300005459 Bacteria 5197
253 Ga0068867_100059953 3300005459 Bacteria 2822
254 Ga0068867_100074124 3300005459 Bacteria 2550
255 Ga0068867_100080230 3300005459 Bacteria 2457
256 Ga0068867_100091712 3300005459 Unclassified 2307
257 Ga0068867_100108638 3300005459 Unclassified 2128
258 Ga0068867_100121853 3300005459 Bacteria 2017
259 Ga0068867_100121971 3300005459 Unclassified 2016
260 Ga0068867_100249064 3300005459 Bacteria 1444
261 Ga0068867_100291561 3300005459 Unclassified 1342
262 Ga0068867_100448211 3300005459 Unclassified 1099
263 Ga0070685_10018286 3300005466 Bacteria 3767
264 Ga0070685_10028761 3300005466 Unclassified 3083
265 Ga0070685_10041717 3300005466 Bacteria 2616
266 Ga0070685_10047750 3300005466 Unclassified 2463
267 Ga0070685_10091132 3300005466 Bacteria 1845
268 Ga0070685_10211309 3300005466 Bacteria 1267
269 Ga0070685_10275069 3300005466 Unclassified 1125
270 Ga0070707_100156482 3300005468 Unclassified 2220
271 Ga0070698_100004078 3300005471 Bacteria 16046
272 Ga0070698_100004771 3300005471 Bacteria 14879
273 Ga0070698_100150268 3300005471 Bacteria 2277
274 Ga0070698_100150886 3300005471 Unclassified 2272
275 Ga0070698_100153895 3300005471 Bacteria 2245
276 Ga0070679_100000398 3300005530 Bacteria 37016
277 Ga0070679_100000665 3300005530 Bacteria 29299
278 Ga0070679_100009345 3300005530 Bacteria 9269
279 Ga0070679_100015562 3300005530 Bacteria 7309
280 Ga0070679_100023731 3300005530 Bacteria 6009
281 Ga0070679_100036142 3300005530 Unclassified 4901
282 Ga0070679_100207788 3300005530 Bacteria 1922
283 Ga0070679_100266331 3300005530 Bacteria 1668
284 Ga0070684_100010524 3300005535 Bacteria 7331
285 Ga0070684_100019072 3300005535 Bacteria 5669
286 Ga0070684_100038020 3300005535 Bacteria 4132
287 Ga0070684_100246944 3300005535 Bacteria 1631
288 Ga0070684_100446368 3300005535 Bacteria 1195
289 Ga0068853_100000765 3300005539 Bacteria 22316
290 Ga0068853_100003733 3300005539 Bacteria 11684
291 Ga0068853_100005178 3300005539 Bacteria 10198
292 Ga0068853_100008103 3300005539 Bacteria 8433
293 Ga0068853_100009588 3300005539 Bacteria 7802
294 Ga0068853_100013232 3300005539 Bacteria 6734
295 Ga0068853_100015866 3300005539 Bacteria 6187
296 Ga0068853_100021279 3300005539 Bacteria 5405
297 Ga0068853_100034294 3300005539 Bacteria 4308
298 Ga0068853_100043349 3300005539 Bacteria 3849
299 Ga0068853_100051118 3300005539 Bacteria 3557
300 Ga0068853_100055941 3300005539 Bacteria 3401
301 Ga0068853_100079204 3300005539 Bacteria 2873
302 Ga0068853_100081751 3300005539 Bacteria 2829
303 Ga0068853_100113513 3300005539 Bacteria 2409
304 Ga0068853_100131697 3300005539 Unclassified 2239
305 Ga0068853_100140342 3300005539 Unclassified 2169
306 Ga0068853_100140592 3300005539 Bacteria 2167
307 Ga0068853_100146098 3300005539 Unclassified 2125
308 Ga0068853_100156483 3300005539 Bacteria 2054
309 Ga0068853_100163298 3300005539 Bacteria 2011
310 Ga0068853_100176648 3300005539 Bacteria 1935
311 Ga0068853_100198696 3300005539 Bacteria 1824
312 Ga0070672_100000020 3300005543 Bacteria 69277
313 Ga0070672_100010475 3300005543 Bacteria 6430
314 Ga0070672_100017526 3300005543 Bacteria 5158
315 Ga0070672_100040151 3300005543 Bacteria 3588
316 Ga0070672_100144244 3300005543 Unclassified 1966
317 Ga0070672_100154946 3300005543 Unclassified 1897
318 Ga0070672_100352143 3300005543 Bacteria 1255
319 Ga0070672_100493660 3300005543 Bacteria 1058
320 Ga0070686_100052359 3300005544 Bacteria 2603
321 Ga0070686_100069177 3300005544 Unclassified 2305
322 Ga0070686_100092819 3300005544 Unclassified 2022
323 Ga0070686_100220174 3300005544 Unclassified 1371
324 Ga0070686_100251170 3300005544 Unclassified 1292
325 Ga0070686_100261922 3300005544 Unclassified 1268
326 Ga0070696_100185057 3300005546 Bacteria 1547
327 Ga0070693_100193804 3300005547 Bacteria 1316
328 Ga0070665_100000032 3300005548 Bacteria 333352
329 Ga0070665_100004608 3300005548 Bacteria 14413
330 Ga0070665_100009875 3300005548 Bacteria 9649
331 Ga0070665_100036978 3300005548 Bacteria 4910
332 Ga0070665_100281435 3300005548 Unclassified 1665
333 Ga0070704_100250240 3300005549 Unclassified 1455
334 Ga0068855_100000043 3300005563 Bacteria 149118
335 Ga0068855_100000517 3300005563 Bacteria 47550
336 Ga0068855_100003465 3300005563 Bacteria 19312
337 Ga0068855_100006600 3300005563 Bacteria 14106
338 Ga0068855_100007632 3300005563 Bacteria 13082
339 Ga0068855_100026529 3300005563 Bacteria 6931
340 Ga0068855_100037770 3300005563 Bacteria 5741
341 Ga0068855_100071980 3300005563 Bacteria 4019
342 Ga0068855_100077688 3300005563 Unclassified 3852
343 Ga0068855_100130689 3300005563 Unclassified 2868
344 Ga0068855_100131777 3300005563 Bacteria 2854
345 Ga0068855_100243761 3300005563 Bacteria 2007
346 Ga0068855_100255644 3300005563 Bacteria 1953
347 Ga0068855_100274720 3300005563 Bacteria 1873
348 Ga0070664_100004753 3300005564 Bacteria 10893
349 Ga0070664_100014024 3300005564 Bacteria 6536
350 Ga0070664_100025338 3300005564 Bacteria 4915
351 Ga0070664_100060340 3300005564 Unclassified 3229
352 Ga0070664_100064447 3300005564 Bacteria 3125
353 Ga0070664_100117547 3300005564 Unclassified 2325
354 Ga0070664_100168759 3300005564 Bacteria 1940
355 Ga0068857_100005247 3300005577 Bacteria 11033
356 Ga0068857_100019273 3300005577 Bacteria 5990
357 Ga0068857_100022072 3300005577 Bacteria 5600
358 Ga0068857_100046329 3300005577 Bacteria 3859
359 Ga0068857_100084855 3300005577 Bacteria 2830
360 Ga0068857_100093940 3300005577 Bacteria 2685
361 Ga0068857_100201857 3300005577 Bacteria 1813
362 Ga0068857_100239235 3300005577 Bacteria 1662
363 Ga0068857_100265379 3300005577 Bacteria 1577
364 Ga0068857_100418582 3300005577 Bacteria 1249
365 Ga0068854_100004832 3300005578 Bacteria 8502
366 Ga0068854_100014650 3300005578 Bacteria 5172
367 Ga0068854_100026428 3300005578 Bacteria 3990
368 Ga0068854_100061532 3300005578 Bacteria 2720
369 Ga0068854_100084423 3300005578 Bacteria 2350
370 Ga0068854_100117771 3300005578 Bacteria 2012
371 Ga0068854_100296895 3300005578 Bacteria 1306
372 Ga0068856_100000960 3300005614 Bacteria 30788
373 Ga0068856_100010180 3300005614 Bacteria 9141
374 Ga0068856_100010333 3300005614 Bacteria 9068
375 Ga0068856_100027529 3300005614 Bacteria 5545
376 Ga0068856_100050889 3300005614 Bacteria 4085
377 Ga0068856_100166108 3300005614 Bacteria 2218
378 Ga0070702_100015101 3300005615 Bacteria 3935
379 Ga0070702_100016189 3300005615 Unclassified 3822
380 Ga0068852_100000744 3300005616 Bacteria 21378
381 Ga0068852_100003125 3300005616 Bacteria 11534
382 Ga0068852_100011448 3300005616 Bacteria 6679
383 Ga0068852_100016745 3300005616 Bacteria 5728
384 Ga0068852_100025634 3300005616 Bacteria 4781
385 Ga0068852_100030572 3300005616 Unclassified 4436
386 Ga0068852_100039952 3300005616 Bacteria 3954
387 Ga0068852_100044878 3300005616 Bacteria 3757
388 Ga0068852_100046203 3300005616 Bacteria 3709
389 Ga0068852_100059484 3300005616 Unclassified 3314
390 Ga0068852_100060932 3300005616 Bacteria 3277
391 Ga0068852_100098257 3300005616 Bacteria 2636
392 Ga0068852_100290605 3300005616 Bacteria 1579
393 Ga0068852_100694246 3300005616 Unclassified 1027
394 Ga0068852_101032766 3300005616 Bacteria 841
395 Ga0068859_100000024 3300005617 Bacteria 217931
396 Ga0068859_100005138 3300005617 Bacteria 13287
397 Ga0068859_100011212 3300005617 Bacteria 9013
398 Ga0068859_100015329 3300005617 Bacteria 7698
399 Ga0068859_100017243 3300005617 Bacteria 7252
400 Ga0068859_100056651 3300005617 Bacteria 3946
401 Ga0068859_100077822 3300005617 Unclassified 3358
402 Ga0068859_100115801 3300005617 Bacteria 2745
403 Ga0068859_100163857 3300005617 Bacteria 2302
404 Ga0068859_100251807 3300005617 Bacteria 1857
405 Ga0068859_100307533 3300005617 Bacteria 1678
406 Ga0068859_100321072 3300005617 Unclassified 1642
407 Ga0068859_100364454 3300005617 Bacteria 1540
408 Ga0068859_100454948 3300005617 Bacteria 1376
409 Ga0068859_100583039 3300005617 Bacteria 1212
410 Ga0068864_100000392 3300005618 Bacteria 38124
411 Ga0068864_100001230 3300005618 Bacteria 21292
412 Ga0068864_100004478 3300005618 Bacteria 11483
413 Ga0068864_100010987 3300005618 Bacteria 7487
414 Ga0068864_100066233 3300005618 Bacteria 3135
415 Ga0068864_100078396 3300005618 Bacteria 2891
416 Ga0068864_100105531 3300005618 Bacteria 2504
417 Ga0068864_100144940 3300005618 Bacteria 2146
418 Ga0068864_100342511 3300005618 Bacteria 1409
419 Ga0068864_100801446 3300005618 Bacteria 926
420 Ga0068866_10003950 3300005718 Bacteria 6091
421 Ga0068866_10004497 3300005718 Bacteria 5715
422 Ga0068866_10026702 3300005718 Bacteria 2731
423 Ga0068866_10108849 3300005718 Bacteria 1542
424 Ga0068861_100001296 3300005719 Bacteria 15630
425 Ga0068861_100002876 3300005719 Bacteria 11343
426 Ga0068861_100011713 3300005719 Bacteria 6104
427 Ga0068861_100255305 3300005719 Bacteria 1498
428 Ga0068861_100745992 3300005719 Bacteria 914
429 Ga0068851_10002179 3300005834 Bacteria 8611
430 Ga0068851_10028869 3300005834 Unclassified 2742
431 Ga0068851_10033944 3300005834 Unclassified 2545
432 Ga0068851_10139084 3300005834 Bacteria 1319
433 Ga0068851_10236759 3300005834 Unclassified 1031
434 Ga0068870_10099579 3300005840 Bacteria 1640
435 Ga0068870_10161340 3300005840 Bacteria 1330
436 Ga0068863_100002032 3300005841 Bacteria 20050
437 Ga0068863_100041019 3300005841 Bacteria 4401
438 Ga0068863_100044019 3300005841 Bacteria 4238
439 Ga0068863_100081367 3300005841 Bacteria 3068
440 Ga0068863_100162063 3300005841 Unclassified 2143
441 Ga0068863_100176131 3300005841 Unclassified 2053
442 Ga0068863_100222387 3300005841 Bacteria 1819
443 Ga0068863_100355858 3300005841 Bacteria 1426
444 Ga0068863_100613425 3300005841 Bacteria 1077
445 Ga0068863_100637392 3300005841 Bacteria 1056
446 Ga0068858_100000342 3300005842 Bacteria 49465
447 Ga0068858_100001879 3300005842 Bacteria 21434
448 Ga0068858_100040620 3300005842 Bacteria 4315
449 Ga0068858_100073111 3300005842 Unclassified 3183
450 Ga0068858_100084635 3300005842 Bacteria 2950
451 Ga0068858_100242229 3300005842 Unclassified 1711
452 Ga0068858_100322335 3300005842 Unclassified 1477
453 Ga0068858_100341294 3300005842 Bacteria 1434
454 Ga0068858_100344609 3300005842 Unclassified 1426
455 Ga0068858_100376464 3300005842 Bacteria 1362
456 Ga0068860_100001341 3300005843 Bacteria 26789
457 Ga0068860_100001513 3300005843 Bacteria 25039
458 Ga0068860_100004887 3300005843 Bacteria 13659
459 Ga0068860_100008647 3300005843 Bacteria 10144
460 Ga0068860_100008887 3300005843 Bacteria 10010
461 Ga0068860_100012453 3300005843 Bacteria 8375
462 Ga0068860_100041777 3300005843 Unclassified 4381
463 Ga0068860_100056124 3300005843 Bacteria 3746
464 Ga0068860_100061958 3300005843 Bacteria 3554
465 Ga0068860_100145406 3300005843 Unclassified 2281
466 Ga0068860_100266244 3300005843 Bacteria 1672
467 Ga0068860_100302123 3300005843 Bacteria 1568
468 Ga0068860_100544434 3300005843 Bacteria 1162
469 Ga0068862_100001074 3300005844 Bacteria 26203
470 Ga0068862_100029514 3300005844 Bacteria 4621
471 Ga0068862_100481473 3300005844 Bacteria 1175
472 Ga0068862_100617136 3300005844 Bacteria 1043
473 Ga0081540_1002949 3300005983 Bacteria 13669
474 Ga0081539_10001169 3300005985 Bacteria 47510
475 Ga0070717_10230034 3300006028 Bacteria 1632
476 Ga0070715_10004258 3300006163 Bacteria 4670
477 Ga0070715_10023552 3300006163 Bacteria 2414
478 Ga0070716_100154275 3300006173 Unclassified 1481
479 Ga0075366_10001935 3300006195 Bacteria 10467
480 Ga0075366_10061467 3300006195 Bacteria 2232
481 Ga0075366_10249471 3300006195 Bacteria 1082
482 Ga0075366_10270045 3300006195 Bacteria 1039
483 Ga0075366_10352545 3300006195 Bacteria 903
484 Ga0097621_100000710 3300006237 Bacteria 23372
485 Ga0097621_100001338 3300006237 Bacteria 16956
486 Ga0097621_100004240 3300006237 Bacteria 9963
487 Ga0097621_100009001 3300006237 Bacteria 7226
488 Ga0097621_100012836 3300006237 Bacteria 6223
489 Ga0097621_100038073 3300006237 Bacteria 3859
490 Ga0097621_100138438 3300006237 Bacteria 2078
491 Ga0097621_100193520 3300006237 Unclassified 1762
492 Ga0097621_100251141 3300006237 Unclassified 1549
493 Ga0097621_100282872 3300006237 Bacteria 1460
494 Ga0097621_100300793 3300006237 Bacteria 1417
495 Ga0097621_100453595 3300006237 Bacteria 1155
496 Ga0068871_100000044 3300006358 Bacteria 67105
497 Ga0068871_100000294 3300006358 Bacteria 34890
498 Ga0068871_100008618 3300006358 Bacteria 7334
499 Ga0068871_100015163 3300006358 Bacteria 5761
500 Ga0068871_100024438 3300006358 Bacteria 4686
501 Ga0068871_100026066 3300006358 Bacteria 4557
502 Ga0068871_100026333 3300006358 Bacteria 4537
503 Ga0068871_100038510 3300006358 Bacteria 3820
504 Ga0068871_100232381 3300006358 Bacteria 1601
505 Ga0068871_100258066 3300006358 Unclassified 1520
506 Ga0068871_100341523 3300006358 Unclassified 1322
507 Ga0075428_100006050 3300006844 Bacteria 13444
508 Ga0075428_100161324 3300006844 Bacteria 2433
509 Ga0075428_100419177 3300006844 Unclassified 1434
510 Ga0075430_100001157 3300006846 Bacteria 21067
511 Ga0075430_100365311 3300006846 Unclassified 1192
512 Ga0075431_100003874 3300006847 Bacteria 14558
513 Ga0075431_100010980 3300006847 Bacteria 9115
514 Ga0075434_100109091 3300006871 Bacteria 2778
515 Ga0075429_100001234 3300006880 Bacteria 20728
516 Ga0075429_100019684 3300006880 Bacteria 5851
517 Ga0075429_100062699 3300006880 Bacteria 3239
518 Ga0068865_100000909 3300006881 Bacteria 16785
519 Ga0068865_100002711 3300006881 Bacteria 10509
520 Ga0068865_100003364 3300006881 Bacteria 9579
521 Ga0068865_100033276 3300006881 Bacteria 3451
522 Ga0068865_100185736 3300006881 Bacteria 1604
523 Ga0068865_100195359 3300006881 Bacteria 1568
524 Ga0068865_100205761 3300006881 Bacteria 1531
525 Ga0068865_100286916 3300006881 Bacteria 1312
526 Ga0068865_100326345 3300006881 Bacteria 1236
527 Ga0097620_100000024 3300006931 Bacteria 217931
528 Ga0097620_100005138 3300006931 Bacteria 13287
529 Ga0097620_100011212 3300006931 Bacteria 9013
530 Ga0097620_100015329 3300006931 Bacteria 7698
531 Ga0097620_100017242 3300006931 Bacteria 7252
532 Ga0097620_100056649 3300006931 Bacteria 3946
533 Ga0097620_100077818 3300006931 Unclassified 3358
534 Ga0097620_100115799 3300006931 Bacteria 2745
535 Ga0097620_100163864 3300006931 Bacteria 2302
536 Ga0097620_100251820 3300006931 Bacteria 1857
537 Ga0097620_100307525 3300006931 Bacteria 1678
538 Ga0097620_100321095 3300006931 Unclassified 1642
539 Ga0097620_100364462 3300006931 Bacteria 1540
540 Ga0097620_100454925 3300006931 Bacteria 1376
541 Ga0097620_100583096 3300006931 Bacteria 1212
542 Ga0105244_10089637 3300009036 Bacteria 1514
543 Ga0105240_10000103 3300009093 Bacteria 172981
544 Ga0105240_10000800 3300009093 Bacteria 56989
545 Ga0105240_10001677 3300009093 Bacteria 37580
546 Ga0105240_10001787 3300009093 Bacteria 36277
547 Ga0105240_10004962 3300009093 Bacteria 20004
548 Ga0105240_10018800 3300009093 Bacteria 9258
549 Ga0105240_10027308 3300009093 Bacteria 7475
550 Ga0105240_10065900 3300009093 Bacteria 4495
551 Ga0105240_10078823 3300009093 Bacteria 4055
552 Ga0105240_10084323 3300009093 Bacteria 3896
553 Ga0105240_10106027 3300009093 Bacteria 3410
554 Ga0105240_10144220 3300009093 Bacteria 2843
555 Ga0105240_10165337 3300009093 Bacteria 2625
556 Ga0105240_10204965 3300009093 Unclassified 2309
557 Ga0105240_10210860 3300009093 Bacteria 2270
558 Ga0105240_10394345 3300009093 Bacteria 1560
559 Ga0105240_10441456 3300009093 Bacteria 1458
560 Ga0105240_10686775 3300009093 Bacteria 1119
561 Ga0105240_10697802 3300009093 Bacteria 1108
562 Ga0111539_10000458 3300009094 Bacteria 51231
563 Ga0111539_10011561 3300009094 Bacteria 11079
564 Ga0111539_10244806 3300009094 Bacteria 2088
565 Ga0111539_10291175 3300009094 Bacteria 1900
566 Ga0105245_10062678 3300009098 Bacteria 3355
567 Ga0105245_10294763 3300009098 Bacteria 1590
568 Ga0105245_10303081 3300009098 Bacteria 1568
569 Ga0105245_10741268 3300009098 Bacteria 1018
570 Ga0105247_10011352 3300009101 Bacteria 5372
571 Ga0105247_10040947 3300009101 Bacteria 2833
572 Ga0105247_10073788 3300009101 Bacteria 2139
573 Ga0105247_10160789 3300009101 Bacteria 1487
574 Ga0114129_10011078 3300009147 Bacteria 12846
575 Ga0114129_10046449 3300009147 Bacteria 6102
576 Ga0114129_10117314 3300009147 Bacteria 3668
577 Ga0105243_10153696 3300009148 Bacteria 1977
578 Ga0105241_10000777 3300009174 Bacteria 24263
579 Ga0105241_10001809 3300009174 Bacteria 16223
580 Ga0105241_10002168 3300009174 Bacteria 14785
581 Ga0105241_10006662 3300009174 Bacteria 8499
582 Ga0105241_10061480 3300009174 Unclassified 2892
583 Ga0105241_10074809 3300009174 Bacteria 2638
584 Ga0105241_10122217 3300009174 Bacteria 2098
585 Ga0105241_10151185 3300009174 Bacteria 1899
586 Ga0105241_10706185 3300009174 Unclassified 921
587 Ga0105242_10010519 3300009176 Bacteria 7103
588 Ga0105242_10015262 3300009176 Bacteria 5966
589 Ga0105242_10023480 3300009176 Bacteria 4859
590 Ga0105242_10026092 3300009176 Bacteria 4629
591 Ga0105242_10026677 3300009176 Bacteria 4580
592 Ga0105242_10064176 3300009176 Bacteria 3026
593 Ga0105242_10151950 3300009176 Unclassified 2019
594 Ga0105242_10159749 3300009176 Bacteria 1971
595 Ga0105242_10365793 3300009176 Bacteria 1336
596 Ga0105242_10529103 3300009176 Unclassified 1126
597 Ga0105248_10045826 3300009177 Bacteria 4902
598 Ga0105248_10321779 3300009177 Unclassified 1742
599 Ga0105237_10000578 3300009545 Bacteria 51257
600 Ga0105237_10003264 3300009545 Bacteria 19375
601 Ga0105237_10005389 3300009545 Bacteria 14455
602 Ga0105237_10007421 3300009545 Bacteria 12004
603 Ga0105237_10007918 3300009545 Bacteria 11581
604 Ga0105237_10011343 3300009545 Bacteria 9430
605 Ga0105237_10014149 3300009545 Bacteria 8352
606 Ga0105237_10020903 3300009545 Bacteria 6738
607 Ga0105237_10027910 3300009545 Bacteria 5753
608 Ga0105237_10030381 3300009545 Bacteria 5488
609 Ga0105237_10035118 3300009545 Bacteria 5075
610 Ga0105237_10039752 3300009545 Bacteria 4747
611 Ga0105237_10158977 3300009545 Bacteria 2257
612 Ga0105237_10594553 3300009545 Bacteria 1113
613 Ga0105238_10000592 3300009551 Bacteria 38095
614 Ga0105238_10039464 3300009551 Bacteria 4788
615 Ga0105238_10042180 3300009551 Bacteria 4621
616 Ga0105238_10048733 3300009551 Bacteria 4268
617 Ga0105238_10074203 3300009551 Bacteria 3395
618 Ga0105249_10001375 3300009553 Bacteria 21278
619 Ga0105249_10001970 3300009553 Bacteria 17816
620 Ga0105249_10025557 3300009553 Bacteria 5317
621 Ga0105249_10026752 3300009553 Bacteria 5202
622 Ga0105249_10054779 3300009553 Bacteria 3647
623 Ga0105249_10059532 3300009553 Bacteria 3503
624 Ga0105249_10066344 3300009553 Bacteria 3322
625 Ga0105249_10074491 3300009553 Bacteria 3142
626 Ga0105249_10182862 3300009553 Bacteria 2041
627 Ga0105249_10245008 3300009553 Bacteria 1774
628 Ga0105249_10474469 3300009553 Bacteria 1293
629 Ga0105249_10614255 3300009553 Unclassified 1143
630 Ga0105239_10000001 3300010375 Bacteria 617353
631 Ga0105239_10000007 3300010375 Bacteria 385297
632 Ga0105239_10000180 3300010375 Bacteria 91772
633 Ga0105239_10000212 3300010375 Bacteria 85747
634 Ga0105239_10000352 3300010375 Bacteria 67522
635 Ga0105239_10000992 3300010375 Bacteria 39769
636 Ga0105239_10001405 3300010375 Bacteria 32195
637 Ga0105239_10007439 3300010375 Bacteria 12564
638 Ga0105239_10016055 3300010375 Bacteria 8287
639 Ga0105239_10056681 3300010375 Bacteria 4298
640 Ga0105239_10073160 3300010375 Bacteria 3768
641 Ga0105239_10076740 3300010375 Unclassified 3676
642 Ga0105239_10213948 3300010375 Bacteria 2161
643 Ga0105246_10051377 3300011119 Bacteria 2831
644 Ga0105246_10105345 3300011119 Bacteria 2061
645 Ga0105246_10409043 3300011119 Bacteria 1129
646 Ga0157373_10000245 3300013100 Bacteria 44563
647 Ga0157373_10002264 3300013100 Bacteria 14590
648 Ga0157373_10002904 3300013100 Bacteria 12977
649 Ga0157373_10003171 3300013100 Bacteria 12427
650 Ga0157373_10005746 3300013100 Bacteria 9286
651 Ga0157373_10011196 3300013100 Bacteria 6601
652 Ga0157373_10020458 3300013100 Bacteria 4810
653 Ga0157373_10026338 3300013100 Bacteria 4201
654 Ga0157373_10029204 3300013100 Bacteria 3974
655 Ga0157373_10080241 3300013100 Unclassified 2301
656 Ga0157373_10100605 3300013100 Unclassified 2034
657 Ga0157373_10106476 3300013100 Bacteria 1972
658 Ga0157373_10196846 3300013100 Bacteria 1420
659 Ga0157373_10355366 3300013100 Bacteria 1045
660 Ga0157371_10000418 3300013102 Bacteria 52571
661 Ga0157371_10000851 3300013102 Bacteria 34883
662 Ga0157371_10002731 3300013102 Bacteria 16625
663 Ga0157371_10002946 3300013102 Bacteria 15852
664 Ga0157371_10005012 3300013102 Bacteria 11348
665 Ga0157371_10008478 3300013102 Bacteria 8183
666 Ga0157371_10008985 3300013102 Bacteria 7902
667 Ga0157371_10012488 3300013102 Bacteria 6490
668 Ga0157371_10018679 3300013102 Bacteria 5123
669 Ga0157371_10041568 3300013102 Bacteria 3280
670 Ga0157371_10041592 3300013102 Bacteria 3279
671 Ga0157371_10054941 3300013102 Bacteria 2826
672 Ga0157371_10092815 3300013102 Unclassified 2139
673 Ga0157371_10105367 3300013102 Unclassified 2001
674 Ga0157371_10140079 3300013102 Unclassified 1723
675 Ga0157371_10173572 3300013102 Unclassified 1541
676 Ga0157371_10233015 3300013102 Bacteria 1324
677 Ga0157371_10321193 3300013102 Bacteria 1124
678 Ga0157371_10442554 3300013102 Bacteria 955
679 Ga0157371_10459164 3300013102 Bacteria 937
680 Ga0157370_10000197 3300013104 Bacteria 75846
681 Ga0157370_10001620 3300013104 Bacteria 27815
682 Ga0157370_10001816 3300013104 Bacteria 26328
683 Ga0157370_10002183 3300013104 Bacteria 23875
684 Ga0157370_10002188 3300013104 Bacteria 23838
685 Ga0157370_10006873 3300013104 Bacteria 12456
686 Ga0157370_10017062 3300013104 Bacteria 7336
687 Ga0157370_10030722 3300013104 Bacteria 5262
688 Ga0157370_10045646 3300013104 Bacteria 4202
689 Ga0157370_10060798 3300013104 Bacteria 3586
690 Ga0157370_10066900 3300013104 Bacteria 3397
691 Ga0157370_10079953 3300013104 Bacteria 3078
692 Ga0157370_10129166 3300013104 Bacteria 2358
693 Ga0157370_10144531 3300013104 Bacteria 2215
694 Ga0157370_10151989 3300013104 Bacteria 2154
695 Ga0157370_10173586 3300013104 Bacteria 2003
696 Ga0157370_10214603 3300013104 Bacteria 1783
697 Ga0157370_10367379 3300013104 Bacteria 1326
698 Ga0157369_10000031 3300013105 Bacteria 203214
699 Ga0157369_10020641 3300013105 Bacteria 7367
700 Ga0157369_10041671 3300013105 Bacteria 5011
701 Ga0157369_10041955 3300013105 Bacteria 4993
702 Ga0157369_10069522 3300013105 Unclassified 3783
703 Ga0157369_10120236 3300013105 Unclassified 2787
704 Ga0157369_10123745 3300013105 Bacteria 2743
705 Ga0157369_10194621 3300013105 Unclassified 2130
706 Ga0157369_10363349 3300013105 Bacteria 1503
707 Ga0157369_10486176 3300013105 Bacteria 1277
708 Ga0157369_10640308 3300013105 Bacteria 1097
709 Ga0157374_10000914 3300013296 Bacteria 25675
710 Ga0157374_10001221 3300013296 Bacteria 21951
711 Ga0157374_10008347 3300013296 Bacteria 8843
712 Ga0157374_10013769 3300013296 Bacteria 7064
713 Ga0157374_10024325 3300013296 Bacteria 5429
714 Ga0157374_10033177 3300013296 Bacteria 4709
715 Ga0157374_10052361 3300013296 Bacteria 3802
716 Ga0157374_10052861 3300013296 Bacteria 3786
717 Ga0157374_10056468 3300013296 Bacteria 3665
718 Ga0157374_10123615 3300013296 Bacteria 2500
719 Ga0157374_10204708 3300013296 Bacteria 1934
720 Ga0157374_10358487 3300013296 Bacteria 1450
721 Ga0157374_10471158 3300013296 Unclassified 1258
722 Ga0157374_10753713 3300013296 Bacteria 988
723 Ga0157378_10003529 3300013297 Bacteria 13868
724 Ga0157378_10014484 3300013297 Bacteria 6904
725 Ga0157378_10020345 3300013297 Bacteria 5838
726 Ga0157378_10027912 3300013297 Bacteria 4977
727 Ga0157378_10053119 3300013297 Bacteria 3607
728 Ga0157378_10070381 3300013297 Unclassified 3141
729 Ga0157378_10097250 3300013297 Bacteria 2683
730 Ga0157378_10108892 3300013297 Bacteria 2537
731 Ga0157378_10120313 3300013297 Unclassified 2419
732 Ga0157378_10132069 3300013297 Unclassified 2312
733 Ga0157378_10198577 3300013297 Bacteria 1896
734 Ga0157378_10356474 3300013297 Bacteria 1430
735 Ga0157378_10407866 3300013297 Bacteria 1340
736 Ga0163162_10000010 3300013306 Bacteria 302032
737 Ga0163162_10000093 3300013306 Bacteria 82738
738 Ga0163162_10000131 3300013306 Bacteria 67924
739 Ga0163162_10000154 3300013306 Bacteria 63581
740 Ga0163162_10000189 3300013306 Bacteria 56954
741 Ga0163162_10001288 3300013306 Bacteria 23443
742 Ga0163162_10001546 3300013306 Bacteria 21488
743 Ga0163162_10004949 3300013306 Bacteria 12838
744 Ga0163162_10010730 3300013306 Bacteria 8912
745 Ga0163162_10011210 3300013306 Bacteria 8739
746 Ga0163162_10011453 3300013306 Bacteria 8649
747 Ga0163162_10034902 3300013306 Bacteria 5007
748 Ga0163162_10107364 3300013306 Bacteria 2887
749 Ga0163162_10131816 3300013306 Bacteria 2608
750 Ga0163162_10133746 3300013306 Bacteria 2590
751 Ga0163162_10139229 3300013306 Unclassified 2539
752 Ga0163162_10399787 3300013306 Bacteria 1506
753 Ga0163162_10729791 3300013306 Bacteria 1111
754 Ga0163162_11081636 3300013306 Bacteria 908
755 Ga0157372_10000073 3300013307 Bacteria 107356
756 Ga0157372_10000173 3300013307 Bacteria 71416
757 Ga0157372_10002062 3300013307 Bacteria 21839
758 Ga0157372_10003396 3300013307 Bacteria 17186
759 Ga0157372_10013408 3300013307 Bacteria 8753
760 Ga0157372_10043627 3300013307 Bacteria 4966
761 Ga0157372_10046553 3300013307 Bacteria 4815
762 Ga0157372_10050546 3300013307 Bacteria 4624
763 Ga0157372_10052360 3300013307 Bacteria 4545
764 Ga0157372_10068835 3300013307 Bacteria 3980
765 Ga0157372_10086369 3300013307 Bacteria 3559
766 Ga0157372_10112740 3300013307 Bacteria 3116
767 Ga0157372_10140801 3300013307 Bacteria 2779
768 Ga0157372_10143555 3300013307 Bacteria 2753
769 Ga0157372_10154478 3300013307 Unclassified 2650
770 Ga0157372_10171083 3300013307 Bacteria 2513
771 Ga0157372_10177767 3300013307 Bacteria 2463
772 Ga0157372_10180428 3300013307 Bacteria 2444
773 Ga0157372_10208694 3300013307 Bacteria 2263
774 Ga0157372_10218144 3300013307 Unclassified 2211
775 Ga0157372_10247343 3300013307 Bacteria 2069
776 Ga0157372_10317509 3300013307 Bacteria 1814
777 Ga0157372_10401987 3300013307 Bacteria 1596
778 Ga0157372_10628770 3300013307 Bacteria 1251
779 Ga0157372_10799020 3300013307 Unclassified 1096
780 Ga0157372_10882867 3300013307 Bacteria 1038
781 Ga0157372_11045018 3300013307 Bacteria 945
782 Ga0157372_11287192 3300013307 Bacteria 844
783 Ga0157375_10000850 3300013308 Bacteria 26585
784 Ga0157375_10001388 3300013308 Bacteria 20910
785 Ga0157375_10001823 3300013308 Bacteria 18281
786 Ga0157375_10006292 3300013308 Bacteria 10341
787 Ga0157375_10006520 3300013308 Bacteria 10157
788 Ga0157375_10013251 3300013308 Bacteria 7331
