F495562

General Info

Members Datasets Scaffolds Average Seq Length
1748 527 1748 173

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_12070956|Ga0157372_120709561
Length 175
Sequence MFRWYVVNTYSGHEKKVKQNLEHRVASLGQSRAVRQVVVPTETTTELTDGQEATVEKRTMPGYVLVNMDLNDDTWVVVKNTPGVTGFVGASKDSPPVPLTQGEVDRLLHKEVAVRERTRAQYSIGESVKVVSGPLSDFSGEISEINEDAARLKVLVSIFGRETPVEVGFDQVKKI

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
130 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
131 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
148 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
153 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
158 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
159 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
160 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
161 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
230 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
231 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
232 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
233 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
234 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
235 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
236 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
237 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
238 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
239 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
240 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
241 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
242 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
243 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
244 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
247 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
250 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
251 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
252 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
253 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
254 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
255 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
256 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
257 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
258 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
259 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
260 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
261 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
262 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
263 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
264 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
265 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
266 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
267 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
268 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
269 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
277 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
278 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
279 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
280 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
281 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
282 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
283 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
284 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
285 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
286 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
287 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
288 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
289 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
290 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
291 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
292 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
293 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
294 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
295 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
296 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
297 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
298 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
299 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
300 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
301 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
302 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
303 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
304 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
305 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
306 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
307 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
308 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
309 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
310 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
311 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
312 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
313 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
314 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
315 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
316 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
317 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
318 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
319 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
320 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
321 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
322 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
323 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
324 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
325 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
326 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
327 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
328 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
329 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
330 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
331 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
332 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
333 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
334 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
335 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
336 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
337 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
338 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
339 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
340 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
341 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
342 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
343 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
344 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
345 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
346 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
347 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
348 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
349 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
350 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
351 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
352 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
353 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
354 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
355 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
356 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
357 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
358 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
359 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
360 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
361 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
362 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
363 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
364 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
365 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
366 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
367 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
368 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
369 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
370 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
371 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
372 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
373 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
374 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
375 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
376 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
377 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
378 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
379 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
380 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
381 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
382 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
383 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
384 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
385 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
386 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
387 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
388 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
389 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
390 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
391 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
392 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
393 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
394 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
395 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
396 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
397 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
398 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
399 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
400 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
401 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
402 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
403 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
404 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
405 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
406 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
407 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
408 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
409 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
410 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
411 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
412 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
413 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
414 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
415 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
416 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
417 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
418 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
419 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
420 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
421 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
422 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
423 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
424 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
425 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
426 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
427 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
428 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
449 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
450 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
451 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
452 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
453 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
454 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
455 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
456 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
457 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
458 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
459 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
460 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
461 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
462 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
463 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
464 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
465 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
466 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
470 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
471 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
472 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
473 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
474 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
475 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
476 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
477 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
478 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
479 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
480 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
481 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
482 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
483 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
484 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
485 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
486 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
487 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
488 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
489 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
490 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
491 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
492 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
493 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
494 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
495 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
496 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
526 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
527 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.14
Metatranscriptomes 4.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0
Rhizoplane 8.92
Rhizosphere 84.84
Stem 0
Stem Tuber 0
Unclassified 3.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1002723 3300000546 Bacteria 2096
2 JGI24740J21852_10006093 3300001979 Bacteria 5039
3 JGI24735J21928_10125772 3300002067 Bacteria 739
4 JGI24735J21928_10147564 3300002067 Bacteria 679
5 JGI24748J21848_1000565 3300002074 Bacteria 3991
6 JGI24744J21845_10018127 3300002077 Bacteria 1397
7 JGI24034J26672_10000096 3300002239 Bacteria 15443
8 JGI24742J22300_10003253 3300002244 Bacteria 2630
9 JGI24742J22300_10070225 3300002244 Bacteria 652
10 JGI24751J29686_10019622 3300002459 Bacteria 1400
11 JGI25407J50210_10000745 3300003373 Bacteria 6845
12 JGI25407J50210_10001748 3300003373 Bacteria 4990
13 JGI25407J50210_10018542 3300003373 Bacteria 1809
14 Ga0007417J51691_1029640 3300003544 Bacteria 1084
15 Ga0006781J51513_1014848 3300003568 Bacteria 999
16 Ga0007410J51695_1015549 3300003574 Bacteria 1049
17 Ga0007416J51690_1020459 3300003577 Bacteria 1052
18 Ga0007429J51699_1014367 3300003579 Bacteria 1236
19 JGI25404J52841_10008305 3300003659 Bacteria 2208
20 Ga0032354_1010026 3300003693 Bacteria 1089
21 Ga0032354_1025023 3300003693 Bacteria 970
22 JGI25405J52794_10070454 3300003911 Bacteria 762
23 Ga0058863_11930334 3300004799 Bacteria 920
24 Ga0070658_10505183 3300005327 Bacteria 1044
25 Ga0070658_10998766 3300005327 Bacteria 728
26 Ga0070676_10282090 3300005328 Bacteria 1120
27 Ga0070683_100003058 3300005329 Bacteria 13455
28 Ga0070683_100003409 3300005329 Bacteria 12889
29 Ga0070683_100012464 3300005329 Bacteria 7389
30 Ga0070683_100048380 3300005329 Bacteria 3931
31 Ga0070683_100091959 3300005329 Bacteria 2849
32 Ga0070683_100449358 3300005329 Bacteria 1230
33 Ga0070670_100335464 3300005331 Bacteria 1326
34 Ga0070670_100753467 3300005331 Bacteria 878
35 Ga0070677_10000017 3300005333 Bacteria 52010
36 Ga0070677_10541034 3300005333 Bacteria 637
37 Ga0068869_100233810 3300005334 Bacteria 1461
38 Ga0068869_100778215 3300005334 Bacteria 821
39 Ga0070666_10007999 3300005335 Bacteria 6539
40 Ga0070680_100002006 3300005336 Bacteria 14996
41 Ga0070680_100302481 3300005336 Bacteria 1357
42 Ga0070682_100000797 3300005337 Bacteria 18487
43 Ga0070682_100001233 3300005337 Bacteria 14566
44 Ga0070682_100105731 3300005337 Bacteria 1867
45 Ga0070682_100174161 3300005337 Bacteria 1498
46 Ga0068868_100001548 3300005338 Bacteria 15713
47 Ga0068868_100004107 3300005338 Bacteria 10173
48 Ga0068868_100044017 3300005338 Bacteria 3489
49 Ga0070660_100043104 3300005339 Bacteria 3447
50 Ga0070660_100147571 3300005339 Bacteria 1890
51 Ga0070660_100654831 3300005339 Bacteria 880
52 Ga0070689_100125494 3300005340 Bacteria 2054
53 Ga0070691_10001397 3300005341 Bacteria 10310
54 Ga0070691_10001422 3300005341 Bacteria 10226
55 Ga0070691_10118071 3300005341 Bacteria 1333
56 Ga0070691_10206432 3300005341 Bacteria 1035
57 Ga0070661_100000523 3300005344 Bacteria 29425
58 Ga0070661_100073348 3300005344 Bacteria 2520
59 Ga0070661_100189663 3300005344 Bacteria 1567
60 Ga0070661_100479924 3300005344 Bacteria 993
61 Ga0070692_10005150 3300005345 Bacteria 5533
62 Ga0070692_10211374 3300005345 Bacteria 1142
63 Ga0070692_10446862 3300005345 Bacteria 827
64 Ga0070668_100019738 3300005347 Bacteria 5075
65 Ga0070668_100050250 3300005347 Bacteria 3210
66 Ga0070668_100313706 3300005347 Bacteria 1318
67 Ga0070668_100330811 3300005347 Bacteria 1285
68 Ga0070668_100445348 3300005347 Bacteria 1112
69 Ga0070668_100738365 3300005347 Bacteria 871
70 Ga0070669_100006804 3300005353 Bacteria 8225
71 Ga0070669_101072945 3300005353 Bacteria 693
72 Ga0070675_100000063 3300005354 Bacteria 64820
73 Ga0070675_100234550 3300005354 Bacteria 1601
74 Ga0070675_100775739 3300005354 Bacteria 875
75 Ga0070671_100671957 3300005355 Bacteria 898
76 Ga0070674_100000026 3300005356 Bacteria 77168
77 Ga0070674_100000158 3300005356 Bacteria 31265
78 Ga0070674_100032921 3300005356 Bacteria 3446
79 Ga0070674_100054066 3300005356 Bacteria 2775
80 Ga0070674_100150891 3300005356 Bacteria 1754
81 Ga0070674_100216912 3300005356 Bacteria 1486
82 Ga0070674_100261751 3300005356 Bacteria 1363
83 Ga0070674_100507433 3300005356 Bacteria 1005
84 Ga0070673_100064789 3300005364 Bacteria 2912
85 Ga0070673_100095663 3300005364 Bacteria 2437
86 Ga0070673_100331015 3300005364 Bacteria 1347
87 Ga0070688_100000134 3300005365 Bacteria 39823
88 Ga0070688_100001886 3300005365 Bacteria 10516
89 Ga0070688_100226015 3300005365 Bacteria 1321
90 Ga0070659_100000031 3300005366 Bacteria 125048
91 Ga0070659_100014620 3300005366 Bacteria 5868
92 Ga0070659_100073278 3300005366 Bacteria 2726
93 Ga0070659_100220699 3300005366 Bacteria 1564
94 Ga0070659_100695539 3300005366 Bacteria 879
95 Ga0070667_100020941 3300005367 Bacteria 5432
96 Ga0070667_101115352 3300005367 Bacteria 737
97 Ga0070714_100005244 3300005435 Bacteria 9870
98 Ga0070714_100069919 3300005435 Bacteria 3033
99 Ga0070714_100070366 3300005435 Bacteria 3024
100 Ga0070714_100238192 3300005435 Bacteria 1679
101 Ga0070714_100564676 3300005435 Bacteria 1090
102 Ga0070714_101693513 3300005435 Bacteria 618
103 Ga0070713_100028369 3300005436 Bacteria 4420
104 Ga0070713_100219672 3300005436 Bacteria 1724
105 Ga0070713_101195533 3300005436 Bacteria 736
106 Ga0070710_10000005 3300005437 Bacteria 238049
107 Ga0070710_10010223 3300005437 Bacteria 4605
108 Ga0070710_10114911 3300005437 Bacteria 1622
109 Ga0070710_10310631 3300005437 Bacteria 1032
110 Ga0070701_10423138 3300005438 Bacteria 849
111 Ga0070701_10459607 3300005438 Bacteria 819
112 Ga0070711_100115639 3300005439 Bacteria 1975
113 Ga0070711_100323696 3300005439 Bacteria 1232
114 Ga0070711_100368347 3300005439 Bacteria 1159
115 Ga0070705_100003005 3300005440 Bacteria 8345
116 Ga0070705_100198060 3300005440 Bacteria 1375
117 Ga0070700_100000892 3300005441 Bacteria 14724
118 Ga0070700_100034267 3300005441 Bacteria 3065
119 Ga0070700_100039719 3300005441 Bacteria 2876
120 Ga0070700_100039802 3300005441 Bacteria 2874
121 Ga0070700_100079898 3300005441 Bacteria 2109
122 Ga0070700_100100131 3300005441 Bacteria 1908
123 Ga0070700_100237347 3300005441 Bacteria 1301
124 Ga0070700_100568161 3300005441 Bacteria 884
125 Ga0070694_100119274 3300005444 Bacteria 1891
126 Ga0070694_100257326 3300005444 Bacteria 1323
127 Ga0070708_100812610 3300005445 Bacteria 879
128 Ga0070663_100086943 3300005455 Bacteria 2309
129 Ga0070663_100162656 3300005455 Bacteria 1719
130 Ga0070663_100437465 3300005455 Bacteria 1076
131 Ga0070663_100620227 3300005455 Bacteria 912
132 Ga0070663_101135200 3300005455 Bacteria 684
133 Ga0070678_100099394 3300005456 Bacteria 2251
134 Ga0070678_100166568 3300005456 Bacteria 1791
135 Ga0070678_100664647 3300005456 Bacteria 936
136 Ga0070678_100741558 3300005456 Bacteria 888
137 Ga0070662_100000007 3300005457 Bacteria 168761
138 Ga0070662_100627364 3300005457 Bacteria 905
139 Ga0070681_10010572 3300005458 Bacteria 9116
140 Ga0070681_10282763 3300005458 Bacteria 1570
141 Ga0070681_10487440 3300005458 Bacteria 1146
142 Ga0070681_11137874 3300005458 Bacteria 702
143 Ga0068867_100000286 3300005459 Bacteria 33258
144 Ga0068867_100145536 3300005459 Bacteria 1857
145 Ga0070685_10000204 3300005466 Bacteria 39823
146 Ga0070685_10002445 3300005466 Bacteria 9552
147 Ga0070685_10007458 3300005466 Bacteria 5599
148 Ga0070685_10349126 3300005466 Bacteria 1011
149 Ga0070685_10350829 3300005466 Bacteria 1009
150 Ga0070706_101366510 3300005467 Bacteria 649
151 Ga0070699_100734214 3300005518 Bacteria 903
152 Ga0070679_100002103 3300005530 Bacteria 17941
153 Ga0070679_100052056 3300005530 Bacteria 4079
154 Ga0070679_100458785 3300005530 Bacteria 1219
155 Ga0070679_100766648 3300005530 Bacteria 908
156 Ga0070679_100882337 3300005530 Bacteria 838
157 Ga0070684_100012262 3300005535 Bacteria 6864
158 Ga0070684_100022232 3300005535 Bacteria 5286
159 Ga0070684_100037305 3300005535 Bacteria 4169
160 Ga0070684_100092187 3300005535 Bacteria 2696
161 Ga0070684_100101773 3300005535 Bacteria 2567
162 Ga0070684_100243987 3300005535 Bacteria 1642
163 Ga0070684_100327544 3300005535 Bacteria 1407
164 Ga0070684_100472053 3300005535 Bacteria 1160
165 Ga0070684_100486441 3300005535 Bacteria 1142
166 Ga0070684_100621878 3300005535 Bacteria 1005
167 Ga0068853_100084704 3300005539 Bacteria 2778
168 Ga0068853_100265380 3300005539 Bacteria 1579
169 Ga0068853_100314104 3300005539 Bacteria 1451
170 Ga0068853_100383699 3300005539 Bacteria 1312
171 Ga0070672_100000003 3300005543 Bacteria 159532
172 Ga0070672_100121376 3300005543 Bacteria 2139
173 Ga0070672_100395050 3300005543 Bacteria 1184
174 Ga0070672_100678047 3300005543 Bacteria 901
175 Ga0070686_100137172 3300005544 Bacteria 1699
176 Ga0070686_100189498 3300005544 Bacteria 1467
177 Ga0070686_100395475 3300005544 Bacteria 1050
178 Ga0070695_100502938 3300005545 Bacteria 938
179 Ga0070695_100814836 3300005545 Bacteria 749
180 Ga0070696_100228611 3300005546 Bacteria 1399
181 Ga0070693_100000635 3300005547 Bacteria 15524
182 Ga0070693_100119471 3300005547 Bacteria 1633
183 Ga0070665_100001169 3300005548 Bacteria 32197
184 Ga0070665_100005060 3300005548 Bacteria 13677
185 Ga0070665_100028564 3300005548 Bacteria 5617
186 Ga0070665_100111165 3300005548 Bacteria 2742
187 Ga0070704_100085178 3300005549 Bacteria 2338
188 Ga0070704_100898204 3300005549 Bacteria 797
189 Ga0070664_100440934 3300005564 Bacteria 1194
190 Ga0068857_100574465 3300005577 Bacteria 1064
191 Ga0068857_101193254 3300005577 Bacteria 737
192 Ga0068854_100042556 3300005578 Bacteria 3216
193 Ga0068854_100697814 3300005578 Bacteria 876
194 Ga0068856_100008031 3300005614 Bacteria 10302
195 Ga0068856_100124985 3300005614 Bacteria 2575
196 Ga0068856_100127736 3300005614 Bacteria 2546
197 Ga0068856_101124683 3300005614 Bacteria 802
198 Ga0070702_100055837 3300005615 Bacteria 2278
199 Ga0070702_100342667 3300005615 Bacteria 1049
200 Ga0068852_100000035 3300005616 Bacteria 99721
201 Ga0068852_100052206 3300005616 Bacteria 3513
202 Ga0068852_100985202 3300005616 Bacteria 861
203 Ga0068859_100038844 3300005617 Bacteria 4774
204 Ga0068859_101317775 3300005617 Bacteria 796
205 Ga0068864_100000023 3300005618 Bacteria 257064
206 Ga0068864_100258955 3300005618 Bacteria 1618
207 Ga0068864_100474594 3300005618 Bacteria 1200
208 Ga0068864_101112451 3300005618 Bacteria 786
209 Ga0068866_10000006 3300005718 Bacteria 176129
210 Ga0068866_10256365 3300005718 Bacteria 1073
211 Ga0068861_100020993 3300005719 Bacteria 4688
212 Ga0068861_100242516 3300005719 Bacteria 1534
213 Ga0068861_100283573 3300005719 Bacteria 1427
214 Ga0068861_100301564 3300005719 Bacteria 1388
215 Ga0068861_100428130 3300005719 Bacteria 1181
216 Ga0068861_100449228 3300005719 Bacteria 1155
217 Ga0068861_100562889 3300005719 Bacteria 1040
218 Ga0068861_100657806 3300005719 Bacteria 969
219 Ga0068851_10012563 3300005834 Bacteria 3994
220 Ga0068851_10125428 3300005834 Bacteria 1384
221 Ga0068870_10048760 3300005840 Bacteria 2231
222 Ga0068870_10162797 3300005840 Bacteria 1325
223 Ga0068863_100000039 3300005841 Bacteria 161450
224 Ga0068863_100217994 3300005841 Bacteria 1838
225 Ga0068858_100000831 3300005842 Bacteria 32170
226 Ga0068858_100002144 3300005842 Bacteria 19996
227 Ga0068860_100010408 3300005843 Bacteria 9199
228 Ga0068860_100069911 3300005843 Bacteria 3337
229 Ga0068862_100009489 3300005844 Bacteria 8052
230 Ga0068862_100594497 3300005844 Bacteria 1062
231 Ga0068862_100675439 3300005844 Bacteria 998
232 Ga0081455_10004450 3300005937 Bacteria 15713
233 Ga0081455_10005517 3300005937 Bacteria 13858
234 Ga0081455_10022100 3300005937 Bacteria 5953
235 Ga0081455_10039825 3300005937 Bacteria 4149
236 Ga0081455_10075891 3300005937 Bacteria 2771
237 Ga0081455_10081648 3300005937 Bacteria 2647
238 Ga0081455_10082957 3300005937 Bacteria 2620
239 Ga0081455_10293247 3300005937 Bacteria 1170
240 Ga0081455_10734408 3300005937 Bacteria 626
241 Ga0081538_10002352 3300005981 Bacteria 18600
242 Ga0081538_10003174 3300005981 Bacteria 15630
243 Ga0081538_10003407 3300005981 Bacteria 15040
244 Ga0081538_10004819 3300005981 Bacteria 12299
245 Ga0081538_10005666 3300005981 Bacteria 11179
246 Ga0081538_10007304 3300005981 Bacteria 9574
247 Ga0081538_10007363 3300005981 Bacteria 9531
248 Ga0081538_10008064 3300005981 Bacteria 8998
249 Ga0081538_10008419 3300005981 Bacteria 8757
250 Ga0081538_10012428 3300005981 Bacteria 6823
251 Ga0081538_10014954 3300005981 Bacteria 6042
252 Ga0081538_10016746 3300005981 Bacteria 5604
253 Ga0081538_10032403 3300005981 Bacteria 3503
254 Ga0081538_10047567 3300005981 Bacteria 2629
255 Ga0081538_10073415 3300005981 Bacteria 1869
256 Ga0081538_10083321 3300005981 Bacteria 1691
257 Ga0081540_1000281 3300005983 Bacteria 52990
258 Ga0081540_1002619 3300005983 Bacteria 14626
259 Ga0081540_1011708 3300005983 Bacteria 5838
260 Ga0081540_1021960 3300005983 Bacteria 3780
261 Ga0081540_1023897 3300005983 Bacteria 3561
262 Ga0081540_1052495 3300005983 Bacteria 2006
263 Ga0081540_1131644 3300005983 Bacteria 1020
264 Ga0081539_10009838 3300005985 Bacteria 7895
265 Ga0081539_10011205 3300005985 Bacteria 7134
266 Ga0081539_10019085 3300005985 Bacteria 4714
267 Ga0081539_10062799 3300005985 Bacteria 2029
268 Ga0081539_10096456 3300005985 Bacteria 1516
269 Ga0081539_10117833 3300005985 Bacteria 1324
270 Ga0070717_10000056 3300006028 Bacteria 96306
271 Ga0070717_10010045 3300006028 Bacteria 7126
272 Ga0070717_10045832 3300006028 Bacteria 3576
273 Ga0070717_10152056 3300006028 Bacteria 2003
274 Ga0070717_11634643 3300006028 Bacteria 583
275 Ga0075365_10005286 3300006038 Bacteria 6945
276 Ga0075365_10043763 3300006038 Bacteria 2932
277 Ga0075365_10089481 3300006038 Bacteria 2095
278 Ga0075365_10181502 3300006038 Bacteria 1472
279 Ga0075365_10207736 3300006038 Bacteria 1372
280 Ga0075365_10211604 3300006038 Bacteria 1359
281 Ga0075365_10215512 3300006038 Bacteria 1346
282 Ga0075365_10285531 3300006038 Bacteria 1161
283 Ga0075365_10312996 3300006038 Bacteria 1105
284 Ga0075365_10642715 3300006038 Bacteria 750
285 Ga0075363_100587192 3300006048 Bacteria 667
286 Ga0075364_10035298 3300006051 Bacteria 3231
287 Ga0075364_10242016 3300006051 Bacteria 1225
288 Ga0075364_10485065 3300006051 Bacteria 845
289 Ga0075364_10501578 3300006051 Bacteria 830
290 Ga0075364_10655956 3300006051 Bacteria 716
291 Ga0075432_10015808 3300006058 Bacteria 2575
292 Ga0070715_10000003 3300006163 Bacteria 345282
293 Ga0070716_100067406 3300006173 Bacteria 2091
294 Ga0070712_100000013 3300006175 Bacteria 109912
295 Ga0070712_100003643 3300006175 Bacteria 9497
296 Ga0070712_100007714 3300006175 Bacteria 6731
297 Ga0070712_100013065 3300006175 Bacteria 5296
298 Ga0070712_100117043 3300006175 Bacteria 1999
299 Ga0070712_100802678 3300006175 Bacteria 807
300 Ga0075367_10046401 3300006178 Bacteria 2552
301 Ga0075367_10512016 3300006178 Bacteria 762
302 Ga0075369_10282698 3300006186 Bacteria 773
303 Ga0075427_10040623 3300006194 Bacteria 784
304 Ga0097621_100464795 3300006237 Bacteria 1142
305 Ga0075370_10045254 3300006353 Bacteria 2489
306 Ga0068871_100810310 3300006358 Bacteria 864
307 Ga0068871_101000231 3300006358 Bacteria 779
308 Ga0068871_101210178 3300006358 Bacteria 709
309 Ga0075428_100025686 3300006844 Bacteria 6522
310 Ga0075428_100054770 3300006844 Bacteria 4371
311 Ga0075428_100073592 3300006844 Bacteria 3732
312 Ga0075428_100126876 3300006844 Bacteria 2776
313 Ga0075428_100220583 3300006844 Bacteria 2048
314 Ga0075428_100286406 3300006844 Bacteria 1773
315 Ga0075428_100349701 3300006844 Bacteria 1586
316 Ga0075428_100364745 3300006844 Bacteria 1549
317 Ga0075428_100394957 3300006844 Bacteria 1482
318 Ga0075428_100780687 3300006844 Bacteria 1016
319 Ga0075428_101171650 3300006844 Bacteria 810
320 Ga0075430_100002606 3300006846 Bacteria 15056
321 Ga0075430_100037214 3300006846 Bacteria 4125
322 Ga0075430_100042689 3300006846 Bacteria 3834
323 Ga0075430_100109952 3300006846 Bacteria 2298
324 Ga0075430_100169624 3300006846 Bacteria 1815
325 Ga0075430_100177602 3300006846 Bacteria 1771
326 Ga0075430_100461629 3300006846 Bacteria 1048
327 Ga0075431_100025370 3300006847 Bacteria 6076
328 Ga0075431_100058947 3300006847 Bacteria 3962
329 Ga0075431_100088845 3300006847 Bacteria 3190
330 Ga0075431_100093091 3300006847 Bacteria 3111
331 Ga0075431_100198837 3300006847 Bacteria 2051
332 Ga0075431_100636839 3300006847 Bacteria 1048
333 Ga0075431_100685949 3300006847 Bacteria 1003
334 Ga0075433_10000370 3300006852 Bacteria 28281
335 Ga0075433_10039850 3300006852 Bacteria 4064
336 Ga0075433_10065549 3300006852 Bacteria 3185
337 Ga0075433_10068428 3300006852 Bacteria 3117
338 Ga0075433_10163301 3300006852 Bacteria 1982
339 Ga0075434_100025749 3300006871 Bacteria 5758
340 Ga0075434_100115069 3300006871 Bacteria 2702
341 Ga0075434_100180398 3300006871 Bacteria 2131
342 Ga0075434_100321286 3300006871 Bacteria 1568
343 Ga0075434_100605556 3300006871 Bacteria 1115
344 Ga0075434_100609576 3300006871 Bacteria 1111
345 Ga0075429_100001704 3300006880 Bacteria 18173