789 Ga0157375_10021961 3300013308 Bacteria 5867
790 Ga0157375_10043902 3300013308 Bacteria 4338
791 Ga0157375_10071904 3300013308 Bacteria 3474
792 Ga0157375_10110719 3300013308 Bacteria 2843
793 Ga0157375_10134957 3300013308 Bacteria 2590
794 Ga0157375_10167443 3300013308 Bacteria 2343
795 Ga0157375_10201446 3300013308 Bacteria 2147
796 Ga0157375_10366265 3300013308 Bacteria 1607
797 Ga0157375_10376650 3300013308 Bacteria 1586
798 Ga0157375_10422202 3300013308 Bacteria 1499
799 Ga0157375_10552617 3300013308 Unclassified 1313
800 Ga0157375_10915224 3300013308 Bacteria 1020
801 Ga0163163_10000471 3300014325 Bacteria 36731
802 Ga0163163_10000825 3300014325 Bacteria 26376
803 Ga0163163_10002272 3300014325 Bacteria 16213
804 Ga0163163_10009933 3300014325 Bacteria 8533
805 Ga0163163_10080403 3300014325 Unclassified 3259
806 Ga0163163_10101861 3300014325 Bacteria 2894
807 Ga0157380_10003936 3300014326 Bacteria 10251
808 Ga0157380_10018266 3300014326 Bacteria 5203
809 Ga0157380_10023605 3300014326 Bacteria 4642
810 Ga0157380_10073624 3300014326 Bacteria 2770
811 Ga0157380_10154016 3300014326 Unclassified 1990
812 Ga0157380_10425108 3300014326 Bacteria 1268
813 Ga0182008_10000024 3300014497 Bacteria 199978
814 Ga0182008_10000082 3300014497 Bacteria 74716
815 Ga0182008_10000503 3300014497 Bacteria 29456
816 Ga0182008_10006487 3300014497 Bacteria 6533
817 Ga0182008_10012897 3300014497 Bacteria 4400
818 Ga0182008_10022002 3300014497 Bacteria 3268
819 Ga0157377_10001438 3300014745 Bacteria 10284
820 Ga0157377_10009315 3300014745 Bacteria 4811
821 Ga0157377_10013943 3300014745 Bacteria 4080
822 Ga0157377_10018718 3300014745 Bacteria 3605
823 Ga0157377_10039544 3300014745 Bacteria 2609
824 Ga0157377_10171509 3300014745 Bacteria 1357
825 Ga0157377_10374994 3300014745 Unclassified 962
826 Ga0157379_10001930 3300014968 Bacteria 17154
827 Ga0157379_10005329 3300014968 Bacteria 11050
828 Ga0157379_10056117 3300014968 Unclassified 3520
829 Ga0157379_10068332 3300014968 Bacteria 3177
830 Ga0157379_10069695 3300014968 Bacteria 3145
831 Ga0157379_10123724 3300014968 Bacteria 2327
832 Ga0157379_10143965 3300014968 Bacteria 2149
833 Ga0157379_10185128 3300014968 Bacteria 1882
834 Ga0157379_10261167 3300014968 Bacteria 1574
835 Ga0157376_10000916 3300014969 Bacteria 19135
836 Ga0157376_10001409 3300014969 Bacteria 15807
837 Ga0157376_10006039 3300014969 Bacteria 8512
838 Ga0157376_10287865 3300014969 Unclassified 1550
839 Ga0157376_10775446 3300014969 Bacteria 970
840 Ga0157376_10901861 3300014969 Unclassified 902
841 Ga0182006_1000373 3300015261 Bacteria 37119
842 Ga0182006_1002727 3300015261 Bacteria 9466
843 Ga0182006_1004126 3300015261 Bacteria 7220
844 Ga0182006_1005808 3300015261 Bacteria 5816
845 Ga0182006_1009924 3300015261 Bacteria 4256
846 Ga0182006_1048129 3300015261 Bacteria 1650
847 Ga0182007_10000002 3300015262 Bacteria 564661
848 Ga0182007_10004523 3300015262 Bacteria 6288
849 Ga0182007_10005822 3300015262 Bacteria 5358
850 Ga0182007_10061891 3300015262 Bacteria 1227
851 Ga0182005_1050424 3300015265 Bacteria 1131
852 Ga0183373_1004 3300015682 Bacteria 537398
853 Ga0163161_10000856 3300017792 Bacteria 23716
854 Ga0163161_10001255 3300017792 Bacteria 18992
855 Ga0163161_10001554 3300017792 Bacteria 16943
856 Ga0163161_10014039 3300017792 Bacteria 5577
857 Ga0163161_10022880 3300017792 Bacteria 4403
858 Ga0163161_10024488 3300017792 Bacteria 4264
859 Ga0163161_10028422 3300017792 Unclassified 3972
860 Ga0163161_10045950 3300017792 Bacteria 3150
861 Ga0163161_10072869 3300017792 Bacteria 2516
862 Ga0163161_10078048 3300017792 Bacteria 2433
863 Ga0163161_10107048 3300017792 Bacteria 2087
864 Ga0163161_10110034 3300017792 Bacteria 2059
865 Ga0163161_10150859 3300017792 Bacteria 1766
866 Ga0163161_10234859 3300017792 Bacteria 1424
867 Ga0163161_10381861 3300017792 Bacteria 1126
868 Ga0163161_10641440 3300017792 Bacteria 879
869 Ga0206351_10266021 3300020077 Bacteria 1126
870 Ga0206352_10171243 3300020078 Unclassified 2308
871 Ga0154015_1198199 3300020610 Bacteria 1536
872 Ga0154015_1441652 3300020610 Bacteria 1196
873 Ga0213872_10006185 3300021361 Bacteria 6044
874 Ga0213876_10023559 3300021384 Bacteria 3252
875 Ga0224712_10035334 3300022467 Bacteria 1844
876 Ga0209436_103559 3300025208 Unclassified 4092
877 Ga0207427_100025 3300025231 Bacteria 433726
878 Ga0209437_100010 3300025233 Bacteria 838447
879 Ga0209437_100017 3300025233 Bacteria 694471
880 Ga0209437_100148 3300025233 Bacteria 158795
881 Ga0207425_1000023 3300025245 Bacteria 341339
882 Ga0209646_1001012 3300025246 Bacteria 8602
883 Ga0209026_1000430 3300025250 Bacteria 35017
884 Ga0209026_1000498 3300025250 Bacteria 28577
885 Ga0209026_1005565 3300025250 Bacteria 3350
886 Ga0209129_1000032 3300025258 Bacteria 341150
887 Ga0209129_1006980 3300025258 Bacteria 3483
888 Ga0209233_1000017 3300025261 Bacteria 898076
889 Ga0209233_1001847 3300025261 Bacteria 8130
890 Ga0207666_1005382 3300025271 Unclassified 1635
891 Ga0209455_1000682 3300025272 Bacteria 20151
892 Ga0209130_1002864 3300025284 Bacteria 7976
893 Ga0209676_1000009 3300025292 Bacteria 981719
894 Ga0209676_1000363 3300025292 Bacteria 85613
895 Ga0209025_1000047 3300025294 Bacteria 341150
896 Ga0209758_1000145 3300025297 Bacteria 170553
897 Ga0209050_1000094 3300025298 Bacteria 242893
898 Ga0209050_1029027 3300025298 Bacteria 1780
899 Ga0207426_1000059 3300025302 Bacteria 363842
900 Ga0207426_1000234 3300025302 Bacteria 126926
901 Ga0207426_1039841 3300025302 Bacteria 1468
902 Ga0207697_10012795 3300025315 Unclassified 3511
903 Ga0207697_10042239 3300025315 Unclassified 1873
904 Ga0207697_10044972 3300025315 Bacteria 1817
905 Ga0207697_10115793 3300025315 Bacteria 1151
906 Ga0207697_10166184 3300025315 Unclassified 964
907 Ga0207656_10010545 3300025321 Bacteria 3466
908 Ga0207656_10021255 3300025321 Unclassified 2591
909 Ga0207656_10039145 3300025321 Unclassified 2004
910 Ga0207656_10126649 3300025321 Bacteria 1193
911 Ga0207656_10139579 3300025321 Bacteria 1142
912 Ga0207682_10029174 3300025893 Unclassified 2205
913 Ga0207682_10058426 3300025893 Bacteria 1610
914 Ga0207642_10025354 3300025899 Unclassified 2397
915 Ga0207710_10002076 3300025900 Bacteria 9496
916 Ga0207710_10027249 3300025900 Bacteria 2473
917 Ga0207680_10000024 3300025903 Bacteria 82106
918 Ga0207680_10000907 3300025903 Bacteria 13999
919 Ga0207680_10061670 3300025903 Bacteria 2288
920 Ga0207680_10091551 3300025903 Bacteria 1935
921 Ga0207680_10225739 3300025903 Bacteria 1285
922 Ga0207647_10000358 3300025904 Bacteria 37132
923 Ga0207647_10000680 3300025904 Bacteria 26722
924 Ga0207647_10002110 3300025904 Bacteria 15216
925 Ga0207647_10023206 3300025904 Bacteria 4108
926 Ga0207647_10023686 3300025904 Bacteria 4056
927 Ga0207647_10095624 3300025904 Bacteria 1769
928 Ga0207647_10113164 3300025904 Bacteria 1604
929 Ga0207647_10113581 3300025904 Bacteria 1601
930 Ga0207647_10173695 3300025904 Unclassified 1254
931 Ga0207645_10004249 3300025907 Bacteria 10636
932 Ga0207645_10006511 3300025907 Bacteria 8370
933 Ga0207645_10008865 3300025907 Bacteria 6987
934 Ga0207645_10021055 3300025907 Bacteria 4257
935 Ga0207645_10036497 3300025907 Bacteria 3155
936 Ga0207645_10143436 3300025907 Bacteria 1557
937 Ga0207645_10154702 3300025907 Bacteria 1498
938 Ga0207643_10004405 3300025908 Bacteria 7574
939 Ga0207643_10008664 3300025908 Bacteria 5457
940 Ga0207643_10160761 3300025908 Unclassified 1351
941 Ga0207705_10000045 3300025909 Bacteria 180625
942 Ga0207705_10009444 3300025909 Bacteria 7092
943 Ga0207705_10011675 3300025909 Bacteria 6346
944 Ga0207705_10051441 3300025909 Bacteria 2965
945 Ga0207705_10175968 3300025909 Bacteria 1613
946 Ga0207705_10247490 3300025909 Bacteria 1359
947 Ga0207705_10411428 3300025909 Bacteria 1046
948 Ga0207705_10493114 3300025909 Bacteria 951
949 Ga0207654_10000945 3300025911 Bacteria 15957
950 Ga0207654_10001057 3300025911 Bacteria 14992
951 Ga0207654_10002875 3300025911 Bacteria 8737
952 Ga0207654_10011519 3300025911 Bacteria 4513
953 Ga0207654_10027133 3300025911 Bacteria 3110
954 Ga0207654_10047562 3300025911 Bacteria 2451
955 Ga0207707_10000785 3300025912 Bacteria 31123
956 Ga0207707_10002289 3300025912 Bacteria 17267
957 Ga0207707_10015783 3300025912 Bacteria 6585
958 Ga0207707_10109062 3300025912 Bacteria 2420
959 Ga0207707_10145017 3300025912 Unclassified 2075
960 Ga0207707_10238445 3300025912 Bacteria 1581
961 Ga0207707_10399063 3300025912 Unclassified 1181
962 Ga0207695_10000019 3300025913 Bacteria 732137
963 Ga0207695_10000087 3300025913 Bacteria 276412
964 Ga0207695_10000863 3300025913 Bacteria 55452
965 Ga0207695_10004265 3300025913 Bacteria 19632
966 Ga0207695_10004821 3300025913 Bacteria 18242
967 Ga0207695_10032498 3300025913 Bacteria 5710
968 Ga0207695_10051405 3300025913 Unclassified 4328
969 Ga0207695_10087504 3300025913 Bacteria 3138
970 Ga0207695_10176783 3300025913 Bacteria 2057
971 Ga0207695_10308142 3300025913 Bacteria 1474
972 Ga0207695_10447819 3300025913 Bacteria 1174
973 Ga0207671_10003252 3300025914 Bacteria 16346
974 Ga0207671_10006450 3300025914 Bacteria 10444
975 Ga0207671_10007651 3300025914 Bacteria 9333
976 Ga0207671_10008745 3300025914 Bacteria 8532
977 Ga0207671_10017925 3300025914 Bacteria 5446
978 Ga0207671_10022639 3300025914 Unclassified 4747
979 Ga0207671_10036181 3300025914 Bacteria 3660
980 Ga0207671_10110205 3300025914 Bacteria 2094
981 Ga0207671_10148648 3300025914 Bacteria 1809
982 Ga0207671_10269052 3300025914 Bacteria 1342
983 Ga0207671_10492185 3300025914 Unclassified 978
984 Ga0207660_10012376 3300025917 Bacteria 5581
985 Ga0207660_10032056 3300025917 Bacteria 3624
986 Ga0207660_10040413 3300025917 Bacteria 3265
987 Ga0207660_10407469 3300025917 Bacteria 1095
988 Ga0207662_10022900 3300025918 Bacteria 3585
989 Ga0207662_10342869 3300025918 Bacteria 1002
990 Ga0207657_10009277 3300025919 Bacteria 9911
991 Ga0207657_10028323 3300025919 Bacteria 5112
992 Ga0207657_10040503 3300025919 Bacteria 4127
993 Ga0207657_10057355 3300025919 Bacteria 3356
994 Ga0207657_10078928 3300025919 Bacteria 2770
995 Ga0207657_10091876 3300025919 Bacteria 2530
996 Ga0207657_10113207 3300025919 Bacteria 2239
997 Ga0207657_10196814 3300025919 Unclassified 1623
998 Ga0207657_10569962 3300025919 Bacteria 884
999 Ga0207649_10001875 3300025920 Bacteria 11999
1000 Ga0207649_10005900 3300025920 Bacteria 6641
1001 Ga0207649_10060515 3300025920 Unclassified 2380
1002 Ga0207652_10000103 3300025921 Bacteria 91988
1003 Ga0207652_10001257 3300025921 Bacteria 22555
1004 Ga0207652_10002683 3300025921 Bacteria 14930
1005 Ga0207652_10004292 3300025921 Bacteria 11623
1006 Ga0207652_10034573 3300025921 Bacteria 4260
1007 Ga0207652_10055658 3300025921 Unclassified 3403
1008 Ga0207652_10060901 3300025921 Bacteria 3258
1009 Ga0207652_10195098 3300025921 Bacteria 1821
1010 Ga0207652_10417910 3300025921 Bacteria 1210
1011 Ga0207646_10164022 3300025922 Unclassified 2006
1012 Ga0207681_10010220 3300025923 Bacteria 5747
1013 Ga0207681_10097147 3300025923 Bacteria 2116
1014 Ga0207681_10140772 3300025923 Bacteria 1796
1015 Ga0207681_10206168 3300025923 Bacteria 1512
1016 Ga0207681_10213768 3300025923 Unclassified 1488
1017 Ga0207694_10011375 3300025924 Bacteria 6717
1018 Ga0207694_10058055 3300025924 Bacteria 3010
1019 Ga0207650_10033682 3300025925 Unclassified 3711
1020 Ga0207650_10045601 3300025925 Bacteria 3225
1021 Ga0207650_10050701 3300025925 Bacteria 3070
1022 Ga0207650_10094946 3300025925 Bacteria 2285
1023 Ga0207650_10122960 3300025925 Bacteria 2023
1024 Ga0207650_10140567 3300025925 Unclassified 1898
1025 Ga0207650_10150375 3300025925 Bacteria 1837
1026 Ga0207650_10242466 3300025925 Bacteria 1457
1027 Ga0207650_10311268 3300025925 Bacteria 1288
1028 Ga0207650_10405853 3300025925 Unclassified 1128
1029 Ga0207659_10028297 3300025926 Bacteria 3807
1030 Ga0207659_10052832 3300025926 Bacteria 2896
1031 Ga0207659_10056781 3300025926 Bacteria 2805
1032 Ga0207659_10307547 3300025926 Bacteria 1304
1033 Ga0207687_10260785 3300025927 Bacteria 1381
1034 Ga0207687_10463974 3300025927 Bacteria 1052
1035 Ga0207644_10027212 3300025931 Unclassified 3950
1036 Ga0207644_10052954 3300025931 Bacteria 2919
1037 Ga0207644_10064041 3300025931 Bacteria 2671
1038 Ga0207644_10077611 3300025931 Bacteria 2446
1039 Ga0207644_10136589 3300025931 Bacteria 1883
1040 Ga0207644_10157937 3300025931 Unclassified 1760
1041 Ga0207644_10174594 3300025931 Unclassified 1680
1042 Ga0207644_10460216 3300025931 Bacteria 1046
1043 Ga0207690_10000766 3300025932 Bacteria 20779
1044 Ga0207690_10005287 3300025932 Bacteria 7612
1045 Ga0207690_10022304 3300025932 Bacteria 3936
1046 Ga0207690_10025950 3300025932 Bacteria 3686
1047 Ga0207690_10034698 3300025932 Bacteria 3252
1048 Ga0207690_10079990 3300025932 Unclassified 2279
1049 Ga0207690_10112549 3300025932 Unclassified 1963
1050 Ga0207690_10199973 3300025932 Bacteria 1517
1051 Ga0207706_10000057 3300025933 Bacteria 112805
1052 Ga0207706_10013742 3300025933 Bacteria 7347
1053 Ga0207706_10015669 3300025933 Bacteria 6851
1054 Ga0207706_10032770 3300025933 Bacteria 4625
1055 Ga0207706_10041077 3300025933 Bacteria 4101
1056 Ga0207706_10041917 3300025933 Bacteria 4056
1057 Ga0207706_10045347 3300025933 Unclassified 3896
1058 Ga0207706_10051782 3300025933 Bacteria 3625
1059 Ga0207706_10096309 3300025933 Bacteria 2603
1060 Ga0207686_10001595 3300025934 Bacteria 12714
1061 Ga0207686_10012459 3300025934 Unclassified 4678
1062 Ga0207686_10123301 3300025934 Unclassified 1767
1063 Ga0207686_10219974 3300025934 Bacteria 1371
1064 Ga0207709_10218812 3300025935 Unclassified 1372
1065 Ga0207709_10546443 3300025935 Unclassified 910
1066 Ga0207670_10040768 3300025936 Bacteria 3049
1067 Ga0207670_10046370 3300025936 Bacteria 2887
1068 Ga0207670_10061173 3300025936 Bacteria 2569
1069 Ga0207669_10029049 3300025937 Bacteria 3051
1070 Ga0207669_10141837 3300025937 Unclassified 1669
1071 Ga0207669_10210636 3300025937 Bacteria 1418
1072 Ga0207669_10334663 3300025937 Bacteria 1163
1073 Ga0207669_10342008 3300025937 Bacteria 1153
1074 Ga0207704_10000266 3300025938 Bacteria 25142
1075 Ga0207704_10005149 3300025938 Bacteria 6020
1076 Ga0207704_10019491 3300025938 Bacteria 3564
1077 Ga0207704_10027744 3300025938 Bacteria 3130
1078 Ga0207704_10028606 3300025938 Bacteria 3095
1079 Ga0207704_10080944 3300025938 Bacteria 2099
1080 Ga0207704_10398916 3300025938 Bacteria 1085
1081 Ga0207665_10076711 3300025939 Bacteria 2292
1082 Ga0207691_10000322 3300025940 Bacteria 47690
1083 Ga0207691_10013189 3300025940 Bacteria 7912
1084 Ga0207691_10022737 3300025940 Bacteria 5910
1085 Ga0207691_10035059 3300025940 Bacteria 4662
1086 Ga0207691_10042771 3300025940 Bacteria 4175
1087 Ga0207691_10056700 3300025940 Bacteria 3568
1088 Ga0207691_10057182 3300025940 Bacteria 3551
1089 Ga0207691_10129274 3300025940 Bacteria 2232
1090 Ga0207691_10218260 3300025940 Unclassified 1654
1091 Ga0207691_10551051 3300025940 Unclassified 978
1092 Ga0207711_10560098 3300025941 Unclassified 1066
1093 Ga0207689_10002373 3300025942 Bacteria 17589
1094 Ga0207689_10004255 3300025942 Bacteria 13015
1095 Ga0207689_10005993 3300025942 Bacteria 10751
1096 Ga0207689_10006451 3300025942 Bacteria 10371
1097 Ga0207689_10012780 3300025942 Bacteria 7173
1098 Ga0207689_10013331 3300025942 Bacteria 7013
1099 Ga0207689_10014390 3300025942 Bacteria 6730
1100 Ga0207689_10015849 3300025942 Bacteria 6384
1101 Ga0207689_10017568 3300025942 Bacteria 6046
1102 Ga0207689_10018768 3300025942 Bacteria 5832
1103 Ga0207689_10021517 3300025942 Bacteria 5423
1104 Ga0207689_10022338 3300025942 Bacteria 5320
1105 Ga0207689_10031594 3300025942 Bacteria 4407
1106 Ga0207689_10124311 3300025942 Bacteria 2122
1107 Ga0207689_10216840 3300025942 Unclassified 1581
1108 Ga0207689_10311971 3300025942 Unclassified 1304
1109 Ga0207661_10001968 3300025944 Bacteria 14142
1110 Ga0207661_10010454 3300025944 Bacteria 6681
1111 Ga0207661_10019341 3300025944 Bacteria 5075
1112 Ga0207661_10034779 3300025944 Bacteria 3922
1113 Ga0207661_10064761 3300025944 Unclassified 2964
1114 Ga0207661_10125085 3300025944 Bacteria 2195
1115 Ga0207661_10565966 3300025944 Bacteria 1042
1116 Ga0207679_10000223 3300025945 Bacteria 44739
1117 Ga0207679_10001672 3300025945 Bacteria 13821
1118 Ga0207679_10020334 3300025945 Bacteria 4479
1119 Ga0207679_10028022 3300025945 Bacteria 3904
1120 Ga0207667_10000015 3300025949 Bacteria 417534
1121 Ga0207667_10000644 3300025949 Bacteria 45263
1122 Ga0207667_10003221 3300025949 Bacteria 20157
1123 Ga0207667_10009488 3300025949 Bacteria 11459
1124 Ga0207667_10030806 3300025949 Bacteria 5798
1125 Ga0207667_10056376 3300025949 Bacteria 4128
1126 Ga0207667_10060374 3300025949 Bacteria 3969
1127 Ga0207667_10065419 3300025949 Bacteria 3792
1128 Ga0207667_10107856 3300025949 Bacteria 2873
1129 Ga0207667_10125592 3300025949 Bacteria 2643
1130 Ga0207667_10221630 3300025949 Bacteria 1938
1131 Ga0207667_10323234 3300025949 Bacteria 1576
1132 Ga0207667_10398347 3300025949 Bacteria 1402
1133 Ga0207651_10007850 3300025960 Bacteria 5713
1134 Ga0207651_10014436 3300025960 Bacteria 4561
1135 Ga0207651_10029097 3300025960 Bacteria 3496
1136 Ga0207651_10042377 3300025960 Bacteria 3029
1137 Ga0207651_10051187 3300025960 Unclassified 2808
1138 Ga0207651_10130067 3300025960 Bacteria 1925
1139 Ga0207651_10181632 3300025960 Bacteria 1669
1140 Ga0207651_10253036 3300025960 Unclassified 1442
1141 Ga0207651_10424240 3300025960 Unclassified 1136
1142 Ga0207651_10596466 3300025960 Bacteria 965
1143 Ga0207651_10654532 3300025960 Unclassified 922
1144 Ga0207712_10002565 3300025961 Bacteria 11677
1145 Ga0207712_10005545 3300025961 Bacteria 7964
1146 Ga0207712_10011918 3300025961 Bacteria 5544
1147 Ga0207712_10025662 3300025961 Bacteria 3918
1148 Ga0207712_10046585 3300025961 Bacteria 3006
1149 Ga0207712_10074204 3300025961 Bacteria 2455
1150 Ga0207712_10280329 3300025961 Bacteria 1360
1151 Ga0207668_10000475 3300025972 Bacteria 25151
1152 Ga0207668_10036554 3300025972 Bacteria 3278
1153 Ga0207668_10204089 3300025972 Bacteria 1576
1154 Ga0207668_10207663 3300025972 Bacteria 1564
1155 Ga0207668_10620326 3300025972 Unclassified 944
1156 Ga0207640_10002135 3300025981 Bacteria 10617
1157 Ga0207640_10095408 3300025981 Bacteria 2071
1158 Ga0207640_10112020 3300025981 Bacteria 1936
1159 Ga0207640_10134143 3300025981 Bacteria 1794
1160 Ga0207640_10195321 3300025981 Unclassified 1529
1161 Ga0207640_10206176 3300025981 Bacteria 1494
1162 Ga0207640_10258312 3300025981 Bacteria 1356
1163 Ga0207658_10002470 3300025986 Bacteria 13496
1164 Ga0207658_10008454 3300025986 Bacteria 7006
1165 Ga0207658_10012330 3300025986 Bacteria 5835
1166 Ga0207658_10012528 3300025986 Bacteria 5793
1167 Ga0207658_10034411 3300025986 Bacteria 3622
1168 Ga0207658_10182935 3300025986 Unclassified 1736
1169 Ga0207658_10188642 3300025986 Unclassified 1712
1170 Ga0207658_10222666 3300025986 Unclassified 1588
1171 Ga0207658_10366099 3300025986 Bacteria 1259
1172 Ga0207677_10000863 3300026023 Bacteria 17337
1173 Ga0207677_10002657 3300026023 Bacteria 9412
1174 Ga0207677_10007297 3300026023 Bacteria 6102
1175 Ga0207677_10007663 3300026023 Bacteria 5992
1176 Ga0207677_10035820 3300026023 Bacteria 3227
1177 Ga0207677_10051804 3300026023 Bacteria 2784
1178 Ga0207677_10057073 3300026023 Bacteria 2679
1179 Ga0207677_10076732 3300026023 Bacteria 2380
1180 Ga0207703_10000814 3300026035 Bacteria 30775
1181 Ga0207703_10068179 3300026035 Unclassified 2931
1182 Ga0207703_10125988 3300026035 Bacteria 2205
1183 Ga0207703_10625764 3300026035 Bacteria 1019
1184 Ga0207639_10004988 3300026041 Bacteria 8940
1185 Ga0207639_10005319 3300026041 Bacteria 8693
1186 Ga0207639_10005473 3300026041 Bacteria 8582
1187 Ga0207639_10008068 3300026041 Bacteria 7199
1188 Ga0207639_10009288 3300026041 Bacteria 6780
1189 Ga0207639_10011449 3300026041 Bacteria 6162
1190 Ga0207639_10015980 3300026041 Bacteria 5301
1191 Ga0207639_10031117 3300026041 Bacteria 3919
1192 Ga0207639_10033500 3300026041 Bacteria 3790
1193 Ga0207639_10042980 3300026041 Bacteria 3390
1194 Ga0207639_10057505 3300026041 Bacteria 2986
1195 Ga0207639_10095718 3300026041 Bacteria 2387
1196 Ga0207639_10097453 3300026041 Bacteria 2368
1197 Ga0207639_10107882 3300026041 Unclassified 2263
1198 Ga0207639_10125427 3300026041 Bacteria 2117
1199 Ga0207639_10132910 3300026041 Unclassified 2062
1200 Ga0207639_10251336 3300026041 Bacteria 1542
1201 Ga0207639_10557432 3300026041 Bacteria 1053
1202 Ga0207678_10032708 3300026067 Bacteria 4533
1203 Ga0207678_10366102 3300026067 Unclassified 1245
1204 Ga0207708_10112481 3300026075 Unclassified 2115
1205 Ga0207702_10000165 3300026078 Bacteria 79066
1206 Ga0207702_10019965 3300026078 Bacteria 5550
1207 Ga0207702_10135571 3300026078 Bacteria 2221
1208 Ga0207702_10156603 3300026078 Bacteria 2077
1209 Ga0207702_10317660 3300026078 Bacteria 1482
1210 Ga0207702_10344598 3300026078 Bacteria 1424
1211 Ga0207641_10000058 3300026088 Bacteria 166385
1212 Ga0207641_10003931 3300026088 Bacteria 12996
1213 Ga0207641_10005737 3300026088 Bacteria 10545
1214 Ga0207641_10017416 3300026088 Bacteria 5882
1215 Ga0207641_10041507 3300026088 Bacteria 3856
1216 Ga0207641_10059311 3300026088 Bacteria 3258
1217 Ga0207641_10065270 3300026088 Bacteria 3113
1218 Ga0207641_10121696 3300026088 Unclassified 2330
1219 Ga0207641_10319375 3300026088 Unclassified 1472
1220 Ga0207641_10321659 3300026088 Unclassified 1467
1221 Ga0207641_10638083 3300026088 Bacteria 1045
1222 Ga0207648_10000820 3300026089 Bacteria 35151
1223 Ga0207648_10003208 3300026089 Bacteria 17220
1224 Ga0207648_10004484 3300026089 Bacteria 14324
1225 Ga0207648_10007640 3300026089 Bacteria 10592
1226 Ga0207648_10012664 3300026089 Bacteria 7885
1227 Ga0207648_10017326 3300026089 Bacteria 6560
1228 Ga0207648_10037211 3300026089 Bacteria 4286
1229 Ga0207648_10052616 3300026089 Bacteria 3561
1230 Ga0207648_10087459 3300026089 Bacteria 2720
1231 Ga0207648_10121269 3300026089 Bacteria 2299
1232 Ga0207648_10172746 3300026089 Bacteria 1911
1233 Ga0207648_10191482 3300026089 Bacteria 1813
1234 Ga0207648_10385588 3300026089 Bacteria 1268
1235 Ga0207676_10004821 3300026095 Bacteria 9570
1236 Ga0207676_10008428 3300026095 Bacteria 7329
1237 Ga0207676_10012530 3300026095 Bacteria 6079
1238 Ga0207676_10027108 3300026095 Bacteria 4264
1239 Ga0207676_10071782 3300026095 Bacteria 2781
1240 Ga0207676_10084729 3300026095 Unclassified 2584
1241 Ga0207676_10102365 3300026095 Bacteria 2377
1242 Ga0207676_10193088 3300026095 Unclassified 1793
1243 Ga0207676_10525211 3300026095 Bacteria 1127
1244 Ga0207674_10031003 3300026116 Bacteria 5619
1245 Ga0207674_10031084 3300026116 Bacteria 5610
1246 Ga0207674_10061629 3300026116 Unclassified 3789
1247 Ga0207674_10075106 3300026116 Bacteria 3390
1248 Ga0207674_10085770 3300026116 Bacteria 3143
1249 Ga0207674_10093977 3300026116 Bacteria 2986
1250 Ga0207674_10109546 3300026116 Bacteria 2738
1251 Ga0207674_10157689 3300026116 Unclassified 2225
1252 Ga0207674_10176620 3300026116 Bacteria 2088
1253 Ga0207674_10265145 3300026116 Bacteria 1665
1254 Ga0207675_100000646 3300026118 Bacteria 34270
1255 Ga0207675_100002881 3300026118 Bacteria 16915
1256 Ga0207675_100014651 3300026118 Bacteria 7310
1257 Ga0207675_100108878 3300026118 Bacteria 2613
1258 Ga0207675_100159933 3300026118 Bacteria 2148
1259 Ga0207675_100197471 3300026118 Bacteria 1931
1260 Ga0207675_100223013 3300026118 Bacteria 1817
1261 Ga0207675_100315104 3300026118 Unclassified 1526
1262 Ga0207675_100325210 3300026118 Bacteria 1502
1263 Ga0207683_10012841 3300026121 Bacteria 7149
1264 Ga0207683_10020499 3300026121 Bacteria 5654
1265 Ga0207683_10030804 3300026121 Unclassified 4651
1266 Ga0207683_10165220 3300026121 Bacteria 2003
1267 Ga0207698_10003833 3300026142 Bacteria 9103
1268 Ga0207698_10006479 3300026142 Bacteria 7308
1269 Ga0207698_10015545 3300026142 Bacteria 5099
1270 Ga0207698_10020442 3300026142 Unclassified 4557
1271 Ga0207698_10033537 3300026142 Bacteria 3732
1272 Ga0207698_10047101 3300026142 Bacteria 3262
1273 Ga0207698_10090718 3300026142 Bacteria 2500
1274 Ga0207698_10119163 3300026142 Unclassified 2230
1275 Ga0207698_10125088 3300026142 Unclassified 2185
1276 Ga0207698_10144799 3300026142 Unclassified 2053
1277 Ga0207698_10162772 3300026142 Bacteria 1954
1278 Ga0207698_10175937 3300026142 Bacteria 1890
1279 Ga0207698_10419937 3300026142 Bacteria 1283
1280 Ga0209968_1004926 3300027526 Bacteria 2003
1281 Ga0207428_10074553 3300027907 Bacteria 2661
1282 Ga0207428_10086053 3300027907 Bacteria 2447
1283 Ga0268266_10000030 3300028379 Bacteria 417120
1284 Ga0268266_10003162 3300028379 Bacteria 16711
1285 Ga0268266_10061888 3300028379 Bacteria 3228
1286 Ga0268266_10525811 3300028379 Unclassified 1131
1287 Ga0268265_10003417 3300028380 Bacteria 11428
1288 Ga0268265_10005499 3300028380 Bacteria 8648
1289 Ga0268265_10012001 3300028380 Bacteria 5863
1290 Ga0268265_10043777 3300028380 Bacteria 3330
1291 Ga0268265_10112713 3300028380 Bacteria 2224
1292 Ga0268265_10137972 3300028380 Bacteria 2037
1293 Ga0268264_10001732 3300028381 Bacteria 20053
1294 Ga0268264_10003381 3300028381 Bacteria 13781
1295 Ga0268264_10004437 3300028381 Bacteria 11970
1296 Ga0268264_10011514 3300028381 Bacteria 7306
1297 Ga0268264_10016463 3300028381 Bacteria 6055
1298 Ga0268264_10021945 3300028381 Bacteria 5210
1299 Ga0268264_10040321 3300028381 Bacteria 3859
1300 Ga0268264_10054278 3300028381 Bacteria 3346
1301 Ga0268264_10185596 3300028381 Bacteria 1892
1302 Ga0268264_10341907 3300028381 Bacteria 1422
1303 Ga0268264_10392779 3300028381 Unclassified 1331
1304 Ga0268264_11011648 3300028381 Bacteria 838
1305 Ga0307517_10001481 3300028786 Bacteria 39285
1306 Ga0307517_10022273 3300028786 Bacteria 7945
1307 Ga0307517_10113502 3300028786 Bacteria 2045
1308 Ga0307515_10000001 3300028794 Bacteria 4259510
1309 Ga0307515_10000012 3300028794 Bacteria 582232
1310 Ga0307515_10000059 3300028794 Bacteria 257520
1311 Ga0307515_10000349 3300028794 Bacteria 114163
1312 Ga0307515_10000376 3300028794 Bacteria 109190
1313 Ga0307515_10005206 3300028794 Bacteria 26435
1314 Ga0307515_10040038 3300028794 Bacteria 7424
1315 Ga0307515_10263621 3300028794 Unclassified 1455
1316 Ga0307511_10000076 3300030521 Bacteria 82520
1317 Ga0316177_1015993 3300030731 Bacteria 3065
1318 Ga0316177_1087909 3300030731 Bacteria 967
1319 Ga0316176_1026788 3300030732 Bacteria 12096
1320 Ga0316183_1099321 3300030742 Bacteria 18877
1321 Ga0316181_1156971 3300030744 Bacteria 5606
1322 Ga0316181_1210309 3300030744 Bacteria 1947
1323 Ga0316182_1096864 3300030745 Bacteria 2018
1324 Ga0265320_10093821 3300031240 Bacteria 1388