346 Ga0075429_100131226 3300006880 Bacteria 2191
347 Ga0075429_100298427 3300006880 Bacteria 1411
348 Ga0075429_100772556 3300006880 Bacteria 841
349 Ga0075429_100934700 3300006880 Bacteria 759
350 Ga0068865_100000056 3300006881 Bacteria 62122
351 Ga0068865_100208430 3300006881 Bacteria 1521
352 Ga0068865_100258729 3300006881 Bacteria 1377
353 Ga0075436_100060287 3300006914 Bacteria 2621
354 Ga0075436_100618559 3300006914 Bacteria 799
355 Ga0097620_100038844 3300006931 Bacteria 4774
356 Ga0097620_101317698 3300006931 Bacteria 796
357 Ga0075435_100046851 3300007076 Bacteria 3469
358 Ga0075435_100120874 3300007076 Bacteria 2186
359 Ga0099795_10144923 3300007788 Bacteria 969
360 Ga0105240_10130738 3300009093 Bacteria 3012
361 Ga0111539_10133775 3300009094 Bacteria 2903
362 Ga0111539_10178499 3300009094 Bacteria 2481
363 Ga0111539_10437615 3300009094 Bacteria 1523
364 Ga0111539_10494215 3300009094 Bacteria 1425
365 Ga0111539_10888506 3300009094 Bacteria 1036
366 Ga0111539_10912306 3300009094 Bacteria 1022
367 Ga0111539_11070873 3300009094 Bacteria 937
368 Ga0111539_11845347 3300009094 Bacteria 701
369 Ga0105245_10000049 3300009098 Bacteria 128277
370 Ga0105245_10001790 3300009098 Bacteria 19569
371 Ga0105245_10003775 3300009098 Bacteria 13481
372 Ga0105245_10011090 3300009098 Bacteria 7846
373 Ga0105245_10077043 3300009098 Bacteria 3039
374 Ga0105245_10125321 3300009098 Bacteria 2404
375 Ga0105245_10570663 3300009098 Bacteria 1155
376 Ga0105245_10941637 3300009098 Bacteria 906
377 Ga0105245_11558831 3300009098 Bacteria 712
378 Ga0105247_10041042 3300009101 Bacteria 2830
379 Ga0105247_10204238 3300009101 Bacteria 1329
380 Ga0105247_10335237 3300009101 Bacteria 1059
381 Ga0105247_10362958 3300009101 Bacteria 1022
382 Ga0114129_10001406 3300009147 Bacteria 32466
383 Ga0114129_10030455 3300009147 Bacteria 7636
384 Ga0114129_10034211 3300009147 Bacteria 7175
385 Ga0114129_10135528 3300009147 Bacteria 3379
386 Ga0114129_10137937 3300009147 Bacteria 3345
387 Ga0114129_10207698 3300009147 Bacteria 2649
388 Ga0114129_10311982 3300009147 Bacteria 2093
389 Ga0114129_10395410 3300009147 Bacteria 1822
390 Ga0114129_10663127 3300009147 Bacteria 1345
391 Ga0114129_10728834 3300009147 Bacteria 1271
392 Ga0114129_10878963 3300009147 Bacteria 1137
393 Ga0114129_10949435 3300009147 Bacteria 1086
394 Ga0114129_12548289 3300009147 Bacteria 611
395 Ga0105243_10082170 3300009148 Bacteria 2632
396 Ga0105243_10924074 3300009148 Bacteria 870
397 Ga0105243_11039221 3300009148 Bacteria 824
398 Ga0105241_10552308 3300009174 Bacteria 1034
399 Ga0105242_10000010 3300009176 Bacteria 151649
400 Ga0105242_10050337 3300009176 Bacteria 3392
401 Ga0105242_10235579 3300009176 Bacteria 1643
402 Ga0105248_10005136 3300009177 Bacteria 14438
403 Ga0105248_10433653 3300009177 Bacteria 1480
404 Ga0105248_10840020 3300009177 Bacteria 1037
405 Ga0105237_10373185 3300009545 Bacteria 1431
406 Ga0105237_10526273 3300009545 Bacteria 1189
407 Ga0105237_10813851 3300009545 Bacteria 941
408 Ga0105237_10853945 3300009545 Bacteria 917
409 Ga0105237_11600102 3300009545 Bacteria 658
410 Ga0105238_10000014 3300009551 Bacteria 241954
411 Ga0105238_10118749 3300009551 Bacteria 2624
412 Ga0105238_10445084 3300009551 Bacteria 1292
413 Ga0105249_10000619 3300009553 Bacteria 32319
414 Ga0105249_10006121 3300009553 Bacteria 10437
415 Ga0105249_10167887 3300009553 Bacteria 2126
416 Ga0105249_10232301 3300009553 Bacteria 1819
417 Ga0105249_10552813 3300009553 Bacteria 1202
418 Ga0105249_11338543 3300009553 Bacteria 788
419 Ga0105239_10009439 3300010375 Bacteria 10991
420 Ga0105239_10502046 3300010375 Bacteria 1379
421 Ga0105239_10600385 3300010375 Bacteria 1255
422 Ga0105239_11028342 3300010375 Bacteria 948
423 Ga0105239_11682895 3300010375 Bacteria 734
424 Ga0105246_10058712 3300011119 Bacteria 2666
425 Ga0105246_10189507 3300011119 Bacteria 1591
426 Ga0105246_10205486 3300011119 Bacteria 1534
427 Ga0105246_10858141 3300011119 Bacteria 810
428 Ga0105246_11230945 3300011119 Bacteria 690
429 Ga0157322_1019757 3300012490 Bacteria 639
430 Ga0157341_1006144 3300012494 Bacteria 921
431 Ga0157342_1052715 3300012507 Bacteria 577
432 Ga0157373_10422359 3300013100 Bacteria 957
433 Ga0157373_10448527 3300013100 Bacteria 928
434 Ga0157371_10193956 3300013102 Bacteria 1455
435 Ga0157371_10408218 3300013102 Bacteria 994
436 Ga0157370_10005806 3300013104 Bacteria 13797
437 Ga0157370_10162514 3300013104 Bacteria 2077
438 Ga0157369_10000348 3300013105 Bacteria 61516
439 Ga0157369_10474664 3300013105 Bacteria 1294
440 Ga0157369_11021349 3300013105 Bacteria 846
441 Ga0157374_10010605 3300013296 Bacteria 7933
442 Ga0157374_10132226 3300013296 Bacteria 2415
443 Ga0157378_10008849 3300013297 Bacteria 8760
444 Ga0157378_10019158 3300013297 Bacteria 6013
445 Ga0157378_10212935 3300013297 Bacteria 1833
446 Ga0157378_10754836 3300013297 Bacteria 996
447 Ga0157378_10793228 3300013297 Bacteria 972
448 Ga0163162_10074005 3300013306 Bacteria 3464
449 Ga0163162_10295726 3300013306 Bacteria 1751
450 Ga0163162_10606543 3300013306 Bacteria 1220
451 Ga0163162_10802526 3300013306 Bacteria 1059
452 Ga0163162_10911901 3300013306 Bacteria 991
453 Ga0163162_10944300 3300013306 Bacteria 974
454 Ga0163162_11426830 3300013306 Bacteria 788
455 Ga0157372_10008684 3300013307 Bacteria 10790
456 Ga0157372_10021856 3300013307 Bacteria 6916
457 Ga0157372_10487963 3300013307 Bacteria 1436
458 Ga0157372_10656824 3300013307 Bacteria 1221
459 Ga0157372_12070956 3300013307 Bacteria 654
460 Ga0157375_10001799 3300013308 Bacteria 18373
461 Ga0157375_10004307 3300013308 Bacteria 12347
462 Ga0157375_10137679 3300013308 Bacteria 2567
463 Ga0157375_10404272 3300013308 Bacteria 1532
464 Ga0157375_10417239 3300013308 Bacteria 1508
465 Ga0157375_10519179 3300013308 Bacteria 1354
466 Ga0163163_10044683 3300014325 Bacteria 4347
467 Ga0163163_10217286 3300014325 Bacteria 1960
468 Ga0163163_10357688 3300014325 Bacteria 1516
469 Ga0163163_12224147 3300014325 Bacteria 607
470 Ga0157380_10168899 3300014326 Bacteria 1909
471 Ga0157380_10560983 3300014326 Bacteria 1122
472 Ga0157380_10563105 3300014326 Bacteria 1120
473 Ga0182008_10068735 3300014497 Bacteria 1743
474 Ga0182008_10135099 3300014497 Bacteria 1231
475 Ga0182008_10545947 3300014497 Bacteria 643
476 Ga0157377_10018963 3300014745 Bacteria 3587
477 Ga0157377_10208736 3300014745 Bacteria 1244
478 Ga0157377_10224613 3300014745 Bacteria 1204
479 Ga0157379_10041544 3300014968 Bacteria 4105
480 Ga0157379_10132596 3300014968 Bacteria 2243
481 Ga0157379_10531944 3300014968 Bacteria 1092
482 Ga0157376_10014477 3300014969 Bacteria 5922
483 Ga0157376_10023185 3300014969 Bacteria 4855
484 Ga0157376_10175114 3300014969 Bacteria 1956
485 Ga0157376_10572978 3300014969 Bacteria 1120
486 Ga0157376_10813484 3300014969 Bacteria 948
487 Ga0182007_10139929 3300015262 Bacteria 818
488 Ga0182005_1157453 3300015265 Bacteria 664
489 Ga0163161_10000013 3300017792 Bacteria 258747
490 Ga0163161_10022200 3300017792 Bacteria 4466
491 Ga0197907_10226004 3300020069 Bacteria 1569
492 Ga0197907_10263697 3300020069 Bacteria 1313
493 Ga0197907_10502577 3300020069 Bacteria 1836
494 Ga0197907_11319355 3300020069 Bacteria 709
495 Ga0206356_10319799 3300020070 Bacteria 2513
496 Ga0206356_11054826 3300020070 Bacteria 3985
497 Ga0206356_11287848 3300020070 Bacteria 630
498 Ga0206356_11691794 3300020070 Bacteria 676
499 Ga0206356_11746000 3300020070 Bacteria 557
500 Ga0206355_1427505 3300020076 Bacteria 658
501 Ga0206355_1710056 3300020076 Bacteria 1509
502 Ga0206351_10453586 3300020077 Bacteria 1408
503 Ga0206350_10199528 3300020080 Bacteria 1580
504 Ga0206350_10542446 3300020080 Bacteria 664
505 Ga0206353_11117576 3300020082 Bacteria 3238
506 Ga0206353_11725351 3300020082 Bacteria 1060
507 Ga0206353_11838604 3300020082 Bacteria 740
508 Ga0206353_12051169 3300020082 Bacteria 684
509 Ga0154015_1602182 3300020610 Bacteria 1296
510 Ga0154015_1695541 3300020610 Bacteria 1432
511 Ga0213873_10008616 3300021358 Bacteria 2090
512 Ga0213874_10001182 3300021377 Bacteria 5357
513 Ga0213876_10016117 3300021384 Bacteria 3953
514 Ga0213876_10026178 3300021384 Bacteria 3076
515 Ga0213876_10032232 3300021384 Bacteria 2764
516 Ga0213876_10062337 3300021384 Bacteria 1968
517 Ga0213875_10000432 3300021388 Bacteria 36597
518 Ga0213875_10016820 3300021388 Bacteria 3542
519 Ga0213875_10022860 3300021388 Bacteria 2989
520 Ga0213875_10028272 3300021388 Bacteria 2664
521 Ga0213875_10054690 3300021388 Bacteria 1869
522 Ga0213875_10187856 3300021388 Bacteria 971
523 Ga0224712_10038884 3300022467 Bacteria 1780
524 Ga0224712_10056499 3300022467 Bacteria 1548
525 Ga0224712_10066318 3300022467 Bacteria 1453
526 Ga0207656_10013897 3300025321 Bacteria 3089
527 Ga0207653_10037946 3300025885 Bacteria 1573
528 Ga0207682_10000008 3300025893 Bacteria 87020
529 Ga0207692_10000003 3300025898 Bacteria 431531
530 Ga0207642_10000001 3300025899 Bacteria 714030
531 Ga0207642_10000003 3300025899 Bacteria 650651
532 Ga0207642_10000004 3300025899 Bacteria 407822
533 Ga0207642_10000008 3300025899 Bacteria 132651
534 Ga0207642_10190036 3300025899 Bacteria 1126
535 Ga0207642_10257967 3300025899 Bacteria 993
536 Ga0207642_10344649 3300025899 Bacteria 877
537 Ga0207710_10000220 3300025900 Bacteria 50023
538 Ga0207710_10058868 3300025900 Bacteria 1738
539 Ga0207710_10182630 3300025900 Bacteria 1030
540 Ga0207688_10007210 3300025901 Bacteria 6048
541 Ga0207688_10018227 3300025901 Bacteria 3822
542 Ga0207647_10107536 3300025904 Bacteria 1650
543 Ga0207647_10262583 3300025904 Bacteria 989
544 Ga0207647_10498231 3300025904 Bacteria 679
545 Ga0207685_10000003 3300025905 Bacteria 344527
546 Ga0207699_10030456 3300025906 Bacteria 3020
547 Ga0207645_10344637 3300025907 Bacteria 996
548 Ga0207645_10358374 3300025907 Bacteria 977
549 Ga0207643_10076612 3300025908 Bacteria 1932
550 Ga0207643_10188526 3300025908 Bacteria 1251
551 Ga0207707_10005257 3300025912 Bacteria 11339
552 Ga0207707_10009788 3300025912 Bacteria 8313
553 Ga0207707_10213426 3300025912 Bacteria 1681
554 Ga0207695_10088255 3300025913 Bacteria 3122
555 Ga0207695_10303936 3300025913 Bacteria 1486
556 Ga0207671_10416437 3300025914 Bacteria 1069
557 Ga0207671_10490687 3300025914 Bacteria 979
558 Ga0207693_10000046 3300025915 Bacteria 100888
559 Ga0207693_10004849 3300025915 Bacteria 11320
560 Ga0207693_10004896 3300025915 Bacteria 11254
561 Ga0207693_10026794 3300025915 Bacteria 4559
562 Ga0207693_10070542 3300025915 Bacteria 2734
563 Ga0207693_10295902 3300025915 Bacteria 1268
564 Ga0207693_10644642 3300025915 Bacteria 823
565 Ga0207663_10180455 3300025916 Bacteria 1507
566 Ga0207663_10278393 3300025916 Bacteria 1242
567 Ga0207663_10485787 3300025916 Bacteria 957
568 Ga0207663_10659680 3300025916 Bacteria 826
569 Ga0207663_10963102 3300025916 Bacteria 684
570 Ga0207660_10092024 3300025917 Bacteria 2250
571 Ga0207660_10552817 3300025917 Bacteria 936
572 Ga0207662_10272477 3300025918 Bacteria 1117
573 Ga0207662_10676925 3300025918 Bacteria 722
574 Ga0207657_10139550 3300025919 Bacteria 1981
575 Ga0207657_10165059 3300025919 Bacteria 1797
576 Ga0207657_10171939 3300025919 Bacteria 1755
577 Ga0207657_10206589 3300025919 Bacteria 1578
578 Ga0207657_10295437 3300025919 Bacteria 1284
579 Ga0207649_10000388 3300025920 Bacteria 32980
580 Ga0207649_10056686 3300025920 Bacteria 2448
581 Ga0207649_10193371 3300025920 Bacteria 1432
582 Ga0207652_10000687 3300025921 Bacteria 32979
583 Ga0207652_10004160 3300025921 Bacteria 11800
584 Ga0207652_10476352 3300025921 Bacteria 1125
585 Ga0207652_11063708 3300025921 Bacteria 709
586 Ga0207646_10686815 3300025922 Bacteria 916
587 Ga0207681_10013602 3300025923 Bacteria 5038
588 Ga0207694_10000008 3300025924 Bacteria 484902
589 Ga0207650_10754383 3300025925 Bacteria 824
590 Ga0207659_10000054 3300025926 Bacteria 76823
591 Ga0207659_10210571 3300025926 Bacteria 1558
592 Ga0207687_10000027 3300025927 Bacteria 168505
593 Ga0207687_10000039 3300025927 Bacteria 114303
594 Ga0207687_10003143 3300025927 Bacteria 11198
595 Ga0207687_10038127 3300025927 Bacteria 3283
596 Ga0207687_10045423 3300025927 Bacteria 3036
597 Ga0207687_10062650 3300025927 Bacteria 2631
598 Ga0207687_10189472 3300025927 Bacteria 1600
599 Ga0207687_10704599 3300025927 Bacteria 857
600 Ga0207700_10017789 3300025928 Bacteria 4756
601 Ga0207700_10220752 3300025928 Bacteria 1607
602 Ga0207664_10000105 3300025929 Bacteria 75519
603 Ga0207664_10026964 3300025929 Bacteria 4350
604 Ga0207664_10044906 3300025929 Bacteria 3462
605 Ga0207664_10151835 3300025929 Bacteria 1968
606 Ga0207664_10270430 3300025929 Bacteria 1489
607 Ga0207664_10402962 3300025929 Bacteria 1217
608 Ga0207664_10964641 3300025929 Bacteria 764
609 Ga0207644_10558913 3300025931 Bacteria 948
610 Ga0207690_10000367 3300025932 Bacteria 29944
611 Ga0207690_10003175 3300025932 Bacteria 9867
612 Ga0207690_10068817 3300025932 Bacteria 2433
613 Ga0207690_10163371 3300025932 Bacteria 1662
614 Ga0207690_10873376 3300025932 Bacteria 745
615 Ga0207706_10000018 3300025933 Bacteria 168729
616 Ga0207706_10002496 3300025933 Bacteria 17926
617 Ga0207706_10339377 3300025933 Bacteria 1307
618 Ga0207706_10555586 3300025933 Bacteria 988
619 Ga0207706_10580362 3300025933 Bacteria 964
620 Ga0207686_10000394 3300025934 Bacteria 30367
621 Ga0207686_10001080 3300025934 Bacteria 15958
622 Ga0207686_10010468 3300025934 Bacteria 5051
623 Ga0207686_10035482 3300025934 Bacteria 2994
624 Ga0207686_10101719 3300025934 Bacteria 1920
625 Ga0207686_10235135 3300025934 Bacteria 1331
626 Ga0207686_10270794 3300025934 Bacteria 1249
627 Ga0207709_10017975 3300025935 Bacteria 3954
628 Ga0207709_10083807 3300025935 Bacteria 2062
629 Ga0207709_10253474 3300025935 Bacteria 1287
630 Ga0207709_10270399 3300025935 Bacteria 1250
631 Ga0207670_10083182 3300025936 Bacteria 2244
632 Ga0207669_10000041 3300025937 Bacteria 67085
633 Ga0207669_10000083 3300025937 Bacteria 47557
634 Ga0207669_10009064 3300025937 Bacteria 4715
635 Ga0207669_10399615 3300025937 Bacteria 1076
636 Ga0207669_10970496 3300025937 Bacteria 713
637 Ga0207704_10000092 3300025938 Bacteria 52383
638 Ga0207704_10072943 3300025938 Bacteria 2184
639 Ga0207665_10023069 3300025939 Bacteria 4099
640 Ga0207665_10111835 3300025939 Bacteria 1920
641 Ga0207665_10256760 3300025939 Bacteria 1293
642 Ga0207691_10000005 3300025940 Bacteria 163117
643 Ga0207711_10000011 3300025941 Bacteria 518817
644 Ga0207689_10019813 3300025942 Bacteria 5667
645 Ga0207689_10637904 3300025942 Bacteria 897
646 Ga0207661_10000155 3300025944 Bacteria 44064
647 Ga0207661_10001735 3300025944 Bacteria 14917
648 Ga0207661_10007230 3300025944 Bacteria 7893
649 Ga0207661_10007883 3300025944 Bacteria 7589
650 Ga0207661_10090386 3300025944 Bacteria 2549
651 Ga0207661_10091970 3300025944 Bacteria 2528
652 Ga0207661_10195721 3300025944 Bacteria 1775
653 Ga0207661_10302055 3300025944 Bacteria 1435
654 Ga0207661_11254215 3300025944 Bacteria 681
655 Ga0207679_10021872 3300025945 Bacteria 4345
656 Ga0207679_10724315 3300025945 Bacteria 904
657 Ga0207667_10568816 3300025949 Bacteria 1145
658 Ga0207667_10583565 3300025949 Bacteria 1128
659 Ga0207651_10464808 3300025960 Bacteria 1088
660 Ga0207712_10000067 3300025961 Bacteria 130079
661 Ga0207712_10003594 3300025961 Bacteria 9779
662 Ga0207712_10115729 3300025961 Bacteria 2019
663 Ga0207712_10347240 3300025961 Bacteria 1232
664 Ga0207712_10376202 3300025961 Bacteria 1187
665 Ga0207668_10105990 3300025972 Bacteria 2099
666 Ga0207668_10106757 3300025972 Bacteria 2092
667 Ga0207668_10149199 3300025972 Bacteria 1808
668 Ga0207668_10264596 3300025972 Bacteria 1403
669 Ga0207668_10275682 3300025972 Bacteria 1377
670 Ga0207668_10366195 3300025972 Bacteria 1209
671 Ga0207668_10658903 3300025972 Bacteria 917
672 Ga0207640_10426896 3300025981 Bacteria 1086
673 Ga0207658_10002450 3300025986 Bacteria 13579
674 Ga0207658_10379597 3300025986 Bacteria 1238
675 Ga0207677_10002371 3300026023 Bacteria 9865
676 Ga0207677_10117124 3300026023 Bacteria 1996
677 Ga0207677_10504716 3300026023 Bacteria 1046
678 Ga0207703_10001660 3300026035 Bacteria 20002
679 Ga0207703_10002059 3300026035 Bacteria 17745
680 Ga0207703_10146711 3300026035 Bacteria 2053
681 Ga0207703_10522313 3300026035 Bacteria 1117
682 Ga0207639_10581900 3300026041 Bacteria 1031
683 Ga0207678_10167792 3300026067 Bacteria 1874
684 Ga0207678_10384162 3300026067 Bacteria 1214
685 Ga0207678_10422686 3300026067 Bacteria 1156
686 Ga0207678_11124798 3300026067 Bacteria 695
687 Ga0207708_10003287 3300026075 Bacteria 11893
688 Ga0207708_10039146 3300026075 Bacteria 3611
689 Ga0207708_10052314 3300026075 Bacteria 3111
690 Ga0207708_10055912 3300026075 Bacteria 3009
691 Ga0207708_10097197 3300026075 Bacteria 2276
692 Ga0207708_10108440 3300026075 Bacteria 2154
693 Ga0207708_10159916 3300026075 Bacteria 1778
694 Ga0207708_10208275 3300026075 Bacteria 1562
695 Ga0207708_10219051 3300026075 Bacteria 1524
696 Ga0207708_11219944 3300026075 Bacteria 658
697 Ga0207702_10001995 3300026078 Bacteria 19804
698 Ga0207702_10020931 3300026078 Bacteria 5413
699 Ga0207702_10024809 3300026078 Bacteria 4974
700 Ga0207702_10052280 3300026078 Bacteria 3456
701 Ga0207702_10098300 3300026078 Bacteria 2578
702 Ga0207702_10571588 3300026078 Bacteria 1107
703 Ga0207702_11104578 3300026078 Bacteria 787
704 Ga0207641_10000065 3300026088 Bacteria 156066
705 Ga0207641_10562518 3300026088 Bacteria 1113
706 Ga0207648_10001221 3300026089 Bacteria 28819
707 Ga0207648_10194748 3300026089 Bacteria 1797
708 Ga0207648_10422278 3300026089 Bacteria 1211
709 Ga0207648_10879638 3300026089 Bacteria 836
710 Ga0207676_10000025 3300026095 Bacteria 261714
711 Ga0207676_10128753 3300026095 Bacteria 2149
712 Ga0207676_10874321 3300026095 Bacteria 880
713 Ga0207674_10070823 3300026116 Bacteria 3505
714 Ga0207674_10129140 3300026116 Bacteria 2492
715 Ga0207674_10258055 3300026116 Bacteria 1690
716 Ga0207674_10258327 3300026116 Bacteria 1689
717 Ga0207674_10729752 3300026116 Bacteria 956
718 Ga0207674_10753394 3300026116 Bacteria 940
719 Ga0207675_100007075 3300026118 Bacteria 10602
720 Ga0207675_100137263 3300026118 Bacteria 2321
721 Ga0207675_100228775 3300026118 Bacteria 1793
722 Ga0207675_100356283 3300026118 Bacteria 1435
723 Ga0207675_100400936 3300026118 Bacteria 1352
724 Ga0207675_100499335 3300026118 Bacteria 1211
725 Ga0207683_10018525 3300026121 Bacteria 5942
726 Ga0207683_10063110 3300026121 Bacteria 3263
727 Ga0207683_10193235 3300026121 Bacteria 1848
728 Ga0207683_10340628 3300026121 Bacteria 1375
729 Ga0207683_10597506 3300026121 Bacteria 1021
730 Ga0207683_10742687 3300026121 Bacteria 910
731 Ga0207683_10960721 3300026121 Bacteria 793
732 Ga0207683_11197277 3300026121 Bacteria 704
733 Ga0207698_10000014 3300026142 Bacteria 240703
734 Ga0207698_10003054 3300026142 Bacteria 10034
735 Ga0207698_10347926 3300026142 Bacteria 1399
736 Ga0207698_10459174 3300026142 Bacteria 1231
737 Ga0207698_11078117 3300026142 Bacteria 816
738 Ga0207698_11453610 3300026142 Bacteria 701
739 Ga0207428_10039865 3300027907 Bacteria 3813
740 Ga0207428_10043666 3300027907 Bacteria 3620
741 Ga0207428_10098732 3300027907 Bacteria 2259
742 Ga0207428_10132411 3300027907 Bacteria 1907
743 Ga0207428_10163197 3300027907 Bacteria 1691
744 Ga0207428_10228513 3300027907 Bacteria 1393
745 Ga0207428_10266475 3300027907 Bacteria 1275
746 Ga0268266_10000029 3300028379 Bacteria 424015
747 Ga0268266_10003036 3300028379 Bacteria 17229
748 Ga0268265_10002323 3300028380 Bacteria 14452
749 Ga0268265_10483785 3300028380 Bacteria 1163
750 Ga0268265_11196951 3300028380 Bacteria 757
751 Ga0268265_11230038 3300028380 Bacteria 747
752 Ga0268264_10007803 3300028381 Bacteria 8907
753 Ga0268264_10054875 3300028381 Bacteria 3328
754 Ga0268264_10204628 3300028381 Bacteria 1808
755 Ga0265337_1000032 3300028556 Bacteria 61342
756 Ga0265326_10000182 3300028558 Bacteria 31975
757 Ga0265326_10000391 3300028558 Bacteria 17570
758 Ga0265319_1000030 3300028563 Bacteria 129742
759 Ga0265319_1006490 3300028563 Bacteria 5410
760 Ga0265319_1101708 3300028563 Bacteria 902
761 Ga0265334_10000050 3300028573 Bacteria 88877
762 Ga0265318_10036076 3300028577 Bacteria 1899
763 Ga0265322_10000012 3300028654 Bacteria 152373
764 Ga0265322_10122887 3300028654 Bacteria 739
765 Ga0265336_10004549 3300028666 Bacteria 5228
766 Ga0265336_10007107 3300028666 Bacteria 3998
767 Ga0265338_10000156 3300028800 Bacteria 125065
768 Ga0265338_10086859 3300028800 Bacteria 2600
769 Ga0265324_10000620 3300029957 Bacteria 24187
770 Ga0265320_10000001 3300031240 Bacteria 847191
771 Ga0265325_10037045 3300031241 Bacteria 2580
772 Ga0265329_10001617 3300031242 Bacteria 10810
773 Ga0265331_10001949 3300031250 Bacteria 14428
774 Ga0265327_10000003 3300031251 Bacteria 852750
775 Ga0265327_10038308 3300031251 Bacteria 2617
776 Ga0265327_10108155 3300031251 Bacteria 1332
777 Ga0265316_10025457 3300031344 Bacteria 4937
778 Ga0307513_10334284 3300031456 Bacteria 1268
779 Ga0307408_100342149 3300031548 Bacteria 1266
780 Ga0307408_100345327 3300031548 Bacteria 1261
781 Ga0307408_100741977 3300031548 Bacteria 886
782 Ga0265314_10000178 3300031711 Bacteria 94070
783 Ga0316576_10069035 3300031727 Bacteria 2605
784 Ga0307405_10051289 3300031731 Bacteria 2559
785 Ga0307405_10114950 3300031731 Bacteria 1830
786 Ga0307405_10120355 3300031731 Bacteria 1795
787 Ga0307413_10007576 3300031824 Bacteria 5054
788 Ga0307413_10149331 3300031824 Bacteria 1626
789 Ga0307413_10304501 3300031824 Bacteria 1210
790 Ga0307413_10792947 3300031824 Bacteria 795
791 Ga0307410_10020361 3300031852 Bacteria 4056
792 Ga0307410_10020508 3300031852 Bacteria 4044
793 Ga0307410_10068568 3300031852 Bacteria 2450
794 Ga0307410_10461715 3300031852 Bacteria 1038
795 Ga0326468_10002833 3300031889 Bacteria 1457
796 Ga0307406_10043957 3300031901 Bacteria 2797
797 Ga0307406_10190419 3300031901 Bacteria 1501
798 Ga0307406_10204848 3300031901 Bacteria 1455
799 Ga0307407_10019802 3300031903 Bacteria 3434
800 Ga0307407_10030089 3300031903 Bacteria 2925
801 Ga0307407_10044272 3300031903 Bacteria 2507
802 Ga0307407_10059200 3300031903 Bacteria 2230
803 Ga0307407_10312298 3300031903 Bacteria 1100
804 Ga0307407_10325366 3300031903 Bacteria 1080
805 Ga0307407_10408666 3300031903 Bacteria 976
806 Ga0307412_10249148 3300031911 Bacteria 1378
807 Ga0307412_10666697 3300031911 Bacteria 889
808 Ga0307409_100000534 3300031995 Bacteria 16437
809 Ga0307409_100032385 3300031995 Bacteria 3789
810 Ga0307409_100036124 3300031995 Bacteria 3628
811 Ga0307409_100053888 3300031995 Bacteria 3094
812 Ga0307409_100059238 3300031995 Bacteria 2979
813 Ga0307409_100088264 3300031995 Bacteria 2531
814 Ga0307409_100126674 3300031995 Bacteria 2173
815 Ga0307409_100267682 3300031995 Bacteria 1572
816 Ga0307409_100404794 3300031995 Bacteria 1304
817 Ga0307409_100520432 3300031995 Bacteria 1162
818 Ga0307409_101600301 3300031995 Bacteria 680
819 Ga0307409_101756305 3300031995 Bacteria 649
820 Ga0307416_100004671 3300032002 Bacteria 8291
821 Ga0307416_100018928 3300032002 Bacteria 4867
822 Ga0307416_100050895 3300032002 Bacteria 3305
823 Ga0307416_100082233 3300032002 Bacteria 2727
824 Ga0307416_100090547 3300032002 Bacteria 2623
825 Ga0307416_100096755 3300032002 Bacteria 2554
826 Ga0307416_100205805 3300032002 Bacteria 1872
827 Ga0307416_100435480 3300032002 Bacteria 1359
828 Ga0307416_100706519 3300032002 Bacteria 1098
829 Ga0307416_100808962 3300032002 Bacteria 1033
830 Ga0307416_101273321 3300032002 Bacteria 841
831 Ga0307416_101502622 3300032002 Bacteria 779
832 Ga0307414_10366487 3300032004 Bacteria 1241
833 Ga0307414_10404034 3300032004 Bacteria 1187
834 Ga0307414_10640388 3300032004 Bacteria 957
835 Ga0307411_10153303 3300032005 Bacteria 1715
836 Ga0307411_10156586 3300032005 Bacteria 1700
837 Ga0307411_10887820 3300032005 Bacteria 791
838 Ga0307415_100000877 3300032126 Bacteria 13752
839 Ga0307415_100003728 3300032126 Bacteria 7802
840 Ga0307415_100149326 3300032126 Bacteria 1796
841 Ga0307415_100177819 3300032126 Bacteria 1666
842 Ga0307415_100194643 3300032126 Bacteria 1603
843 Ga0307415_100322513 3300032126 Bacteria 1288
844 Ga0307415_100367101 3300032126 Bacteria 1217
845 Ga0307415_100586140 3300032126 Bacteria 990
846 Ga0307415_100751978 3300032126 Bacteria 885
847 Ga0307415_100970861 3300032126 Bacteria 788
848 Ga0373944_0078673 3300035089 Bacteria 1086
849 Ga0373951_0106443 3300035091 Bacteria 751
850 Ga0373952_0044480 3300035092 Bacteria 1038
851 Ga0373954_0087815 3300035118 Bacteria 1491
852 Ga0373943_0079353 3300035170 Bacteria 1680
853 Ga0373946_0114228 3300035171 Bacteria 1226
854 Ga0373955_0068713 3300035172 Bacteria 1975
855 Ga0373955_0106906 3300035172 Bacteria 1614
856 Ga0373961_0037079 3300035241 Bacteria 1391
857 Ga0316574_0073643 3300035398 Bacteria 2160
858 Ga0316574_0082301 3300035398 Bacteria 2045
859 Ga0316574_0343618 3300035398 Bacteria 945
860 Ga0316574_0852079 3300035398 Bacteria 553
861 Ga0373924_0055972 3300035410 Bacteria 1642
862 Ga0373931_0575766 3300035691 Bacteria 734
863 Ga0373935_0123234 3300035692 Bacteria 1734
864 Ga0373935_0363191 3300035692 Bacteria 1034
865 Ga0373935_0781808 3300035692 Bacteria 704
866 Ga0373927_0122321 3300035695 Bacteria 1699
867 Ga0373933_0049145 3300035724 Bacteria 2514
868 Ga0373933_0199053 3300035724 Bacteria 1282
869 Ga0373947_0189914 3300035725 Bacteria 1340
870 Ga0373937_0004250 3300036401 Bacteria 12136
871 Ga0373937_0049210 3300036401 Bacteria 3860
872 Ga0373937_0152541 3300036401 Bacteria 2164
873 Ga0373937_0333997 3300036401 Bacteria 1435
874 Ga0373937_0846820 3300036401 Bacteria 863
875 Ga0316582_0123886 3300036647 Bacteria 1732
876 Ga0316582_0186344 3300036647 Bacteria 1413
877 Ga0316584_0011612 3300036712 Bacteria 6195
878 Ga0373925_1122623 3300037068 Bacteria 647
879 Ga0395899_0190943 3300037312 Bacteria 1433
880 Ga0395899_0200259 3300037312 Bacteria 1393
881 Ga0395900_0024946 3300037418 Bacteria 6119
882 Ga0395900_0207637 3300037418 Bacteria 1979
883 Ga0395900_0234875 3300037418 Bacteria 1842
884 Ga0395900_0299334 3300037418 Bacteria 1595
885 Ga0395900_0331014 3300037418 Bacteria 1501
886 Ga0395900_0694007 3300037418 Bacteria 952
887 Ga0395898_0006808 3300037466 Bacteria 12160
888 Ga0395898_0029500 3300037466 Bacteria 5494
889 Ga0395898_0093235 3300037466 Bacteria 2895
890 Ga0395898_0157094 3300037466 Bacteria 2175
891 Ga0395898_0161043 3300037466 Bacteria 2146
892 Ga0395898_0181431 3300037466 Bacteria 2012
893 Ga0395898_0321199 3300037466 Bacteria 1477
894 Ga0395898_0496511 3300037466 Bacteria 1161
895 Ga0395898_0548426 3300037466 Bacteria 1098
896 Ga0395898_0617276 3300037466 Bacteria 1027
897 Ga0395898_0775278 3300037466 Bacteria 900
898 Ga0395898_0815380 3300037466 Bacteria 873
899 Ga0395898_0949921 3300037466 Bacteria 797
900 Ga0395905_0103388 3300037471 Bacteria 2674
901 Ga0395905_0195984 3300037471 Bacteria 1894
902 Ga0395905_0340529 3300037471 Bacteria 1391
903 Ga0395905_0641276 3300037471 Bacteria 964
904 Ga0395905_0712930 3300037471 Bacteria 905
905 Ga0436364_0106860 3300037853 Bacteria 1132
906 Ga0436364_0143102 3300037853 Bacteria 6244
907 Ga0436364_0232403 3300037853 Bacteria 3206
908 Ga0436364_0285692 3300037853 Bacteria 6091
909 Ga0436364_0346470 3300037853 Bacteria 1448
910 Ga0436364_0346957 3300037853 Bacteria 2816
911 Ga0436364_0472975 3300037853 Bacteria 760
912 Ga0436364_0561523 3300037853 Bacteria 1334
913 Ga0436364_0829524 3300037853 Bacteria 608
914 Ga0436364_1031907 3300037853 Bacteria 102112
915 Ga0436364_1056938 3300037853 Bacteria 1047
916 Ga0436364_1160444 3300037853 Bacteria 752
917 Ga0436364_1168699 3300037853 Bacteria 7457
918 Ga0395901_0005610 3300038443 Bacteria 12699
919 Ga0395901_0076584 3300038443 Bacteria 3490
920 Ga0395901_0105378 3300038443 Bacteria 2959
921 Ga0395901_0252827 3300038443 Bacteria 1836
922 Ga0395901_0340599 3300038443 Bacteria 1549
923 Ga0395901_0463896 3300038443 Bacteria 1294
924 Ga0395901_0651066 3300038443 Bacteria 1057
925 Ga0395901_0703038 3300038443 Bacteria 1008
926 Ga0395901_1033471 3300038443 Bacteria 796
927 Ga0395901_1038483 3300038443 Bacteria 793
928 Ga0395901_1047997 3300038443 Bacteria 789
929 Ga0395901_1320517 3300038443 Bacteria 682
930 Ga0395901_1761399 3300038443 Bacteria 569
931 Ga0436365_0221050 3300039437 Bacteria 600
932 Ga0436365_0229613 3300039437 Bacteria 1963
933 Ga0436365_0654188 3300039437 Bacteria 2467
934 Ga0436365_0699626 3300039437 Bacteria 8037
935 Ga0436365_0941052 3300039437 Bacteria 3093
936 Ga0436365_1067328 3300039437 Bacteria 957
937 Ga0436365_1154041 3300039437 Bacteria 744
938 Ga0436365_1233534 3300039437 Bacteria 3547
939 Ga0436365_1418397 3300039437 Bacteria 3236
940 Ga0436365_1481388 3300039437 Bacteria 713
941 Ga0436360_0664694 3300039438 Bacteria 578
942 Ga0436360_0821324 3300039438 Bacteria 968
943 Ga0436360_1134058 3300039438 Bacteria 786
944 Ga0436361_1070910 3300039447 Bacteria 621
945 Ga0436363_0074967 3300039450 Bacteria 719
946 Ga0436363_0240367 3300039450 Bacteria 656
947 Ga0436363_0545932 3300039450 Bacteria 952
948 Ga0436363_0627696 3300039450 Bacteria 32730
949 Ga0436363_0676392 3300039450 Bacteria 3577
950 Ga0436363_0732988 3300039450 Bacteria 672
951 Ga0436363_0989127 3300039450 Bacteria 916
952 Ga0436363_1254867 3300039450 Bacteria 662
953 Ga0436363_1432928 3300039450 Bacteria 648
954 Ga0436362_0042707 3300039453 Bacteria 1191
955 Ga0436362_0080939 3300039453 Bacteria 832
956 Ga0436362_0150515 3300039453 Bacteria 678
957 Ga0436362_0306467 3300039453 Bacteria 1471
958 Ga0436362_0708969 3300039453 Bacteria 2539
959 Ga0436362_0785080 3300039453 Bacteria 698
960 Ga0436362_0872615 3300039453 Bacteria 2934
961 Ga0436362_1013764 3300039453 Bacteria 700
962 Ga0451789_0352119 3300041443 Bacteria 645
963 Ga0451802_1133852 3300041460 Bacteria 916
964 Ga0451802_1973824 3300041460 Bacteria 1144
965 Ga0451805_065324 3300041461 Bacteria 696
966 Ga0451833_0037273 3300041491 Bacteria 2278
967 Ga0451837_1082767 3300041494 Bacteria 1099
968 Ga0451839_1032745 3300041496 Bacteria 603
969 Ga0451839_1532378 3300041496 Bacteria 544
970 Ga0451847_0347266 3300041503 Bacteria 903
971 Ga0451849_1511113 3300041505 Bacteria 883
972 Ga0451855_0398413 3300041511 Bacteria 729
973 Ga0451853_0867433 3300041512 Bacteria 1394
974 Ga0451853_2250389 3300041512 Bacteria 974
975 Ga0451853_2281280 3300041512 Bacteria 779
976 Ga0451853_2975849 3300041512 Bacteria 2284
977 Ga0439448_0028541 3300042005 Bacteria 1763
978 Ga0439454_016321 3300042011 Bacteria 1049
979 Ga0439463_070705 3300042016 Bacteria 894
980 Ga0450917_003657 3300042120 Bacteria 1115
981 Ga0439446_0245051 3300042156 Bacteria 617
982 Ga0439458_0081323 3300042157 Bacteria 827
983 Ga0439459_0012694 3300042438 Bacteria 1504
984 Ga0439459_0162681 3300042438 Bacteria 590
985 Ga0439440_0034182 3300042993 Bacteria 1215
986 Ga0466969_0036435 3300044656 Bacteria 2485
987 Ga0466969_0073210 3300044656 Bacteria 1644
988 Ga0466972_0061896 3300044658 Bacteria 1794
989 Ga0466965_0204056 3300044683 Bacteria 1049
990 Ga0466966_0023720 3300044684 Bacteria 4015
991 Ga0466966_0118848 3300044684 Bacteria 1625
992 Ga0466966_0133761 3300044684 Bacteria 1517
993 Ga0466966_0161683 3300044684 Bacteria 1363
994 Ga0466966_0282218 3300044684 Bacteria 999
995 Ga0466966_0307169 3300044684 Bacteria 953
996 Ga0466961_0003639 3300044693 Bacteria 9604
997 Ga0466961_0033037 3300044693 Bacteria 3325
998 Ga0466961_0038935 3300044693 Bacteria 3049
999 Ga0466961_0119231 3300044693 Bacteria 1657
1000 Ga0466961_0264626 3300044693 Bacteria 1054
1001 Ga0466961_0377469 3300044693 Bacteria 861
1002 Ga0466961_0458547 3300044693 Bacteria 771
1003 Ga0466961_0604665 3300044693 Bacteria 659