1325 Ga0265331_10081425 3300031250 Unclassified 1503
1326 Ga0265327_10000013 3300031251 Bacteria 519549
1327 Ga0265327_10000031 3300031251 Bacteria 325718
1328 Ga0265327_10000137 3300031251 Bacteria 160704
1329 Ga0265327_10013169 3300031251 Bacteria 5512
1330 Ga0265327_10013842 3300031251 Bacteria 5327
1331 Ga0265327_10071989 3300031251 Bacteria 1728
1332 Ga0307513_10219831 3300031456 Bacteria 1722
1333 Ga0307509_10044062 3300031507 Bacteria 4822
1334 Ga0307509_10064621 3300031507 Bacteria 3848
1335 Ga0307509_10126854 3300031507 Bacteria 2516
1336 Ga0307509_10256229 3300031507 Bacteria 1529
1337 Ga0307509_10261765 3300031507 Bacteria 1504
1338 Ga0307408_100000541 3300031548 Bacteria 32578
1339 Ga0307408_100003308 3300031548 Bacteria 11082
1340 Ga0307408_100018035 3300031548 Bacteria 4735
1341 Ga0307408_100049099 3300031548 Bacteria 3029
1342 Ga0307508_10006441 3300031616 Bacteria 11041
1343 Ga0307508_10270277 3300031616 Bacteria 1294
1344 Ga0265314_10088042 3300031711 Bacteria 2029
1345 Ga0307516_10003288 3300031730 Bacteria 20916
1346 Ga0307516_10129055 3300031730 Bacteria 2310
1347 Ga0307516_10247622 3300031730 Bacteria 1478
1348 Ga0307405_10000015 3300031731 Bacteria 206299
1349 Ga0307405_10015968 3300031731 Bacteria 4082
1350 Ga0307405_10024515 3300031731 Bacteria 3447
1351 Ga0307405_10498241 3300031731 Bacteria 976
1352 Ga0307413_10123252 3300031824 Bacteria 1760
1353 Ga0307413_10177719 3300031824 Bacteria 1514
1354 Ga0307407_10000027 3300031903 Bacteria 107307
1355 Ga0307412_10000030 3300031911 Bacteria 208541
1356 Ga0307412_10012923 3300031911 Bacteria 4880
1357 Ga0307412_10039962 3300031911 Bacteria 3033
1358 Ga0307412_10128525 3300031911 Bacteria 1837
1359 Ga0307412_10492401 3300031911 Bacteria 1019
1360 Ga0307416_100000002 3300032002 Bacteria 509907
1361 Ga0307416_100056158 3300032002 Bacteria 3176
1362 Ga0307416_100246061 3300032002 Bacteria 1737
1363 Ga0307414_10000262 3300032004 Bacteria 33057
1364 Ga0307414_10006046 3300032004 Bacteria 6714
1365 Ga0307414_10019408 3300032004 Bacteria 4213
1366 Ga0307414_10027138 3300032004 Bacteria 3696
1367 Ga0307414_10037255 3300032004 Bacteria 3254
1368 Ga0307414_10066410 3300032004 Unclassified 2579
1369 Ga0307414_10128998 3300032004 Bacteria 1959
1370 Ga0307414_10130002 3300032004 Unclassified 1953
1371 Ga0307414_10211709 3300032004 Bacteria 1585
1372 Ga0307414_10620892 3300032004 Bacteria 972
1373 Ga0307507_10003702 3300033179 Bacteria 28885
1374 Ga0307507_10115244 3300033179 Unclassified 2175
1375 Ga0307510_10000464 3300033180 Bacteria 39482
1376 Ga0373950_0027934 3300034818 Bacteria 1032
1377 Ga0373934_0045137 3300035086 Unclassified 1742
1378 Ga0373943_0057217 3300035170 Unclassified 1937
1379 Ga0373946_0029924 3300035171 Bacteria 2171
1380 Ga0373955_0009887 3300035172 Bacteria 4488
1381 Ga0373935_0150339 3300035692 Bacteria 1580
1382 Ga0373933_0062135 3300035724 Unclassified 2255
1383 Ga0373933_0156255 3300035724 Bacteria 1447
1384 Ga0373947_0386689 3300035725 Bacteria 942
1385 Ga0373937_0016924 3300036401 Bacteria 6483
1386 Ga0373925_0214204 3300037068 Bacteria 1535
1387 Ga0373925_0358037 3300037068 Unclassified 1186
1388 Ga0373925_0466509 3300037068 Bacteria 1035
1389 Ga0395899_0000001 3300037312 Bacteria 1750322
1390 Ga0395899_0000887 3300037312 Bacteria 28407
1391 Ga0395899_0007044 3300037312 Bacteria 8701
1392 Ga0395899_0007705 3300037312 Bacteria 8302
1393 Ga0395899_0020100 3300037312 Bacteria 5067
1394 Ga0395899_0037069 3300037312 Bacteria 3656
1395 Ga0395899_0055058 3300037312 Bacteria 2942
1396 Ga0395899_0067028 3300037312 Bacteria 2634
1397 Ga0395899_0078418 3300037312 Unclassified 2407
1398 Ga0395900_0000143 3300037418 Bacteria 120234
1399 Ga0395900_0000684 3300037418 Bacteria 45221
1400 Ga0395900_0003189 3300037418 Bacteria 17771
1401 Ga0395900_0006556 3300037418 Bacteria 12124
1402 Ga0395900_0039835 3300037418 Bacteria 4842
1403 Ga0395900_0114735 3300037418 Bacteria 2764
1404 Ga0395898_0001240 3300037466 Bacteria 38058
1405 Ga0395898_0004789 3300037466 Bacteria 14725
1406 Ga0395898_0136633 3300037466 Bacteria 2347
1407 Ga0395898_0187493 3300037466 Bacteria 1976
1408 Ga0395898_0238196 3300037466 Bacteria 1735
1409 Ga0395898_0325443 3300037466 Bacteria 1466
1410 Ga0395905_0000175 3300037471 Bacteria 104024
1411 Ga0395905_0000981 3300037471 Bacteria 36581
1412 Ga0395905_0002365 3300037471 Bacteria 21010
1413 Ga0395905_0005773 3300037471 Bacteria 12580
1414 Ga0395905_0246718 3300037471 Bacteria 1668
1415 Ga0395901_0000313 3300038443 Bacteria 59766
1416 Ga0395901_0000995 3300038443 Bacteria 30617
1417 Ga0395901_0004445 3300038443 Bacteria 14139
1418 Ga0395901_0009480 3300038443 Bacteria 9877
1419 Ga0395901_0010499 3300038443 Bacteria 9381
1420 Ga0395901_0021527 3300038443 Bacteria 6607
1421 Ga0395901_0045853 3300038443 Bacteria 4539
1422 Ga0395901_0455660 3300038443 Bacteria 1307
1423 Ga0436365_0782007 3300039437 Bacteria 1906
1424 Ga0436365_0943390 3300039437 Bacteria 13925
1425 Ga0436365_1630471 3300039437 Bacteria 1924
1426 Ga0436361_1115729 3300039447 Bacteria 13860
1427 Ga0439436_0000160 3300041404 Bacteria 15790
1428 Ga0439439_0052951 3300041406 Bacteria 1066
1429 Ga0439453_0008644 3300041408 Bacteria 1639
1430 Ga0451787_841972 3300041441 Bacteria 1044
1431 Ga0451795_0318958 3300041456 Bacteria 1000
1432 Ga0451802_0264569 3300041460 Bacteria 1236
1433 Ga0451802_1472217 3300041460 Bacteria 1482
1434 Ga0451804_0820654 3300041463 Bacteria 1163
1435 Ga0451841_1351513 3300041498 Bacteria 926
1436 Ga0451853_3193490 3300041512 Bacteria 1537
1437 Ga0439431_0009310 3300041997 Bacteria 2217
1438 Ga0439441_001534 3300042001 Unclassified 3055
1439 Ga0439445_0029071 3300042004 Unclassified 1427
1440 Ga0439449_0006413 3300042007 Bacteria 4500
1441 Ga0439455_0038536 3300042012 Bacteria 1216
1442 Ga0439462_0004351 3300042015 Bacteria 3449
1443 Ga0439462_0040408 3300042015 Bacteria 1244
1444 Ga0450922_007563 3300042124 Bacteria 1020
1445 Ga0450894_011061 3300042131 Bacteria 1173
1446 Ga0450898_000823 3300042134 Bacteria 3844
1447 Ga0450898_022155 3300042134 Bacteria 1123
1448 Ga0439446_0034792 3300042156 Unclassified 1467
1449 Ga0439434_0007850 3300042435 Unclassified 3127
1450 Ga0439434_0037469 3300042435 Bacteria 1485
1451 Ga0439460_0032113 3300042461 Bacteria 1502
1452 Ga0451577_0012474 3300042876 Bacteria 7978
1453 Ga0451577_0107849 3300042876 Bacteria 2490
1454 Ga0451577_0687026 3300042876 Bacteria 927
1455 Ga0466969_0057063 3300044656 Bacteria 1904
1456 Ga0466972_0000049 3300044658 Bacteria 118829
1457 Ga0466972_0000146 3300044658 Bacteria 57580
1458 Ga0466972_0000641 3300044658 Bacteria 16866
1459 Ga0466972_0006223 3300044658 Bacteria 5998
1460 Ga0453683_0016564 3300044673 Bacteria 4755
1461 Ga0453683_0126061 3300044673 Unclassified 1612
1462 Ga0453683_0267404 3300044673 Unclassified 1091
1463 Ga0466965_0154913 3300044683 Bacteria 1199
1464 Ga0466966_0000015 3300044684 Bacteria 127402
1465 Ga0466961_0085905 3300044693 Bacteria 1989
1466 Ga0466961_0120018 3300044693 Bacteria 1651
1467 Ga0453684_0027037 3300044712 Bacteria 8251
1468 Ga0453684_0054484 3300044712 Bacteria 5209
1469 Ga0453684_0073768 3300044712 Unclassified 4300
1470 Ga0453684_0143209 3300044712 Bacteria 2851
1471 Ga0453684_0309874 3300044712 Bacteria 1792
1472 Ga0466971_0056363 3300044719 Bacteria 1773
1473 Ga0466971_0152248 3300044719 Unclassified 1080
1474 Ga0466968_0022170 3300044735 Bacteria 2580
1475 Ga0466970_0015947 3300044765 Bacteria 3868
1476 Ga0466957_0000381 3300044842 Bacteria 21723
1477 Ga0466957_0012327 3300044842 Bacteria 4949
1478 Ga0466957_0062028 3300044842 Bacteria 2296
1479 Ga0466960_0093469 3300044901 Bacteria 1537
1480 Ga0466959_0000030 3300045049 Bacteria 111343
1481 Ga0466959_0057437 3300045049 Bacteria 2837
1482 Ga0466959_0151381 3300045049 Unclassified 1635
1483 Ga0466959_0560120 3300045049 Unclassified 770
1484 Ga0451576_0130745 3300045051 Unclassified 2617
1485 Ga0451576_0475321 3300045051 Bacteria 1313
1486 Ga0451576_0812298 3300045051 Unclassified 982
1487 Ga0466967_0248632 3300045976 Bacteria 1698
1488 Ga0466967_0844880 3300045976 Bacteria 910
1489 Ga0495627_104413 3300046453 Bacteria 807
1490 Ga0495629_0020111 3300046459 Bacteria 4767
1491 Ga0495638_0111546 3300046460 Bacteria 1624
1492 Ga0495638_0117585 3300046460 Bacteria 1573
1493 Ga0495651_0330405 3300046462 Bacteria 1013
1494 Ga0495650_0000162 3300046471 Bacteria 148927
1495 Ga0495650_0045261 3300046471 Bacteria 1854
1496 Ga0495582_0091006 3300046473 Bacteria 1701
1497 Ga0495662_0165709 3300046476 Bacteria 1089
1498 Ga0495585_0000100 3300046492 Bacteria 91669
1499 Ga0495585_0000153 3300046492 Bacteria 74267
1500 Ga0495585_0000853 3300046492 Bacteria 26111
1501 Ga0495585_0186983 3300046492 Bacteria 1062
1502 Ga0495607_0154217 3300046501 Bacteria 1173
1503 Ga0495583_0017756 3300046506 Bacteria 3767
1504 Ga0495606_0000033 3300046507 Bacteria 247739
1505 Ga0495606_0005624 3300046507 Bacteria 11905
1506 Ga0495606_0013056 3300046507 Bacteria 6599
1507 Ga0495606_0016861 3300046507 Bacteria 5548
1508 Ga0495608_0117296 3300046511 Unclassified 1708
1509 Ga0495610_0000768 3300046512 Bacteria 30249
1510 Ga0495610_0002306 3300046512 Bacteria 16113
1511 Ga0495610_0009518 3300046512 Bacteria 6131
1512 Ga0495616_0003449 3300046513 Bacteria 10118
1513 Ga0495616_0006594 3300046513 Bacteria 7014
1514 Ga0495618_0016132 3300046514 Unclassified 4566
1515 Ga0495628_0216836 3300046516 Unclassified 1438
1516 Ga0495630_0017644 3300046517 Bacteria 5232
1517 Ga0495630_0042346 3300046517 Unclassified 3400
1518 Ga0495631_0006431 3300046518 Bacteria 6062
1519 Ga0495632_0025276 3300046519 Unclassified 3144
1520 Ga0495637_0048334 3300046520 Bacteria 1792
1521 Ga0495644_0004653 3300046523 Bacteria 5393
1522 Ga0495648_0013944 3300046524 Bacteria 5913
1523 Ga0495648_0048233 3300046524 Bacteria 2624
1524 Ga0495648_0067829 3300046524 Bacteria 2084
1525 Ga0495663_0072881 3300046525 Bacteria 1096
1526 Ga0495652_0326599 3300046529 Bacteria 1106
1527 Ga0495654_0030700 3300046530 Bacteria 2733
1528 Ga0495654_0076653 3300046530 Bacteria 1575
1529 Ga0495640_0220929 3300046533 Bacteria 1195
1530 Ga0495586_0034603 3300046535 Bacteria 2714
1531 Ga0495587_0023448 3300046536 Unclassified 3792
1532 Ga0495587_0119968 3300046536 Bacteria 1507
1533 Ga0495609_0004780 3300046538 Bacteria 7312
1534 Ga0495609_0028955 3300046538 Bacteria 2524
1535 Ga0495609_0031055 3300046538 Bacteria 2430
1536 Ga0495633_0000389 3300046558 Bacteria 46261
1537 Ga0495633_0011583 3300046558 Bacteria 4746
1538 Ga0495633_0021524 3300046558 Bacteria 3224
1539 Ga0495667_0292027 3300046559 Bacteria 1034
1540 Ga0495668_0000009 3300046616 Bacteria 492623
1541 Ga0495668_0000121 3300046616 Bacteria 116234
1542 Ga0495668_0001043 3300046616 Bacteria 29368
1543 Ga0495634_0030005 3300046642 Unclassified 3760
1544 Ga0495634_0085542 3300046642 Bacteria 2055
1545 Ga0495625_0000131 3300046660 Bacteria 117738
1546 Ga0495625_0000951 3300046660 Bacteria 38714
1547 Ga0495625_0001562 3300046660 Bacteria 27264
1548 Ga0495625_0012472 3300046660 Bacteria 6886
1549 Ga0495625_0016203 3300046660 Bacteria 5872
1550 Ga0495625_0023966 3300046660 Bacteria 4654
1551 Ga0495625_0028787 3300046660 Bacteria 4161
1552 Ga0495625_0047135 3300046660 Bacteria 3108
1553 Ga0495635_0217823 3300046663 Unclassified 1292
1554 Ga0495661_0018305 3300046665 Bacteria 4609
1555 Ga0495647_0067788 3300046681 Bacteria 1422
1556 Ga0495658_0048820 3300046683 Bacteria 2388
1557 Ga0495658_0112207 3300046683 Bacteria 1640
1558 Ga0495658_0127114 3300046683 Unclassified 1548
1559 Ga0495669_0092746 3300046684 Unclassified 1396
1560 Ga0495613_0275641 3300046689 Bacteria 1169
1561 Ga0495613_0309616 3300046689 Unclassified 1092
1562 Ga0495670_0010108 3300046691 Bacteria 4641
1563 Ga0495670_0075781 3300046691 Bacteria 1708
1564 Ga0495671_0147908 3300046692 Bacteria 1144
1565 Ga0495649_0000009 3300046694 Bacteria 451725
1566 Ga0495600_0048821 3300046809 Unclassified 2761
1567 Ga0495660_0006541 3300046810 Bacteria 6886
1568 Ga0495660_0164436 3300046810 Bacteria 1086
1569 Ga0495672_0073342 3300047320 Bacteria 1931
1570 Ga0495680_0050171 3300047322 Unclassified 3264
1571 Ga0495683_0041431 3300047323 Unclassified 2324
1572 Ga0495687_001889 3300047443 Bacteria 18066
1573 Ga0495687_004330 3300047443 Bacteria 9657
1574 Ga0495684_0162552 3300047471 Unclassified 1665
1575 Ga0495686_0000005 3300047472 Bacteria 827143
1576 Ga0495686_0000365 3300047472 Bacteria 73281
1577 Ga0495686_0000843 3300047472 Bacteria 39372
1578 Ga0495686_0000973 3300047472 Bacteria 35208
1579 Ga0495686_0008772 3300047472 Bacteria 7368
1580 Ga0495686_0010545 3300047472 Bacteria 6566
1581 Ga0495686_0015477 3300047472 Bacteria 5206
1582 Ga0495686_0064154 3300047472 Bacteria 2274
1583 Ga0495686_0266028 3300047472 Bacteria 958
1584 Ga0495602_0102640 3300048088 Bacteria 2343
1585 Ga0496101_0399871 3300048904 Bacteria 1082
1586 Ga0496104_0324376 3300048907 Unclassified 1453
1587 Ga0496108_0106115 3300048911 Bacteria 2399
1588 Ga0496108_0111916 3300048911 Unclassified 2336
1589 Ga0496110_0065825 3300048913 Bacteria 3204
1590 Ga0496113_0233418 3300048916 Unclassified 1467
1591 Ga0496114_0078693 3300048917 Bacteria 2782
1592 Ga0496114_0118899 3300048917 Unclassified 2271
1593 Ga0496122_0000869 3300048925 Bacteria 56890
1594 Ga0496123_0004125 3300048926 Bacteria 15552
1595 Ga0496124_0021144 3300048927 Bacteria 5999
1596 Ga0496124_0029360 3300048927 Bacteria 4902
1597 Ga0496125_0134431 3300048928 Bacteria 1733
1598 Ga0496126_0207146 3300048929 Unclassified 1653
1599 Ga0495678_004234 3300049459 Bacteria 8417
1600 Ga0495678_007273 3300049459 Bacteria 5763
1601 Ga0495682_0039100 3300049460 Bacteria 1742
1602 Ga0501291_016456 3300049514 Bacteria 1130
1603 Ga0501312_003267 3300049528 Bacteria 1829
1604 Ga0501335_007048 3300049551 Bacteria 1032
1605 Ga0501031_0015181 3300049568 Bacteria 5001
1606 Ga0501031_0031393 3300049568 Bacteria 3465
1607 Ga0501031_0236319 3300049568 Bacteria 1188
1608 Ga0501032_0000817 3300049569 Bacteria 25273
1609 Ga0501032_0002512 3300049569 Bacteria 14333
1610 Ga0501032_0002569 3300049569 Bacteria 14207
1611 Ga0501032_0169165 3300049569 Unclassified 1433
1612 Ga0501032_0288523 3300049569 Bacteria 1062
1613 Ga0501033_0000004 3300049570 Bacteria 441310
1614 Ga0501033_0071834 3300049570 Bacteria 2542
1615 Ga0501033_0135840 3300049570 Unclassified 1779
1616 Ga0501034_0000709 3300049571 Bacteria 50589
1617 Ga0501034_0009937 3300049571 Bacteria 9945
1618 Ga0501034_0017803 3300049571 Bacteria 7289
1619 Ga0501034_0021380 3300049571 Bacteria 6596
1620 Ga0501034_0023872 3300049571 Bacteria 6226
1621 Ga0501034_0060569 3300049571 Bacteria 3802
1622 Ga0501034_0064590 3300049571 Bacteria 3674
1623 Ga0501034_0176773 3300049571 Unclassified 2100
1624 Ga0501034_0190011 3300049571 Unclassified 2016
1625 Ga0501036_0001790 3300049572 Bacteria 16682
1626 Ga0501036_0003646 3300049572 Bacteria 12314
1627 Ga0501036_0027902 3300049572 Bacteria 4772
1628 Ga0501036_0317033 3300049572 Unclassified 1303
1629 Ga0501037_0003854 3300049573 Bacteria 10888
1630 Ga0501037_0006833 3300049573 Bacteria 8334
1631 Ga0501037_0050842 3300049573 Unclassified 3032
1632 Ga0501037_0138878 3300049573 Unclassified 1740
1633 Ga0501038_0010410 3300049574 Bacteria 8503
1634 Ga0501038_0011039 3300049574 Bacteria 8247
1635 Ga0501038_0017411 3300049574 Bacteria 6495
1636 Ga0501038_0069951 3300049574 Bacteria 2980
1637 Ga0501038_0221080 3300049574 Bacteria 1511
1638 Ga0501038_0449725 3300049574 Bacteria 991
1639 Ga0501039_0000948 3300049575 Bacteria 21101
1640 Ga0501039_0005375 3300049575 Bacteria 9683
1641 Ga0501039_0152770 3300049575 Unclassified 1813
1642 Ga0501043_0000465 3300049579 Bacteria 36212
1643 Ga0501043_0030261 3300049579 Bacteria 4254
1644 Ga0501043_0030395 3300049579 Bacteria 4245
1645 Ga0501043_0033741 3300049579 Bacteria 4027
1646 Ga0501043_0043756 3300049579 Bacteria 3520
1647 Ga0501043_0100396 3300049579 Bacteria 2275
1648 Ga0501046_0002298 3300049580 Bacteria 18017
1649 Ga0501046_0043520 3300049580 Unclassified 3575
1650 Ga0501046_0173032 3300049580 Bacteria 1619
1651 Ga0501047_0004399 3300049581 Bacteria 13262
1652 Ga0501047_0007344 3300049581 Bacteria 10361
1653 Ga0501047_0050199 3300049581 Bacteria 4029
1654 Ga0501047_0059951 3300049581 Bacteria 3674
1655 Ga0501047_0154927 3300049581 Unclassified 2165
1656 Ga0501047_0161178 3300049581 Bacteria 2115
1657 Ga0501048_0293929 3300049582 Bacteria 1155
1658 Ga0501067_0022764 3300049583 Bacteria 3468
1659 Ga0501067_0024112 3300049583 Bacteria 3373
1660 Ga0501069_0179676 3300049585 Bacteria 1223
1661 Ga0501070_0005280 3300049586 Bacteria 11020
1662 Ga0501070_0026373 3300049586 Bacteria 4876
1663 Ga0501070_0030351 3300049586 Bacteria 4529
1664 Ga0501071_0138288 3300049587 Bacteria 1813
1665 Ga0501072_0154798 3300049588 Bacteria 1828
1666 Ga0501073_0001470 3300049589 Bacteria 17454
1667 Ga0501073_0010241 3300049589 Bacteria 6888
1668 Ga0501074_0000494 3300049590 Bacteria 24088
1669 Ga0501074_0068923 3300049590 Bacteria 2543
1670 Ga0501223_000671 3300049663 Bacteria 8175
1671 Ga0501250_004252 3300049680 Bacteria 1416
1672 Ga0501252_001538 3300049682 Bacteria 2148
1673 Ga0501257_018556 3300049686 Bacteria 1623
1674 Ga0501219_000429 3300049703 Bacteria 6863
1675 Ga0501225_0045419 3300049705 Bacteria 1216
1676 Ga0501079_0108510 3300049741 Bacteria 2155
1677 Ga0501080_0048629 3300049742 Unclassified 3947
1678 Ga0501080_0051600 3300049742 Bacteria 3827
1679 Ga0501080_0081953 3300049742 Bacteria 2997
1680 Ga0501080_0163918 3300049742 Unclassified 2052
1681 Ga0501080_0550579 3300049742 Bacteria 1027
1682 Ga0501083_0004351 3300049744 Bacteria 9976
1683 Ga0501083_0043155 3300049744 Bacteria 3055
1684 Ga0501241_010045 3300049758 Bacteria 1722
1685 Ga0501270_015694 3300049767 Bacteria 1085
1686 Ga0501035_0002001 3300049822 Bacteria 20361
1687 Ga0501035_0012389 3300049822 Bacteria 7883
1688 Ga0501035_0081321 3300049822 Bacteria 2859
1689 Ga0501035_0088522 3300049822 Bacteria 2728
1690 Ga0501035_0122658 3300049822 Bacteria 2270
1691 Ga0501035_0212910 3300049822 Unclassified 1653
1692 Ga0501035_0223392 3300049822 Unclassified 1607
1693 Ga0501044_0001393 3300049823 Bacteria 28337
1694 Ga0501044_0007592 3300049823 Bacteria 11921
1695 Ga0501044_0012072 3300049823 Bacteria 9357
1696 Ga0501044_0012302 3300049823 Bacteria 9266
1697 Ga0501044_0015990 3300049823 Bacteria 8073
1698 Ga0501044_0074210 3300049823 Bacteria 3457
1699 Ga0501044_0077143 3300049823 Bacteria 3380
1700 Ga0501044_0091250 3300049823 Bacteria 3073
1701 Ga0501044_0332222 3300049823 Bacteria 1442
1702 Ga0501045_0000121 3300049824 Bacteria 40474
1703 Ga0501284_00002 3300050005 Bacteria 220402
1704 nmdc:mga0k408_111640_c1 3300050493 Bacteria 1616
1705 nmdc:mga0k408_16428_c1 3300050493 Unclassified 4108
1706 nmdc:mga0k408_16961_c1 3300050493 Bacteria 2108
1707 nmdc:mga0k408_17298_c2 3300050493 Bacteria 1734
1708 nmdc:mga0k408_1783_c1 3300050493 Bacteria 11536
1709 nmdc:mga0k408_2480_c1 3300050493 Bacteria 9815
1710 nmdc:mga0k408_803_c1 3300050493 Bacteria 17292
1711 nmdc:mga05p37_1790_c1 3300050507 Bacteria 11844
1712 nmdc:mga05p37_192611_c1 3300050507 Unclassified 2474
1713 nmdc:mga09592_17522_c1 3300050508 Bacteria 5869
1714 nmdc:mga09592_226044_c1 3300050508 Unclassified 1621
1715 nmdc:mga09592_260887_c1 3300050508 Bacteria 1502
1716 nmdc:mga09592_2958_c1 3300050508 Bacteria 13771
1717 nmdc:mga09592_403000_c1 3300050508 Unclassified 1182
1718 nmdc:mga0qj67_34856_c1 3300050509 Bacteria 3933
1719 nmdc:mga0qj67_87151_c1 3300050509 Bacteria 2505
1720 nmdc:mga06r32_662613_c1 3300050510 Unclassified 1011
1721 nmdc:mga06r32_714193_c1 3300050510 Unclassified 967
1722 nmdc:mga06r32_8304_c1 3300050510 Bacteria 9348
1723 nmdc:mga08y16_314925_c1 3300050511 Bacteria 1611
1724 nmdc:mga08y16_71119_c1 3300050511 Bacteria 3626
1725 nmdc:mga08y16_7939_c1 3300050511 Bacteria 11107
1726 nmdc:mga0n895_108422_c1 3300050512 Bacteria 2791
1727 Ga0500578_0000063 3300053086 Bacteria 117869
1728 Ga0500578_0036846 3300053086 Bacteria 3141
1729 Ga0500644_0005907 3300053088 Bacteria 3110
1730 Ga0500644_0097116 3300053088 Unclassified 1113
1731 Ga0500646_0001109 3300053090 Bacteria 7315
1732 Ga0500583_0000076 3300053092 Bacteria 59162
1733 Ga0500583_0074734 3300053092 Bacteria 1626
1734 Ga0500651_0000455 3300053093 Bacteria 21853
1735 Ga0500651_0097400 3300053093 Bacteria 1807
1736 Ga0500651_0211007 3300053093 Bacteria 1142
1737 Ga0500651_0240862 3300053093 Bacteria 1055
1738 Ga0500650_0017765 3300053098 Bacteria 3075
1739 Ga0500650_0246764 3300053098 Bacteria 802
1740 Ga0500555_007087 3300053103 Bacteria 3187
1741 Ga0500556_0082967 3300053104 Bacteria 1214
1742 Ga0500562_000013 3300053108 Bacteria 150003
1743 Ga0500569_002068 3300053109 Bacteria 3904
1744 Ga0500594_0003368 3300053118 Bacteria 3504
1745 Ga0500608_001288 3300053122 Bacteria 8923
1746 Ga0500614_018600 3300053123 Bacteria 1582
1747 Ga0500618_000012 3300053125 Bacteria 185382
1748 Ga0500618_004252 3300053125 Bacteria 4639
1749 Ga0500618_024837 3300053125 Bacteria 1441
1750 Ga0500642_0014246 3300053130 Bacteria 2952
1751 Ga0500652_002332 3300053131 Bacteria 5709
1752 Ga0500658_0045976 3300053134 Bacteria 1766
1753 Ga0500658_0086335 3300053134 Bacteria 1350
1754 Ga0500559_0014490 3300053136 Bacteria 3332
1755 Ga0500561_0014213 3300053137 Bacteria 1743
1756 Ga0500568_0000080 3300053139 Bacteria 92694
1757 Ga0500573_0060852 3300053140 Bacteria 2163
1758 Ga0500577_0015622 3300053142 Bacteria 2376
1759 Ga0500588_0005030 3300053146 Bacteria 2908
1760 Ga0500588_0155901 3300053146 Unclassified 828
1761 Ga0500589_149285 3300053147 Bacteria 953
1762 Ga0500604_0014652 3300053151 Bacteria 2137
1763 Ga0500616_0029782 3300053153 Bacteria 3002
1764 Ga0500616_0045449 3300053153 Unclassified 2340
1765 Ga0500616_0077228 3300053153 Bacteria 1682
1766 Ga0500616_0134940 3300053153 Unclassified 1161
1767 Ga0500622_0000005 3300053156 Bacteria 502443
1768 Ga0500622_0000242 3300053156 Bacteria 56575
1769 Ga0500622_0000838 3300053156 Bacteria 26284
1770 Ga0500622_0133575 3300053156 Bacteria 1190
1771 Ga0500622_0135983 3300053156 Bacteria 1177
1772 Ga0500624_000118 3300053157 Bacteria 35980
1773 Ga0500633_0002655 3300053160 Bacteria 3730
1774 Ga0500636_0184278 3300053177 Bacteria 1118
1775 Ga0500636_0219123 3300053177 Bacteria 993
1776 Ga0500637_0052899 3300053178 Bacteria 2317
1777 Ga0500611_000060 3300053727 Bacteria 47744
1778 Ga0500645_007254 3300053730 Bacteria 3877
1779 Ga0501084_0003712 3300054114 Bacteria 12398
1780 Ga0587130_000922 3300059631 Bacteria 2053
1781 Ga0501082_0018747 3300060353 Bacteria 5962
1782 Ga0466962_0013263 3300061719 Bacteria 3963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053093 Ga0500651_0211007 Ga0500651_0211007_435_1040 197
2 3300013307 Ga0157372_10043627 Ga0157372_100436272 218
3 3300039437 Ga0436365_1630471 Ga0436365_1630471_782_1558 218
4 3300005539 Ga0068853_100005178 Ga0068853_1000051787 220
5 3300026041 Ga0207639_10008068 Ga0207639_100080685 220
6 3300053153 Ga0500616_0045449 Ga0500616_0045449_1360_2070 220
7 3300005337 Ga0070682_100016818 Ga0070682_1000168184 222
8 3300048916 Ga0496113_0233418 Ga0496113_0233418_69_752 223
9 3300005289 Ga0065704_10111806 Ga0065704_101118062 224
10 3300005539 Ga0068853_100176648 Ga0068853_1001766482 224
11 3300005544 Ga0070686_100092819 Ga0070686_1000928193 224
12 3300005616 Ga0068852_100694246 Ga0068852_1006942461 224
13 3300005842 Ga0068858_100242229 Ga0068858_1002422292 224
14 3300006163 Ga0070715_10004258 Ga0070715_100042583 224
15 3300006237 Ga0097621_100282872 Ga0097621_1002828722 224
16 3300006358 Ga0068871_100341523 Ga0068871_1003415232 224
17 3300009177 Ga0105248_10321779 Ga0105248_103217792 224
18 3300013307 Ga0157372_10882867 Ga0157372_108828672 224
19 3300014968 Ga0157379_10261167 Ga0157379_102611671 224
20 3300014969 Ga0157376_10901861 Ga0157376_109018611 224
21 3300025271 Ga0207666_1005382 Ga0207666_10053821 224
22 3300025315 Ga0207697_10042239 Ga0207697_100422392 224
23 3300025934 Ga0207686_10001595 Ga0207686_100015958 224
24 3300025941 Ga0207711_10560098 Ga0207711_105600982 224
25 3300025961 Ga0207712_10011918 Ga0207712_100119183 224
26 3300025986 Ga0207658_10222666 Ga0207658_102226662 224
27 3300026088 Ga0207641_10065270 Ga0207641_100652702 224
28 3300026118 Ga0207675_100315104 Ga0207675_1003151041 224
29 3300026142 Ga0207698_10125088 Ga0207698_101250883 224
30 3300028380 Ga0268265_10137972 Ga0268265_101379723 224
31 3300028381 Ga0268264_10392779 Ga0268264_103927792 224
32 3300035171 Ga0373946_0029924 Ga0373946_0029924_653_1429 224
33 3300046663 Ga0495635_0217823 Ga0495635_0217823_422_1198 224
34 3300049580 Ga0501046_0173032 Ga0501046_0173032_85_861 224
35 3300049583 Ga0501067_0024112 Ga0501067_0024112_2342_3118 224
36 3300049586 Ga0501070_0030351 Ga0501070_0030351_1814_2590 224
37 3300049587 Ga0501071_0138288 Ga0501071_0138288_807_1583 224
38 3300049588 Ga0501072_0154798 Ga0501072_0154798_718_1494 224
39 3300049589 Ga0501073_0010241 Ga0501073_0010241_3185_3961 224
40 3300049590 Ga0501074_0068923 Ga0501074_0068923_1629_2405 224
41 3300049742 Ga0501080_0051600 Ga0501080_0051600_2655_3431 224
42 3300049744 Ga0501083_0043155 Ga0501083_0043155_758_1534 224
43 3300049823 Ga0501044_0077143 Ga0501044_0077143_2072_2848 224
44 3300054114 Ga0501084_0003712 Ga0501084_0003712_2660_3436 224
45 3300060353 Ga0501082_0018747 Ga0501082_0018747_279_1055 224
46 3300013307 Ga0157372_11045018 Ga0157372_110450181 226
47 3300049459 Ga0495678_004234 Ga0495678_004234_7666_8355 226
48 3300053098 Ga0500650_0246764 Ga0500650_0246764_94_783 226
49 3300042876 Ga0451577_0687026 Ga0451577_0687026_11_706 227
50 3300045049 Ga0466959_0560120 Ga0466959_0560120_25_720 227
51 iso_pu_bacteria 2738541278 2738726804 227
52 3300005471 Ga0070698_100153895 Ga0070698_1001538952 228
53 3300005539 Ga0068853_100008103 Ga0068853_1000081036 228
54 3300005834 Ga0068851_10028869 Ga0068851_100288692 228
55 3300025321 Ga0207656_10021255 Ga0207656_100212552 228
56 3300026041 Ga0207639_10107882 Ga0207639_101078822 228
57 3300049823 Ga0501044_0074210 Ga0501044_0074210_512_1198 228
58 3300003322 rootL2_10062555 rootL2_1006255512 229
59 3300003323 rootH1_10055568 rootH1_100555681 229
60 3300003323 rootH1_10163117 rootH1_101631172 229
61 3300005335 Ga0070666_10210467 Ga0070666_102104671 229
62 3300028794 Ga0307515_10000059 Ga0307515_10000059136 229
63 3300031240 Ga0265320_10093821 Ga0265320_100938211 229
64 3300042876 Ga0451577_0107849 Ga0451577_0107849_1623_2402 229
65 3300044712 Ga0453684_0073768 Ga0453684_0073768_2041_2820 229
66 3300002737 JGI25162J39368_1000011 JGI25162J39368_1000011297 231