1004 Ga0466963_0001627 3300044694 Bacteria 12228
1005 Ga0466963_0015440 3300044694 Bacteria 4729
1006 Ga0466963_0020681 3300044694 Bacteria 4141
1007 Ga0466963_0029245 3300044694 Bacteria 3545
1008 Ga0466963_0036608 3300044694 Bacteria 3201
1009 Ga0466963_0302185 3300044694 Bacteria 1125
1010 Ga0466963_0382950 3300044694 Bacteria 991
1011 Ga0466963_0440550 3300044694 Bacteria 919
1012 Ga0466963_0675908 3300044694 Bacteria 729
1013 Ga0466964_0042874 3300044706 Bacteria 1834
1014 Ga0466964_0243801 3300044706 Bacteria 883
1015 Ga0466971_0008251 3300044719 Bacteria 4544
1016 Ga0466971_0013912 3300044719 Bacteria 3537
1017 Ga0466971_0035443 3300044719 Bacteria 2237
1018 Ga0466971_0056109 3300044719 Bacteria 1777
1019 Ga0466971_0084538 3300044719 Bacteria 1449
1020 Ga0466971_0245336 3300044719 Bacteria 852
1021 Ga0466971_0354122 3300044719 Bacteria 711
1022 Ga0466968_0015354 3300044735 Bacteria 3034
1023 Ga0466968_0039733 3300044735 Bacteria 1981
1024 Ga0466968_0080927 3300044735 Bacteria 1427
1025 Ga0466968_0106982 3300044735 Bacteria 1254
1026 Ga0466968_0263216 3300044735 Bacteria 821
1027 Ga0466970_0041505 3300044765 Bacteria 2445
1028 Ga0466970_0172160 3300044765 Bacteria 1200
1029 Ga0466970_0227408 3300044765 Bacteria 1042
1030 Ga0466970_0426915 3300044765 Bacteria 758
1031 Ga0466970_0597831 3300044765 Bacteria 640
1032 Ga0466970_0913536 3300044765 Bacteria 516
1033 Ga0466957_0007191 3300044842 Bacteria 6295
1034 Ga0466957_0061370 3300044842 Bacteria 2307
1035 Ga0466957_0354022 3300044842 Bacteria 996
1036 Ga0466957_0428596 3300044842 Bacteria 908
1037 Ga0466957_0467800 3300044842 Bacteria 871
1038 Ga0466957_0536966 3300044842 Bacteria 814
1039 Ga0466957_0542711 3300044842 Bacteria 810
1040 Ga0466957_0834617 3300044842 Bacteria 656
1041 Ga0466960_0004643 3300044901 Bacteria 5387
1042 Ga0466960_0025223 3300044901 Bacteria 2689
1043 Ga0466960_0039158 3300044901 Bacteria 2234
1044 Ga0466960_0163038 3300044901 Bacteria 1198
1045 Ga0466960_0770998 3300044901 Bacteria 581
1046 Ga0466960_0806992 3300044901 Bacteria 568
1047 Ga0466959_0001493 3300045049 Bacteria 14360
1048 Ga0466959_0035180 3300045049 Bacteria 3706
1049 Ga0466959_0042982 3300045049 Bacteria 3332
1050 Ga0466959_0062522 3300045049 Bacteria 2705
1051 Ga0466959_0097947 3300045049 Bacteria 2101
1052 Ga0466959_0112458 3300045049 Bacteria 1942
1053 Ga0466959_0148873 3300045049 Bacteria 1651
1054 Ga0466959_0176995 3300045049 Bacteria 1494
1055 Ga0466959_0216504 3300045049 Bacteria 1329
1056 Ga0466959_0288069 3300045049 Bacteria 1126
1057 Ga0466959_0397876 3300045049 Bacteria 936
1058 Ga0466959_0447995 3300045049 Bacteria 875
1059 Ga0466959_0473332 3300045049 Bacteria 848
1060 Ga0466959_0484004 3300045049 Bacteria 837
1061 Ga0466959_0577843 3300045049 Bacteria 757
1062 Ga0466958_0003781 3300045836 Bacteria 7900
1063 Ga0466958_0013647 3300045836 Bacteria 4630
1064 Ga0466958_0038178 3300045836 Bacteria 2881
1065 Ga0466958_0051714 3300045836 Bacteria 2488
1066 Ga0466958_0053421 3300045836 Bacteria 2449
1067 Ga0466958_0073140 3300045836 Bacteria 2100
1068 Ga0466958_0073657 3300045836 Bacteria 2092
1069 Ga0466958_0078070 3300045836 Bacteria 2034
1070 Ga0466958_0096115 3300045836 Bacteria 1837
1071 Ga0466958_0156443 3300045836 Bacteria 1439
1072 Ga0466958_0180271 3300045836 Bacteria 1340
1073 Ga0466958_0296187 3300045836 Bacteria 1038
1074 Ga0466958_0304484 3300045836 Bacteria 1023
1075 Ga0466958_0439622 3300045836 Bacteria 844
1076 Ga0466958_0847933 3300045836 Bacteria 596
1077 Ga0466958_0853695 3300045836 Bacteria 594
1078 Ga0466967_0000003 3300045976 Bacteria 169144
1079 Ga0466967_0022464 3300045976 Bacteria 5148
1080 Ga0466967_0039117 3300045976 Bacteria 4074
1081 Ga0466967_0074773 3300045976 Bacteria 3044
1082 Ga0466967_0094671 3300045976 Bacteria 2720
1083 Ga0466967_0125691 3300045976 Bacteria 2375
1084 Ga0466967_0226700 3300045976 Bacteria 1778
1085 Ga0466967_0309116 3300045976 Bacteria 1522
1086 Ga0466967_0335370 3300045976 Bacteria 1461
1087 Ga0466967_0356617 3300045976 Bacteria 1416
1088 Ga0466967_0404473 3300045976 Bacteria 1329
1089 Ga0466967_0605596 3300045976 Bacteria 1081
1090 Ga0466967_0663928 3300045976 Bacteria 1031
1091 Ga0466967_0718885 3300045976 Bacteria 990
1092 Ga0466967_1102080 3300045976 Bacteria 791
1093 Ga0466967_1223502 3300045976 Bacteria 748
1094 Ga0466967_1282231 3300045976 Bacteria 730
1095 Ga0495592_0003637 3300046454 Bacteria 11095
1096 Ga0495592_0026155 3300046454 Bacteria 4427
1097 Ga0495592_0049814 3300046454 Bacteria 3113
1098 Ga0495592_0189881 3300046454 Bacteria 1393
1099 Ga0495592_0206161 3300046454 Bacteria 1323
1100 Ga0495592_0221337 3300046454 Bacteria 1265
1101 Ga0495592_0389058 3300046454 Bacteria 886
1102 Ga0495603_0000744 3300046455 Bacteria 18634
1103 Ga0495603_0002184 3300046455 Bacteria 11505
1104 Ga0495603_0003928 3300046455 Bacteria 8859
1105 Ga0495603_0067458 3300046455 Bacteria 2106
1106 Ga0495603_0069459 3300046455 Bacteria 2072
1107 Ga0495591_082635 3300046458 Bacteria 817
1108 Ga0495629_0000091 3300046459 Bacteria 78697
1109 Ga0495629_0034425 3300046459 Bacteria 3581
1110 Ga0495638_0017341 3300046460 Bacteria 4803
1111 Ga0495641_0000400 3300046461 Bacteria 36235
1112 Ga0495641_0008386 3300046461 Bacteria 6314
1113 Ga0495641_0010702 3300046461 Bacteria 5288
1114 Ga0495641_0232571 3300046461 Bacteria 827
1115 Ga0495651_0000497 3300046462 Bacteria 30480
1116 Ga0495651_0034052 3300046462 Bacteria 3972
1117 Ga0495651_0138845 3300046462 Bacteria 1765
1118 Ga0495651_0435924 3300046462 Bacteria 849
1119 Ga0495653_0119872 3300046463 Bacteria 1877
1120 Ga0495653_0132302 3300046463 Bacteria 1764
1121 Ga0495653_0132681 3300046463 Bacteria 1761
1122 Ga0495653_0136154 3300046463 Bacteria 1732
1123 Ga0495653_0242536 3300046463 Bacteria 1200
1124 Ga0495650_0000188 3300046471 Bacteria 134775
1125 Ga0495580_0094112 3300046472 Bacteria 2085
1126 Ga0495580_0386661 3300046472 Bacteria 945
1127 Ga0495580_0500982 3300046472 Bacteria 811
1128 Ga0495582_0000006 3300046473 Bacteria 140434
1129 Ga0495582_0046569 3300046473 Bacteria 2389
1130 Ga0495582_0513287 3300046473 Bacteria 693
1131 Ga0495605_0121670 3300046474 Bacteria 1183
1132 Ga0495639_0025364 3300046475 Bacteria 2614
1133 Ga0495639_0171256 3300046475 Bacteria 1054
1134 Ga0495639_0263081 3300046475 Bacteria 855
1135 Ga0495662_0003307 3300046476 Bacteria 8166
1136 Ga0495662_0008091 3300046476 Bacteria 5181
1137 Ga0495662_0220124 3300046476 Bacteria 935
1138 Ga0495664_0106141 3300046477 Bacteria 1694
1139 Ga0495664_0272353 3300046477 Bacteria 1023
1140 Ga0495584_0241531 3300046491 Bacteria 918
1141 Ga0495584_0313339 3300046491 Bacteria 797
1142 Ga0495584_0327596 3300046491 Bacteria 778
1143 Ga0495585_0314618 3300046492 Bacteria 767
1144 Ga0495594_0000001 3300046499 Bacteria 293051
1145 Ga0495594_0422241 3300046499 Bacteria 758
1146 Ga0495596_0100336 3300046500 Bacteria 1124
1147 Ga0495596_0131698 3300046500 Bacteria 970
1148 Ga0495607_0253618 3300046501 Bacteria 846
1149 Ga0495606_0000283 3300046507 Bacteria 88309
1150 Ga0495608_0000010 3300046511 Bacteria 258660
1151 Ga0495608_0000184 3300046511 Bacteria 44478
1152 Ga0495608_0000564 3300046511 Bacteria 25451
1153 Ga0495608_0056368 3300046511 Bacteria 2595
1154 Ga0495610_0193131 3300046512 Bacteria 839
1155 Ga0495616_0130736 3300046513 Bacteria 1151
1156 Ga0495618_0000037 3300046514 Bacteria 99735
1157 Ga0495618_0412151 3300046514 Bacteria 825
1158 Ga0495618_0764689 3300046514 Bacteria 564
1159 Ga0495620_0000730 3300046515 Bacteria 20256
1160 Ga0495620_0163560 3300046515 Bacteria 864
1161 Ga0495620_0181769 3300046515 Bacteria 813
1162 Ga0495628_0015314 3300046516 Bacteria 6404
1163 Ga0495628_0032702 3300046516 Bacteria 4197
1164 Ga0495630_0000378 3300046517 Bacteria 35012
1165 Ga0495630_0004380 3300046517 Bacteria 9914
1166 Ga0495630_0169576 3300046517 Bacteria 1663
1167 Ga0495630_0259155 3300046517 Bacteria 1328
1168 Ga0495630_0376446 3300046517 Bacteria 1087
1169 Ga0495630_0756871 3300046517 Bacteria 742
1170 Ga0495630_0863445 3300046517 Bacteria 690
1171 Ga0495631_0048284 3300046518 Bacteria 1867
1172 Ga0495631_0091740 3300046518 Bacteria 1308
1173 Ga0495632_0284274 3300046519 Bacteria 736
1174 Ga0495643_0140303 3300046522 Bacteria 1206
1175 Ga0495644_0150844 3300046523 Bacteria 889
1176 Ga0495663_0034943 3300046525 Bacteria 1508
1177 Ga0495663_0104730 3300046525 Bacteria 935
1178 Ga0495663_0284553 3300046525 Bacteria 593
1179 Ga0495666_0245355 3300046526 Bacteria 817
1180 Ga0495642_0393762 3300046528 Bacteria 611
1181 Ga0495652_0000009 3300046529 Bacteria 311000
1182 Ga0495652_0008763 3300046529 Bacteria 9206
1183 Ga0495652_0118252 3300046529 Bacteria 2118
1184 Ga0495665_0507316 3300046531 Bacteria 607
1185 Ga0495640_0010112 3300046533 Bacteria 7312
1186 Ga0495640_0044573 3300046533 Bacteria 3083
1187 Ga0495640_0594359 3300046533 Bacteria 669
1188 Ga0495586_0002482 3300046535 Bacteria 9997
1189 Ga0495587_0048315 3300046536 Bacteria 2520
1190 Ga0495587_0068246 3300046536 Bacteria 2071
1191 Ga0495587_0362367 3300046536 Bacteria 807
1192 Ga0495598_0000130 3300046537 Bacteria 12735
1193 Ga0495609_0048160 3300046538 Bacteria 1906
1194 Ga0495621_0003784 3300046539 Bacteria 4197
1195 Ga0495621_0107551 3300046539 Bacteria 1067
1196 Ga0495621_0221092 3300046539 Bacteria 767
1197 Ga0495597_0308454 3300046542 Bacteria 613
1198 Ga0495645_0007960 3300046543 Bacteria 7378
1199 Ga0495622_0000069 3300046557 Bacteria 89759
1200 Ga0495633_0093797 3300046558 Bacteria 1395
1201 Ga0495667_0000067 3300046559 Bacteria 81751
1202 Ga0495667_0028867 3300046559 Bacteria 3735
1203 Ga0495667_0275040 3300046559 Bacteria 1069
1204 Ga0495667_0548583 3300046559 Bacteria 722
1205 Ga0495667_0730516 3300046559 Bacteria 613
1206 Ga0495656_0001302 3300046615 Bacteria 8119
1207 Ga0495656_0074702 3300046615 Bacteria 1515
1208 Ga0495656_0079291 3300046615 Bacteria 1478
1209 Ga0495656_0220350 3300046615 Bacteria 948
1210 Ga0495668_0231312 3300046616 Bacteria 1012
1211 Ga0495668_0357744 3300046616 Bacteria 801
1212 Ga0495634_0001020 3300046642 Bacteria 26279
1213 Ga0495634_0058229 3300046642 Bacteria 2576
1214 Ga0495634_0068451 3300046642 Bacteria 2345
1215 Ga0495634_0116088 3300046642 Bacteria 1717
1216 Ga0495634_0258533 3300046642 Bacteria 1063
1217 Ga0495625_0000109 3300046660 Bacteria 125064
1218 Ga0495635_0000006 3300046663 Bacteria 301820
1219 Ga0495635_0015170 3300046663 Bacteria 5389
1220 Ga0495635_0024519 3300046663 Bacteria 4203
1221 Ga0495635_0079576 3300046663 Bacteria 2243
1222 Ga0495635_0081937 3300046663 Bacteria 2208
1223 Ga0495588_0135324 3300046674 Bacteria 1301
1224 Ga0495588_0542005 3300046674 Bacteria 610
1225 Ga0495657_0000005 3300046675 Bacteria 254860
1226 Ga0495657_0008079 3300046675 Bacteria 8069
1227 Ga0495657_0008679 3300046675 Bacteria 7758
1228 Ga0495599_0030022 3300046678 Bacteria 3409
1229 Ga0495599_0042683 3300046678 Bacteria 2846
1230 Ga0495623_0134696 3300046679 Bacteria 1475
1231 Ga0495623_0470292 3300046679 Bacteria 667
1232 Ga0495646_0105124 3300046680 Bacteria 1613
1233 Ga0495647_0000010 3300046681 Bacteria 94696
1234 Ga0495647_0210033 3300046681 Bacteria 856
1235 Ga0495647_0235687 3300046681 Bacteria 811
1236 Ga0495658_0000094 3300046683 Bacteria 46061
1237 Ga0495658_0294258 3300046683 Bacteria 1026
1238 Ga0495658_0299473 3300046683 Bacteria 1017
1239 Ga0495658_0308808 3300046683 Bacteria 1001
1240 Ga0495613_0000087 3300046689 Bacteria 88644
1241 Ga0495613_0000329 3300046689 Bacteria 42819
1242 Ga0495613_0076443 3300046689 Bacteria 2437
1243 Ga0495624_0000259 3300046690 Bacteria 41997
1244 Ga0495624_0000576 3300046690 Bacteria 28722
1245 Ga0495624_0053030 3300046690 Bacteria 2561
1246 Ga0495624_0656024 3300046690 Bacteria 624
1247 Ga0495670_0122781 3300046691 Bacteria 1350
1248 Ga0495670_0193363 3300046691 Bacteria 1076
1249 Ga0495670_0368989 3300046691 Bacteria 774
1250 Ga0495671_0351615 3300046692 Bacteria 707
1251 Ga0495649_0069927 3300046694 Bacteria 1882
1252 Ga0495649_0156280 3300046694 Bacteria 1197
1253 Ga0495649_0323123 3300046694 Bacteria 783
1254 Ga0495649_0392111 3300046694 Bacteria 698
1255 Ga0495589_0098492 3300046794 Bacteria 1416
1256 Ga0495589_0299342 3300046794 Bacteria 746
1257 Ga0495589_0310472 3300046794 Bacteria 730
1258 Ga0495589_0326316 3300046794 Bacteria 709
1259 Ga0495600_0003402 3300046809 Bacteria 9363
1260 Ga0495600_0017923 3300046809 Bacteria 4507
1261 Ga0495600_0204674 3300046809 Bacteria 1266
1262 Ga0495660_0119480 3300046810 Bacteria 1335
1263 Ga0495581_0026510 3300047315 Bacteria 3360
1264 Ga0495581_0106703 3300047315 Bacteria 1628
1265 Ga0495581_0339534 3300047315 Bacteria 877
1266 Ga0495581_0581516 3300047315 Bacteria 649
1267 Ga0495604_0000294 3300047317 Bacteria 44723
1268 Ga0495604_0000460 3300047317 Bacteria 36155
1269 Ga0495604_0011664 3300047317 Bacteria 6989
1270 Ga0495604_0068212 3300047317 Bacteria 2700
1271 Ga0495604_0249119 3300047317 Bacteria 1211
1272 Ga0495604_0552315 3300047317 Bacteria 742
1273 Ga0495636_0237661 3300047318 Bacteria 840
1274 Ga0495674_0000115 3300047319 Bacteria 60282
1275 Ga0495674_0088536 3300047319 Bacteria 2648
1276 Ga0495674_0453826 3300047319 Bacteria 1030
1277 Ga0495672_0045216 3300047320 Bacteria 2636
1278 Ga0495672_0148439 3300047320 Bacteria 1218
1279 Ga0495672_0188564 3300047320 Bacteria 1039
1280 Ga0495676_0000405 3300047321 Bacteria 34992
1281 Ga0495676_0003648 3300047321 Bacteria 13966
1282 Ga0495676_0036586 3300047321 Bacteria 4097
1283 Ga0495676_0095537 3300047321 Bacteria 2211
1284 Ga0495676_0241321 3300047321 Bacteria 1237
1285 Ga0495676_0506358 3300047321 Bacteria 792
1286 Ga0495676_0818928 3300047321 Bacteria 599
1287 Ga0495676_0831824 3300047321 Bacteria 593
1288 Ga0495676_0842177 3300047321 Bacteria 589
1289 Ga0495680_0000336 3300047322 Bacteria 52443
1290 Ga0495680_0003588 3300047322 Bacteria 15200
1291 Ga0495680_0005033 3300047322 Bacteria 12496
1292 Ga0495680_0005621 3300047322 Bacteria 11751
1293 Ga0495680_0070802 3300047322 Bacteria 2657
1294 Ga0495680_0357979 3300047322 Bacteria 1015
1295 Ga0495675_0000004 3300047444 Bacteria 211049
1296 Ga0495677_0158529 3300047445 Bacteria 873
1297 Ga0495673_0175915 3300047469 Bacteria 813
1298 Ga0495681_0343793 3300047470 Bacteria 569
1299 Ga0495684_0189733 3300047471 Bacteria 1520
1300 Ga0495684_0918320 3300047471 Bacteria 562
1301 Ga0495686_0079517 3300047472 Bacteria 2005
1302 Ga0495686_0170121 3300047472 Bacteria 1268
1303 Ga0495686_0305462 3300047472 Bacteria 877
1304 Ga0495593_0041904 3300047673 Bacteria 2460
1305 Ga0495593_0167787 3300047673 Bacteria 1107
1306 Ga0495602_0001468 3300048088 Bacteria 23411
1307 Ga0495602_0018692 3300048088 Bacteria 6908
1308 Ga0495602_0103437 3300048088 Bacteria 2331
1309 Ga0495602_0271048 3300048088 Bacteria 1255
1310 Ga0495602_0657412 3300048088 Bacteria 715
1311 Ga0495626_0116807 3300048091 Bacteria 1151
1312 Ga0496100_0000004 3300048903 Bacteria 321778
1313 Ga0496100_0000056 3300048903 Bacteria 67554
1314 Ga0496100_0005784 3300048903 Bacteria 6688
1315 Ga0496100_0033831 3300048903 Bacteria 3201
1316 Ga0496100_0733267 3300048903 Bacteria 772
1317 Ga0496100_0771249 3300048903 Bacteria 753
1318 Ga0496101_0000005 3300048904 Bacteria 331455
1319 Ga0496101_0000007 3300048904 Bacteria 321778
1320 Ga0496101_0002691 3300048904 Bacteria 10902
1321 Ga0496101_0002990 3300048904 Bacteria 10411
1322 Ga0496101_0004434 3300048904 Bacteria 8836
1323 Ga0496101_0144656 3300048904 Bacteria 1815
1324 Ga0496101_0548829 3300048904 Bacteria 914
1325 Ga0496101_0567771 3300048904 Bacteria 897
1326 Ga0496101_0650387 3300048904 Bacteria 833
1327 Ga0496102_0000021 3300048905 Bacteria 246920
1328 Ga0496102_0023697 3300048905 Bacteria 5454
1329 Ga0496102_0025474 3300048905 Bacteria 5266
1330 Ga0496102_0034667 3300048905 Bacteria 4540
1331 Ga0496102_0035755 3300048905 Bacteria 4473
1332 Ga0496102_0053517 3300048905 Bacteria 3679
1333 Ga0496102_0059461 3300048905 Bacteria 3495
1334 Ga0496102_0201315 3300048905 Bacteria 1877
1335 Ga0496102_0217864 3300048905 Bacteria 1799
1336 Ga0496102_0259072 3300048905 Bacteria 1640
1337 Ga0496102_0441570 3300048905 Bacteria 1221
1338 Ga0496102_0462427 3300048905 Bacteria 1190
1339 Ga0496102_0545543 3300048905 Bacteria 1082
1340 Ga0496102_0581379 3300048905 Bacteria 1043
1341 Ga0496102_0666006 3300048905 Bacteria 964
1342 Ga0496103_0000001 3300048906 Bacteria 643471
1343 Ga0496103_0013036 3300048906 Bacteria 4929
1344 Ga0496103_0122963 3300048906 Bacteria 1654
1345 Ga0496103_0222089 3300048906 Bacteria 1215
1346 Ga0496103_0264922 3300048906 Bacteria 1106
1347 Ga0496103_0392541 3300048906 Bacteria 891
1348 Ga0496104_0000007 3300048907 Bacteria 524804
1349 Ga0496104_0000008 3300048907 Bacteria 516976
1350 Ga0496104_0000307 3300048907 Bacteria 43626
1351 Ga0496104_0030956 3300048907 Bacteria 4974
1352 Ga0496104_0067190 3300048907 Bacteria 3405
1353 Ga0496104_0176982 3300048907 Bacteria 2043
1354 Ga0496104_0477701 3300048907 Bacteria 1158
1355 Ga0496105_0000002 3300048908 Bacteria 753215
1356 Ga0496105_0000003 3300048908 Bacteria 713251
1357 Ga0496105_0000070 3300048908 Bacteria 80117
1358 Ga0496105_0038744 3300048908 Bacteria 3927
1359 Ga0496105_0048146 3300048908 Bacteria 3518
1360 Ga0496105_0204644 3300048908 Bacteria 1610
1361 Ga0496105_0593772 3300048908 Bacteria 860
1362 Ga0496105_1197804 3300048908 Bacteria 559
1363 Ga0496106_0000004 3300048909 Bacteria 279896
1364 Ga0496106_0000099 3300048909 Bacteria 65733
1365 Ga0496106_0000446 3300048909 Bacteria 29509
1366 Ga0496106_0011248 3300048909 Bacteria 6622
1367 Ga0496106_0061201 3300048909 Bacteria 2855
1368 Ga0496106_0100122 3300048909 Bacteria 2247
1369 Ga0496106_0143507 3300048909 Bacteria 1879
1370 Ga0496106_0379963 3300048909 Bacteria 1135
1371 Ga0496106_0605167 3300048909 Bacteria 878
1372 Ga0496107_0000001 3300048910 Bacteria 321778
1373 Ga0496107_0000004 3300048910 Bacteria 297680
1374 Ga0496107_0008595 3300048910 Bacteria 7069
1375 Ga0496107_0029766 3300048910 Bacteria 3888
1376 Ga0496107_0076994 3300048910 Bacteria 2429
1377 Ga0496107_0167809 3300048910 Bacteria 1628
1378 Ga0496107_0214825 3300048910 Bacteria 1430
1379 Ga0496107_0423424 3300048910 Bacteria 990
1380 Ga0496107_0569402 3300048910 Bacteria 838
1381 Ga0496107_1040197 3300048910 Bacteria 593
1382 Ga0496108_0000004 3300048911 Bacteria 545055
1383 Ga0496108_0001764 3300048911 Bacteria 17210
1384 Ga0496108_0007661 3300048911 Bacteria 8741
1385 Ga0496108_0022549 3300048911 Bacteria 5177
1386 Ga0496108_0068405 3300048911 Bacteria 2996
1387 Ga0496108_0072629 3300048911 Bacteria 2904
1388 Ga0496108_0078136 3300048911 Bacteria 2801
1389 Ga0496108_0397186 3300048911 Bacteria 1204
1390 Ga0496108_0460348 3300048911 Bacteria 1111
1391 Ga0496108_0492087 3300048911 Bacteria 1071
1392 Ga0496108_0612431 3300048911 Bacteria 948
1393 Ga0496108_0638648 3300048911 Bacteria 926
1394 Ga0496109_0000036 3300048912 Bacteria 153972
1395 Ga0496109_0000062 3300048912 Bacteria 112843
1396 Ga0496109_0000081 3300048912 Bacteria 99723
1397 Ga0496109_0001426 3300048912 Bacteria 19841
1398 Ga0496109_0007548 3300048912 Bacteria 9219
1399 Ga0496109_0029920 3300048912 Bacteria 4880
1400 Ga0496109_0042469 3300048912 Bacteria 4118
1401 Ga0496109_0042974 3300048912 Bacteria 4096
1402 Ga0496109_0048970 3300048912 Bacteria 3846
1403 Ga0496109_0088745 3300048912 Bacteria 2858
1404 Ga0496109_0141955 3300048912 Bacteria 2246
1405 Ga0496109_0144134 3300048912 Bacteria 2228
1406 Ga0496109_0379874 3300048912 Bacteria 1334
1407 Ga0496109_0686349 3300048912 Bacteria 961
1408 Ga0496109_0693729 3300048912 Bacteria 955
1409 Ga0496109_0752392 3300048912 Bacteria 912
1410 Ga0496110_0005253 3300048913 Bacteria 10134
1411 Ga0496110_0025910 3300048913 Bacteria 5015
1412 Ga0496110_0027349 3300048913 Bacteria 4889
1413 Ga0496110_0030606 3300048913 Bacteria 4640
1414 Ga0496110_0051197 3300048913 Bacteria 3629
1415 Ga0496110_0056256 3300048913 Bacteria 3461
1416 Ga0496110_0065198 3300048913 Bacteria 3220
1417 Ga0496110_0078356 3300048913 Bacteria 2942
1418 Ga0496110_0082247 3300048913 Bacteria 2872
1419 Ga0496110_0225864 3300048913 Bacteria 1702
1420 Ga0496110_0331477 3300048913 Bacteria 1386
1421 Ga0496110_0335009 3300048913 Bacteria 1378
1422 Ga0496110_0696896 3300048913 Bacteria 917
1423 Ga0496110_0765691 3300048913 Bacteria 869
1424 Ga0496111_0000013 3300048914 Bacteria 82182
1425 Ga0496111_0007431 3300048914 Bacteria 7180
1426 Ga0496111_0010466 3300048914 Bacteria 6226
1427 Ga0496111_0011719 3300048914 Bacteria 5919
1428 Ga0496111_0056259 3300048914 Bacteria 2845
1429 Ga0496111_0056339 3300048914 Bacteria 2844
1430 Ga0496111_0105485 3300048914 Bacteria 2074
1431 Ga0496111_0371183 3300048914 Bacteria 1058
1432 Ga0496111_0621043 3300048914 Bacteria 790
1433 Ga0496112_0000002 3300048915 Bacteria 782039
1434 Ga0496112_0008410 3300048915 Bacteria 9242
1435 Ga0496112_0022659 3300048915 Bacteria 5989
1436 Ga0496112_0052822 3300048915 Bacteria 3989
1437 Ga0496112_0129411 3300048915 Bacteria 2495
1438 Ga0496112_0146080 3300048915 Bacteria 2333
1439 Ga0496112_0157546 3300048915 Bacteria 2237
1440 Ga0496112_0411782 3300048915 Bacteria 1291
1441 Ga0496112_0458832 3300048915 Bacteria 1212
1442 Ga0496112_1039697 3300048915 Bacteria 738
1443 Ga0496113_0005015 3300048916 Bacteria 8209
1444 Ga0496113_0011837 3300048916 Bacteria 5844
1445 Ga0496113_0017170 3300048916 Bacteria 5018
1446 Ga0496113_0046403 3300048916 Bacteria 3225
1447 Ga0496113_0046981 3300048916 Bacteria 3207
1448 Ga0496113_0173068 3300048916 Bacteria 1710
1449 Ga0496113_0259437 3300048916 Bacteria 1388
1450 Ga0496113_0559875 3300048916 Bacteria 917
1451 Ga0496113_0608197 3300048916 Bacteria 875
1452 Ga0496113_0928980 3300048916 Bacteria 687
1453 Ga0496114_0000097 3300048917 Bacteria 63410
1454 Ga0496114_0016423 3300048917 Bacteria 5965
1455 Ga0496114_0056702 3300048917 Bacteria 3270
1456 Ga0496114_0465265 3300048917 Bacteria 1119
1457 Ga0496114_1575319 3300048917 Bacteria 545
1458 Ga0496115_0000005 3300048918 Bacteria 290756
1459 Ga0496115_0000151 3300048918 Bacteria 64493
1460 Ga0496115_0028068 3300048918 Bacteria 4408
1461 Ga0496115_0041838 3300048918 Bacteria 3648
1462 Ga0496115_0384718 3300048918 Bacteria 1140
1463 Ga0496115_0802195 3300048918 Bacteria 733
1464 Ga0496119_0002837 3300048922 Bacteria 18521
1465 Ga0496119_0145181 3300048922 Bacteria 1277
1466 Ga0496120_0309135 3300048923 Bacteria 721
1467 Ga0496121_0001679 3300048924 Bacteria 36402
1468 Ga0496121_0131489 3300048924 Bacteria 1872
1469 Ga0496121_0222872 3300048924 Bacteria 1327
1470 Ga0496124_0030161 3300048927 Bacteria 4818
1471 Ga0496124_0114998 3300048927 Bacteria 2160
1472 Ga0496125_0107993 3300048928 Bacteria 2026
1473 Ga0501306_036201 3300049127 Bacteria 751
1474 Ga0501305_021748 3300049161 Bacteria 950
1475 Ga0501316_027908 3300049532 Bacteria 744
1476 Ga0501323_027561 3300049539 Bacteria 783
1477 Ga0501333_013089 3300049549 Bacteria 612
1478 Ga0501031_0015090 3300049568 Bacteria 5018
1479 Ga0501031_0352908 3300049568 Bacteria 952
1480 Ga0501032_0008313 3300049569 Bacteria 7561
1481 Ga0501033_0020432 3300049570 Bacteria 5002
1482 Ga0501034_0197643 3300049571 Bacteria 1970
1483 Ga0501034_0313295 3300049571 Bacteria 1503
1484 Ga0501036_0014315 3300049572 Bacteria 6602
1485 Ga0501036_0327194 3300049572 Bacteria 1280
1486 Ga0501036_1237899 3300049572 Bacteria 608
1487 Ga0501037_0026869 3300049573 Bacteria 4251
1488 Ga0501038_0003011 3300049574 Bacteria 15713
1489 Ga0501038_0388258 3300049574 Bacteria 1082
1490 Ga0501038_1138217 3300049574 Bacteria 569
1491 Ga0501039_0026339 3300049575 Bacteria 4468
1492 Ga0501039_0032104 3300049575 Bacteria 4048
1493 Ga0501039_0190871 3300049575 Bacteria 1611
1494 Ga0501039_0380475 3300049575 Bacteria 1109
1495 Ga0501039_0415179 3300049575 Bacteria 1057
1496 Ga0501039_0593008 3300049575 Bacteria 869
1497 Ga0501039_0792081 3300049575 Bacteria 740
1498 Ga0501040_0117916 3300049576 Bacteria 1861
1499 Ga0501040_0560640 3300049576 Bacteria 825
1500 Ga0501040_0942949 3300049576 Bacteria 625
1501 Ga0501041_0658041 3300049577 Bacteria 670
1502 Ga0501041_0692429 3300049577 Bacteria 652
1503 Ga0501042_0132505 3300049578 Bacteria 1797
1504 Ga0501043_0011801 3300049579 Bacteria 6842
1505 Ga0501046_0076175 3300049580 Bacteria 2599
1506 Ga0501046_0674221 3300049580 Bacteria 730
1507 Ga0501046_1011150 3300049580 Bacteria 577
1508 Ga0501047_0338849 3300049581 Bacteria 1341
1509 Ga0501048_0008605 3300049582 Bacteria 7706
1510 Ga0501048_0239366 3300049582 Bacteria 1288
1511 Ga0501048_0263663 3300049582 Bacteria 1224
1512 Ga0501067_0051717 3300049583 Bacteria 2276
1513 Ga0501067_0250955 3300049583 Bacteria 985
1514 Ga0501067_0287982 3300049583 Bacteria 915
1515 Ga0501068_0053877 3300049584 Bacteria 2436
1516 Ga0501069_0111577 3300049585 Bacteria 1557
1517 Ga0501069_0718240 3300049585 Bacteria 603
1518 Ga0501069_0857433 3300049585 Bacteria 552
1519 Ga0501070_0067934 3300049586 Bacteria 2951
1520 Ga0501070_0262016 3300049586 Bacteria 1413
1521 Ga0501070_1135276 3300049586 Bacteria 602
1522 Ga0501071_0080921 3300049587 Bacteria 2376
1523 Ga0501071_0149899 3300049587 Bacteria 1739
1524 Ga0501071_0471460 3300049587 Bacteria 962
1525 Ga0501071_0631589 3300049587 Bacteria 824
1526 Ga0501071_0830234 3300049587 Bacteria 713
1527 Ga0501071_1097281 3300049587 Bacteria 615
1528 Ga0501071_1101627 3300049587 Bacteria 613
1529 Ga0501071_1218399 3300049587 Bacteria 581
1530 Ga0501072_0030488 3300049588 Bacteria 4219
1531 Ga0501072_0121295 3300049588 Bacteria 2083
1532 Ga0501072_0121706 3300049588 Bacteria 2079
1533 Ga0501072_1239257 3300049588 Bacteria 579
1534 Ga0501073_0003341 3300049589 Bacteria 12058
1535 Ga0501074_0021626 3300049590 Bacteria 4670
1536 Ga0501074_0889087 3300049590 Bacteria 627
1537 Ga0501074_1032652 3300049590 Bacteria 578
1538 Ga0501075_0002918 3300049591 Bacteria 11473
1539 Ga0501075_0135998 3300049591 Bacteria 1873
1540 Ga0501075_0222026 3300049591 Bacteria 1441
1541 Ga0501075_0310350 3300049591 Bacteria 1202
1542 Ga0501075_0346006 3300049591 Bacteria 1133
1543 Ga0501075_0947584 3300049591 Bacteria 654
1544 Ga0501076_0211765 3300049592 Bacteria 1584
1545 Ga0501076_0221083 3300049592 Bacteria 1548
1546 Ga0501076_0652572 3300049592 Bacteria 868
1547 Ga0501076_1608049 3300049592 Bacteria 533
1548 Ga0501077_0038314 3300049593 Bacteria 3052
1549 Ga0501202_048696 3300049652 Bacteria 934
1550 Ga0501202_214078 3300049652 Bacteria 531
1551 Ga0501079_0140478 3300049741 Bacteria 1881
1552 Ga0501080_0009784 3300049742 Bacteria 8760
1553 Ga0501080_0740409 3300049742 Bacteria 865
1554 Ga0501080_0769568 3300049742 Bacteria 846
1555 Ga0501081_0067501 3300049743 Bacteria 2489
1556 Ga0501081_0316803 3300049743 Bacteria 1146
1557 Ga0501081_0704336 3300049743 Bacteria 758
1558 Ga0501083_0035442 3300049744 Bacteria 3408
1559 Ga0501271_023026 3300049768 Bacteria 732
1560 Ga0501279_066755 3300049775 Bacteria 599
1561 Ga0501035_0028326 3300049822 Bacteria 5114
1562 Ga0501044_0197385 3300049823 Bacteria 1971
1563 Ga0501045_0177439 3300049824 Bacteria 1587
1564 Ga0501045_0229471 3300049824 Bacteria 1382
1565 Ga0501045_0351247 3300049824 Bacteria 1098
1566 Ga0501045_0377504 3300049824 Bacteria 1055
1567 Ga0501045_0387686 3300049824 Bacteria 1040
1568 Ga0501045_0725964 3300049824 Bacteria 733
1569 Ga0501212_048057 3300049851 Bacteria 718
1570 nmdc:mga03n38_311334_c1 3300050490 Bacteria 848
1571 nmdc:mga03n38_393255_c1 3300050490 Bacteria 762
1572 nmdc:mga03n38_799324_c1 3300050490 Bacteria 549
1573 nmdc:mga00v17_28304_c1 3300050491 Bacteria 3281
1574 nmdc:mga00v17_40086_c1 3300050491 Bacteria 2808
1575 nmdc:mga00v17_522877_c1 3300050491 Bacteria 768
1576 nmdc:mga00v17_58083_c1 3300050491 Bacteria 2369
1577 nmdc:mga0yw44_108467_c1 3300050492 Bacteria 1777
1578 nmdc:mga0yw44_30865_c1 3300050492 Bacteria 3111
1579 nmdc:mga0yw44_31154_c1 3300050492 Bacteria 3098
1580 nmdc:mga0yw44_437561_c1 3300050492 Bacteria 886
1581 nmdc:mga0yw44_56646_c1 3300050492 Bacteria 2389
1582 nmdc:mga0yw44_646909_c1 3300050492 Bacteria 718
1583 nmdc:mga0yw44_80994_c1 3300050492 Bacteria 2035
1584 nmdc:mga06z11_225441_c1 3300050494 Bacteria 1096
1585 nmdc:mga06z11_549858_c1 3300050494 Bacteria 701
1586 nmdc:mga05p37_1046103_c1 3300050507 Bacteria 862
1587 nmdc:mga05p37_1335450_c1 3300050507 Bacteria 728
1588 nmdc:mga05p37_1492816_c1 3300050507 Bacteria 673
1589 nmdc:mga05p37_171058_c1 3300050507 Bacteria 2649
1590 nmdc:mga05p37_2126_c1 3300050507 Bacteria 23135
1591 nmdc:mga05p37_215402_c1 3300050507 Bacteria 2320
1592 nmdc:mga05p37_229127_c1 3300050507 Bacteria 2239
1593 nmdc:mga05p37_329197_c1 3300050507 Bacteria 1805
1594 nmdc:mga05p37_494716_c1 3300050507 Bacteria 1405
1595 nmdc:mga05p37_803997_c1 3300050507 Bacteria 1028
1596 nmdc:mga05p37_871112_c1 3300050507 Bacteria 975
1597 nmdc:mga05p37_916102_c1 3300050507 Bacteria 943
1598 nmdc:mga09592_1040550_c1 3300050508 Bacteria 683
1599 nmdc:mga09592_471723_c1 3300050508 Bacteria 1082
1600 nmdc:mga09592_659424_c1 3300050508 Bacteria 893
1601 nmdc:mga09592_702059_c1 3300050508 Bacteria 861
1602 nmdc:mga09592_77107_c1 3300050508 Bacteria 2835
1603 nmdc:mga09592_8963_c1 3300050508 Bacteria 8135
1604 nmdc:mga0qj67_283899_c1 3300050509 Bacteria 1342
1605 nmdc:mga0qj67_330662_c1 3300050509 Bacteria 1233
1606 nmdc:mga0qj67_332900_c1 3300050509 Bacteria 1228
1607 nmdc:mga0qj67_37616_c1 3300050509 Bacteria 3792
1608 nmdc:mga0qj67_377647_c1 3300050509 Bacteria 1145
1609 nmdc:mga0qj67_3939_c1 3300050509 Bacteria 10742
1610 nmdc:mga0qj67_8178_c1 3300050509 Bacteria 7751
1611 nmdc:mga06r32_1334885_c1 3300050510 Bacteria 660
1612 nmdc:mga06r32_13566_c1 3300050510 Bacteria 7386
1613 nmdc:mga06r32_15290_c1 3300050510 Bacteria 6972
1614 nmdc:mga06r32_182954_c1 3300050510 Bacteria 2082
1615 nmdc:mga06r32_368405_c1 3300050510 Bacteria 1420
1616 nmdc:mga06r32_577887_c1 3300050510 Bacteria 1096
1617 nmdc:mga06r32_581976_c1 3300050510 Bacteria 1091
1618 nmdc:mga06r32_61326_c1 3300050510 Bacteria 3620
1619 nmdc:mga06r32_787322_c1 3300050510 Bacteria 912
1620 nmdc:mga06r32_8713_c1 3300050510 Bacteria 9142
1621 nmdc:mga08y16_139552_c1 3300050511 Bacteria 2520
1622 nmdc:mga08y16_276242_c1 3300050511 Bacteria 1734
1623 nmdc:mga08y16_3104_c1 3300050511 Bacteria 17193
1624 nmdc:mga08y16_478802_c1 3300050511 Bacteria 1267
1625 nmdc:mga08y16_713413_c1 3300050511 Bacteria 1002
1626 nmdc:mga08y16_77993_c1 3300050511 Bacteria 3454
1627 nmdc:mga08y16_93351_c1 3300050511 Bacteria 3135
1628 nmdc:mga0n895_1276281_c1 3300050512 Bacteria 706
1629 nmdc:mga0n895_17820_c1 3300050512 Bacteria 6557
1630 nmdc:mga0n895_204100_c1 3300050512 Bacteria 2007
1631 nmdc:mga0n895_238971_c1 3300050512 Bacteria 1843
1632 nmdc:mga0n895_276873_c1 3300050512 Bacteria 1702
1633 nmdc:mga0n895_623428_c1 3300050512 Bacteria 1079
1634 nmdc:mga0n895_81940_c1 3300050512 Bacteria 3216
1635 nmdc:mga0n895_888939_c1 3300050512 Bacteria 877
1636 nmdc:mga0rr50_21531_c1 3300050513 Bacteria 4403
1637 nmdc:mga0rr50_323320_c1 3300050513 Bacteria 1293
1638 nmdc:mga0rr50_690140_c1 3300050513 Bacteria 871
1639 nmdc:mga0rr50_920489_c1 3300050513 Bacteria 745
1640 nmdc:mga0rr50_990203_c1 3300050513 Bacteria 716
1641 nmdc:mga08x19_1014915_c1 3300050514 Bacteria 589
1642 nmdc:mga08x19_1154767_c1 3300050514 Bacteria 549
1643 nmdc:mga0a205_1148527_c1 3300050515 Bacteria 624
1644 nmdc:mga0a205_15_c2 3300050515 Bacteria 75060
1645 nmdc:mga0a205_1820_c1 3300050515 Bacteria 18449
1646 nmdc:mga0a205_193239_c1 3300050515 Bacteria 1927
1647 nmdc:mga0a205_321736_c1 3300050515 Bacteria 1418
1648 nmdc:mga0a205_476559_c1 3300050515 Bacteria 1106
1649 nmdc:mga0a205_6623_c1 3300050515 Bacteria 10483
1650 Ga0495601_0000065 3300053077 Bacteria 58386
1651 Ga0495601_0002370 3300053077 Bacteria 10674