67 3300010375 Ga0105239_10000180 Ga0105239_1000018013 231
68 3300017792 Ga0163161_10045950 Ga0163161_100459503 231
69 3300025233 Ga0209437_100017 Ga0209437_100017457 231
70 3300026089 Ga0207648_10121269 Ga0207648_101212693 231
71 3300046471 Ga0495650_0045261 Ga0495650_0045261_974_1669 231
72 3300046492 Ga0495585_0000100 Ga0495585_0000100_2421_3116 231
73 3300046524 Ga0495648_0067829 Ga0495648_0067829_299_994 231
74 3300046530 Ga0495654_0030700 Ga0495654_0030700_73_768 231
75 3300046538 Ga0495609_0028955 Ga0495609_0028955_839_1534 231
76 3300046616 Ga0495668_0000121 Ga0495668_0000121_63282_63977 231
77 3300046660 Ga0495625_0012472 Ga0495625_0012472_1361_2056 231
78 3300046660 Ga0495625_0028787 Ga0495625_0028787_2421_3116 231
79 3300047472 Ga0495686_0000365 Ga0495686_0000365_56776_57471 231
80 3300053123 Ga0500614_018600 Ga0500614_018600_65_760 231
81 3300003316 rootH1_10072769 rootH1_100727692 232
82 3300015265 Ga0182005_1050424 Ga0182005_10504241 232
83 3300049459 Ga0495678_007273 Ga0495678_007273_3446_4144 232
84 3300002987 JGI25159J45721_1031796 JGI25159J45721_10317961 233
85 3300003322 rootL2_10242251 rootL2_102422513 233
86 3300003354 JGI25160J50197_1011154 JGI25160J50197_10111543 233
87 3300005341 Ga0070691_10016281 Ga0070691_100162812 233
88 3300009093 Ga0105240_10697802 Ga0105240_106978022 233
89 3300025208 Ga0209436_103559 Ga0209436_1035592 233
90 3300025284 Ga0209130_1002864 Ga0209130_10028649 233
91 3300025302 Ga0207426_1000234 Ga0207426_100023444 233
92 3300028794 Ga0307515_10000349 Ga0307515_1000034973 233
93 3300044658 Ga0466972_0006223 Ga0466972_0006223_3008_3718 233
94 3300046810 Ga0495660_0164436 Ga0495660_0164436_228_944 233
95 3300048927 Ga0496124_0029360 Ga0496124_0029360_3889_4599 233
96 3300053088 Ga0500644_0097116 Ga0500644_0097116_314_1024 233
97 3300053109 Ga0500569_002068 Ga0500569_002068_1765_2481 233
98 3300053134 Ga0500658_0045976 Ga0500658_0045976_390_1100 233
99 3300053134 Ga0500658_0086335 Ga0500658_0086335_595_1311 233
100 3300053146 Ga0500588_0155901 Ga0500588_0155901_37_747 233
101 3300053156 Ga0500622_0000005 Ga0500622_0000005_237831_238547 233
102 3300053160 Ga0500633_0002655 Ga0500633_0002655_856_1572 233
103 3300013296 Ga0157374_10204708 Ga0157374_102047082 234
104 3300013297 Ga0157378_10120313 Ga0157378_101203132 235
105 3300047472 Ga0495686_0010545 Ga0495686_0010545_1751_2485 236
106 3300003322 rootL2_10072205 rootL2_100722054 238
107 3300046507 Ga0495606_0005624 Ga0495606_0005624_10716_11438 239
108 3300046810 Ga0495660_0006541 Ga0495660_0006541_2426_3148 239
109 3300005347 Ga0070668_100429418 Ga0070668_1004294182 240
110 3300031251 Ga0265327_10071989 Ga0265327_100719892 240
111 3300005331 Ga0070670_100060961 Ga0070670_1000609615 241
112 3300005456 Ga0070678_100156646 Ga0070678_1001566462 241
113 3300025925 Ga0207650_10311268 Ga0207650_103112681 241
114 3300026121 Ga0207683_10020499 Ga0207683_100204993 241
115 3300037068 Ga0373925_0214204 Ga0373925_0214204_538_1275 241
116 3300047472 Ga0495686_0008772 Ga0495686_0008772_3515_4291 241
117 3300050493 nmdc:mga0k408_16428_c1 nmdc:mga0k408_16428_c1_2432_3208 241
118 3300003322 rootL2_10291845 rootL2_102918453 243
119 3300005288 Ga0065714_10072146 Ga0065714_100721463 243
120 3300006028 Ga0070717_10230034 Ga0070717_102300342 245
121 3300014326 Ga0157380_10425108 Ga0157380_104251081 246
122 3300031911 Ga0307412_10039962 Ga0307412_100399624 247
123 3300032004 Ga0307414_10128998 Ga0307414_101289982 247
124 3300041441 Ga0451787_841972 Ga0451787_841972_19_774 247
125 iso_pu_bacteria 2522125168 2522553646 247
126 iso_pu_bacteria 2842903701 2842908811 247
127 3300014497 Ga0182008_10006487 Ga0182008_100064874 248
128 3300014497 Ga0182008_10022002 Ga0182008_100220023 248
129 3300015262 Ga0182007_10004523 Ga0182007_100045237 248
130 3300015262 Ga0182007_10005822 Ga0182007_100058224 248
131 3300028794 Ga0307515_10263621 Ga0307515_102636211 249
132 3300031507 Ga0307509_10044062 Ga0307509_100440625 249
133 iso_pu_bacteria 2852623160 2852624814 249
134 iso_pu_bacteria 2884933994 2884936304 249
135 iso_pu_bacteria 2914759650 2914762857 249
136 iso_pu_bacteria 2919437846 2919438299 249
137 3300005617 Ga0068859_100364454 Ga0068859_1003644541 250
138 3300006931 Ga0097620_100364462 Ga0097620_1003644621 250
139 3300013307 Ga0157372_10013408 Ga0157372_100134083 250
140 iso_pu_bacteria 2585427687 2586206295 250
141 iso_pu_bacteria 2599185184 2599480397 250
142 iso_pu_bacteria 2738541278 2738725593 250
143 iso_pu_bacteria 2738541283 2738755417 250
144 iso_pu_bacteria 2738541284 2738763528 250
145 iso_pu_bacteria 2738541302 2738856156 250
146 iso_pu_bacteria 2738543023 2739303250 250
147 iso_pu_bacteria 2739367651 2739588283 250
148 iso_pu_bacteria 2739367656 2739613944 250
149 iso_pu_bacteria 2739367663 2739648559 250
150 iso_pu_bacteria 2775506987 2776615034 250
151 iso_pu_bacteria 2818991437 2819546261 250
152 iso_pu_bacteria 2818991444 2819585683 250
153 iso_pu_bacteria 2840677318 2840678479 250
154 iso_pu_bacteria 2842722452 2842723910 250
155 iso_pu_bacteria 2842909656 2842912358 250
156 iso_pu_bacteria 2849281842 2849282791 250
157 iso_pu_bacteria 2852627209 2852629509 250
158 iso_pu_bacteria 2857627736 2857629299 250
159 iso_pu_bacteria 2883068021 2883071396 250
160 iso_pu_bacteria 2895498888 2895501071 250
161 iso_pu_bacteria 2896085136 2896086297 250
162 iso_pu_bacteria 2902048731 2902049882 250
163 iso_pu_bacteria 2904445276 2904446532 250
164 iso_pu_bacteria 2911138879 2911143537 250
165 iso_pu_bacteria 2919186247 2919190268 250
166 iso_pu_bacteria 2928078545 2928083362 250
167 iso_pu_bacteria 2928147474 2928151376 250
168 iso_pu_bacteria 2929154850 2929159591 250
169 iso_pu_bacteria 2932082852 2932087293 250
170 iso_pu_bacteria 2939664404 2939668549 250
171 iso_pu_bacteria 2945997725 2945999344 250
172 iso_pu_bacteria 2954016120 2954021742 250
173 iso_pu_bacteria 2977232053 2977232945 250
174 3300003316 rootH1_10057698 rootH1_100576985 251
175 3300003322 rootL2_10082704 rootL2_100827042 251
176 3300004798 Ga0058859_10680689 Ga0058859_106806892 251
177 3300005262 Ga0065165_1000861 Ga0065165_100086127 251
178 3300005289 Ga0065704_10256341 Ga0065704_102563411 251
179 3300005841 Ga0068863_100637392 Ga0068863_1006373921 251
180 3300006881 Ga0068865_100286916 Ga0068865_1002869162 251
181 3300009093 Ga0105240_10078823 Ga0105240_100788235 251
182 3300009098 Ga0105245_10294763 Ga0105245_102947631 251
183 3300009545 Ga0105237_10030381 Ga0105237_100303814 251
184 3300010375 Ga0105239_10000992 Ga0105239_100009927 251
185 3300013102 Ga0157371_10233015 Ga0157371_102330151 251
186 3300013308 Ga0157375_10915224 Ga0157375_109152242 251
187 3300017792 Ga0163161_10150859 Ga0163161_101508592 251
188 3300017792 Ga0163161_10234859 Ga0163161_102348591 251
189 3300025292 Ga0209676_1000363 Ga0209676_100036327 251
190 3300025298 Ga0209050_1029027 Ga0209050_10290272 251
191 3300025302 Ga0207426_1039841 Ga0207426_10398412 251
192 3300025927 Ga0207687_10463974 Ga0207687_104639742 251
193 3300028794 Ga0307515_10000012 Ga0307515_10000012283 251
194 3300030731 Ga0316177_1015993 Ga0316177_10159932 251
195 3300030732 Ga0316176_1026788 Ga0316176_10267887 251
196 3300030742 Ga0316183_1099321 Ga0316183_10993217 251
197 3300030744 Ga0316181_1156971 Ga0316181_11569715 251
198 3300031250 Ga0265331_10081425 Ga0265331_100814251 251
199 3300031251 Ga0265327_10000137 Ga0265327_1000013756 251
200 3300031251 Ga0265327_10013169 Ga0265327_100131694 251
201 3300031548 Ga0307408_100018035 Ga0307408_1000180353 251
202 3300031711 Ga0265314_10088042 Ga0265314_100880422 251
203 3300031730 Ga0307516_10003288 Ga0307516_1000328817 251
204 3300031731 Ga0307405_10015968 Ga0307405_100159684 251
205 3300031824 Ga0307413_10123252 Ga0307413_101232522 251
206 3300031911 Ga0307412_10012923 Ga0307412_100129235 251
207 3300032004 Ga0307414_10027138 Ga0307414_100271383 251
208 3300032004 Ga0307414_10211709 Ga0307414_102117091 251
209 3300033179 Ga0307507_10115244 Ga0307507_101152443 251
210 3300044656 Ga0466969_0057063 Ga0466969_0057063_431_1198 251
211 3300044684 Ga0466966_0000015 Ga0466966_0000015_74511_75278 251
212 3300044719 Ga0466971_0056363 Ga0466971_0056363_368_1135 251
213 3300044735 Ga0466968_0022170 Ga0466968_0022170_1210_1977 251
214 3300045049 Ga0466959_0000030 Ga0466959_0000030_63421_64188 251
215 3300045976 Ga0466967_0844880 Ga0466967_0844880_113_880 251
216 3300003320 rootH2_10089486 rootH2_100894868 252
217 3300003320 rootH2_10135214 rootH2_101352141 252
218 3300009551 Ga0105238_10074203 Ga0105238_100742034 252
219 3300044712 Ga0453684_0143209 Ga0453684_0143209_1183_1956 252
220 3300046533 Ga0495640_0220929 Ga0495640_0220929_90_848 252
221 3300046536 Ga0495587_0119968 Ga0495587_0119968_684_1442 252
222 3300002737 JGI25162J39368_1000107 JGI25162J39368_100010767 253
223 3300003320 rootH2_10135408 rootH2_101354084 253
224 3300003323 rootH1_10067100 rootH1_100671002 253
225 3300003323 rootH1_10160751 rootH1_101607512 253
226 3300005288 Ga0065714_10010117 Ga0065714_100101173 253
227 3300005288 Ga0065714_10084798 Ga0065714_100847983 253
228 3300005327 Ga0070658_10016538 Ga0070658_100165383 253
229 3300005327 Ga0070658_10119415 Ga0070658_101194152 253
230 3300005330 Ga0070690_100413144 Ga0070690_1004131441 253
231 3300005336 Ga0070680_100093643 Ga0070680_1000936433 253
232 3300005337 Ga0070682_100000019 Ga0070682_100000019173 253
233 3300005337 Ga0070682_100337389 Ga0070682_1003373891 253
234 3300005341 Ga0070691_10079580 Ga0070691_100795801 253
235 3300005366 Ga0070659_100000648 Ga0070659_10000064818 253
236 3300005366 Ga0070659_100051464 Ga0070659_1000514642 253
237 3300005367 Ga0070667_100113747 Ga0070667_1001137472 253
238 3300005458 Ga0070681_10026227 Ga0070681_100262272 253
239 3300005459 Ga0068867_100121853 Ga0068867_1001218532 253
240 3300005530 Ga0070679_100015562 Ga0070679_1000155624 253
241 3300005530 Ga0070679_100207788 Ga0070679_1002077881 253
242 3300005539 Ga0068853_100034294 Ga0068853_1000342942 253
243 3300005543 Ga0070672_100493660 Ga0070672_1004936601 253
244 3300005544 Ga0070686_100069177 Ga0070686_1000691771 253
245 3300005563 Ga0068855_100000043 Ga0068855_100000043147 253
246 3300005563 Ga0068855_100000517 Ga0068855_10000051721 253
247 3300005563 Ga0068855_100037770 Ga0068855_1000377706 253
248 3300005563 Ga0068855_100243761 Ga0068855_1002437612 253
249 3300005577 Ga0068857_100022072 Ga0068857_1000220728 253
250 3300005616 Ga0068852_101032766 Ga0068852_1010327661 253
251 3300005841 Ga0068863_100044019 Ga0068863_1000440194 253
252 3300006195 Ga0075366_10001935 Ga0075366_100019354 253
253 3300006237 Ga0097621_100453595 Ga0097621_1004535952 253
254 3300006358 Ga0068871_100026066 Ga0068871_1000260665 253
255 3300009093 Ga0105240_10000103 Ga0105240_1000010399 253
256 3300009093 Ga0105240_10210860 Ga0105240_102108603 253
257 3300009093 Ga0105240_10394345 Ga0105240_103943452 253
258 3300009098 Ga0105245_10303081 Ga0105245_103030812 253
259 3300009098 Ga0105245_10741268 Ga0105245_107412681 253
260 3300009174 Ga0105241_10006662 Ga0105241_100066625 253
261 3300009545 Ga0105237_10014149 Ga0105237_100141492 253
262 3300009545 Ga0105237_10027910 Ga0105237_100279103 253
263 3300010375 Ga0105239_10000001 Ga0105239_10000001280 253
264 3300010375 Ga0105239_10000212 Ga0105239_1000021220 253
265 3300010375 Ga0105239_10000352 Ga0105239_1000035216 253
266 3300010375 Ga0105239_10213948 Ga0105239_102139483 253
267 3300013102 Ga0157371_10002946 Ga0157371_100029464 253
268 3300013104 Ga0157370_10006873 Ga0157370_100068733 253
269 3300013104 Ga0157370_10060798 Ga0157370_100607984 253
270 3300013297 Ga0157378_10003529 Ga0157378_1000352913 253
271 3300013306 Ga0163162_10133746 Ga0163162_101337463 253
272 3300013306 Ga0163162_10399787 Ga0163162_103997872 253
273 3300013307 Ga0157372_10000173 Ga0157372_1000017320 253
274 3300013308 Ga0157375_10006520 Ga0157375_100065202 253
275 3300013308 Ga0157375_10366265 Ga0157375_103662652 253
276 3300014968 Ga0157379_10068332 Ga0157379_100683322 253
277 3300017792 Ga0163161_10014039 Ga0163161_100140394 253
278 3300017792 Ga0163161_10110034 Ga0163161_101100342 253
279 3300025233 Ga0209437_100148 Ga0209437_10014876 253
280 3300025250 Ga0209026_1000430 Ga0209026_100043024 253
281 3300025250 Ga0209026_1000498 Ga0209026_10004988 253
282 3300025250 Ga0209026_1005565 Ga0209026_10055652 253
283 3300025258 Ga0209129_1006980 Ga0209129_10069805 253
284 3300025261 Ga0209233_1001847 Ga0209233_10018478 253
285 3300025904 Ga0207647_10002110 Ga0207647_1000211010 253
286 3300025911 Ga0207654_10011519 Ga0207654_100115193 253
287 3300025912 Ga0207707_10002289 Ga0207707_1000228915 253
288 3300025913 Ga0207695_10000019 Ga0207695_10000019488 253
289 3300025913 Ga0207695_10087504 Ga0207695_100875043 253
290 3300025914 Ga0207671_10007651 Ga0207671_100076515 253
291 3300025917 Ga0207660_10032056 Ga0207660_100320562 253
292 3300025921 Ga0207652_10034573 Ga0207652_100345733 253
293 3300025932 Ga0207690_10000766 Ga0207690_1000076618 253
294 3300025932 Ga0207690_10034698 Ga0207690_100346984 253
295 3300025949 Ga0207667_10000015 Ga0207667_10000015141 253
296 3300025949 Ga0207667_10000644 Ga0207667_1000064413 253
297 3300025949 Ga0207667_10030806 Ga0207667_100308062 253
298 3300025949 Ga0207667_10221630 Ga0207667_102216303 253
299 3300025972 Ga0207668_10207663 Ga0207668_102076632 253
300 3300025981 Ga0207640_10095408 Ga0207640_100954082 253
301 3300025986 Ga0207658_10188642 Ga0207658_101886422 253
302 3300026041 Ga0207639_10009288 Ga0207639_100092886 253
303 3300026078 Ga0207702_10000165 Ga0207702_1000016583 253
304 3300026088 Ga0207641_10041507 Ga0207641_100415074 253
305 3300026116 Ga0207674_10031003 Ga0207674_100310032 253
306 3300028794 Ga0307515_10000001 Ga0307515_100000012275 253
307 3300028794 Ga0307515_10000376 Ga0307515_1000037677 253
308 3300028794 Ga0307515_10005206 Ga0307515_1000520623 253
309 3300031251 Ga0265327_10000013 Ga0265327_10000013184 253
310 3300031456 Ga0307513_10219831 Ga0307513_102198312 253
311 3300031730 Ga0307516_10129055 Ga0307516_101290553 253
312 3300031824 Ga0307413_10177719 Ga0307413_101777192 253
313 3300032004 Ga0307414_10037255 Ga0307414_100372553 253
314 3300032004 Ga0307414_10130002 Ga0307414_101300022 253
315 3300033179 Ga0307507_10003702 Ga0307507_100037024 253
316 3300037312 Ga0395899_0000001 Ga0395899_0000001_661415_662176 253
317 3300041460 Ga0451802_0264569 Ga0451802_0264569_192_968 253
318 3300042124 Ga0450922_007563 Ga0450922_007563_79_852 253
319 3300042435 Ga0439434_0037469 Ga0439434_0037469_141_914 253
320 3300044712 Ga0453684_0309874 Ga0453684_0309874_427_1200 253
321 3300046462 Ga0495651_0330405 Ga0495651_0330405_183_944 253
322 3300046523 Ga0495644_0004653 Ga0495644_0004653_2945_3706 253
323 3300046558 Ga0495633_0000389 Ga0495633_0000389_24540_25301 253
324 3300046660 Ga0495625_0001562 Ga0495625_0001562_21115_21876 253
325 3300046665 Ga0495661_0018305 Ga0495661_0018305_599_1360 253
326 3300046691 Ga0495670_0075781 Ga0495670_0075781_781_1542 253
327 3300047472 Ga0495686_0000843 Ga0495686_0000843_34234_35001 253
328 3300047472 Ga0495686_0000973 Ga0495686_0000973_19395_20156 253
329 3300047472 Ga0495686_0064154 Ga0495686_0064154_1481_2248 253
330 3300047472 Ga0495686_0266028 Ga0495686_0266028_42_803 253
331 3300048911 Ga0496108_0111916 Ga0496108_0111916_647_1423 253
332 3300049568 Ga0501031_0031393 Ga0501031_0031393_31_792 253
333 3300049569 Ga0501032_0000817 Ga0501032_0000817_19738_20499 253
334 3300049569 Ga0501032_0002569 Ga0501032_0002569_7725_8486 253
335 3300049570 Ga0501033_0000004 Ga0501033_0000004_82507_83268 253
336 3300049571 Ga0501034_0000709 Ga0501034_0000709_21400_22161 253
337 3300049572 Ga0501036_0027902 Ga0501036_0027902_148_909 253
338 3300049573 Ga0501037_0006833 Ga0501037_0006833_3629_4390 253
339 3300049574 Ga0501038_0011039 Ga0501038_0011039_4636_5397 253
340 3300049575 Ga0501039_0000948 Ga0501039_0000948_14894_15655 253
341 3300049579 Ga0501043_0000465 Ga0501043_0000465_25241_26002 253
342 3300049581 Ga0501047_0050199 Ga0501047_0050199_1170_1931 253
343 3300049822 Ga0501035_0122658 Ga0501035_0122658_1265_2026 253
344 3300049823 Ga0501044_0001393 Ga0501044_0001393_14613_15374 253
345 3300049824 Ga0501045_0000121 Ga0501045_0000121_9807_10568 253
346 3300050493 nmdc:mga0k408_2480_c1 nmdc:mga0k408_2480_c1_7257_8018 253
347 3300050493 nmdc:mga0k408_803_c1 nmdc:mga0k408_803_c1_10511_11272 253
348 3300053125 Ga0500618_000012 Ga0500618_000012_86986_87747 253
349 3300053125 Ga0500618_004252 Ga0500618_004252_1289_2071 253
350 3300053130 Ga0500642_0014246 Ga0500642_0014246_344_1105 253
351 3300053156 Ga0500622_0000838 Ga0500622_0000838_16441_17202 253
352 3300053157 Ga0500624_000118 Ga0500624_000118_11967_12728 253
353 2162886007 SwRhRL2b_contig_900390 SwRhRL2b_0622.00003160 254
354 3300000043 ARcpr5yngRDRAFT_c004046 ARcpr5yngRDRAFT_0040462 254
355 3300001904 JGI24736J21556_1011832 JGI24736J21556_10118322 254
356 3300002067 JGI24735J21928_10000013 JGI24735J21928_10000013138 254
357 3300002077 JGI24744J21845_10004274 JGI24744J21845_100042743 254
358 3300002077 JGI24744J21845_10007841 JGI24744J21845_100078412 254
359 3300002459 JGI24751J29686_10000514 JGI24751J29686_100005145 254
360 3300002737 JGI25162J39368_1001539 JGI25162J39368_100153912 254
361 3300002774 JGI25150J39212_1000014 JGI25150J39212_100001458 254
362 3300003187 JGI25151J46595_10000042 JGI25151J46595_1000004258 254
363 3300003214 JGI25165J46597_1000157 JGI25165J46597_100015770 254
364 3300003215 JGI25153J46596_10000009 JGI25153J46596_1000000958 254
365 3300003316 rootH1_10069966 rootH1_100699664 254
366 3300003320 rootH2_10005336 rootH2_1000533652 254
367 3300003320 rootH2_10239708 rootH2_102397083 254
368 3300003322 rootL2_10011714 rootL2_100117142 254
369 3300003322 rootL2_10034522 rootL2_100345221 254
370 3300003323 rootH1_10045017 rootH1_100450176 254
371 3300003323 rootH1_10122117 rootH1_101221175 254
372 3300003323 rootH1_10176161 rootH1_101761611 254
373 3300003323 rootH1_10323063 rootH1_103230632 254
374 3300003354 JGI25160J50197_1001629 JGI25160J50197_10016299 254
375 3300003781 Ga0055536_1000019 Ga0055536_1000019124 254
376 3300003791 Ga0055530_10000770 Ga0055530_1000077030 254
377 3300005288 Ga0065714_10003901 Ga0065714_100039015 254
378 3300005288 Ga0065714_10005215 Ga0065714_100052151 254
379 3300005288 Ga0065714_10023653 Ga0065714_100236532 254
380 3300005289 Ga0065704_10000301 Ga0065704_1000030110 254
381 3300005289 Ga0065704_10008634 Ga0065704_100086341 254
382 3300005290 Ga0065712_10177389 Ga0065712_101773892 254
383 3300005293 Ga0065715_10095897 Ga0065715_100958973 254
384 3300005293 Ga0065715_10106495 Ga0065715_101064953 254
385 3300005293 Ga0065715_10172051 Ga0065715_101720511 254
386 3300005295 Ga0065707_10101033 Ga0065707_101010331 254
387 3300005327 Ga0070658_10000028 Ga0070658_1000002881 254
388 3300005327 Ga0070658_10039485 Ga0070658_100394854 254
389 3300005327 Ga0070658_10061402 Ga0070658_100614024 254
390 3300005327 Ga0070658_10141055 Ga0070658_101410551 254
391 3300005327 Ga0070658_10340798 Ga0070658_103407982 254
392 3300005328 Ga0070676_10005029 Ga0070676_100050297 254
393 3300005328 Ga0070676_10005673 Ga0070676_100056734 254
394 3300005328 Ga0070676_10014015 Ga0070676_100140155 254
395 3300005328 Ga0070676_10014253 Ga0070676_100142532 254
396 3300005328 Ga0070676_10112938 Ga0070676_101129382 254
397 3300005328 Ga0070676_10182001 Ga0070676_101820012 254
398 3300005329 Ga0070683_100012644 Ga0070683_1000126443 254
399 3300005329 Ga0070683_100024392 Ga0070683_1000243922 254
400 3300005329 Ga0070683_100061333 Ga0070683_1000613335 254
401 3300005329 Ga0070683_100068007 Ga0070683_1000680073 254
402 3300005329 Ga0070683_100091702 Ga0070683_1000917024 254
403 3300005329 Ga0070683_100508679 Ga0070683_1005086792 254
404 3300005330 Ga0070690_100003978 Ga0070690_1000039784 254
405 3300005330 Ga0070690_100080114 Ga0070690_1000801141 254
406 3300005330 Ga0070690_100143156 Ga0070690_1001431561 254
407 3300005330 Ga0070690_100251784 Ga0070690_1002517841 254
408 3300005331 Ga0070670_100008722 Ga0070670_1000087226 254
409 3300005331 Ga0070670_100021006 Ga0070670_1000210064 254
410 3300005331 Ga0070670_100034177 Ga0070670_1000341775 254
411 3300005331 Ga0070670_100101396 Ga0070670_1001013963 254
412 3300005331 Ga0070670_100110243 Ga0070670_1001102433 254
413 3300005331 Ga0070670_100118791 Ga0070670_1001187913 254
414 3300005331 Ga0070670_100212704 Ga0070670_1002127041 254
415 3300005331 Ga0070670_100300395 Ga0070670_1003003951 254
416 3300005331 Ga0070670_100305544 Ga0070670_1003055442 254
417 3300005333 Ga0070677_10004025 Ga0070677_100040252 254
418 3300005333 Ga0070677_10035856 Ga0070677_100358562 254
419 3300005334 Ga0068869_100002953 Ga0068869_1000029535 254
420 3300005334 Ga0068869_100003332 Ga0068869_1000033329 254
421 3300005334 Ga0068869_100003776 Ga0068869_1000037769 254
422 3300005334 Ga0068869_100004072 Ga0068869_1000040728 254
423 3300005334 Ga0068869_100007583 Ga0068869_1000075837 254
424 3300005334 Ga0068869_100010195 Ga0068869_1000101951 254
425 3300005334 Ga0068869_100010840 Ga0068869_1000108407 254
426 3300005334 Ga0068869_100071129 Ga0068869_1000711293 254
427 3300005334 Ga0068869_100095762 Ga0068869_1000957622 254
428 3300005334 Ga0068869_100132311 Ga0068869_1001323113 254
429 3300005334 Ga0068869_100172610 Ga0068869_1001726102 254
430 3300005334 Ga0068869_100209447 Ga0068869_1002094472 254
431 3300005335 Ga0070666_10000106 Ga0070666_1000010620 254
432 3300005335 Ga0070666_10002796 Ga0070666_100027967 254
433 3300005335 Ga0070666_10010770 Ga0070666_100107702 254
434 3300005335 Ga0070666_10027835 Ga0070666_100278352 254
435 3300005335 Ga0070666_10077510 Ga0070666_100775103 254
436 3300005335 Ga0070666_10139090 Ga0070666_101390902 254
437 3300005335 Ga0070666_10223584 Ga0070666_102235842 254
438 3300005336 Ga0070680_100016902 Ga0070680_1000169025 254
439 3300005336 Ga0070680_100079143 Ga0070680_1000791433 254
440 3300005336 Ga0070680_100139222 Ga0070680_1001392222 254
441 3300005337 Ga0070682_100009574 Ga0070682_1000095741 254
442 3300005337 Ga0070682_100043551 Ga0070682_1000435513 254
443 3300005337 Ga0070682_100075427 Ga0070682_1000754273 254
444 3300005338 Ga0068868_100000112 Ga0068868_1000001127 254
445 3300005338 Ga0068868_100006802 Ga0068868_10000680210 254
446 3300005338 Ga0068868_100007286 Ga0068868_1000072868 254
447 3300005338 Ga0068868_100012873 Ga0068868_1000128733 254
448 3300005338 Ga0068868_100013907 Ga0068868_1000139075 254
449 3300005338 Ga0068868_100019003 Ga0068868_1000190036 254
450 3300005338 Ga0068868_100031334 Ga0068868_1000313343 254
451 3300005338 Ga0068868_100055050 Ga0068868_1000550503 254
452 3300005338 Ga0068868_100158563 Ga0068868_1001585632 254
453 3300005338 Ga0068868_100179422 Ga0068868_1001794222 254
454 3300005339 Ga0070660_100008501 Ga0070660_1000085014 254
455 3300005339 Ga0070660_100024596 Ga0070660_1000245961 254
456 3300005339 Ga0070660_100025079 Ga0070660_1000250793 254
457 3300005339 Ga0070660_100030203 Ga0070660_1000302034 254
458 3300005339 Ga0070660_100263205 Ga0070660_1002632051 254
459 3300005340 Ga0070689_100019767 Ga0070689_1000197675 254
460 3300005340 Ga0070689_100067244 Ga0070689_1000672443 254
461 3300005340 Ga0070689_100124129 Ga0070689_1001241293 254
462 3300005343 Ga0070687_100251787 Ga0070687_1002517871 254
463 3300005344 Ga0070661_100007958 Ga0070661_1000079586 254
464 3300005344 Ga0070661_100008722 Ga0070661_1000087223 254
465 3300005344 Ga0070661_100034349 Ga0070661_1000343492 254
466 3300005344 Ga0070661_100174991 Ga0070661_1001749912 254
467 3300005345 Ga0070692_10128107 Ga0070692_101281072 254
468 3300005345 Ga0070692_10155983 Ga0070692_101559832 254
469 3300005347 Ga0070668_100000518 Ga0070668_10000051811 254
470 3300005347 Ga0070668_100029487 Ga0070668_1000294873 254
471 3300005347 Ga0070668_100044040 Ga0070668_1000440401 254
472 3300005347 Ga0070668_100047046 Ga0070668_1000470461 254
473 3300005347 Ga0070668_100087339 Ga0070668_1000873392 254
474 3300005353 Ga0070669_100007803 Ga0070669_1000078035 254
475 3300005353 Ga0070669_100010226 Ga0070669_1000102268 254
476 3300005353 Ga0070669_100039836 Ga0070669_1000398366 254
477 3300005353 Ga0070669_100075618 Ga0070669_1000756183 254
478 3300005353 Ga0070669_100182959 Ga0070669_1001829591 254
479 3300005353 Ga0070669_100232433 Ga0070669_1002324332 254
480 3300005353 Ga0070669_100234426 Ga0070669_1002344262 254
481 3300005354 Ga0070675_100008660 Ga0070675_1000086602 254
482 3300005354 Ga0070675_100039942 Ga0070675_1000399421 254
483 3300005354 Ga0070675_100157982 Ga0070675_1001579822 254
484 3300005354 Ga0070675_100807236 Ga0070675_1008072361 254
485 3300005355 Ga0070671_100012602 Ga0070671_1000126026 254
486 3300005355 Ga0070671_100013595 Ga0070671_1000135954 254
487 3300005355 Ga0070671_100023118 Ga0070671_1000231186 254
488 3300005355 Ga0070671_100036023 Ga0070671_1000360233 254
489 3300005355 Ga0070671_100046263 Ga0070671_1000462633 254
490 3300005355 Ga0070671_100066579 Ga0070671_1000665793 254
491 3300005355 Ga0070671_100107672 Ga0070671_1001076723 254
492 3300005355 Ga0070671_100120675 Ga0070671_1001206752 254
493 3300005356 Ga0070674_100010772 Ga0070674_1000107725 254
494 3300005356 Ga0070674_100492620 Ga0070674_1004926202 254
495 3300005356 Ga0070674_100525397 Ga0070674_1005253971 254
496 3300005364 Ga0070673_100000916 Ga0070673_10000091615 254
497 3300005364 Ga0070673_100001100 Ga0070673_1000011009 254
498 3300005364 Ga0070673_100001738 Ga0070673_1000017384 254
499 3300005364 Ga0070673_100015805 Ga0070673_1000158055 254
500 3300005364 Ga0070673_100022702 Ga0070673_1000227023 254
501 3300005364 Ga0070673_100026755 Ga0070673_1000267552 254
502 3300005364 Ga0070673_100029457 Ga0070673_1000294574 254
503 3300005364 Ga0070673_100058990 Ga0070673_1000589902 254
504 3300005364 Ga0070673_100189874 Ga0070673_1001898742 254
505 3300005364 Ga0070673_100298128 Ga0070673_1002981282 254
506 3300005364 Ga0070673_100408999 Ga0070673_1004089991 254
507 3300005365 Ga0070688_100001727 Ga0070688_1000017279 254
508 3300005365 Ga0070688_100069096 Ga0070688_1000690961 254
509 3300005365 Ga0070688_100193069 Ga0070688_1001930692 254
510 3300005365 Ga0070688_100200837 Ga0070688_1002008372 254
511 3300005366 Ga0070659_100007387 Ga0070659_1000073875 254
512 3300005366 Ga0070659_100020487 Ga0070659_1000204874 254
513 3300005366 Ga0070659_100033730 Ga0070659_1000337305 254
514 3300005366 Ga0070659_100037729 Ga0070659_1000377292 254
515 3300005366 Ga0070659_100075065 Ga0070659_1000750652 254
516 3300005366 Ga0070659_100135643 Ga0070659_1001356433 254
517 3300005366 Ga0070659_100142698 Ga0070659_1001426983 254
518 3300005367 Ga0070667_100001056 Ga0070667_1000010567 254
519 3300005367 Ga0070667_100005421 Ga0070667_1000054218 254
520 3300005367 Ga0070667_100017871 Ga0070667_1000178716 254
521 3300005367 Ga0070667_100018530 Ga0070667_1000185305 254
522 3300005367 Ga0070667_100023305 Ga0070667_1000233054 254
523 3300005367 Ga0070667_100047560 Ga0070667_1000475603 254
524 3300005367 Ga0070667_100057251 Ga0070667_1000572512 254
525 3300005367 Ga0070667_100065006 Ga0070667_1000650064 254
526 3300005367 Ga0070667_100157688 Ga0070667_1001576883 254
527 3300005367 Ga0070667_100311192 Ga0070667_1003111921 254
528 3300005367 Ga0070667_100374647 Ga0070667_1003746471 254
529 3300005367 Ga0070667_100655185 Ga0070667_1006551851 254
530 3300005438 Ga0070701_10226615 Ga0070701_102266151 254
531 3300005441 Ga0070700_100132413 Ga0070700_1001324133 254
532 3300005441 Ga0070700_100454781 Ga0070700_1004547811 254
533 3300005455 Ga0070663_100019054 Ga0070663_1000190545 254
534 3300005455 Ga0070663_100036245 Ga0070663_1000362453 254
535 3300005455 Ga0070663_100589676 Ga0070663_1005896761 254
536 3300005456 Ga0070678_100010010 Ga0070678_1000100104 254
537 3300005456 Ga0070678_100011580 Ga0070678_1000115806 254
538 3300005456 Ga0070678_100031450 Ga0070678_1000314505 254
539 3300005456 Ga0070678_100197839 Ga0070678_1001978392 254
540 3300005456 Ga0070678_100206875 Ga0070678_1002068753 254
541 3300005456 Ga0070678_100265143 Ga0070678_1002651432 254
542 3300005456 Ga0070678_100631427 Ga0070678_1006314271 254
543 3300005457 Ga0070662_100000014 Ga0070662_10000001444 254
544 3300005457 Ga0070662_100003721 Ga0070662_1000037216 254
545 3300005457 Ga0070662_100004869 Ga0070662_1000048696 254
546 3300005457 Ga0070662_100010077 Ga0070662_1000100773 254
547 3300005457 Ga0070662_100060152 Ga0070662_1000601525 254
548 3300005457 Ga0070662_100082916 Ga0070662_1000829162 254
549 3300005457 Ga0070662_100094047 Ga0070662_1000940472 254
550 3300005457 Ga0070662_100167404 Ga0070662_1001674042 254
551 3300005457 Ga0070662_100196833 Ga0070662_1001968332 254
552 3300005457 Ga0070662_100725614 Ga0070662_1007256141 254
553 3300005458 Ga0070681_10040908 Ga0070681_100409083 254
554 3300005458 Ga0070681_10042951 Ga0070681_100429511 254
555 3300005458 Ga0070681_10269908 Ga0070681_102699082 254
556 3300005458 Ga0070681_10327177 Ga0070681_103271772 254
557 3300005458 Ga0070681_10333205 Ga0070681_103332052 254
558 3300005459 Ga0068867_100003104 Ga0068867_1000031045 254
559 3300005459 Ga0068867_100004645 Ga0068867_1000046457 254
560 3300005459 Ga0068867_100006101 Ga0068867_1000061016 254
561 3300005459 Ga0068867_100016823 Ga0068867_1000168238 254
562 3300005459 Ga0068867_100059953 Ga0068867_1000599533 254
563 3300005459 Ga0068867_100074124 Ga0068867_1000741243 254
564 3300005459 Ga0068867_100080230 Ga0068867_1000802302 254
565 3300005459 Ga0068867_100091712 Ga0068867_1000917123 254
566 3300005459 Ga0068867_100108638 Ga0068867_1001086383 254
567 3300005459 Ga0068867_100121971 Ga0068867_1001219712 254
568 3300005459 Ga0068867_100249064 Ga0068867_1002490642 254
569 3300005459 Ga0068867_100291561 Ga0068867_1002915611 254
570 3300005459 Ga0068867_100448211 Ga0068867_1004482111 254
571 3300005466 Ga0070685_10018286 Ga0070685_100182862 254
572 3300005466 Ga0070685_10028761 Ga0070685_100287611 254
573 3300005466 Ga0070685_10041717 Ga0070685_100417172 254
574 3300005466 Ga0070685_10047750 Ga0070685_100477502 254
575 3300005466 Ga0070685_10091132 Ga0070685_100911323 254
576 3300005466 Ga0070685_10211309 Ga0070685_102113091 254
577 3300005466 Ga0070685_10275069 Ga0070685_102750691 254
578 3300005468 Ga0070707_100156482 Ga0070707_1001564822 254
579 3300005471 Ga0070698_100004078 Ga0070698_1000040787 254
580 3300005471 Ga0070698_100004771 Ga0070698_1000047716 254
581 3300005471 Ga0070698_100150268 Ga0070698_1001502682 254
582 3300005471 Ga0070698_100150886 Ga0070698_1001508862 254
583 3300005530 Ga0070679_100000398 Ga0070679_10000039834 254
584 3300005530 Ga0070679_100000665 Ga0070679_10000066522 254
585 3300005530 Ga0070679_100009345 Ga0070679_1000093452 254
586 3300005530 Ga0070679_100023731 Ga0070679_1000237316 254
587 3300005530 Ga0070679_100036142 Ga0070679_1000361425 254
588 3300005530 Ga0070679_100266331 Ga0070679_1002663312 254
589 3300005535 Ga0070684_100010524 Ga0070684_1000105243 254
590 3300005535 Ga0070684_100019072 Ga0070684_1000190725 254
591 3300005535 Ga0070684_100038020 Ga0070684_1000380202 254
592 3300005535 Ga0070684_100246944 Ga0070684_1002469442 254
593 3300005535 Ga0070684_100446368 Ga0070684_1004463681 254
594 3300005539 Ga0068853_100000765 Ga0068853_1000007653 254
595 3300005539 Ga0068853_100003733 Ga0068853_1000037334 254
596 3300005539 Ga0068853_100009588 Ga0068853_1000095883 254
597 3300005539 Ga0068853_100013232 Ga0068853_1000132328 254
598 3300005539 Ga0068853_100015866 Ga0068853_1000158665 254
599 3300005539 Ga0068853_100021279 Ga0068853_1000212792 254
600 3300005539 Ga0068853_100043349 Ga0068853_1000433493 254
601 3300005539 Ga0068853_100051118 Ga0068853_1000511184 254
602 3300005539 Ga0068853_100055941 Ga0068853_1000559412 254
603 3300005539 Ga0068853_100079204 Ga0068853_1000792041 254
604 3300005539 Ga0068853_100081751 Ga0068853_1000817513 254
605 3300005539 Ga0068853_100113513 Ga0068853_1001135132 254
606 3300005539 Ga0068853_100131697 Ga0068853_1001316972 254
607 3300005539 Ga0068853_100140342 Ga0068853_1001403422 254
608 3300005539 Ga0068853_100140592 Ga0068853_1001405923 254
609 3300005539 Ga0068853_100146098 Ga0068853_1001460983 254
610 3300005539 Ga0068853_100156483 Ga0068853_1001564833 254
611 3300005539 Ga0068853_100163298 Ga0068853_1001632982 254
612 3300005539 Ga0068853_100198696 Ga0068853_1001986962 254
613 3300005543 Ga0070672_100000020 Ga0070672_10000002068 254
614 3300005543 Ga0070672_100010475 Ga0070672_1000104758 254
615 3300005543 Ga0070672_100017526 Ga0070672_1000175265 254
616 3300005543 Ga0070672_100040151 Ga0070672_1000401513 254
617 3300005543 Ga0070672_100144244 Ga0070672_1001442443 254
618 3300005543 Ga0070672_100154946 Ga0070672_1001549462 254
619 3300005543 Ga0070672_100352143 Ga0070672_1003521431 254
620 3300005544 Ga0070686_100052359 Ga0070686_1000523592 254
621 3300005544 Ga0070686_100220174 Ga0070686_1002201742 254
622 3300005544 Ga0070686_100251170 Ga0070686_1002511701 254
623 3300005544 Ga0070686_100261922 Ga0070686_1002619222 254
624 3300005546 Ga0070696_100185057 Ga0070696_1001850572 254
625 3300005547 Ga0070693_100193804 Ga0070693_1001938041 254
626 3300005548 Ga0070665_100000032 Ga0070665_100000032211 254
627 3300005548 Ga0070665_100004608 Ga0070665_1000046085 254
628 3300005548 Ga0070665_100009875 Ga0070665_1000098755 254
629 3300005548 Ga0070665_100036978 Ga0070665_1000369784 254
630 3300005548 Ga0070665_100281435 Ga0070665_1002814352 254
631 3300005549 Ga0070704_100250240 Ga0070704_1002502402 254
632 3300005563 Ga0068855_100003465 Ga0068855_10000346517 254
633 3300005563 Ga0068855_100006600 Ga0068855_10000660010 254
634 3300005563 Ga0068855_100007632 Ga0068855_1000076324 254
635 3300005563 Ga0068855_100026529 Ga0068855_1000265295 254
636 3300005563 Ga0068855_100071980 Ga0068855_1000719805 254
637 3300005563 Ga0068855_100077688 Ga0068855_1000776884 254
638 3300005563 Ga0068855_100130689 Ga0068855_1001306894 254
639 3300005563 Ga0068855_100131777 Ga0068855_1001317773 254
640 3300005563 Ga0068855_100255644 Ga0068855_1002556442 254
641 3300005563 Ga0068855_100274720 Ga0068855_1002747202 254
642 3300005564 Ga0070664_100004753 Ga0070664_10000475312 254
643 3300005564 Ga0070664_100014024 Ga0070664_1000140243 254
644 3300005564 Ga0070664_100025338 Ga0070664_1000253385 254
645 3300005564 Ga0070664_100060340 Ga0070664_1000603403 254
646 3300005564 Ga0070664_100064447 Ga0070664_1000644471 254
647 3300005564 Ga0070664_100117547 Ga0070664_1001175473 254
648 3300005564 Ga0070664_100168759 Ga0070664_1001687593 254
649 3300005577 Ga0068857_100005247 Ga0068857_1000052479 254
650 3300005577 Ga0068857_100019273 Ga0068857_1000192735 254
651 3300005577 Ga0068857_100046329 Ga0068857_1000463296 254
652 3300005577 Ga0068857_100084855 Ga0068857_1000848553 254
653 3300005577 Ga0068857_100093940 Ga0068857_1000939402 254
654 3300005577 Ga0068857_100201857 Ga0068857_1002018572 254
655 3300005577 Ga0068857_100239235 Ga0068857_1002392352 254
656 3300005577 Ga0068857_100265379 Ga0068857_1002653792 254
657 3300005577 Ga0068857_100418582 Ga0068857_1004185822 254
658 3300005578 Ga0068854_100004832 Ga0068854_1000048328 254
659 3300005578 Ga0068854_100014650 Ga0068854_1000146504 254
660 3300005578 Ga0068854_100026428 Ga0068854_1000264282 254
661 3300005578 Ga0068854_100061532 Ga0068854_1000615323 254
662 3300005578 Ga0068854_100084423 Ga0068854_1000844233 254
663 3300005578 Ga0068854_100117771 Ga0068854_1001177713 254
664 3300005578 Ga0068854_100296895 Ga0068854_1002968952 254
665 3300005614 Ga0068856_100000960 Ga0068856_10000096019 254
666 3300005614 Ga0068856_100010180 Ga0068856_1000101804 254
667 3300005614 Ga0068856_100010333 Ga0068856_1000103336 254
668 3300005614 Ga0068856_100027529 Ga0068856_1000275295 254
669 3300005614 Ga0068856_100050889 Ga0068856_1000508895 254
670 3300005614 Ga0068856_100166108 Ga0068856_1001661083 254
671 3300005615 Ga0070702_100015101 Ga0070702_1000151013 254
672 3300005615 Ga0070702_100016189 Ga0070702_1000161894 254
673 3300005616 Ga0068852_100000744 Ga0068852_10000074415 254
674 3300005616 Ga0068852_100003125 Ga0068852_1000031254 254
675 3300005616 Ga0068852_100011448 Ga0068852_1000114484 254
676 3300005616 Ga0068852_100016745 Ga0068852_1000167454 254
677 3300005616 Ga0068852_100025634 Ga0068852_1000256344 254
678 3300005616 Ga0068852_100030572 Ga0068852_1000305724 254
679 3300005616 Ga0068852_100039952 Ga0068852_1000399522 254
680 3300005616 Ga0068852_100044878 Ga0068852_1000448784 254
681 3300005616 Ga0068852_100046203 Ga0068852_1000462031 254
682 3300005616 Ga0068852_100059484 Ga0068852_1000594842 254
683 3300005616 Ga0068852_100060932 Ga0068852_1000609323 254
684 3300005616 Ga0068852_100098257 Ga0068852_1000982573 254
685 3300005616 Ga0068852_100290605 Ga0068852_1002906052 254
686 3300005617 Ga0068859_100000024 Ga0068859_10000002421 254
687 3300005617 Ga0068859_100005138 Ga0068859_1000051382 254
688 3300005617 Ga0068859_100011212 Ga0068859_10001121210 254
689 3300005617 Ga0068859_100015329 Ga0068859_1000153295 254
690 3300005617 Ga0068859_100017243 Ga0068859_1000172438 254
691 3300005617 Ga0068859_100056651 Ga0068859_1000566512 254
692 3300005617 Ga0068859_100077822 Ga0068859_1000778223 254
693 3300005617 Ga0068859_100115801 Ga0068859_1001158013 254
694 3300005617 Ga0068859_100163857 Ga0068859_1001638572 254
695 3300005617 Ga0068859_100251807 Ga0068859_1002518072 254
696 3300005617 Ga0068859_100307533 Ga0068859_1003075332 254
697 3300005617 Ga0068859_100321072 Ga0068859_1003210722 254
698 3300005617 Ga0068859_100454948 Ga0068859_1004549482 254
699 3300005617 Ga0068859_100583039 Ga0068859_1005830392 254
700 3300005618 Ga0068864_100000392 Ga0068864_10000039230 254
701 3300005618 Ga0068864_100001230 Ga0068864_1000012307 254
702 3300005618 Ga0068864_100004478 Ga0068864_10000447813 254
703 3300005618 Ga0068864_100010987 Ga0068864_1000109874 254
704 3300005618 Ga0068864_100066233 Ga0068864_1000662333 254
705 3300005618 Ga0068864_100078396 Ga0068864_1000783962 254
706 3300005618 Ga0068864_100105531 Ga0068864_1001055311 254
707 3300005618 Ga0068864_100144940 Ga0068864_1001449401 254
708 3300005618 Ga0068864_100342511 Ga0068864_1003425112 254
709 3300005618 Ga0068864_100801446 Ga0068864_1008014461 254
710 3300005718 Ga0068866_10003950 Ga0068866_100039503 254
711 3300005718 Ga0068866_10004497 Ga0068866_100044976 254
712 3300005718 Ga0068866_10026702 Ga0068866_100267024 254
713 3300005718 Ga0068866_10108849 Ga0068866_101088491 254
714 3300005719 Ga0068861_100001296 Ga0068861_10000129613 254
715 3300005719 Ga0068861_100002876 Ga0068861_1000028768 254
716 3300005719 Ga0068861_100011713 Ga0068861_1000117135 254
717 3300005719 Ga0068861_100255305 Ga0068861_1002553052 254
718 3300005719 Ga0068861_100745992 Ga0068861_1007459921 254
719 3300005834 Ga0068851_10002179 Ga0068851_100021793 254
720 3300005834 Ga0068851_10033944 Ga0068851_100339443 254
721 3300005834 Ga0068851_10139084 Ga0068851_101390842 254
722 3300005834 Ga0068851_10236759 Ga0068851_102367592 254
723 3300005840 Ga0068870_10099579 Ga0068870_100995792 254
724 3300005840 Ga0068870_10161340 Ga0068870_101613402 254
725 3300005841 Ga0068863_100002032 Ga0068863_1000020327 254
726 3300005841 Ga0068863_100041019 Ga0068863_1000410195 254
727 3300005841 Ga0068863_100081367 Ga0068863_1000813673 254
728 3300005841 Ga0068863_100162063 Ga0068863_1001620632 254
729 3300005841 Ga0068863_100176131 Ga0068863_1001761312 254
730 3300005841 Ga0068863_100222387 Ga0068863_1002223871 254
731 3300005841 Ga0068863_100355858 Ga0068863_1003558582 254
732 3300005841 Ga0068863_100613425 Ga0068863_1006134252 254
733 3300005842 Ga0068858_100000342 Ga0068858_10000034239 254
734 3300005842 Ga0068858_100001879 Ga0068858_10000187920 254
735 3300005842 Ga0068858_100040620 Ga0068858_1000406204 254
736 3300005842 Ga0068858_100073111 Ga0068858_1000731115 254
737 3300005842 Ga0068858_100084635 Ga0068858_1000846353 254
738 3300005842 Ga0068858_100322335 Ga0068858_1003223352 254
739 3300005842 Ga0068858_100341294 Ga0068858_1003412942 254
740 3300005842 Ga0068858_100344609 Ga0068858_1003446092 254
741 3300005842 Ga0068858_100376464 Ga0068858_1003764642 254
742 3300005843 Ga0068860_100001341 Ga0068860_10000134110 254
743 3300005843 Ga0068860_100001513 Ga0068860_1000015136 254
744 3300005843 Ga0068860_100004887 Ga0068860_1000048872 254
745 3300005843 Ga0068860_100008647 Ga0068860_1000086474 254
746 3300005843 Ga0068860_100008887 Ga0068860_1000088879 254
747 3300005843 Ga0068860_100012453 Ga0068860_1000124536 254
748 3300005843 Ga0068860_100041777 Ga0068860_1000417773 254
749 3300005843 Ga0068860_100056124 Ga0068860_1000561244 254
750 3300005843 Ga0068860_100061958 Ga0068860_1000619583 254
751 3300005843 Ga0068860_100145406 Ga0068860_1001454061 254
752 3300005843 Ga0068860_100266244 Ga0068860_1002662442 254
753 3300005843 Ga0068860_100302123 Ga0068860_1003021232 254
754 3300005843 Ga0068860_100544434 Ga0068860_1005444341 254
755 3300005844 Ga0068862_100001074 Ga0068862_10000107420 254
756 3300005844 Ga0068862_100029514 Ga0068862_1000295145 254
757 3300005844 Ga0068862_100481473 Ga0068862_1004814731 254
758 3300005844 Ga0068862_100617136 Ga0068862_1006171362 254
759 3300005983 Ga0081540_1002949 Ga0081540_10029497 254
760 3300005985 Ga0081539_10001169 Ga0081539_1000116914 254
761 3300006163 Ga0070715_10023552 Ga0070715_100235523 254
762 3300006173 Ga0070716_100154275 Ga0070716_1001542751 254
763 3300006195 Ga0075366_10061467 Ga0075366_100614672 254
764 3300006195 Ga0075366_10249471 Ga0075366_102494712 254
765 3300006195 Ga0075366_10270045 Ga0075366_102700451 254
766 3300006195 Ga0075366_10352545 Ga0075366_103525452 254
767 3300006237 Ga0097621_100000710 Ga0097621_10000071018 254
768 3300006237 Ga0097621_100001338 Ga0097621_10000133818 254
769 3300006237 Ga0097621_100004240 Ga0097621_1000042407 254
770 3300006237 Ga0097621_100009001 Ga0097621_1000090014 254
771 3300006237 Ga0097621_100012836 Ga0097621_1000128366 254
772 3300006237 Ga0097621_100038073 Ga0097621_1000380732 254
773 3300006237 Ga0097621_100138438 Ga0097621_1001384383 254
774 3300006237 Ga0097621_100193520 Ga0097621_1001935201 254
775 3300006237 Ga0097621_100251141 Ga0097621_1002511412 254
776 3300006237 Ga0097621_100300793 Ga0097621_1003007932 254
777 3300006358 Ga0068871_100000044 Ga0068871_1000000443 254
778 3300006358 Ga0068871_100000294 Ga0068871_1000002949 254
779 3300006358 Ga0068871_100008618 Ga0068871_1000086183 254
780 3300006358 Ga0068871_100015163 Ga0068871_1000151634 254
781 3300006358 Ga0068871_100024438 Ga0068871_1000244382 254
782 3300006358 Ga0068871_100026333 Ga0068871_1000263336 254
783 3300006358 Ga0068871_100038510 Ga0068871_1000385103 254
784 3300006358 Ga0068871_100232381 Ga0068871_1002323812 254
785 3300006358 Ga0068871_100258066 Ga0068871_1002580662 254
786 3300006844 Ga0075428_100006050 Ga0075428_1000060509 254
787 3300006844 Ga0075428_100161324 Ga0075428_1001613244 254
788 3300006844 Ga0075428_100419177 Ga0075428_1004191771 254
789 3300006846 Ga0075430_100001157 Ga0075430_10000115722 254
790 3300006846 Ga0075430_100365311 Ga0075430_1003653111 254
791 3300006847 Ga0075431_100003874 Ga0075431_10000387416 254
792 3300006847 Ga0075431_100010980 Ga0075431_1000109807 254
793 3300006871 Ga0075434_100109091 Ga0075434_1001090913 254
794 3300006880 Ga0075429_100001234 Ga0075429_10000123423 254
795 3300006880 Ga0075429_100019684 Ga0075429_1000196846 254
796 3300006880 Ga0075429_100062699 Ga0075429_1000626993 254
797 3300006881 Ga0068865_100000909 Ga0068865_10000090916 254
798 3300006881 Ga0068865_100002711 Ga0068865_1000027114 254
799 3300006881 Ga0068865_100003364 Ga0068865_1000033647 254
800 3300006881 Ga0068865_100033276 Ga0068865_1000332763 254
801 3300006881 Ga0068865_100185736 Ga0068865_1001857362 254
802 3300006881 Ga0068865_100195359 Ga0068865_1001953592 254
803 3300006881 Ga0068865_100205761 Ga0068865_1002057612 254
804 3300006881 Ga0068865_100326345 Ga0068865_1003263451 254
805 3300006931 Ga0097620_100000024 Ga0097620_10000002421 254
806 3300006931 Ga0097620_100005138 Ga0097620_1000051382 254
807 3300006931 Ga0097620_100011212 Ga0097620_10001121210 254
808 3300006931 Ga0097620_100015329 Ga0097620_1000153295 254
809 3300006931 Ga0097620_100017242 Ga0097620_1000172428 254
810 3300006931 Ga0097620_100056649 Ga0097620_1000566495 254
811 3300006931 Ga0097620_100077818 Ga0097620_1000778183 254
812 3300006931 Ga0097620_100115799 Ga0097620_1001157993 254
813 3300006931 Ga0097620_100163864 Ga0097620_1001638642 254
814 3300006931 Ga0097620_100251820 Ga0097620_1002518202 254
815 3300006931 Ga0097620_100307525 Ga0097620_1003075252 254
816 3300006931 Ga0097620_100321095 Ga0097620_1003210952 254
817 3300006931 Ga0097620_100454925 Ga0097620_1004549252 254
818 3300006931 Ga0097620_100583096 Ga0097620_1005830962 254
819 3300009036 Ga0105244_10089637 Ga0105244_100896372 254
820 3300009093 Ga0105240_10000800 Ga0105240_1000080017 254
821 3300009093 Ga0105240_10001677 Ga0105240_1000167727 254
822 3300009093 Ga0105240_10001787 Ga0105240_1000178711 254
823 3300009093 Ga0105240_10004962 Ga0105240_100049626 254
824 3300009093 Ga0105240_10018800 Ga0105240_100188007 254
825 3300009093 Ga0105240_10027308 Ga0105240_100273085 254
826 3300009093 Ga0105240_10065900 Ga0105240_100659005 254
827 3300009093 Ga0105240_10084323 Ga0105240_100843232 254
828 3300009093 Ga0105240_10106027 Ga0105240_101060274 254
829 3300009093 Ga0105240_10144220 Ga0105240_101442201 254
830 3300009093 Ga0105240_10165337 Ga0105240_101653372 254
831 3300009093 Ga0105240_10204965 Ga0105240_102049652 254
832 3300009093 Ga0105240_10441456 Ga0105240_104414562 254
833 3300009093 Ga0105240_10686775 Ga0105240_106867752 254
834 3300009094 Ga0111539_10000458 Ga0111539_100004587 254
835 3300009094 Ga0111539_10011561 Ga0111539_100115614 254
836 3300009094 Ga0111539_10244806 Ga0111539_102448062 254
837 3300009094 Ga0111539_10291175 Ga0111539_102911751 254
838 3300009098 Ga0105245_10062678 Ga0105245_100626783 254
839 3300009101 Ga0105247_10011352 Ga0105247_100113523 254
840 3300009101 Ga0105247_10040947 Ga0105247_100409474 254
841 3300009101 Ga0105247_10073788 Ga0105247_100737882 254
842 3300009101 Ga0105247_10160789 Ga0105247_101607892 254
843 3300009147 Ga0114129_10011078 Ga0114129_100110787 254
844 3300009147 Ga0114129_10046449 Ga0114129_100464493 254
845 3300009147 Ga0114129_10117314 Ga0114129_101173141 254
846 3300009148 Ga0105243_10153696 Ga0105243_101536961 254
847 3300009174 Ga0105241_10000777 Ga0105241_1000077714 254
848 3300009174 Ga0105241_10001809 Ga0105241_1000180915 254
849 3300009174 Ga0105241_10002168 Ga0105241_1000216816 254
850 3300009174 Ga0105241_10061480 Ga0105241_100614805 254
851 3300009174 Ga0105241_10074809 Ga0105241_100748092 254
852 3300009174 Ga0105241_10122217 Ga0105241_101222172 254
853 3300009174 Ga0105241_10151185 Ga0105241_101511853 254
854 3300009174 Ga0105241_10706185 Ga0105241_107061851 254
855 3300009176 Ga0105242_10010519 Ga0105242_100105198 254
856 3300009176 Ga0105242_10015262 Ga0105242_100152623 254
857 3300009176 Ga0105242_10023480 Ga0105242_100234805 254
858 3300009176 Ga0105242_10026092 Ga0105242_100260922 254
859 3300009176 Ga0105242_10026677 Ga0105242_100266775 254
860 3300009176 Ga0105242_10064176 Ga0105242_100641763 254
861 3300009176 Ga0105242_10151950 Ga0105242_101519502 254
862 3300009176 Ga0105242_10159749 Ga0105242_101597493 254
863 3300009176 Ga0105242_10365793 Ga0105242_103657932 254
864 3300009176 Ga0105242_10529103 Ga0105242_105291032 254
865 3300009177 Ga0105248_10045826 Ga0105248_100458267 254
866 3300009545 Ga0105237_10000578 Ga0105237_1000057820 254
867 3300009545 Ga0105237_10003264 Ga0105237_1000326421 254
868 3300009545 Ga0105237_10005389 Ga0105237_1000538911 254
869 3300009545 Ga0105237_10007421 Ga0105237_100074219 254
870 3300009545 Ga0105237_10007918 Ga0105237_100079186 254
871 3300009545 Ga0105237_10011343 Ga0105237_100113436 254
872 3300009545 Ga0105237_10020903 Ga0105237_100209036 254
873 3300009545 Ga0105237_10035118 Ga0105237_100351183 254
874 3300009545 Ga0105237_10039752 Ga0105237_100397524 254
875 3300009545 Ga0105237_10158977 Ga0105237_101589772 254
876 3300009545 Ga0105237_10594553 Ga0105237_105945531 254
877 3300009551 Ga0105238_10000592 Ga0105238_1000059228 254
878 3300009551 Ga0105238_10039464 Ga0105238_100394643 254
879 3300009551 Ga0105238_10042180 Ga0105238_100421801 254
880 3300009551 Ga0105238_10048733 Ga0105238_100487333 254
881 3300009553 Ga0105249_10001375 Ga0105249_1000137518 254
882 3300009553 Ga0105249_10001970 Ga0105249_100019706 254
883 3300009553 Ga0105249_10025557 Ga0105249_100255574 254
884 3300009553 Ga0105249_10026752 Ga0105249_100267525 254
885 3300009553 Ga0105249_10054779 Ga0105249_100547793 254
886 3300009553 Ga0105249_10059532 Ga0105249_100595322 254
887 3300009553 Ga0105249_10066344 Ga0105249_100663443 254
888 3300009553 Ga0105249_10074491 Ga0105249_100744913 254
889 3300009553 Ga0105249_10182862 Ga0105249_101828623 254
890 3300009553 Ga0105249_10245008 Ga0105249_102450082 254
891 3300009553 Ga0105249_10474469 Ga0105249_104744691 254
892 3300009553 Ga0105249_10614255 Ga0105249_106142551 254
893 3300010375 Ga0105239_10000007 Ga0105239_10000007214 254
894 3300010375 Ga0105239_10001405 Ga0105239_100014057 254
895 3300010375 Ga0105239_10007439 Ga0105239_100074395 254
896 3300010375 Ga0105239_10016055 Ga0105239_100160559 254
897 3300010375 Ga0105239_10056681 Ga0105239_100566814 254
898 3300010375 Ga0105239_10073160 Ga0105239_100731603 254
899 3300010375 Ga0105239_10076740 Ga0105239_100767403 254
900 3300011119 Ga0105246_10051377 Ga0105246_100513772 254
901 3300011119 Ga0105246_10105345 Ga0105246_101053452 254
902 3300011119 Ga0105246_10409043 Ga0105246_104090432 254
903 3300013100 Ga0157373_10000245 Ga0157373_1000024512 254
904 3300013100 Ga0157373_10002264 Ga0157373_1000226410 254
905 3300013100 Ga0157373_10002904 Ga0157373_1000290412 254
906 3300013100 Ga0157373_10003171 Ga0157373_1000317111 254
907 3300013100 Ga0157373_10005746 Ga0157373_100057465 254
908 3300013100 Ga0157373_10011196 Ga0157373_100111968 254
909 3300013100 Ga0157373_10020458 Ga0157373_100204586 254
910 3300013100 Ga0157373_10026338 Ga0157373_100263383 254
911 3300013100 Ga0157373_10029204 Ga0157373_100292044 254
912 3300013100 Ga0157373_10080241 Ga0157373_100802413 254
913 3300013100 Ga0157373_10100605 Ga0157373_101006052 254
914 3300013100 Ga0157373_10106476 Ga0157373_101064763 254
915 3300013100 Ga0157373_10196846 Ga0157373_101968462 254
916 3300013100 Ga0157373_10355366 Ga0157373_103553661 254
917 3300013102 Ga0157371_10000418 Ga0157371_1000041818 254
918 3300013102 Ga0157371_10000851 Ga0157371_1000085132 254
919 3300013102 Ga0157371_10002731 Ga0157371_1000273110 254
920 3300013102 Ga0157371_10005012 Ga0157371_100050125 254
921 3300013102 Ga0157371_10008478 Ga0157371_100084788 254
922 3300013102 Ga0157371_10008985 Ga0157371_100089852 254
923 3300013102 Ga0157371_10012488 Ga0157371_100124886 254
924 3300013102 Ga0157371_10018679 Ga0157371_100186793 254
925 3300013102 Ga0157371_10041568 Ga0157371_100415684 254
926 3300013102 Ga0157371_10041592 Ga0157371_100415924 254
927 3300013102 Ga0157371_10054941 Ga0157371_100549413 254
928 3300013102 Ga0157371_10092815 Ga0157371_100928151 254
929 3300013102 Ga0157371_10105367 Ga0157371_101053672 254
930 3300013102 Ga0157371_10140079 Ga0157371_101400791 254
931 3300013102 Ga0157371_10173572 Ga0157371_101735722 254
932 3300013102 Ga0157371_10321193 Ga0157371_103211932 254
933 3300013102 Ga0157371_10442554 Ga0157371_104425542 254
934 3300013102 Ga0157371_10459164 Ga0157371_104591641 254
935 3300013104 Ga0157370_10000197 Ga0157370_1000019754 254
936 3300013104 Ga0157370_10001620 Ga0157370_1000162018 254
937 3300013104 Ga0157370_10001816 Ga0157370_1000181622 254
938 3300013104 Ga0157370_10002183 Ga0157370_1000218310 254
939 3300013104 Ga0157370_10002188 Ga0157370_100021886 254
940 3300013104 Ga0157370_10017062 Ga0157370_100170628 254
941 3300013104 Ga0157370_10030722 Ga0157370_100307225 254
942 3300013104 Ga0157370_10045646 Ga0157370_100456462 254
943 3300013104 Ga0157370_10066900 Ga0157370_100669002 254
944 3300013104 Ga0157370_10079953 Ga0157370_100799531 254
945 3300013104 Ga0157370_10129166 Ga0157370_101291663 254
946 3300013104 Ga0157370_10144531 Ga0157370_101445314 254
947 3300013104 Ga0157370_10151989 Ga0157370_101519891 254
948 3300013104 Ga0157370_10173586 Ga0157370_101735863 254
949 3300013104 Ga0157370_10214603 Ga0157370_102146032 254
950 3300013104 Ga0157370_10367379 Ga0157370_103673791 254
951 3300013105 Ga0157369_10000031 Ga0157369_1000003132 254
952 3300013105 Ga0157369_10020641 Ga0157369_100206416 254
953 3300013105 Ga0157369_10041671 Ga0157369_100416713 254
954 3300013105 Ga0157369_10041955 Ga0157369_100419552 254
955 3300013105 Ga0157369_10069522 Ga0157369_100695224 254
956 3300013105 Ga0157369_10120236 Ga0157369_101202362 254
957 3300013105 Ga0157369_10123745 Ga0157369_101237451 254
958 3300013105 Ga0157369_10194621 Ga0157369_101946212 254
959 3300013105 Ga0157369_10363349 Ga0157369_103633492 254
960 3300013105 Ga0157369_10486176 Ga0157369_104861762 254
961 3300013105 Ga0157369_10640308 Ga0157369_106403081 254
962 3300013296 Ga0157374_10000914 Ga0157374_100009146 254