1652 Ga0495601_0061779 3300053077 Bacteria 2378
1653 Ga0495601_0528473 3300053077 Bacteria 760
1654 Ga0495601_0699421 3300053077 Bacteria 647
1655 Ga0495612_0000088 3300053078 Bacteria 40813
1656 Ga0495612_0001833 3300053078 Bacteria 8714
1657 Ga0495612_0006647 3300053078 Bacteria 4743
1658 Ga0495612_0017434 3300053078 Bacteria 2876
1659 Ga0495612_0019021 3300053078 Bacteria 2749
1660 Ga0495612_0309315 3300053078 Bacteria 709
1661 Ga0495655_0000013 3300053083 Bacteria 63264
1662 Ga0495655_0010522 3300053083 Bacteria 1829
1663 Ga0495595_0000005 3300053084 Bacteria 258660
1664 Ga0495595_0000732 3300053084 Bacteria 12443
1665 Ga0495595_0001765 3300053084 Bacteria 8447
1666 Ga0495595_0155550 3300053084 Bacteria 1126
1667 Ga0495595_0237743 3300053084 Bacteria 911
1668 Ga0495619_0000036 3300053085 Bacteria 125188
1669 Ga0495619_0000359 3300053085 Bacteria 31705
1670 Ga0495619_0002279 3300053085 Bacteria 12653
1671 Ga0495619_0002287 3300053085 Bacteria 12633
1672 Ga0495619_0004256 3300053085 Bacteria 9118
1673 Ga0495619_0007685 3300053085 Bacteria 6825
1674 Ga0495619_0007898 3300053085 Bacteria 6732
1675 Ga0495619_0022738 3300053085 Bacteria 4014
1676 Ga0500566_0003122 3300053094 Bacteria 9907
1677 Ga0500641_0005129 3300053096 Bacteria 4640
1678 Ga0500641_0186833 3300053096 Bacteria 888
1679 Ga0500556_0000495 3300053104 Bacteria 27312
1680 Ga0500614_001071 3300053123 Bacteria 6788
1681 Ga0500628_000014 3300053129 Bacteria 102838
1682 Ga0500616_0004626 3300053153 Bacteria 9713
1683 Ga0500616_0005178 3300053153 Bacteria 8947
1684 Ga0500599_002071 3300053736 Bacteria 2382
1685 Ga0501084_0101235 3300054114 Bacteria 2419
1686 Ga0501084_0306677 3300054114 Bacteria 1341
1687 Ga0501084_0653194 3300054114 Bacteria 888
1688 Ga0501084_0982703 3300054114 Bacteria 709
1689 Ga0501084_1127408 3300054114 Bacteria 658
1690 Ga0587084_008888 3300059477 Bacteria 1284
1691 Ga0587066_068668 3300059490 Bacteria 741
1692 Ga0587066_094613 3300059490 Bacteria 669
1693 Ga0587070_042821 3300059491 Bacteria 874
1694 Ga0587073_0115117 3300059492 Bacteria 718
1695 Ga0587073_0135538 3300059492 Bacteria 681
1696 Ga0587073_0162632 3300059492 Bacteria 641
1697 Ga0587077_099734 3300059493 Bacteria 696
1698 Ga0587080_044053 3300059503 Bacteria 822
1699 Ga0587082_028119 3300059504 Bacteria 963
1700 Ga0587082_061429 3300059504 Bacteria 742
1701 Ga0587082_062097 3300059504 Bacteria 739
1702 Ga0587083_0060264 3300059505 Bacteria 854
1703 Ga0587083_0102616 3300059505 Bacteria 715
1704 Ga0587083_0121303 3300059505 Bacteria 676
1705 Ga0587083_0150610 3300059505 Bacteria 628
1706 Ga0587086_033993 3300059507 Bacteria 763
1707 Ga0587088_112093 3300059508 Bacteria 621
1708 Ga0587090_045691 3300059510 Bacteria 786
1709 Ga0587090_080143 3300059510 Bacteria 653
1710 Ga0587091_032095 3300059511 Bacteria 991
1711 Ga0587092_071989 3300059512 Bacteria 667
1712 Ga0587106_029297 3300059605 Bacteria 873
1713 Ga0587125_018546 3300059607 Bacteria 801
1714 Ga0587109_011473 3300059624 Bacteria 1433
1715 Ga0587113_029010 3300059625 Bacteria 619
1716 Ga0587115_044020 3300059626 Bacteria 706
1717 Ga0587117_032539 3300059627 Bacteria 794
1718 Ga0587122_020071 3300059628 Bacteria 720
1719 Ga0587122_026866 3300059628 Bacteria 657
1720 Ga0587128_055827 3300059630 Bacteria 733
1721 Ga0587128_071473 3300059630 Bacteria 676
1722 Ga0587067_076511 3300059640 Bacteria 733
1723 Ga0587067_079836 3300059640 Bacteria 722
1724 Ga0587068_058914 3300059641 Bacteria 735
1725 Ga0587069_062298 3300059642 Bacteria 690
1726 Ga0587069_067361 3300059642 Bacteria 673
1727 Ga0587069_081142 3300059642 Bacteria 633
1728 Ga0587076_023745 3300059645 Bacteria 1035
1729 Ga0587076_088975 3300059645 Bacteria 672
1730 Ga0587079_042245 3300059647 Bacteria 926
1731 Ga0587079_111056 3300059647 Bacteria 666
1732 Ga0587107_063546 3300059652 Bacteria 657
1733 Ga0587114_069078 3300059655 Bacteria 636
1734 Ga0587071_066629 3300060344 Bacteria 776
1735 Ga0587071_106116 3300060344 Bacteria 655
1736 Ga0587071_117575 3300060344 Bacteria 632
1737 Ga0587071_159842 3300060344 Bacteria 566
1738 Ga0501082_0080177 3300060353 Bacteria 2816
1739 Ga0501082_0217878 3300060353 Bacteria 1661
1740 Ga0501082_0596446 3300060353 Bacteria 967
1741 Ga0501082_0852658 3300060353 Bacteria 797
1742 Ga0466962_0009433 3300061719 Bacteria 4678
1743 Ga0466962_0106538 3300061719 Bacteria 1348
1744 Ga0466962_0160722 3300061719 Bacteria 1092
1745 Ga0466962_0262425 3300061719 Bacteria 850
1746 Ga0530510_0009610 3300061734 Bacteria 6782
1747 Ga0530510_0039682 3300061734 Bacteria 3399
1748 Ga0530510_0216180 3300061734 Bacteria 1424

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041511 Ga0451855_0398413 Ga0451855_0398413_22_444 140
2 3300049652 Ga0501202_214078 Ga0501202_214078_56_478 140
3 3300035398 Ga0316574_0852079 Ga0316574_0852079_100_540 146
4 3300036647 Ga0316582_0123886 Ga0316582_0123886_14_454 146
5 3300037466 Ga0395898_0775278 Ga0395898_0775278_10_450 146
6 3300037471 Ga0395905_0641276 Ga0395905_0641276_509_949 146
7 3300041496 Ga0451839_1532378 Ga0451839_1532378_56_496 146
8 3300046514 Ga0495618_0764689 Ga0495618_0764689_102_542 146
9 3300046533 Ga0495640_0594359 Ga0495640_0594359_19_462 146
10 3300046679 Ga0495623_0470292 Ga0495623_0470292_189_632 146
11 3300047321 Ga0495676_0818928 Ga0495676_0818928_13_456 146
12 3300047469 Ga0495673_0175915 Ga0495673_0175915_345_788 146
13 3300048916 Ga0496113_0608197 Ga0496113_0608197_24_467 146
14 3300049577 Ga0501041_0658041 Ga0501041_0658041_219_659 146
15 3300049577 Ga0501041_0692429 Ga0501041_0692429_185_625 146
16 3300049585 Ga0501069_0718240 Ga0501069_0718240_147_590 146
17 3300049592 Ga0501076_1608049 Ga0501076_1608049_11_451 146
18 3300053077 Ga0495601_0002370 Ga0495601_0002370_27_470 146
19 3300060353 Ga0501082_0852658 Ga0501082_0852658_18_458 146
20 3300046694 Ga0495649_0323123 Ga0495649_0323123_16_462 148
21 3300039438 Ga0436360_0664694 Ga0436360_0664694_117_566 149
22 3300039450 Ga0436363_0240367 Ga0436363_0240367_196_645 149
23 3300039450 Ga0436363_1254867 Ga0436363_1254867_186_635 149
24 3300044765 Ga0466970_0913536 Ga0466970_0913536_10_459 149
25 3300047321 Ga0495676_0842177 Ga0495676_0842177_57_506 149
26 3300050490 nmdc:mga03n38_799324_c1 nmdc:mga03n38_799324_c1_88_537 149
27 3300050515 nmdc:mga0a205_1148527_c1 nmdc:mga0a205_1148527_c1_160_609 149
28 3300050494 nmdc:mga06z11_225441_c1 nmdc:mga06z11_225441_c1_39_512 157
29 3300050514 nmdc:mga08x19_1154767_c1 nmdc:mga08x19_1154767_c1_66_539 157
30 3300044765 Ga0466970_0426915 Ga0466970_0426915_125_604 159
31 3300049585 Ga0501069_0857433 Ga0501069_0857433_29_538 159
32 3300002074 JGI24748J21848_1000565 JGI24748J21848_10005655 168
33 3300002239 JGI24034J26672_10000096 JGI24034J26672_100000965 168
34 3300002244 JGI24742J22300_10003253 JGI24742J22300_100032535 168
35 3300005983 Ga0081540_1000281 Ga0081540_100028127 168
36 3300025916 Ga0207663_10180455 Ga0207663_101804552 168
37 3300028563 Ga0265319_1000030 Ga0265319_100003018 168
38 3300028800 Ga0265338_10000156 Ga0265338_1000015618 168
39 3300031456 Ga0307513_10334284 Ga0307513_103342842 168
40 3300038443 Ga0395901_1320517 Ga0395901_1320517_134_640 168
41 3300049591 Ga0501075_0947584 Ga0501075_0947584_11_520 168
42 3300049593 Ga0501077_0038314 Ga0501077_0038314_2061_2576 171
43 3300000546 LJNas_1002723 LJNas_10027233 173
44 3300001979 JGI24740J21852_10006093 JGI24740J21852_100060937 173
45 3300002067 JGI24735J21928_10125772 JGI24735J21928_101257721 173
46 3300002067 JGI24735J21928_10147564 JGI24735J21928_101475642 173
47 3300002077 JGI24744J21845_10018127 JGI24744J21845_100181273 173
48 3300002244 JGI24742J22300_10070225 JGI24742J22300_100702251 173
49 3300002459 JGI24751J29686_10019622 JGI24751J29686_100196223 173
50 3300003373 JGI25407J50210_10000745 JGI25407J50210_100007458 173
51 3300003373 JGI25407J50210_10001748 JGI25407J50210_100017487 173
52 3300003373 JGI25407J50210_10018542 JGI25407J50210_100185422 173
53 3300003544 Ga0007417J51691_1029640 Ga0007417J51691_10296402 173
54 3300003568 Ga0006781J51513_1014848 Ga0006781J51513_10148481 173
55 3300003574 Ga0007410J51695_1015549 Ga0007410J51695_10155491 173
56 3300003577 Ga0007416J51690_1020459 Ga0007416J51690_10204591 173
57 3300003579 Ga0007429J51699_1014367 Ga0007429J51699_10143671 173
58 3300003659 JGI25404J52841_10008305 JGI25404J52841_100083053 173
59 3300003693 Ga0032354_1010026 Ga0032354_10100261 173
60 3300003693 Ga0032354_1025023 Ga0032354_10250231 173
61 3300003911 JGI25405J52794_10070454 JGI25405J52794_100704541 173
62 3300004799 Ga0058863_11930334 Ga0058863_119303342 173
63 3300005327 Ga0070658_10505183 Ga0070658_105051832 173
64 3300005327 Ga0070658_10998766 Ga0070658_109987662 173
65 3300005328 Ga0070676_10282090 Ga0070676_102820901 173
66 3300005329 Ga0070683_100003058 Ga0070683_10000305815 173
67 3300005329 Ga0070683_100003409 Ga0070683_1000034099 173
68 3300005329 Ga0070683_100012464 Ga0070683_1000124646 173
69 3300005329 Ga0070683_100048380 Ga0070683_1000483802 173
70 3300005329 Ga0070683_100091959 Ga0070683_1000919594 173
71 3300005329 Ga0070683_100449358 Ga0070683_1004493582 173
72 3300005331 Ga0070670_100335464 Ga0070670_1003354641 173
73 3300005331 Ga0070670_100753467 Ga0070670_1007534671 173
74 3300005333 Ga0070677_10000017 Ga0070677_1000001727 173
75 3300005333 Ga0070677_10541034 Ga0070677_105410341 173
76 3300005334 Ga0068869_100233810 Ga0068869_1002338102 173
77 3300005334 Ga0068869_100778215 Ga0068869_1007782151 173
78 3300005335 Ga0070666_10007999 Ga0070666_100079997 173
79 3300005336 Ga0070680_100002006 Ga0070680_10000200612 173
80 3300005336 Ga0070680_100302481 Ga0070680_1003024813 173
81 3300005337 Ga0070682_100000797 Ga0070682_10000079719 173
82 3300005337 Ga0070682_100001233 Ga0070682_1000012337 173
83 3300005337 Ga0070682_100105731 Ga0070682_1001057313 173
84 3300005337 Ga0070682_100174161 Ga0070682_1001741611 173
85 3300005338 Ga0068868_100001548 Ga0068868_10000154810 173
86 3300005338 Ga0068868_100004107 Ga0068868_1000041075 173
87 3300005338 Ga0068868_100044017 Ga0068868_1000440173 173
88 3300005339 Ga0070660_100043104 Ga0070660_1000431045 173
89 3300005339 Ga0070660_100147571 Ga0070660_1001475713 173
90 3300005339 Ga0070660_100654831 Ga0070660_1006548311 173
91 3300005340 Ga0070689_100125494 Ga0070689_1001254942 173
92 3300005341 Ga0070691_10001397 Ga0070691_100013976 173
93 3300005341 Ga0070691_10001422 Ga0070691_1000142216 173
94 3300005341 Ga0070691_10118071 Ga0070691_101180711 173
95 3300005341 Ga0070691_10206432 Ga0070691_102064322 173
96 3300005344 Ga0070661_100000523 Ga0070661_10000052335 173
97 3300005344 Ga0070661_100073348 Ga0070661_1000733482 173
98 3300005344 Ga0070661_100189663 Ga0070661_1001896634 173
99 3300005344 Ga0070661_100479924 Ga0070661_1004799242 173
100 3300005345 Ga0070692_10005150 Ga0070692_100051506 173
101 3300005345 Ga0070692_10211374 Ga0070692_102113741 173
102 3300005345 Ga0070692_10446862 Ga0070692_104468621 173
103 3300005347 Ga0070668_100019738 Ga0070668_1000197386 173
104 3300005347 Ga0070668_100050250 Ga0070668_1000502503 173
105 3300005347 Ga0070668_100313706 Ga0070668_1003137062 173
106 3300005347 Ga0070668_100330811 Ga0070668_1003308112 173
107 3300005347 Ga0070668_100445348 Ga0070668_1004453481 173
108 3300005347 Ga0070668_100738365 Ga0070668_1007383652 173
109 3300005353 Ga0070669_100006804 Ga0070669_1000068049 173
110 3300005353 Ga0070669_101072945 Ga0070669_1010729451 173
111 3300005354 Ga0070675_100000063 Ga0070675_1000000636 173
112 3300005354 Ga0070675_100234550 Ga0070675_1002345503 173
113 3300005354 Ga0070675_100775739 Ga0070675_1007757391 173
114 3300005355 Ga0070671_100671957 Ga0070671_1006719572 173
115 3300005356 Ga0070674_100000026 Ga0070674_1000000266 173
116 3300005356 Ga0070674_100000158 Ga0070674_1000001585 173
117 3300005356 Ga0070674_100032921 Ga0070674_1000329212 173
118 3300005356 Ga0070674_100054066 Ga0070674_1000540665 173
119 3300005356 Ga0070674_100150891 Ga0070674_1001508913 173
120 3300005356 Ga0070674_100216912 Ga0070674_1002169122 173
121 3300005356 Ga0070674_100261751 Ga0070674_1002617513 173
122 3300005356 Ga0070674_100507433 Ga0070674_1005074332 173
123 3300005364 Ga0070673_100064789 Ga0070673_1000647893 173
124 3300005364 Ga0070673_100095663 Ga0070673_1000956633 173
125 3300005364 Ga0070673_100331015 Ga0070673_1003310152 173
126 3300005365 Ga0070688_100000134 Ga0070688_10000013437 173
127 3300005365 Ga0070688_100001886 Ga0070688_1000018868 173
128 3300005365 Ga0070688_100226015 Ga0070688_1002260153 173
129 3300005366 Ga0070659_100000031 Ga0070659_1000000316 173
130 3300005366 Ga0070659_100014620 Ga0070659_1000146206 173
131 3300005366 Ga0070659_100073278 Ga0070659_1000732783 173
132 3300005366 Ga0070659_100220699 Ga0070659_1002206993 173
133 3300005366 Ga0070659_100695539 Ga0070659_1006955392 173
134 3300005367 Ga0070667_100020941 Ga0070667_1000209412 173
135 3300005367 Ga0070667_101115352 Ga0070667_1011153521 173
136 3300005435 Ga0070714_100005244 Ga0070714_1000052441 173
137 3300005435 Ga0070714_100069919 Ga0070714_1000699194 173
138 3300005435 Ga0070714_100070366 Ga0070714_1000703662 173
139 3300005435 Ga0070714_100238192 Ga0070714_1002381922 173
140 3300005435 Ga0070714_100564676 Ga0070714_1005646762 173
141 3300005435 Ga0070714_101693513 Ga0070714_1016935131 173
142 3300005436 Ga0070713_100028369 Ga0070713_1000283693 173
143 3300005436 Ga0070713_100219672 Ga0070713_1002196722 173
144 3300005436 Ga0070713_101195533 Ga0070713_1011955332 173
145 3300005437 Ga0070710_10000005 Ga0070710_1000000571 173
146 3300005437 Ga0070710_10010223 Ga0070710_100102237 173
147 3300005437 Ga0070710_10114911 Ga0070710_101149112 173
148 3300005437 Ga0070710_10310631 Ga0070710_103106312 173
149 3300005438 Ga0070701_10423138 Ga0070701_104231381 173
150 3300005438 Ga0070701_10459607 Ga0070701_104596071 173
151 3300005439 Ga0070711_100115639 Ga0070711_1001156393 173
152 3300005439 Ga0070711_100323696 Ga0070711_1003236961 173
153 3300005439 Ga0070711_100368347 Ga0070711_1003683472 173
154 3300005440 Ga0070705_100003005 Ga0070705_1000030059 173
155 3300005440 Ga0070705_100198060 Ga0070705_1001980603 173
156 3300005441 Ga0070700_100000892 Ga0070700_1000008926 173
157 3300005441 Ga0070700_100034267 Ga0070700_1000342675 173
158 3300005441 Ga0070700_100039719 Ga0070700_1000397195 173
159 3300005441 Ga0070700_100039802 Ga0070700_1000398023 173
160 3300005441 Ga0070700_100079898 Ga0070700_1000798984 173
161 3300005441 Ga0070700_100100131 Ga0070700_1001001313 173
162 3300005441 Ga0070700_100237347 Ga0070700_1002373472 173
163 3300005441 Ga0070700_100568161 Ga0070700_1005681611 173
164 3300005444 Ga0070694_100119274 Ga0070694_1001192744 173
165 3300005444 Ga0070694_100257326 Ga0070694_1002573263 173
166 3300005445 Ga0070708_100812610 Ga0070708_1008126102 173
167 3300005455 Ga0070663_100086943 Ga0070663_1000869433 173
168 3300005455 Ga0070663_100162656 Ga0070663_1001626561 173
169 3300005455 Ga0070663_100437465 Ga0070663_1004374652 173
170 3300005455 Ga0070663_100620227 Ga0070663_1006202272 173
171 3300005455 Ga0070663_101135200 Ga0070663_1011352001 173
172 3300005456 Ga0070678_100099394 Ga0070678_1000993942 173
173 3300005456 Ga0070678_100166568 Ga0070678_1001665682 173
174 3300005456 Ga0070678_100664647 Ga0070678_1006646472 173
175 3300005456 Ga0070678_100741558 Ga0070678_1007415582 173
176 3300005457 Ga0070662_100000007 Ga0070662_10000000710 173
177 3300005457 Ga0070662_100627364 Ga0070662_1006273642 173
178 3300005458 Ga0070681_10010572 Ga0070681_100105723 173
179 3300005458 Ga0070681_10282763 Ga0070681_102827633 173
180 3300005458 Ga0070681_10487440 Ga0070681_104874402 173
181 3300005458 Ga0070681_11137874 Ga0070681_111378741 173
182 3300005459 Ga0068867_100000286 Ga0068867_1000002866 173
183 3300005459 Ga0068867_100145536 Ga0068867_1001455362 173