963 3300013296 Ga0157374_10001221 Ga0157374_1000122110 254
964 3300013296 Ga0157374_10008347 Ga0157374_100083478 254
965 3300013296 Ga0157374_10013769 Ga0157374_100137695 254
966 3300013296 Ga0157374_10024325 Ga0157374_100243255 254
967 3300013296 Ga0157374_10033177 Ga0157374_100331776 254
968 3300013296 Ga0157374_10052361 Ga0157374_100523612 254
969 3300013296 Ga0157374_10052861 Ga0157374_100528612 254
970 3300013296 Ga0157374_10056468 Ga0157374_100564683 254
971 3300013296 Ga0157374_10123615 Ga0157374_101236152 254
972 3300013296 Ga0157374_10358487 Ga0157374_103584872 254
973 3300013296 Ga0157374_10471158 Ga0157374_104711582 254
974 3300013296 Ga0157374_10753713 Ga0157374_107537131 254
975 3300013297 Ga0157378_10014484 Ga0157378_100144846 254
976 3300013297 Ga0157378_10020345 Ga0157378_100203456 254
977 3300013297 Ga0157378_10027912 Ga0157378_100279122 254
978 3300013297 Ga0157378_10053119 Ga0157378_100531193 254
979 3300013297 Ga0157378_10070381 Ga0157378_100703812 254
980 3300013297 Ga0157378_10097250 Ga0157378_100972502 254
981 3300013297 Ga0157378_10108892 Ga0157378_101088923 254
982 3300013297 Ga0157378_10132069 Ga0157378_101320693 254
983 3300013297 Ga0157378_10198577 Ga0157378_101985773 254
984 3300013297 Ga0157378_10356474 Ga0157378_103564742 254
985 3300013297 Ga0157378_10407866 Ga0157378_104078662 254
986 3300013306 Ga0163162_10000010 Ga0163162_10000010251 254
987 3300013306 Ga0163162_10000093 Ga0163162_1000009345 254
988 3300013306 Ga0163162_10000131 Ga0163162_1000013122 254
989 3300013306 Ga0163162_10000154 Ga0163162_100001542 254
990 3300013306 Ga0163162_10000189 Ga0163162_100001899 254
991 3300013306 Ga0163162_10001288 Ga0163162_100012882 254
992 3300013306 Ga0163162_10001546 Ga0163162_100015467 254
993 3300013306 Ga0163162_10004949 Ga0163162_100049496 254
994 3300013306 Ga0163162_10010730 Ga0163162_100107306 254
995 3300013306 Ga0163162_10011210 Ga0163162_100112105 254
996 3300013306 Ga0163162_10011453 Ga0163162_100114537 254
997 3300013306 Ga0163162_10034902 Ga0163162_100349024 254
998 3300013306 Ga0163162_10107364 Ga0163162_101073644 254
999 3300013306 Ga0163162_10131816 Ga0163162_101318163 254
1000 3300013306 Ga0163162_10139229 Ga0163162_101392293 254
1001 3300013306 Ga0163162_10729791 Ga0163162_107297912 254
1002 3300013306 Ga0163162_11081636 Ga0163162_110816362 254
1003 3300013307 Ga0157372_10000073 Ga0157372_1000007324 254
1004 3300013307 Ga0157372_10002062 Ga0157372_100020624 254
1005 3300013307 Ga0157372_10003396 Ga0157372_1000339610 254
1006 3300013307 Ga0157372_10046553 Ga0157372_100465533 254
1007 3300013307 Ga0157372_10050546 Ga0157372_100505465 254
1008 3300013307 Ga0157372_10052360 Ga0157372_100523605 254
1009 3300013307 Ga0157372_10068835 Ga0157372_100688353 254
1010 3300013307 Ga0157372_10086369 Ga0157372_100863693 254
1011 3300013307 Ga0157372_10112740 Ga0157372_101127403 254
1012 3300013307 Ga0157372_10140801 Ga0157372_101408013 254
1013 3300013307 Ga0157372_10143555 Ga0157372_101435553 254
1014 3300013307 Ga0157372_10154478 Ga0157372_101544782 254
1015 3300013307 Ga0157372_10171083 Ga0157372_101710834 254
1016 3300013307 Ga0157372_10177767 Ga0157372_101777671 254
1017 3300013307 Ga0157372_10180428 Ga0157372_101804282 254
1018 3300013307 Ga0157372_10208694 Ga0157372_102086943 254
1019 3300013307 Ga0157372_10218144 Ga0157372_102181443 254
1020 3300013307 Ga0157372_10247343 Ga0157372_102473433 254
1021 3300013307 Ga0157372_10317509 Ga0157372_103175092 254
1022 3300013307 Ga0157372_10401987 Ga0157372_104019871 254
1023 3300013307 Ga0157372_10628770 Ga0157372_106287702 254
1024 3300013307 Ga0157372_10799020 Ga0157372_107990201 254
1025 3300013307 Ga0157372_11287192 Ga0157372_112871921 254
1026 3300013308 Ga0157375_10000850 Ga0157375_1000085016 254
1027 3300013308 Ga0157375_10001388 Ga0157375_100013883 254
1028 3300013308 Ga0157375_10001823 Ga0157375_1000182317 254
1029 3300013308 Ga0157375_10006292 Ga0157375_100062925 254
1030 3300013308 Ga0157375_10013251 Ga0157375_100132517 254
1031 3300013308 Ga0157375_10021961 Ga0157375_100219616 254
1032 3300013308 Ga0157375_10043902 Ga0157375_100439023 254
1033 3300013308 Ga0157375_10071904 Ga0157375_100719043 254
1034 3300013308 Ga0157375_10110719 Ga0157375_101107195 254
1035 3300013308 Ga0157375_10134957 Ga0157375_101349573 254
1036 3300013308 Ga0157375_10167443 Ga0157375_101674432 254
1037 3300013308 Ga0157375_10201446 Ga0157375_102014462 254
1038 3300013308 Ga0157375_10376650 Ga0157375_103766502 254
1039 3300013308 Ga0157375_10422202 Ga0157375_104222022 254
1040 3300013308 Ga0157375_10552617 Ga0157375_105526172 254
1041 3300014325 Ga0163163_10000471 Ga0163163_1000047127 254
1042 3300014325 Ga0163163_10000825 Ga0163163_1000082515 254
1043 3300014325 Ga0163163_10002272 Ga0163163_1000227213 254
1044 3300014325 Ga0163163_10009933 Ga0163163_100099338 254
1045 3300014325 Ga0163163_10080403 Ga0163163_100804033 254
1046 3300014325 Ga0163163_10101861 Ga0163163_101018611 254
1047 3300014326 Ga0157380_10003936 Ga0157380_100039367 254
1048 3300014326 Ga0157380_10018266 Ga0157380_100182666 254
1049 3300014326 Ga0157380_10023605 Ga0157380_100236053 254
1050 3300014326 Ga0157380_10073624 Ga0157380_100736245 254
1051 3300014326 Ga0157380_10154016 Ga0157380_101540162 254
1052 3300014497 Ga0182008_10000024 Ga0182008_1000002448 254
1053 3300014497 Ga0182008_10000082 Ga0182008_1000008252 254
1054 3300014497 Ga0182008_10000503 Ga0182008_100005033 254
1055 3300014497 Ga0182008_10012897 Ga0182008_100128975 254
1056 3300014745 Ga0157377_10001438 Ga0157377_100014385 254
1057 3300014745 Ga0157377_10009315 Ga0157377_100093153 254
1058 3300014745 Ga0157377_10013943 Ga0157377_100139435 254
1059 3300014745 Ga0157377_10018718 Ga0157377_100187183 254
1060 3300014745 Ga0157377_10039544 Ga0157377_100395441 254
1061 3300014745 Ga0157377_10171509 Ga0157377_101715092 254
1062 3300014745 Ga0157377_10374994 Ga0157377_103749941 254
1063 3300014968 Ga0157379_10001930 Ga0157379_100019308 254
1064 3300014968 Ga0157379_10005329 Ga0157379_100053295 254
1065 3300014968 Ga0157379_10056117 Ga0157379_100561174 254
1066 3300014968 Ga0157379_10069695 Ga0157379_100696953 254
1067 3300014968 Ga0157379_10123724 Ga0157379_101237242 254
1068 3300014968 Ga0157379_10143965 Ga0157379_101439651 254
1069 3300014968 Ga0157379_10185128 Ga0157379_101851283 254
1070 3300014969 Ga0157376_10000916 Ga0157376_100009164 254
1071 3300014969 Ga0157376_10001409 Ga0157376_1000140911 254
1072 3300014969 Ga0157376_10006039 Ga0157376_100060393 254
1073 3300014969 Ga0157376_10287865 Ga0157376_102878652 254
1074 3300014969 Ga0157376_10775446 Ga0157376_107754462 254
1075 3300015261 Ga0182006_1000373 Ga0182006_100037331 254
1076 3300015261 Ga0182006_1002727 Ga0182006_10027274 254
1077 3300015261 Ga0182006_1004126 Ga0182006_10041265 254
1078 3300015261 Ga0182006_1005808 Ga0182006_10058085 254
1079 3300015261 Ga0182006_1009924 Ga0182006_10099243 254
1080 3300015261 Ga0182006_1048129 Ga0182006_10481292 254
1081 3300015262 Ga0182007_10000002 Ga0182007_1000000263 254
1082 3300015262 Ga0182007_10061891 Ga0182007_100618912 254
1083 3300015682 Ga0183373_1004 Ga0183373_1004411 254
1084 3300017792 Ga0163161_10000856 Ga0163161_1000085621 254
1085 3300017792 Ga0163161_10001255 Ga0163161_100012554 254
1086 3300017792 Ga0163161_10001554 Ga0163161_100015544 254
1087 3300017792 Ga0163161_10022880 Ga0163161_100228805 254
1088 3300017792 Ga0163161_10024488 Ga0163161_100244882 254
1089 3300017792 Ga0163161_10028422 Ga0163161_100284223 254
1090 3300017792 Ga0163161_10072869 Ga0163161_100728693 254
1091 3300017792 Ga0163161_10078048 Ga0163161_100780482 254
1092 3300017792 Ga0163161_10107048 Ga0163161_101070482 254
1093 3300017792 Ga0163161_10381861 Ga0163161_103818611 254
1094 3300017792 Ga0163161_10641440 Ga0163161_106414401 254
1095 3300020077 Ga0206351_10266021 Ga0206351_102660211 254
1096 3300020078 Ga0206352_10171243 Ga0206352_101712433 254
1097 3300020610 Ga0154015_1198199 Ga0154015_11981991 254
1098 3300020610 Ga0154015_1441652 Ga0154015_14416522 254
1099 3300021361 Ga0213872_10006185 Ga0213872_100061856 254
1100 3300021384 Ga0213876_10023559 Ga0213876_100235593 254
1101 3300022467 Ga0224712_10035334 Ga0224712_100353341 254
1102 3300025231 Ga0207427_100025 Ga0207427_10002572 254
1103 3300025233 Ga0209437_100010 Ga0209437_100010334 254
1104 3300025245 Ga0207425_1000023 Ga0207425_100002357 254
1105 3300025246 Ga0209646_1001012 Ga0209646_10010127 254
1106 3300025258 Ga0209129_1000032 Ga0209129_1000032216 254
1107 3300025261 Ga0209233_1000017 Ga0209233_1000017347 254
1108 3300025272 Ga0209455_1000682 Ga0209455_100068219 254
1109 3300025292 Ga0209676_1000009 Ga0209676_100000959 254
1110 3300025294 Ga0209025_1000047 Ga0209025_1000047216 254
1111 3300025297 Ga0209758_1000145 Ga0209758_100014557 254
1112 3300025298 Ga0209050_1000094 Ga0209050_100009459 254
1113 3300025302 Ga0207426_1000059 Ga0207426_1000059235 254
1114 3300025315 Ga0207697_10012795 Ga0207697_100127952 254
1115 3300025315 Ga0207697_10044972 Ga0207697_100449722 254
1116 3300025315 Ga0207697_10115793 Ga0207697_101157932 254
1117 3300025315 Ga0207697_10166184 Ga0207697_101661842 254
1118 3300025321 Ga0207656_10010545 Ga0207656_100105455 254
1119 3300025321 Ga0207656_10039145 Ga0207656_100391452 254
1120 3300025321 Ga0207656_10126649 Ga0207656_101266492 254
1121 3300025321 Ga0207656_10139579 Ga0207656_101395791 254
1122 3300025893 Ga0207682_10029174 Ga0207682_100291742 254
1123 3300025893 Ga0207682_10058426 Ga0207682_100584262 254
1124 3300025899 Ga0207642_10025354 Ga0207642_100253542 254
1125 3300025900 Ga0207710_10002076 Ga0207710_100020766 254
1126 3300025900 Ga0207710_10027249 Ga0207710_100272492 254
1127 3300025903 Ga0207680_10000024 Ga0207680_1000002444 254
1128 3300025903 Ga0207680_10000907 Ga0207680_100009077 254
1129 3300025903 Ga0207680_10061670 Ga0207680_100616702 254
1130 3300025903 Ga0207680_10091551 Ga0207680_100915512 254
1131 3300025903 Ga0207680_10225739 Ga0207680_102257391 254
1132 3300025904 Ga0207647_10000358 Ga0207647_100003582 254
1133 3300025904 Ga0207647_10000680 Ga0207647_100006806 254
1134 3300025904 Ga0207647_10023206 Ga0207647_100232063 254
1135 3300025904 Ga0207647_10023686 Ga0207647_100236863 254
1136 3300025904 Ga0207647_10095624 Ga0207647_100956242 254
1137 3300025904 Ga0207647_10113164 Ga0207647_101131642 254
1138 3300025904 Ga0207647_10113581 Ga0207647_101135812 254
1139 3300025904 Ga0207647_10173695 Ga0207647_101736952 254
1140 3300025907 Ga0207645_10004249 Ga0207645_100042499 254
1141 3300025907 Ga0207645_10006511 Ga0207645_100065115 254
1142 3300025907 Ga0207645_10008865 Ga0207645_100088658 254
1143 3300025907 Ga0207645_10021055 Ga0207645_100210552 254
1144 3300025907 Ga0207645_10036497 Ga0207645_100364972 254
1145 3300025907 Ga0207645_10143436 Ga0207645_101434362 254
1146 3300025907 Ga0207645_10154702 Ga0207645_101547022 254
1147 3300025908 Ga0207643_10004405 Ga0207643_1000440510 254
1148 3300025908 Ga0207643_10008664 Ga0207643_100086643 254
1149 3300025908 Ga0207643_10160761 Ga0207643_101607611 254
1150 3300025909 Ga0207705_10000045 Ga0207705_1000004581 254
1151 3300025909 Ga0207705_10009444 Ga0207705_100094443 254
1152 3300025909 Ga0207705_10011675 Ga0207705_100116756 254
1153 3300025909 Ga0207705_10051441 Ga0207705_100514412 254
1154 3300025909 Ga0207705_10175968 Ga0207705_101759682 254
1155 3300025909 Ga0207705_10247490 Ga0207705_102474902 254
1156 3300025909 Ga0207705_10411428 Ga0207705_104114282 254
1157 3300025909 Ga0207705_10493114 Ga0207705_104931141 254
1158 3300025911 Ga0207654_10000945 Ga0207654_100009452 254
1159 3300025911 Ga0207654_10001057 Ga0207654_100010574 254
1160 3300025911 Ga0207654_10002875 Ga0207654_100028759 254
1161 3300025911 Ga0207654_10027133 Ga0207654_100271334 254
1162 3300025911 Ga0207654_10047562 Ga0207654_100475622 254
1163 3300025912 Ga0207707_10000785 Ga0207707_100007859 254
1164 3300025912 Ga0207707_10015783 Ga0207707_100157833 254
1165 3300025912 Ga0207707_10109062 Ga0207707_101090622 254
1166 3300025912 Ga0207707_10145017 Ga0207707_101450171 254
1167 3300025912 Ga0207707_10238445 Ga0207707_102384452 254
1168 3300025912 Ga0207707_10399063 Ga0207707_103990631 254
1169 3300025913 Ga0207695_10000087 Ga0207695_1000008778 254
1170 3300025913 Ga0207695_10000863 Ga0207695_1000086311 254
1171 3300025913 Ga0207695_10004265 Ga0207695_1000426517 254
1172 3300025913 Ga0207695_10004821 Ga0207695_100048215 254
1173 3300025913 Ga0207695_10032498 Ga0207695_100324982 254
1174 3300025913 Ga0207695_10051405 Ga0207695_100514051 254
1175 3300025913 Ga0207695_10176783 Ga0207695_101767832 254
1176 3300025913 Ga0207695_10308142 Ga0207695_103081421 254
1177 3300025913 Ga0207695_10447819 Ga0207695_104478191 254
1178 3300025914 Ga0207671_10003252 Ga0207671_1000325214 254
1179 3300025914 Ga0207671_10006450 Ga0207671_100064504 254
1180 3300025914 Ga0207671_10008745 Ga0207671_1000874510 254
1181 3300025914 Ga0207671_10017925 Ga0207671_100179254 254
1182 3300025914 Ga0207671_10022639 Ga0207671_100226395 254
1183 3300025914 Ga0207671_10036181 Ga0207671_100361812 254
1184 3300025914 Ga0207671_10110205 Ga0207671_101102052 254
1185 3300025914 Ga0207671_10148648 Ga0207671_101486482 254
1186 3300025914 Ga0207671_10269052 Ga0207671_102690522 254
1187 3300025914 Ga0207671_10492185 Ga0207671_104921851 254
1188 3300025917 Ga0207660_10012376 Ga0207660_100123763 254
1189 3300025917 Ga0207660_10040413 Ga0207660_100404134 254
1190 3300025917 Ga0207660_10407469 Ga0207660_104074691 254
1191 3300025918 Ga0207662_10022900 Ga0207662_100229004 254
1192 3300025918 Ga0207662_10342869 Ga0207662_103428691 254
1193 3300025919 Ga0207657_10009277 Ga0207657_100092774 254
1194 3300025919 Ga0207657_10028323 Ga0207657_100283232 254
1195 3300025919 Ga0207657_10040503 Ga0207657_100405032 254
1196 3300025919 Ga0207657_10057355 Ga0207657_100573552 254
1197 3300025919 Ga0207657_10078928 Ga0207657_100789282 254
1198 3300025919 Ga0207657_10091876 Ga0207657_100918763 254
1199 3300025919 Ga0207657_10113207 Ga0207657_101132072 254
1200 3300025919 Ga0207657_10196814 Ga0207657_101968141 254
1201 3300025919 Ga0207657_10569962 Ga0207657_105699621 254
1202 3300025920 Ga0207649_10001875 Ga0207649_100018757 254
1203 3300025920 Ga0207649_10005900 Ga0207649_100059007 254
1204 3300025920 Ga0207649_10060515 Ga0207649_100605153 254
1205 3300025921 Ga0207652_10000103 Ga0207652_1000010370 254
1206 3300025921 Ga0207652_10001257 Ga0207652_1000125710 254
1207 3300025921 Ga0207652_10002683 Ga0207652_1000268314 254
1208 3300025921 Ga0207652_10004292 Ga0207652_1000429216 254
1209 3300025921 Ga0207652_10055658 Ga0207652_100556584 254
1210 3300025921 Ga0207652_10060901 Ga0207652_100609012 254
1211 3300025921 Ga0207652_10195098 Ga0207652_101950982 254
1212 3300025921 Ga0207652_10417910 Ga0207652_104179102 254
1213 3300025922 Ga0207646_10164022 Ga0207646_101640223 254
1214 3300025923 Ga0207681_10010220 Ga0207681_100102203 254
1215 3300025923 Ga0207681_10097147 Ga0207681_100971472 254
1216 3300025923 Ga0207681_10140772 Ga0207681_101407722 254
1217 3300025923 Ga0207681_10206168 Ga0207681_102061682 254
1218 3300025923 Ga0207681_10213768 Ga0207681_102137682 254
1219 3300025924 Ga0207694_10011375 Ga0207694_100113753 254
1220 3300025924 Ga0207694_10058055 Ga0207694_100580553 254
1221 3300025925 Ga0207650_10033682 Ga0207650_100336823 254
1222 3300025925 Ga0207650_10045601 Ga0207650_100456012 254
1223 3300025925 Ga0207650_10050701 Ga0207650_100507012 254
1224 3300025925 Ga0207650_10094946 Ga0207650_100949462 254
1225 3300025925 Ga0207650_10122960 Ga0207650_101229603 254
1226 3300025925 Ga0207650_10140567 Ga0207650_101405672 254
1227 3300025925 Ga0207650_10150375 Ga0207650_101503752 254
1228 3300025925 Ga0207650_10242466 Ga0207650_102424662 254
1229 3300025925 Ga0207650_10405853 Ga0207650_104058531 254
1230 3300025926 Ga0207659_10028297 Ga0207659_100282971 254
1231 3300025926 Ga0207659_10052832 Ga0207659_100528322 254
1232 3300025926 Ga0207659_10056781 Ga0207659_100567811 254
1233 3300025926 Ga0207659_10307547 Ga0207659_103075472 254
1234 3300025927 Ga0207687_10260785 Ga0207687_102607851 254
1235 3300025931 Ga0207644_10027212 Ga0207644_100272125 254
1236 3300025931 Ga0207644_10052954 Ga0207644_100529542 254
1237 3300025931 Ga0207644_10064041 Ga0207644_100640413 254
1238 3300025931 Ga0207644_10077611 Ga0207644_100776113 254
1239 3300025931 Ga0207644_10136589 Ga0207644_101365892 254
1240 3300025931 Ga0207644_10157937 Ga0207644_101579372 254
1241 3300025931 Ga0207644_10174594 Ga0207644_101745941 254
1242 3300025931 Ga0207644_10460216 Ga0207644_104602162 254
1243 3300025932 Ga0207690_10005287 Ga0207690_100052876 254
1244 3300025932 Ga0207690_10022304 Ga0207690_100223041 254
1245 3300025932 Ga0207690_10025950 Ga0207690_100259504 254
1246 3300025932 Ga0207690_10079990 Ga0207690_100799902 254
1247 3300025932 Ga0207690_10112549 Ga0207690_101125491 254
1248 3300025932 Ga0207690_10199973 Ga0207690_101999732 254
1249 3300025933 Ga0207706_10000057 Ga0207706_1000005791 254
1250 3300025933 Ga0207706_10013742 Ga0207706_100137423 254
1251 3300025933 Ga0207706_10015669 Ga0207706_100156697 254
1252 3300025933 Ga0207706_10032770 Ga0207706_100327701 254
1253 3300025933 Ga0207706_10041077 Ga0207706_100410774 254
1254 3300025933 Ga0207706_10041917 Ga0207706_100419175 254
1255 3300025933 Ga0207706_10045347 Ga0207706_100453472 254
1256 3300025933 Ga0207706_10051782 Ga0207706_100517822 254
1257 3300025933 Ga0207706_10096309 Ga0207706_100963092 254
1258 3300025934 Ga0207686_10012459 Ga0207686_100124592 254
1259 3300025934 Ga0207686_10123301 Ga0207686_101233012 254
1260 3300025934 Ga0207686_10219974 Ga0207686_102199741 254
1261 3300025935 Ga0207709_10218812 Ga0207709_102188122 254
1262 3300025935 Ga0207709_10546443 Ga0207709_105464431 254
1263 3300025936 Ga0207670_10040768 Ga0207670_100407684 254
1264 3300025936 Ga0207670_10046370 Ga0207670_100463703 254
1265 3300025936 Ga0207670_10061173 Ga0207670_100611732 254
1266 3300025937 Ga0207669_10029049 Ga0207669_100290494 254
1267 3300025937 Ga0207669_10141837 Ga0207669_101418372 254
1268 3300025937 Ga0207669_10210636 Ga0207669_102106361 254
1269 3300025937 Ga0207669_10334663 Ga0207669_103346632 254
1270 3300025937 Ga0207669_10342008 Ga0207669_103420081 254
1271 3300025938 Ga0207704_10000266 Ga0207704_1000026621 254
1272 3300025938 Ga0207704_10005149 Ga0207704_100051495 254
1273 3300025938 Ga0207704_10019491 Ga0207704_100194913 254
1274 3300025938 Ga0207704_10027744 Ga0207704_100277442 254
1275 3300025938 Ga0207704_10028606 Ga0207704_100286063 254
1276 3300025938 Ga0207704_10080944 Ga0207704_100809443 254
1277 3300025938 Ga0207704_10398916 Ga0207704_103989162 254
1278 3300025939 Ga0207665_10076711 Ga0207665_100767111 254
1279 3300025940 Ga0207691_10000322 Ga0207691_100003227 254
1280 3300025940 Ga0207691_10013189 Ga0207691_100131893 254
1281 3300025940 Ga0207691_10022737 Ga0207691_100227375 254
1282 3300025940 Ga0207691_10035059 Ga0207691_100350595 254
1283 3300025940 Ga0207691_10042771 Ga0207691_100427713 254
1284 3300025940 Ga0207691_10056700 Ga0207691_100567003 254
1285 3300025940 Ga0207691_10057182 Ga0207691_100571823 254
1286 3300025940 Ga0207691_10129274 Ga0207691_101292743 254
1287 3300025940 Ga0207691_10218260 Ga0207691_102182602 254
1288 3300025940 Ga0207691_10551051 Ga0207691_105510511 254
1289 3300025942 Ga0207689_10002373 Ga0207689_1000237320 254
1290 3300025942 Ga0207689_10004255 Ga0207689_100042557 254
1291 3300025942 Ga0207689_10005993 Ga0207689_1000599310 254
1292 3300025942 Ga0207689_10006451 Ga0207689_100064516 254
1293 3300025942 Ga0207689_10012780 Ga0207689_100127805 254
1294 3300025942 Ga0207689_10013331 Ga0207689_100133314 254
1295 3300025942 Ga0207689_10014390 Ga0207689_100143904 254
1296 3300025942 Ga0207689_10015849 Ga0207689_100158498 254
1297 3300025942 Ga0207689_10017568 Ga0207689_100175681 254
1298 3300025942 Ga0207689_10018768 Ga0207689_100187684 254
1299 3300025942 Ga0207689_10021517 Ga0207689_100215177 254
1300 3300025942 Ga0207689_10022338 Ga0207689_100223383 254
1301 3300025942 Ga0207689_10031594 Ga0207689_100315943 254
1302 3300025942 Ga0207689_10124311 Ga0207689_101243111 254
1303 3300025942 Ga0207689_10216840 Ga0207689_102168402 254
1304 3300025942 Ga0207689_10311971 Ga0207689_103119711 254
1305 3300025944 Ga0207661_10001968 Ga0207661_100019686 254
1306 3300025944 Ga0207661_10010454 Ga0207661_100104541 254
1307 3300025944 Ga0207661_10019341 Ga0207661_100193417 254
1308 3300025944 Ga0207661_10034779 Ga0207661_100347793 254
1309 3300025944 Ga0207661_10064761 Ga0207661_100647614 254
1310 3300025944 Ga0207661_10125085 Ga0207661_101250853 254
1311 3300025944 Ga0207661_10565966 Ga0207661_105659662 254
1312 3300025945 Ga0207679_10000223 Ga0207679_100002239 254
1313 3300025945 Ga0207679_10001672 Ga0207679_100016722 254
1314 3300025945 Ga0207679_10020334 Ga0207679_100203345 254
1315 3300025945 Ga0207679_10028022 Ga0207679_100280223 254
1316 3300025949 Ga0207667_10003221 Ga0207667_1000322118 254
1317 3300025949 Ga0207667_10009488 Ga0207667_1000948812 254
1318 3300025949 Ga0207667_10056376 Ga0207667_100563765 254
1319 3300025949 Ga0207667_10060374 Ga0207667_100603745 254
1320 3300025949 Ga0207667_10065419 Ga0207667_100654195 254
1321 3300025949 Ga0207667_10107856 Ga0207667_101078561 254
1322 3300025949 Ga0207667_10125592 Ga0207667_101255923 254
1323 3300025949 Ga0207667_10323234 Ga0207667_103232342 254
1324 3300025949 Ga0207667_10398347 Ga0207667_103983471 254
1325 3300025960 Ga0207651_10007850 Ga0207651_100078505 254
1326 3300025960 Ga0207651_10014436 Ga0207651_100144363 254
1327 3300025960 Ga0207651_10029097 Ga0207651_100290971 254
1328 3300025960 Ga0207651_10042377 Ga0207651_100423774 254
1329 3300025960 Ga0207651_10051187 Ga0207651_100511873 254
1330 3300025960 Ga0207651_10130067 Ga0207651_101300672 254
1331 3300025960 Ga0207651_10181632 Ga0207651_101816322 254
1332 3300025960 Ga0207651_10253036 Ga0207651_102530362 254
1333 3300025960 Ga0207651_10424240 Ga0207651_104242402 254
1334 3300025960 Ga0207651_10596466 Ga0207651_105964661 254
1335 3300025960 Ga0207651_10654532 Ga0207651_106545321 254
1336 3300025961 Ga0207712_10002565 Ga0207712_100025657 254
1337 3300025961 Ga0207712_10005545 Ga0207712_100055453 254
1338 3300025961 Ga0207712_10025662 Ga0207712_100256624 254
1339 3300025961 Ga0207712_10046585 Ga0207712_100465853 254
1340 3300025961 Ga0207712_10074204 Ga0207712_100742042 254
1341 3300025961 Ga0207712_10280329 Ga0207712_102803291 254
1342 3300025972 Ga0207668_10000475 Ga0207668_100004756 254
1343 3300025972 Ga0207668_10036554 Ga0207668_100365543 254
1344 3300025972 Ga0207668_10204089 Ga0207668_102040891 254
1345 3300025972 Ga0207668_10620326 Ga0207668_106203261 254
1346 3300025981 Ga0207640_10002135 Ga0207640_100021359 254
1347 3300025981 Ga0207640_10112020 Ga0207640_101120202 254
1348 3300025981 Ga0207640_10134143 Ga0207640_101341433 254
1349 3300025981 Ga0207640_10195321 Ga0207640_101953212 254
1350 3300025981 Ga0207640_10206176 Ga0207640_102061762 254
1351 3300025981 Ga0207640_10258312 Ga0207640_102583122 254
1352 3300025986 Ga0207658_10002470 Ga0207658_100024707 254
1353 3300025986 Ga0207658_10008454 Ga0207658_100084546 254
1354 3300025986 Ga0207658_10012330 Ga0207658_100123308 254
1355 3300025986 Ga0207658_10012528 Ga0207658_100125282 254
1356 3300025986 Ga0207658_10034411 Ga0207658_100344114 254
1357 3300025986 Ga0207658_10182935 Ga0207658_101829352 254
1358 3300025986 Ga0207658_10366099 Ga0207658_103660992 254
1359 3300026023 Ga0207677_10000863 Ga0207677_100008637 254
1360 3300026023 Ga0207677_10002657 Ga0207677_100026572 254
1361 3300026023 Ga0207677_10007297 Ga0207677_100072975 254
1362 3300026023 Ga0207677_10007663 Ga0207677_100076636 254
1363 3300026023 Ga0207677_10035820 Ga0207677_100358203 254
1364 3300026023 Ga0207677_10051804 Ga0207677_100518043 254
1365 3300026023 Ga0207677_10057073 Ga0207677_100570732 254
1366 3300026023 Ga0207677_10076732 Ga0207677_100767322 254
1367 3300026035 Ga0207703_10000814 Ga0207703_100008147 254
1368 3300026035 Ga0207703_10068179 Ga0207703_100681792 254
1369 3300026035 Ga0207703_10125988 Ga0207703_101259882 254
1370 3300026035 Ga0207703_10625764 Ga0207703_106257641 254
1371 3300026041 Ga0207639_10004988 Ga0207639_100049883 254
1372 3300026041 Ga0207639_10005319 Ga0207639_100053197 254
1373 3300026041 Ga0207639_10005473 Ga0207639_100054738 254
1374 3300026041 Ga0207639_10011449 Ga0207639_100114494 254
1375 3300026041 Ga0207639_10015980 Ga0207639_100159802 254
1376 3300026041 Ga0207639_10031117 Ga0207639_100311172 254
1377 3300026041 Ga0207639_10033500 Ga0207639_100335004 254
1378 3300026041 Ga0207639_10042980 Ga0207639_100429803 254
1379 3300026041 Ga0207639_10057505 Ga0207639_100575052 254
1380 3300026041 Ga0207639_10095718 Ga0207639_100957183 254
1381 3300026041 Ga0207639_10097453 Ga0207639_100974533 254
1382 3300026041 Ga0207639_10125427 Ga0207639_101254272 254
1383 3300026041 Ga0207639_10132910 Ga0207639_101329102 254
1384 3300026041 Ga0207639_10251336 Ga0207639_102513361 254
1385 3300026041 Ga0207639_10557432 Ga0207639_105574322 254
1386 3300026067 Ga0207678_10032708 Ga0207678_100327083 254
1387 3300026067 Ga0207678_10366102 Ga0207678_103661022 254
1388 3300026075 Ga0207708_10112481 Ga0207708_101124813 254
1389 3300026078 Ga0207702_10019965 Ga0207702_100199653 254
1390 3300026078 Ga0207702_10135571 Ga0207702_101355712 254
1391 3300026078 Ga0207702_10156603 Ga0207702_101566033 254
1392 3300026078 Ga0207702_10317660 Ga0207702_103176602 254
1393 3300026078 Ga0207702_10344598 Ga0207702_103445981 254
1394 3300026088 Ga0207641_10000058 Ga0207641_1000005891 254
1395 3300026088 Ga0207641_10003931 Ga0207641_100039314 254
1396 3300026088 Ga0207641_10005737 Ga0207641_100057375 254
1397 3300026088 Ga0207641_10017416 Ga0207641_100174165 254
1398 3300026088 Ga0207641_10059311 Ga0207641_100593115 254
1399 3300026088 Ga0207641_10121696 Ga0207641_101216963 254
1400 3300026088 Ga0207641_10319375 Ga0207641_103193752 254
1401 3300026088 Ga0207641_10321659 Ga0207641_103216592 254
1402 3300026088 Ga0207641_10638083 Ga0207641_106380832 254
1403 3300026089 Ga0207648_10000820 Ga0207648_1000082034 254
1404 3300026089 Ga0207648_10003208 Ga0207648_100032088 254
1405 3300026089 Ga0207648_10004484 Ga0207648_100044848 254
1406 3300026089 Ga0207648_10007640 Ga0207648_100076405 254
1407 3300026089 Ga0207648_10012664 Ga0207648_100126643 254
1408 3300026089 Ga0207648_10017326 Ga0207648_100173266 254
1409 3300026089 Ga0207648_10037211 Ga0207648_100372114 254
1410 3300026089 Ga0207648_10052616 Ga0207648_100526163 254
1411 3300026089 Ga0207648_10087459 Ga0207648_100874593 254
1412 3300026089 Ga0207648_10172746 Ga0207648_101727461 254
1413 3300026089 Ga0207648_10191482 Ga0207648_101914822 254
1414 3300026089 Ga0207648_10385588 Ga0207648_103855881 254
1415 3300026095 Ga0207676_10004821 Ga0207676_100048215 254
1416 3300026095 Ga0207676_10008428 Ga0207676_100084286 254
1417 3300026095 Ga0207676_10012530 Ga0207676_100125304 254
1418 3300026095 Ga0207676_10027108 Ga0207676_100271082 254
1419 3300026095 Ga0207676_10071782 Ga0207676_100717822 254
1420 3300026095 Ga0207676_10084729 Ga0207676_100847295 254
1421 3300026095 Ga0207676_10102365 Ga0207676_101023654 254
1422 3300026095 Ga0207676_10193088 Ga0207676_101930883 254
1423 3300026095 Ga0207676_10525211 Ga0207676_105252112 254
1424 3300026116 Ga0207674_10031084 Ga0207674_100310843 254
1425 3300026116 Ga0207674_10061629 Ga0207674_100616293 254
1426 3300026116 Ga0207674_10075106 Ga0207674_100751063 254
1427 3300026116 Ga0207674_10085770 Ga0207674_100857703 254
1428 3300026116 Ga0207674_10093977 Ga0207674_100939772 254
1429 3300026116 Ga0207674_10109546 Ga0207674_101095461 254
1430 3300026116 Ga0207674_10157689 Ga0207674_101576892 254
1431 3300026116 Ga0207674_10176620 Ga0207674_101766203 254
1432 3300026116 Ga0207674_10265145 Ga0207674_102651452 254
1433 3300026118 Ga0207675_100000646 Ga0207675_10000064626 254
1434 3300026118 Ga0207675_100002881 Ga0207675_1000028814 254
1435 3300026118 Ga0207675_100014651 Ga0207675_1000146516 254
1436 3300026118 Ga0207675_100108878 Ga0207675_1001088784 254
1437 3300026118 Ga0207675_100159933 Ga0207675_1001599332 254
1438 3300026118 Ga0207675_100197471 Ga0207675_1001974712 254
1439 3300026118 Ga0207675_100223013 Ga0207675_1002230133 254
1440 3300026118 Ga0207675_100325210 Ga0207675_1003252102 254
1441 3300026121 Ga0207683_10012841 Ga0207683_100128414 254
1442 3300026121 Ga0207683_10030804 Ga0207683_100308045 254
1443 3300026121 Ga0207683_10165220 Ga0207683_101652201 254
1444 3300026142 Ga0207698_10003833 Ga0207698_100038337 254
1445 3300026142 Ga0207698_10006479 Ga0207698_100064795 254
1446 3300026142 Ga0207698_10015545 Ga0207698_100155452 254
1447 3300026142 Ga0207698_10020442 Ga0207698_100204422 254
1448 3300026142 Ga0207698_10033537 Ga0207698_100335374 254
1449 3300026142 Ga0207698_10047101 Ga0207698_100471011 254
1450 3300026142 Ga0207698_10090718 Ga0207698_100907182 254
1451 3300026142 Ga0207698_10119163 Ga0207698_101191632 254
1452 3300026142 Ga0207698_10144799 Ga0207698_101447992 254
1453 3300026142 Ga0207698_10162772 Ga0207698_101627721 254
1454 3300026142 Ga0207698_10175937 Ga0207698_101759371 254
1455 3300026142 Ga0207698_10419937 Ga0207698_104199372 254
1456 3300027526 Ga0209968_1004926 Ga0209968_10049262 254
1457 3300027907 Ga0207428_10074553 Ga0207428_100745532 254
1458 3300027907 Ga0207428_10086053 Ga0207428_100860533 254
1459 3300028379 Ga0268266_10000030 Ga0268266_10000030120 254
1460 3300028379 Ga0268266_10003162 Ga0268266_100031622 254
1461 3300028379 Ga0268266_10061888 Ga0268266_100618883 254
1462 3300028379 Ga0268266_10525811 Ga0268266_105258112 254
1463 3300028380 Ga0268265_10003417 Ga0268265_100034179 254
1464 3300028380 Ga0268265_10005499 Ga0268265_100054996 254
1465 3300028380 Ga0268265_10012001 Ga0268265_100120016 254
1466 3300028380 Ga0268265_10043777 Ga0268265_100437773 254
1467 3300028380 Ga0268265_10112713 Ga0268265_101127133 254
1468 3300028381 Ga0268264_10001732 Ga0268264_1000173221 254
1469 3300028381 Ga0268264_10003381 Ga0268264_100033819 254
1470 3300028381 Ga0268264_10004437 Ga0268264_100044375 254
1471 3300028381 Ga0268264_10011514 Ga0268264_100115146 254
1472 3300028381 Ga0268264_10016463 Ga0268264_100164633 254
1473 3300028381 Ga0268264_10021945 Ga0268264_100219452 254
1474 3300028381 Ga0268264_10040321 Ga0268264_100403212 254
1475 3300028381 Ga0268264_10054278 Ga0268264_100542784 254
1476 3300028381 Ga0268264_10185596 Ga0268264_101855962 254
1477 3300028381 Ga0268264_10341907 Ga0268264_103419071 254
1478 3300028381 Ga0268264_11011648 Ga0268264_110116481 254
1479 3300028786 Ga0307517_10001481 Ga0307517_1000148113 254
1480 3300028786 Ga0307517_10022273 Ga0307517_100222733 254
1481 3300028786 Ga0307517_10113502 Ga0307517_101135024 254
1482 3300028794 Ga0307515_10040038 Ga0307515_100400388 254
1483 3300030521 Ga0307511_10000076 Ga0307511_1000007690 254
1484 3300030731 Ga0316177_1087909 Ga0316177_10879092 254
1485 3300030744 Ga0316181_1210309 Ga0316181_12103092 254
1486 3300030745 Ga0316182_1096864 Ga0316182_10968641 254
1487 3300031251 Ga0265327_10000031 Ga0265327_10000031245 254
1488 3300031251 Ga0265327_10013842 Ga0265327_100138423 254
1489 3300031507 Ga0307509_10064621 Ga0307509_100646213 254
1490 3300031507 Ga0307509_10126854 Ga0307509_101268543 254
1491 3300031507 Ga0307509_10256229 Ga0307509_102562292 254
1492 3300031507 Ga0307509_10261765 Ga0307509_102617652 254
1493 3300031548 Ga0307408_100000541 Ga0307408_10000054131 254
1494 3300031548 Ga0307408_100003308 Ga0307408_10000330813 254
1495 3300031548 Ga0307408_100049099 Ga0307408_1000490994 254
1496 3300031616 Ga0307508_10006441 Ga0307508_100064412 254
1497 3300031616 Ga0307508_10270277 Ga0307508_102702772 254
1498 3300031730 Ga0307516_10247622 Ga0307516_102476222 254
1499 3300031731 Ga0307405_10000015 Ga0307405_10000015106 254
1500 3300031731 Ga0307405_10024515 Ga0307405_100245153 254
1501 3300031731 Ga0307405_10498241 Ga0307405_104982411 254
1502 3300031903 Ga0307407_10000027 Ga0307407_1000002725 254
1503 3300031911 Ga0307412_10000030 Ga0307412_10000030147 254
1504 3300031911 Ga0307412_10128525 Ga0307412_101285252 254
1505 3300031911 Ga0307412_10492401 Ga0307412_104924011 254
1506 3300032002 Ga0307416_100000002 Ga0307416_10000000251 254
1507 3300032002 Ga0307416_100056158 Ga0307416_1000561582 254
1508 3300032002 Ga0307416_100246061 Ga0307416_1002460612 254
1509 3300032004 Ga0307414_10000262 Ga0307414_1000026223 254
1510 3300032004 Ga0307414_10006046 Ga0307414_100060463 254
1511 3300032004 Ga0307414_10019408 Ga0307414_100194084 254
1512 3300032004 Ga0307414_10066410 Ga0307414_100664103 254
1513 3300032004 Ga0307414_10620892 Ga0307414_106208921 254
1514 3300033180 Ga0307510_10000464 Ga0307510_1000046425 254
1515 3300034818 Ga0373950_0027934 Ga0373950_0027934_227_1003 254
1516 3300035086 Ga0373934_0045137 Ga0373934_0045137_362_1138 254
1517 3300035170 Ga0373943_0057217 Ga0373943_0057217_797_1573 254
1518 3300035172 Ga0373955_0009887 Ga0373955_0009887_809_1585 254
1519 3300035692 Ga0373935_0150339 Ga0373935_0150339_65_841 254
1520 3300035724 Ga0373933_0062135 Ga0373933_0062135_113_889 254
1521 3300035724 Ga0373933_0156255 Ga0373933_0156255_563_1339 254
1522 3300035725 Ga0373947_0386689 Ga0373947_0386689_145_921 254
1523 3300036401 Ga0373937_0016924 Ga0373937_0016924_2275_3051 254
1524 3300037068 Ga0373925_0358037 Ga0373925_0358037_284_1060 254
1525 3300037068 Ga0373925_0466509 Ga0373925_0466509_232_1008 254
1526 3300037312 Ga0395899_0000887 Ga0395899_0000887_2028_2795 254
1527 3300037312 Ga0395899_0007044 Ga0395899_0007044_1429_2196 254
1528 3300037312 Ga0395899_0007705 Ga0395899_0007705_1837_2616 254
1529 3300037312 Ga0395899_0020100 Ga0395899_0020100_1885_2664 254
1530 3300037312 Ga0395899_0037069 Ga0395899_0037069_2180_2947 254
1531 3300037312 Ga0395899_0055058 Ga0395899_0055058_525_1304 254
1532 3300037312 Ga0395899_0067028 Ga0395899_0067028_797_1576 254
1533 3300037312 Ga0395899_0078418 Ga0395899_0078418_1431_2210 254
1534 3300037418 Ga0395900_0000143 Ga0395900_0000143_3196_3963 254
1535 3300037418 Ga0395900_0000684 Ga0395900_0000684_3654_4433 254
1536 3300037418 Ga0395900_0003189 Ga0395900_0003189_6784_7551 254
1537 3300037418 Ga0395900_0006556 Ga0395900_0006556_6055_6834 254
1538 3300037418 Ga0395900_0039835 Ga0395900_0039835_600_1367 254
1539 3300037418 Ga0395900_0114735 Ga0395900_0114735_525_1304 254
1540 3300037466 Ga0395898_0001240 Ga0395898_0001240_33622_34401 254
1541 3300037466 Ga0395898_0004789 Ga0395898_0004789_10124_10891 254
1542 3300037466 Ga0395898_0136633 Ga0395898_0136633_1192_1971 254
1543 3300037466 Ga0395898_0187493 Ga0395898_0187493_97_876 254
1544 3300037466 Ga0395898_0238196 Ga0395898_0238196_258_1037 254
1545 3300037466 Ga0395898_0325443 Ga0395898_0325443_317_1096 254
1546 3300037471 Ga0395905_0000175 Ga0395905_0000175_28718_29485 254
1547 3300037471 Ga0395905_0000981 Ga0395905_0000981_6500_7267 254
1548 3300037471 Ga0395905_0002365 Ga0395905_0002365_2009_2785 254
1549 3300037471 Ga0395905_0005773 Ga0395905_0005773_9747_10526 254
1550 3300037471 Ga0395905_0246718 Ga0395905_0246718_367_1146 254
1551 3300038443 Ga0395901_0000313 Ga0395901_0000313_25602_26369 254
1552 3300038443 Ga0395901_0000995 Ga0395901_0000995_1015_1794 254
1553 3300038443 Ga0395901_0004445 Ga0395901_0004445_7606_8385 254
1554 3300038443 Ga0395901_0009480 Ga0395901_0009480_6468_7235 254
1555 3300038443 Ga0395901_0010499 Ga0395901_0010499_2101_2880 254
1556 3300038443 Ga0395901_0021527 Ga0395901_0021527_4767_5543 254
1557 3300038443 Ga0395901_0045853 Ga0395901_0045853_2247_3026 254
1558 3300038443 Ga0395901_0455660 Ga0395901_0455660_36_815 254
1559 3300039437 Ga0436365_0782007 Ga0436365_0782007_195_974 254
1560 3300039437 Ga0436365_0943390 Ga0436365_0943390_8651_9430 254
1561 3300039447 Ga0436361_1115729 Ga0436361_1115729_2860_3627 254
1562 3300041404 Ga0439436_0000160 Ga0439436_0000160_10079_10855 254
1563 3300041406 Ga0439439_0052951 Ga0439439_0052951_278_1054 254
1564 3300041408 Ga0439453_0008644 Ga0439453_0008644_58_834 254
1565 3300041456 Ga0451795_0318958 Ga0451795_0318958_203_982 254
1566 3300041460 Ga0451802_1472217 Ga0451802_1472217_438_1214 254
1567 3300041463 Ga0451804_0820654 Ga0451804_0820654_153_929 254
1568 3300041498 Ga0451841_1351513 Ga0451841_1351513_77_841 254
1569 3300041512 Ga0451853_3193490 Ga0451853_3193490_646_1422 254
1570 3300041997 Ga0439431_0009310 Ga0439431_0009310_961_1746 254
1571 3300042001 Ga0439441_001534 Ga0439441_001534_464_1240 254
1572 3300042004 Ga0439445_0029071 Ga0439445_0029071_40_819 254
1573 3300042007 Ga0439449_0006413 Ga0439449_0006413_2815_3591 254
1574 3300042012 Ga0439455_0038536 Ga0439455_0038536_59_826 254
1575 3300042015 Ga0439462_0004351 Ga0439462_0004351_2612_3388 254
1576 3300042015 Ga0439462_0040408 Ga0439462_0040408_144_920 254
1577 3300042131 Ga0450894_011061 Ga0450894_011061_338_1117 254
1578 3300042134 Ga0450898_000823 Ga0450898_000823_631_1410 254
1579 3300042134 Ga0450898_022155 Ga0450898_022155_70_846 254
1580 3300042156 Ga0439446_0034792 Ga0439446_0034792_182_958 254
1581 3300042435 Ga0439434_0007850 Ga0439434_0007850_553_1332 254
1582 3300042461 Ga0439460_0032113 Ga0439460_0032113_303_1079 254
1583 3300042876 Ga0451577_0012474 Ga0451577_0012474_5717_6493 254
1584 3300044658 Ga0466972_0000049 Ga0466972_0000049_4379_5155 254
1585 3300044658 Ga0466972_0000146 Ga0466972_0000146_34112_34891 254
1586 3300044658 Ga0466972_0000641 Ga0466972_0000641_4851_5627 254
1587 3300044673 Ga0453683_0016564 Ga0453683_0016564_3586_4362 254
1588 3300044673 Ga0453683_0126061 Ga0453683_0126061_625_1401 254
1589 3300044673 Ga0453683_0267404 Ga0453683_0267404_245_1021 254
1590 3300044683 Ga0466965_0154913 Ga0466965_0154913_317_1081 254
1591 3300044693 Ga0466961_0085905 Ga0466961_0085905_329_1096 254
1592 3300044693 Ga0466961_0120018 Ga0466961_0120018_514_1290 254
1593 3300044712 Ga0453684_0027037 Ga0453684_0027037_6774_7550 254
1594 3300044712 Ga0453684_0054484 Ga0453684_0054484_1222_2004 254
1595 3300044719 Ga0466971_0152248 Ga0466971_0152248_269_1036 254
1596 3300044765 Ga0466970_0015947 Ga0466970_0015947_1610_2389 254
1597 3300044842 Ga0466957_0000381 Ga0466957_0000381_963_1739 254
1598 3300044842 Ga0466957_0012327 Ga0466957_0012327_3836_4612 254
1599 3300044842 Ga0466957_0062028 Ga0466957_0062028_1016_1792 254
1600 3300044901 Ga0466960_0093469 Ga0466960_0093469_650_1426 254
1601 3300045049 Ga0466959_0057437 Ga0466959_0057437_782_1549 254
1602 3300045049 Ga0466959_0151381 Ga0466959_0151381_325_1101 254
1603 3300045051 Ga0451576_0130745 Ga0451576_0130745_10_786 254
1604 3300045051 Ga0451576_0475321 Ga0451576_0475321_64_843 254
1605 3300045051 Ga0451576_0812298 Ga0451576_0812298_171_947 254
1606 3300045976 Ga0466967_0248632 Ga0466967_0248632_580_1374 254
1607 3300046453 Ga0495627_104413 Ga0495627_104413_22_786 254
1608 3300046459 Ga0495629_0020111 Ga0495629_0020111_465_1241 254
1609 3300046460 Ga0495638_0111546 Ga0495638_0111546_394_1170 254
1610 3300046460 Ga0495638_0117585 Ga0495638_0117585_79_855 254
1611 3300046471 Ga0495650_0000162 Ga0495650_0000162_117503_118276 254
1612 3300046473 Ga0495582_0091006 Ga0495582_0091006_854_1630 254
1613 3300046476 Ga0495662_0165709 Ga0495662_0165709_212_988 254
1614 3300046492 Ga0495585_0000153 Ga0495585_0000153_46487_47260 254
1615 3300046492 Ga0495585_0000853 Ga0495585_0000853_8834_9598 254
1616 3300046492 Ga0495585_0186983 Ga0495585_0186983_73_849 254
1617 3300046501 Ga0495607_0154217 Ga0495607_0154217_183_947 254
1618 3300046506 Ga0495583_0017756 Ga0495583_0017756_317_1090 254
1619 3300046507 Ga0495606_0000033 Ga0495606_0000033_184533_185306 254
1620 3300046507 Ga0495606_0013056 Ga0495606_0013056_3416_4183 254
1621 3300046507 Ga0495606_0016861 Ga0495606_0016861_3906_4679 254
1622 3300046511 Ga0495608_0117296 Ga0495608_0117296_143_919 254
1623 3300046512 Ga0495610_0000768 Ga0495610_0000768_8531_9295 254
1624 3300046512 Ga0495610_0002306 Ga0495610_0002306_1191_1955 254
1625 3300046512 Ga0495610_0009518 Ga0495610_0009518_2553_3326 254
1626 3300046513 Ga0495616_0003449 Ga0495616_0003449_8449_9222 254
1627 3300046513 Ga0495616_0006594 Ga0495616_0006594_5876_6649 254
1628 3300046514 Ga0495618_0016132 Ga0495618_0016132_1992_2768 254
1629 3300046516 Ga0495628_0216836 Ga0495628_0216836_119_895 254
1630 3300046517 Ga0495630_0017644 Ga0495630_0017644_4121_4897 254
1631 3300046517 Ga0495630_0042346 Ga0495630_0042346_545_1321 254
1632 3300046518 Ga0495631_0006431 Ga0495631_0006431_395_1162 254
1633 3300046519 Ga0495632_0025276 Ga0495632_0025276_1848_2615 254
1634 3300046520 Ga0495637_0048334 Ga0495637_0048334_550_1314 254
1635 3300046524 Ga0495648_0013944 Ga0495648_0013944_401_1165 254
1636 3300046524 Ga0495648_0048233 Ga0495648_0048233_1520_2293 254
1637 3300046525 Ga0495663_0072881 Ga0495663_0072881_122_886 254
1638 3300046529 Ga0495652_0326599 Ga0495652_0326599_254_1021 254
1639 3300046530 Ga0495654_0076653 Ga0495654_0076653_96_860 254
1640 3300046535 Ga0495586_0034603 Ga0495586_0034603_1337_2113 254
1641 3300046536 Ga0495587_0023448 Ga0495587_0023448_695_1471 254
1642 3300046538 Ga0495609_0004780 Ga0495609_0004780_3272_4036 254
1643 3300046538 Ga0495609_0031055 Ga0495609_0031055_1609_2373 254
1644 3300046558 Ga0495633_0011583 Ga0495633_0011583_1974_2747 254
1645 3300046558 Ga0495633_0021524 Ga0495633_0021524_1408_2172 254
1646 3300046559 Ga0495667_0292027 Ga0495667_0292027_174_950 254
1647 3300046616 Ga0495668_0000009 Ga0495668_0000009_230447_231211 254
1648 3300046616 Ga0495668_0001043 Ga0495668_0001043_18067_18843 254
1649 3300046642 Ga0495634_0030005 Ga0495634_0030005_116_892 254
1650 3300046642 Ga0495634_0085542 Ga0495634_0085542_684_1460 254
1651 3300046660 Ga0495625_0000131 Ga0495625_0000131_61548_62321 254
1652 3300046660 Ga0495625_0000951 Ga0495625_0000951_30255_31019 254
1653 3300046660 Ga0495625_0016203 Ga0495625_0016203_1388_2167 254
1654 3300046660 Ga0495625_0023966 Ga0495625_0023966_675_1448 254
1655 3300046660 Ga0495625_0047135 Ga0495625_0047135_824_1591 254
1656 3300046681 Ga0495647_0067788 Ga0495647_0067788_361_1137 254
1657 3300046683 Ga0495658_0048820 Ga0495658_0048820_312_1088 254
1658 3300046683 Ga0495658_0112207 Ga0495658_0112207_788_1552 254
1659 3300046683 Ga0495658_0127114 Ga0495658_0127114_614_1390 254
1660 3300046684 Ga0495669_0092746 Ga0495669_0092746_188_955 254
1661 3300046689 Ga0495613_0275641 Ga0495613_0275641_356_1132 254
1662 3300046689 Ga0495613_0309616 Ga0495613_0309616_146_922 254
1663 3300046691 Ga0495670_0010108 Ga0495670_0010108_2467_3243 254
1664 3300046692 Ga0495671_0147908 Ga0495671_0147908_65_838 254
1665 3300046694 Ga0495649_0000009 Ga0495649_0000009_61545_62318 254
1666 3300046809 Ga0495600_0048821 Ga0495600_0048821_1173_1949 254
1667 3300047320 Ga0495672_0073342 Ga0495672_0073342_374_1153 254
1668 3300047322 Ga0495680_0050171 Ga0495680_0050171_565_1341 254
1669 3300047323 Ga0495683_0041431 Ga0495683_0041431_288_1055 254
1670 3300047443 Ga0495687_001889 Ga0495687_001889_12893_13666 254
1671 3300047443 Ga0495687_004330 Ga0495687_004330_1469_2236 254
1672 3300047471 Ga0495684_0162552 Ga0495684_0162552_644_1420 254
1673 3300047472 Ga0495686_0000005 Ga0495686_0000005_541106_541882 254
1674 3300047472 Ga0495686_0015477 Ga0495686_0015477_825_1598 254
1675 3300048088 Ga0495602_0102640 Ga0495602_0102640_24_800 254
1676 3300048904 Ga0496101_0399871 Ga0496101_0399871_178_957 254
1677 3300048907 Ga0496104_0324376 Ga0496104_0324376_38_814 254
1678 3300048911 Ga0496108_0106115 Ga0496108_0106115_793_1569 254
1679 3300048913 Ga0496110_0065825 Ga0496110_0065825_565_1341 254
1680 3300048917 Ga0496114_0078693 Ga0496114_0078693_405_1184 254
1681 3300048917 Ga0496114_0118899 Ga0496114_0118899_1289_2065 254
1682 3300048925 Ga0496122_0000869 Ga0496122_0000869_51512_52276 254
1683 3300048926 Ga0496123_0004125 Ga0496123_0004125_9925_10689 254
1684 3300048927 Ga0496124_0021144 Ga0496124_0021144_2559_3338 254
1685 3300048928 Ga0496125_0134431 Ga0496125_0134431_346_1110 254
1686 3300048929 Ga0496126_0207146 Ga0496126_0207146_437_1213 254
1687 3300049460 Ga0495682_0039100 Ga0495682_0039100_145_909 254
1688 3300049514 Ga0501291_016456 Ga0501291_016456_224_1000 254
1689 3300049528 Ga0501312_003267 Ga0501312_003267_483_1259 254
1690 3300049551 Ga0501335_007048 Ga0501335_007048_108_884 254
1691 3300049568 Ga0501031_0015181 Ga0501031_0015181_1453_2229 254
1692 3300049568 Ga0501031_0236319 Ga0501031_0236319_328_1110 254
1693 3300049569 Ga0501032_0002512 Ga0501032_0002512_9130_9912 254
1694 3300049569 Ga0501032_0169165 Ga0501032_0169165_266_1042 254
1695 3300049569 Ga0501032_0288523 Ga0501032_0288523_115_894 254
1696 3300049570 Ga0501033_0071834 Ga0501033_0071834_847_1626 254
1697 3300049570 Ga0501033_0135840 Ga0501033_0135840_338_1114 254
1698 3300049571 Ga0501034_0009937 Ga0501034_0009937_4238_5017 254
1699 3300049571 Ga0501034_0017803 Ga0501034_0017803_5784_6560 254
1700 3300049571 Ga0501034_0021380 Ga0501034_0021380_1600_2382 254
1701 3300049571 Ga0501034_0023872 Ga0501034_0023872_2761_3546 254
1702 3300049571 Ga0501034_0060569 Ga0501034_0060569_1500_2279 254
1703 3300049571 Ga0501034_0064590 Ga0501034_0064590_2077_2856 254
1704 3300049571 Ga0501034_0176773 Ga0501034_0176773_457_1236 254
1705 3300049571 Ga0501034_0190011 Ga0501034_0190011_510_1289 254
1706 3300049572 Ga0501036_0001790 Ga0501036_0001790_5508_6290 254
1707 3300049572 Ga0501036_0003646 Ga0501036_0003646_7891_8667 254
1708 3300049572 Ga0501036_0317033 Ga0501036_0317033_388_1167 254
1709 3300049573 Ga0501037_0003854 Ga0501037_0003854_7439_8215 254
1710 3300049573 Ga0501037_0050842 Ga0501037_0050842_286_1062 254
1711 3300049573 Ga0501037_0138878 Ga0501037_0138878_334_1113 254
1712 3300049574 Ga0501038_0010410 Ga0501038_0010410_3365_4147 254
1713 3300049574 Ga0501038_0017411 Ga0501038_0017411_2220_2996 254
1714 3300049574 Ga0501038_0069951 Ga0501038_0069951_2177_2953 254
1715 3300049574 Ga0501038_0221080 Ga0501038_0221080_410_1189 254
1716 3300049574 Ga0501038_0449725 Ga0501038_0449725_64_843 254
1717 3300049575 Ga0501039_0005375 Ga0501039_0005375_2671_3453 254
1718 3300049575 Ga0501039_0152770 Ga0501039_0152770_545_1321 254
1719 3300049579 Ga0501043_0030261 Ga0501043_0030261_2072_2848 254
1720 3300049579 Ga0501043_0030395 Ga0501043_0030395_118_894 254
1721 3300049579 Ga0501043_0033741 Ga0501043_0033741_2984_3760 254
1722 3300049579 Ga0501043_0043756 Ga0501043_0043756_2610_3389 254
1723 3300049579 Ga0501043_0100396 Ga0501043_0100396_241_1017 254
1724 3300049580 Ga0501046_0002298 Ga0501046_0002298_15626_16408 254
1725 3300049580 Ga0501046_0043520 Ga0501046_0043520_262_1038 254
1726 3300049581 Ga0501047_0004399 Ga0501047_0004399_878_1657 254
1727 3300049581 Ga0501047_0007344 Ga0501047_0007344_5551_6333 254
1728 3300049581 Ga0501047_0059951 Ga0501047_0059951_1339_2115 254
1729 3300049581 Ga0501047_0154927 Ga0501047_0154927_565_1341 254
1730 3300049581 Ga0501047_0161178 Ga0501047_0161178_1016_1792 254
1731 3300049582 Ga0501048_0293929 Ga0501048_0293929_58_840 254
1732 3300049583 Ga0501067_0022764 Ga0501067_0022764_2551_3333 254
1733 3300049585 Ga0501069_0179676 Ga0501069_0179676_264_1046 254
1734 3300049586 Ga0501070_0005280 Ga0501070_0005280_3007_3789 254
1735 3300049586 Ga0501070_0026373 Ga0501070_0026373_325_1104 254
1736 3300049589 Ga0501073_0001470 Ga0501073_0001470_1579_2361 254
1737 3300049590 Ga0501074_0000494 Ga0501074_0000494_21729_22511 254
1738 3300049663 Ga0501223_000671 Ga0501223_000671_116_880 254
1739 3300049680 Ga0501250_004252 Ga0501250_004252_134_925 254
1740 3300049682 Ga0501252_001538 Ga0501252_001538_1129_1893 254
1741 3300049686 Ga0501257_018556 Ga0501257_018556_691_1467 254
1742 3300049703 Ga0501219_000429 Ga0501219_000429_3794_4570 254
1743 3300049705 Ga0501225_0045419 Ga0501225_0045419_332_1108 254
1744 3300049741 Ga0501079_0108510 Ga0501079_0108510_1112_1894 254
1745 3300049742 Ga0501080_0048629 Ga0501080_0048629_2790_3569 254
1746 3300049742 Ga0501080_0081953 Ga0501080_0081953_1310_2086 254
1747 3300049742 Ga0501080_0163918 Ga0501080_0163918_643_1428 254
1748 3300049742 Ga0501080_0550579 Ga0501080_0550579_187_969 254
1749 3300049744 Ga0501083_0004351 Ga0501083_0004351_8669_9451 254
1750 3300049758 Ga0501241_010045 Ga0501241_010045_770_1534 254
1751 3300049767 Ga0501270_015694 Ga0501270_015694_20_811 254
1752 3300049822 Ga0501035_0002001 Ga0501035_0002001_5832_6614 254
1753 3300049822 Ga0501035_0012389 Ga0501035_0012389_2155_2931 254
1754 3300049822 Ga0501035_0081321 Ga0501035_0081321_1688_2467 254
1755 3300049822 Ga0501035_0088522 Ga0501035_0088522_144_923 254
1756 3300049822 Ga0501035_0212910 Ga0501035_0212910_98_877 254
1757 3300049822 Ga0501035_0223392 Ga0501035_0223392_252_1028 254
1758 3300049823 Ga0501044_0007592 Ga0501044_0007592_4760_5542 254
1759 3300049823 Ga0501044_0012072 Ga0501044_0012072_2127_2903 254
1760 3300049823 Ga0501044_0012302 Ga0501044_0012302_7942_8718 254
1761 3300049823 Ga0501044_0015990 Ga0501044_0015990_4467_5243 254
1762 3300049823 Ga0501044_0091250 Ga0501044_0091250_443_1222 254
1763 3300049823 Ga0501044_0332222 Ga0501044_0332222_91_870 254
1764 3300050005 Ga0501284_00002 Ga0501284_00002_23029_23805 254
1765 3300050493 nmdc:mga0k408_111640_c1 nmdc:mga0k408_111640_c1_81_857 254
1766 3300050493 nmdc:mga0k408_16961_c1 nmdc:mga0k408_16961_c1_382_1158 254
1767 3300050493 nmdc:mga0k408_17298_c2 nmdc:mga0k408_17298_c2_302_1078 254
1768 3300050493 nmdc:mga0k408_1783_c1 nmdc:mga0k408_1783_c1_8475_9251 254
1769 3300050507 nmdc:mga05p37_1790_c1 nmdc:mga05p37_1790_c1_2865_3644 254
1770 3300050507 nmdc:mga05p37_192611_c1 nmdc:mga05p37_192611_c1_1500_2276 254
1771 3300050508 nmdc:mga09592_17522_c1 nmdc:mga09592_17522_c1_4599_5375 254
1772 3300050508 nmdc:mga09592_226044_c1 nmdc:mga09592_226044_c1_777_1553 254
1773 3300050508 nmdc:mga09592_260887_c1 nmdc:mga09592_260887_c1_487_1266 254
1774 3300050508 nmdc:mga09592_2958_c1 nmdc:mga09592_2958_c1_1205_1981 254
1775 3300050508 nmdc:mga09592_403000_c1 nmdc:mga09592_403000_c1_40_816 254
1776 3300050509 nmdc:mga0qj67_34856_c1 nmdc:mga0qj67_34856_c1_1824_2600 254
1777 3300050509 nmdc:mga0qj67_87151_c1 nmdc:mga0qj67_87151_c1_593_1369 254
1778 3300050510 nmdc:mga06r32_662613_c1 nmdc:mga06r32_662613_c1_140_916 254
1779 3300050510 nmdc:mga06r32_714193_c1 nmdc:mga06r32_714193_c1_176_952 254
1780 3300050510 nmdc:mga06r32_8304_c1 nmdc:mga06r32_8304_c1_1961_2737 254
1781 3300050511 nmdc:mga08y16_314925_c1 nmdc:mga08y16_314925_c1_451_1227 254
1782 3300050511 nmdc:mga08y16_71119_c1 nmdc:mga08y16_71119_c1_2735_3514 254
1783 3300050511 nmdc:mga08y16_7939_c1 nmdc:mga08y16_7939_c1_1268_2044 254
1784 3300050512 nmdc:mga0n895_108422_c1 nmdc:mga0n895_108422_c1_972_1748 254
1785 3300053086 Ga0500578_0000063 Ga0500578_0000063_54755_55531 254
1786 3300053086 Ga0500578_0036846 Ga0500578_0036846_2061_2837 254
1787 3300053088 Ga0500644_0005907 Ga0500644_0005907_406_1185 254
1788 3300053090 Ga0500646_0001109 Ga0500646_0001109_206_982 254
1789 3300053092 Ga0500583_0000076 Ga0500583_0000076_78_854 254
1790 3300053092 Ga0500583_0074734 Ga0500583_0074734_15_791 254
1791 3300053093 Ga0500651_0000455 Ga0500651_0000455_4087_4851 254
1792 3300053093 Ga0500651_0097400 Ga0500651_0097400_81_857 254
1793 3300053093 Ga0500651_0240862 Ga0500651_0240862_252_1028 254
1794 3300053098 Ga0500650_0017765 Ga0500650_0017765_208_984 254
1795 3300053103 Ga0500555_007087 Ga0500555_007087_1031_1807 254
1796 3300053104 Ga0500556_0082967 Ga0500556_0082967_373_1149 254
1797 3300053108 Ga0500562_000013 Ga0500562_000013_50277_51056 254
1798 3300053118 Ga0500594_0003368 Ga0500594_0003368_1516_2295 254
1799 3300053122 Ga0500608_001288 Ga0500608_001288_3178_3945 254
1800 3300053125 Ga0500618_024837 Ga0500618_024837_140_913 254
1801 3300053131 Ga0500652_002332 Ga0500652_002332_265_1041 254
1802 3300053136 Ga0500559_0014490 Ga0500559_0014490_2083_2859 254
1803 3300053137 Ga0500561_0014213 Ga0500561_0014213_139_903 254
1804 3300053139 Ga0500568_0000080 Ga0500568_0000080_73063_73842 254
1805 3300053140 Ga0500573_0060852 Ga0500573_0060852_1239_2015 254
1806 3300053142 Ga0500577_0015622 Ga0500577_0015622_1311_2087 254
1807 3300053146 Ga0500588_0005030 Ga0500588_0005030_600_1379 254
1808 3300053147 Ga0500589_149285 Ga0500589_149285_137_913 254
1809 3300053151 Ga0500604_0014652 Ga0500604_0014652_435_1211 254
1810 3300053153 Ga0500616_0029782 Ga0500616_0029782_1676_2455 254
1811 3300053153 Ga0500616_0077228 Ga0500616_0077228_840_1616 254
1812 3300053153 Ga0500616_0134940 Ga0500616_0134940_249_1025 254
1813 3300053156 Ga0500622_0000242 Ga0500622_0000242_15112_15891 254
1814 3300053156 Ga0500622_0133575 Ga0500622_0133575_346_1122 254
1815 3300053156 Ga0500622_0135983 Ga0500622_0135983_91_867 254
1816 3300053177 Ga0500636_0184278 Ga0500636_0184278_67_843 254
1817 3300053177 Ga0500636_0219123 Ga0500636_0219123_175_948 254
1818 3300053178 Ga0500637_0052899 Ga0500637_0052899_881_1657 254
1819 3300053727 Ga0500611_000060 Ga0500611_000060_13999_14775 254
1820 3300053730 Ga0500645_007254 Ga0500645_007254_2183_2959 254
1821 3300059631 Ga0587130_000922 Ga0587130_000922_132_908 254
1822 3300061719 Ga0466962_0013263 Ga0466962_0013263_3148_3924 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

37

160

0.88

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

177

254

0.87

PF12146

Hydrolase_4

Serine aminopeptidase, S33

74

254

0.82

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

39

260

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jd6-assembly1.cif.gz_A crystal structure of mgs-mche2, an alpha/beta hydrolase enzyme from the metagenome of sediments from the lagoon of mar chica, morocco 0.9526 4 250
5jd6-assembly1.cif.gz_A crystal structure of mgs-mche2, an alpha/beta hydrolase enzyme from the metagenome of sediments from the lagoon of mar chica, morocco 0.9316 4 250
1iun-assembly1.cif.gz_B meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal 0.8825 3 250
4lyd-assembly1.cif.gz_A-2 crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1 0.8717 2 249
2d0d-assembly1.cif.gz_A-2 crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant 0.8686 3 250
ID Description Score Start End Superfamily
5jd6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9526 4 250 3.40.50.1820
5jd6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9316 4 250 3.40.50.1820
af_A0A0P0WIT7_2_163_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8875 13 122 3.40.50.1820
1iunA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8758 4 250 3.40.50.1820
af_I1NID8_70_391_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8709 11 248 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1Z8QAR2-F1-model_v4 deleted 0.9843 4 250
AF-A0A4Q3EN68-F1-model_v4 Alpha/beta hydrolase 0.9771 128 251 GO:0016020
GO:0016787
AF-A0A1Z8QAR2-F1-model_v4 deleted 0.9764 4 250
AF-A0A7Y2ES60-F1-model_v4 Alpha/beta hydrolase 0.9737 1 251 GO:0016020
GO:0046464
GO:0047372
AF-A0A368D063-F1-model_v4 Alpha/beta fold hydrolase 0.9708 2 250 GO:0016020
GO:0046464
GO:0047372

Feature Viewer

pLDDT pTM Quality
92.94 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map