184 3300005466 Ga0070685_10000204 Ga0070685_1000020437 173
185 3300005466 Ga0070685_10002445 Ga0070685_100024458 173
186 3300005466 Ga0070685_10007458 Ga0070685_100074583 173
187 3300005466 Ga0070685_10349126 Ga0070685_103491262 173
188 3300005466 Ga0070685_10350829 Ga0070685_103508292 173
189 3300005467 Ga0070706_101366510 Ga0070706_1013665101 173
190 3300005518 Ga0070699_100734214 Ga0070699_1007342142 173
191 3300005530 Ga0070679_100002103 Ga0070679_1000021035 173
192 3300005530 Ga0070679_100052056 Ga0070679_1000520565 173
193 3300005530 Ga0070679_100458785 Ga0070679_1004587852 173
194 3300005530 Ga0070679_100766648 Ga0070679_1007666482 173
195 3300005530 Ga0070679_100882337 Ga0070679_1008823371 173
196 3300005535 Ga0070684_100012262 Ga0070684_1000122627 173
197 3300005535 Ga0070684_100022232 Ga0070684_1000222324 173
198 3300005535 Ga0070684_100037305 Ga0070684_1000373058 173
199 3300005535 Ga0070684_100092187 Ga0070684_1000921874 173
200 3300005535 Ga0070684_100101773 Ga0070684_1001017732 173
201 3300005535 Ga0070684_100243987 Ga0070684_1002439873 173
202 3300005535 Ga0070684_100327544 Ga0070684_1003275442 173
203 3300005535 Ga0070684_100472053 Ga0070684_1004720532 173
204 3300005535 Ga0070684_100486441 Ga0070684_1004864412 173
205 3300005535 Ga0070684_100621878 Ga0070684_1006218782 173
206 3300005539 Ga0068853_100084704 Ga0068853_1000847045 173
207 3300005539 Ga0068853_100265380 Ga0068853_1002653803 173
208 3300005539 Ga0068853_100314104 Ga0068853_1003141042 173
209 3300005539 Ga0068853_100383699 Ga0068853_1003836992 173
210 3300005543 Ga0070672_100000003 Ga0070672_100000003161 173
211 3300005543 Ga0070672_100121376 Ga0070672_1001213762 173
212 3300005543 Ga0070672_100395050 Ga0070672_1003950502 173
213 3300005543 Ga0070672_100678047 Ga0070672_1006780472 173
214 3300005544 Ga0070686_100137172 Ga0070686_1001371723 173
215 3300005544 Ga0070686_100189498 Ga0070686_1001894981 173
216 3300005544 Ga0070686_100395475 Ga0070686_1003954751 173
217 3300005545 Ga0070695_100502938 Ga0070695_1005029382 173
218 3300005545 Ga0070695_100814836 Ga0070695_1008148361 173
219 3300005546 Ga0070696_100228611 Ga0070696_1002286112 173
220 3300005547 Ga0070693_100000635 Ga0070693_1000006356 173
221 3300005547 Ga0070693_100119471 Ga0070693_1001194711 173
222 3300005548 Ga0070665_100001169 Ga0070665_10000116932 173
223 3300005548 Ga0070665_100005060 Ga0070665_1000050604 173
224 3300005548 Ga0070665_100028564 Ga0070665_1000285646 173
225 3300005548 Ga0070665_100111165 Ga0070665_1001111652 173
226 3300005549 Ga0070704_100085178 Ga0070704_1000851783 173
227 3300005549 Ga0070704_100898204 Ga0070704_1008982042 173
228 3300005564 Ga0070664_100440934 Ga0070664_1004409342 173
229 3300005577 Ga0068857_100574465 Ga0068857_1005744652 173
230 3300005577 Ga0068857_101193254 Ga0068857_1011932542 173
231 3300005578 Ga0068854_100042556 Ga0068854_1000425562 173
232 3300005578 Ga0068854_100697814 Ga0068854_1006978142 173
233 3300005614 Ga0068856_100008031 Ga0068856_1000080315 173
234 3300005614 Ga0068856_100124985 Ga0068856_1001249854 173
235 3300005614 Ga0068856_100127736 Ga0068856_1001277362 173
236 3300005614 Ga0068856_101124683 Ga0068856_1011246832 173
237 3300005615 Ga0070702_100055837 Ga0070702_1000558374 173
238 3300005615 Ga0070702_100342667 Ga0070702_1003426671 173
239 3300005616 Ga0068852_100000035 Ga0068852_1000000356 173
240 3300005616 Ga0068852_100052206 Ga0068852_1000522062 173
241 3300005616 Ga0068852_100985202 Ga0068852_1009852022 173
242 3300005617 Ga0068859_100038844 Ga0068859_1000388442 173
243 3300005617 Ga0068859_101317775 Ga0068859_1013177752 173
244 3300005618 Ga0068864_100000023 Ga0068864_100000023273 173
245 3300005618 Ga0068864_100258955 Ga0068864_1002589553 173
246 3300005618 Ga0068864_100474594 Ga0068864_1004745942 173
247 3300005618 Ga0068864_101112451 Ga0068864_1011124512 173
248 3300005718 Ga0068866_10000006 Ga0068866_10000006204 173
249 3300005718 Ga0068866_10256365 Ga0068866_102563652 173
250 3300005719 Ga0068861_100020993 Ga0068861_1000209933 173
251 3300005719 Ga0068861_100242516 Ga0068861_1002425163 173
252 3300005719 Ga0068861_100283573 Ga0068861_1002835733 173
253 3300005719 Ga0068861_100301564 Ga0068861_1003015643 173
254 3300005719 Ga0068861_100428130 Ga0068861_1004281302 173
255 3300005719 Ga0068861_100449228 Ga0068861_1004492282 173
256 3300005719 Ga0068861_100562889 Ga0068861_1005628892 173
257 3300005719 Ga0068861_100657806 Ga0068861_1006578061 173
258 3300005834 Ga0068851_10012563 Ga0068851_100125632 173
259 3300005834 Ga0068851_10125428 Ga0068851_101254283 173
260 3300005840 Ga0068870_10048760 Ga0068870_100487602 173
261 3300005840 Ga0068870_10162797 Ga0068870_101627973 173
262 3300005841 Ga0068863_100000039 Ga0068863_100000039167 173
263 3300005841 Ga0068863_100217994 Ga0068863_1002179943 173
264 3300005842 Ga0068858_100000831 Ga0068858_10000083132 173
265 3300005842 Ga0068858_100002144 Ga0068858_10000214417 173
266 3300005843 Ga0068860_100010408 Ga0068860_1000104084 173
267 3300005843 Ga0068860_100069911 Ga0068860_1000699114 173
268 3300005844 Ga0068862_100009489 Ga0068862_10000948913 173
269 3300005844 Ga0068862_100594497 Ga0068862_1005944972 173
270 3300005844 Ga0068862_100675439 Ga0068862_1006754392 173
271 3300005937 Ga0081455_10004450 Ga0081455_1000445010 173
272 3300005937 Ga0081455_10005517 Ga0081455_100055179 173
273 3300005937 Ga0081455_10022100 Ga0081455_100221004 173
274 3300005937 Ga0081455_10039825 Ga0081455_100398255 173
275 3300005937 Ga0081455_10075891 Ga0081455_100758912 173
276 3300005937 Ga0081455_10081648 Ga0081455_100816484 173
277 3300005937 Ga0081455_10082957 Ga0081455_100829571 173
278 3300005937 Ga0081455_10293247 Ga0081455_102932473 173
279 3300005937 Ga0081455_10734408 Ga0081455_107344081 173
280 3300005981 Ga0081538_10002352 Ga0081538_100023529 173
281 3300005981 Ga0081538_10003174 Ga0081538_100031748 173
282 3300005981 Ga0081538_10003407 Ga0081538_1000340710 173
283 3300005981 Ga0081538_10004819 Ga0081538_1000481910 173
284 3300005981 Ga0081538_10005666 Ga0081538_1000566610 173
285 3300005981 Ga0081538_10007304 Ga0081538_100073049 173
286 3300005981 Ga0081538_10007363 Ga0081538_100073637 173
287 3300005981 Ga0081538_10008064 Ga0081538_100080642 173
288 3300005981 Ga0081538_10008419 Ga0081538_100084198 173
289 3300005981 Ga0081538_10012428 Ga0081538_100124283 173
290 3300005981 Ga0081538_10014954 Ga0081538_100149547 173
291 3300005981 Ga0081538_10016746 Ga0081538_100167466 173
292 3300005981 Ga0081538_10032403 Ga0081538_100324033 173
293 3300005981 Ga0081538_10047567 Ga0081538_100475674 173
294 3300005981 Ga0081538_10073415 Ga0081538_100734151 173
295 3300005981 Ga0081538_10083321 Ga0081538_100833214 173
296 3300005983 Ga0081540_1002619 Ga0081540_10026198 173
297 3300005983 Ga0081540_1011708 Ga0081540_10117086 173
298 3300005983 Ga0081540_1021960 Ga0081540_10219605 173
299 3300005983 Ga0081540_1023897 Ga0081540_10238974 173
300 3300005983 Ga0081540_1052495 Ga0081540_10524953 173
301 3300005983 Ga0081540_1131644 Ga0081540_11316442 173
302 3300005985 Ga0081539_10009838 Ga0081539_100098386 173
303 3300005985 Ga0081539_10011205 Ga0081539_100112056 173
304 3300005985 Ga0081539_10019085 Ga0081539_100190853 173
305 3300005985 Ga0081539_10062799 Ga0081539_100627994 173
306 3300005985 Ga0081539_10096456 Ga0081539_100964562 173
307 3300005985 Ga0081539_10117833 Ga0081539_101178332 173
308 3300006028 Ga0070717_10000056 Ga0070717_1000005688 173
309 3300006028 Ga0070717_10010045 Ga0070717_100100454 173
310 3300006028 Ga0070717_10045832 Ga0070717_100458324 173
311 3300006028 Ga0070717_10152056 Ga0070717_101520562 173
312 3300006028 Ga0070717_11634643 Ga0070717_116346431 173
313 3300006038 Ga0075365_10005286 Ga0075365_100052866 173
314 3300006038 Ga0075365_10043763 Ga0075365_100437634 173
315 3300006038 Ga0075365_10089481 Ga0075365_100894811 173
316 3300006038 Ga0075365_10181502 Ga0075365_101815023 173
317 3300006038 Ga0075365_10207736 Ga0075365_102077363 173
318 3300006038 Ga0075365_10211604 Ga0075365_102116041 173
319 3300006038 Ga0075365_10215512 Ga0075365_102155122 173
320 3300006038 Ga0075365_10285531 Ga0075365_102855312 173
321 3300006038 Ga0075365_10312996 Ga0075365_103129962 173
322 3300006038 Ga0075365_10642715 Ga0075365_106427152 173
323 3300006048 Ga0075363_100587192 Ga0075363_1005871921 173
324 3300006051 Ga0075364_10035298 Ga0075364_100352984 173
325 3300006051 Ga0075364_10242016 Ga0075364_102420162 173
326 3300006051 Ga0075364_10485065 Ga0075364_104850652 173
327 3300006051 Ga0075364_10501578 Ga0075364_105015781 173
328 3300006051 Ga0075364_10655956 Ga0075364_106559562 173
329 3300006058 Ga0075432_10015808 Ga0075432_100158083 173
330 3300006163 Ga0070715_10000003 Ga0070715_10000003223 173
331 3300006173 Ga0070716_100067406 Ga0070716_1000674063 173
332 3300006175 Ga0070712_100000013 Ga0070712_1000000136 173
333 3300006175 Ga0070712_100003643 Ga0070712_10000364313 173
334 3300006175 Ga0070712_100007714 Ga0070712_1000077144 173
335 3300006175 Ga0070712_100013065 Ga0070712_1000130655 173
336 3300006175 Ga0070712_100117043 Ga0070712_1001170432 173
337 3300006175 Ga0070712_100802678 Ga0070712_1008026782 173
338 3300006178 Ga0075367_10046401 Ga0075367_100464013 173
339 3300006178 Ga0075367_10512016 Ga0075367_105120161 173
340 3300006186 Ga0075369_10282698 Ga0075369_102826982 173
341 3300006194 Ga0075427_10040623 Ga0075427_100406231 173
342 3300006237 Ga0097621_100464795 Ga0097621_1004647952 173
343 3300006353 Ga0075370_10045254 Ga0075370_100452544 173
344 3300006358 Ga0068871_100810310 Ga0068871_1008103102 173
345 3300006358 Ga0068871_101000231 Ga0068871_1010002312 173
346 3300006358 Ga0068871_101210178 Ga0068871_1012101781 173
347 3300006844 Ga0075428_100025686 Ga0075428_1000256866 173
348 3300006844 Ga0075428_100054770 Ga0075428_1000547705 173
349 3300006844 Ga0075428_100073592 Ga0075428_1000735922 173
350 3300006844 Ga0075428_100126876 Ga0075428_1001268765 173
351 3300006844 Ga0075428_100220583 Ga0075428_1002205833 173
352 3300006844 Ga0075428_100286406 Ga0075428_1002864063 173
353 3300006844 Ga0075428_100349701 Ga0075428_1003497012 173
354 3300006844 Ga0075428_100364745 Ga0075428_1003647453 173
355 3300006844 Ga0075428_100394957 Ga0075428_1003949572 173
356 3300006844 Ga0075428_100780687 Ga0075428_1007806872 173
357 3300006844 Ga0075428_101171650 Ga0075428_1011716502 173
358 3300006846 Ga0075430_100002606 Ga0075430_10000260617 173
359 3300006846 Ga0075430_100037214 Ga0075430_1000372144 173
360 3300006846 Ga0075430_100042689 Ga0075430_1000426894 173
361 3300006846 Ga0075430_100109952 Ga0075430_1001099524 173
362 3300006846 Ga0075430_100169624 Ga0075430_1001696243 173
363 3300006846 Ga0075430_100177602 Ga0075430_1001776023 173
364 3300006846 Ga0075430_100461629 Ga0075430_1004616291 173
365 3300006847 Ga0075431_100025370 Ga0075431_1000253703 173
366 3300006847 Ga0075431_100058947 Ga0075431_1000589476 173
367 3300006847 Ga0075431_100088845 Ga0075431_1000888454 173
368 3300006847 Ga0075431_100093091 Ga0075431_1000930912 173
369 3300006847 Ga0075431_100198837 Ga0075431_1001988373 173
370 3300006847 Ga0075431_100636839 Ga0075431_1006368392 173
371 3300006847 Ga0075431_100685949 Ga0075431_1006859492 173
372 3300006852 Ga0075433_10000370 Ga0075433_1000037039 173
373 3300006852 Ga0075433_10039850 Ga0075433_100398504 173
374 3300006852 Ga0075433_10065549 Ga0075433_100655494 173
375 3300006852 Ga0075433_10068428 Ga0075433_100684285 173
376 3300006852 Ga0075433_10163301 Ga0075433_101633012 173
377 3300006871 Ga0075434_100025749 Ga0075434_1000257492 173
378 3300006871 Ga0075434_100115069 Ga0075434_1001150694 173
379 3300006871 Ga0075434_100180398 Ga0075434_1001803982 173
380 3300006871 Ga0075434_100321286 Ga0075434_1003212863 173
381 3300006871 Ga0075434_100605556 Ga0075434_1006055562 173
382 3300006871 Ga0075434_100609576 Ga0075434_1006095762 173
383 3300006880 Ga0075429_100001704 Ga0075429_1000017045 173
384 3300006880 Ga0075429_100131226 Ga0075429_1001312262 173
385 3300006880 Ga0075429_100298427 Ga0075429_1002984272 173
386 3300006880 Ga0075429_100772556 Ga0075429_1007725562 173
387 3300006880 Ga0075429_100934700 Ga0075429_1009347002 173
388 3300006881 Ga0068865_100000056 Ga0068865_10000005636 173
389 3300006881 Ga0068865_100208430 Ga0068865_1002084302 173
390 3300006881 Ga0068865_100258729 Ga0068865_1002587292 173
391 3300006914 Ga0075436_100060287 Ga0075436_1000602874 173
392 3300006914 Ga0075436_100618559 Ga0075436_1006185591 173
393 3300006931 Ga0097620_100038844 Ga0097620_1000388447 173
394 3300006931 Ga0097620_101317698 Ga0097620_1013176982 173
395 3300007076 Ga0075435_100046851 Ga0075435_1000468514 173
396 3300007076 Ga0075435_100120874 Ga0075435_1001208742 173
397 3300007788 Ga0099795_10144923 Ga0099795_101449232 173
398 3300009093 Ga0105240_10130738 Ga0105240_101307382 173
399 3300009094 Ga0111539_10133775 Ga0111539_101337753 173
400 3300009094 Ga0111539_10178499 Ga0111539_101784992 173
401 3300009094 Ga0111539_10437615 Ga0111539_104376153 173
402 3300009094 Ga0111539_10494215 Ga0111539_104942153 173
403 3300009094 Ga0111539_10888506 Ga0111539_108885062 173
404 3300009094 Ga0111539_10912306 Ga0111539_109123062 173
405 3300009094 Ga0111539_11070873 Ga0111539_110708731 173
406 3300009094 Ga0111539_11845347 Ga0111539_118453471 173
407 3300009098 Ga0105245_10000049 Ga0105245_100000491 173
408 3300009098 Ga0105245_10001790 Ga0105245_1000179028 173
409 3300009098 Ga0105245_10003775 Ga0105245_100037757 173
410 3300009098 Ga0105245_10011090 Ga0105245_100110905 173
411 3300009098 Ga0105245_10077043 Ga0105245_100770431 173
412 3300009098 Ga0105245_10125321 Ga0105245_101253215 173
413 3300009098 Ga0105245_10570663 Ga0105245_105706632 173
414 3300009098 Ga0105245_10941637 Ga0105245_109416372 173
415 3300009098 Ga0105245_11558831 Ga0105245_115588311 173
416 3300009101 Ga0105247_10041042 Ga0105247_100410423 173
417 3300009101 Ga0105247_10204238 Ga0105247_102042382 173
418 3300009101 Ga0105247_10335237 Ga0105247_103352372 173
419 3300009101 Ga0105247_10362958 Ga0105247_103629582 173
420 3300009147 Ga0114129_10001406 Ga0114129_1000140634 173
421 3300009147 Ga0114129_10030455 Ga0114129_100304558 173
422 3300009147 Ga0114129_10034211 Ga0114129_100342114 173
423 3300009147 Ga0114129_10135528 Ga0114129_101355284 173
424 3300009147 Ga0114129_10137937 Ga0114129_101379375 173
425 3300009147 Ga0114129_10207698 Ga0114129_102076985 173
426 3300009147 Ga0114129_10311982 Ga0114129_103119824 173
427 3300009147 Ga0114129_10395410 Ga0114129_103954103 173
428 3300009147 Ga0114129_10663127 Ga0114129_106631272 173
429 3300009147 Ga0114129_10728834 Ga0114129_107288342 173
430 3300009147 Ga0114129_10878963 Ga0114129_108789632 173
431 3300009147 Ga0114129_10949435 Ga0114129_109494352 173
432 3300009147 Ga0114129_12548289 Ga0114129_125482891 173
433 3300009148 Ga0105243_10082170 Ga0105243_100821704 173
434 3300009148 Ga0105243_10924074 Ga0105243_109240741 173
435 3300009148 Ga0105243_11039221 Ga0105243_110392211 173
436 3300009174 Ga0105241_10552308 Ga0105241_105523081 173
437 3300009176 Ga0105242_10000010 Ga0105242_10000010131 173
438 3300009176 Ga0105242_10050337 Ga0105242_100503372 173
439 3300009176 Ga0105242_10235579 Ga0105242_102355792 173
440 3300009177 Ga0105248_10005136 Ga0105248_100051366 173
441 3300009177 Ga0105248_10433653 Ga0105248_104336531 173
442 3300009177 Ga0105248_10840020 Ga0105248_108400202 173
443 3300009545 Ga0105237_10373185 Ga0105237_103731852 173
444 3300009545 Ga0105237_10526273 Ga0105237_105262732 173
445 3300009545 Ga0105237_10813851 Ga0105237_108138512 173
446 3300009545 Ga0105237_10853945 Ga0105237_108539452 173
447 3300009545 Ga0105237_11600102 Ga0105237_116001022 173
448 3300009551 Ga0105238_10000014 Ga0105238_10000014154 173
449 3300009551 Ga0105238_10118749 Ga0105238_101187495 173
450 3300009551 Ga0105238_10445084 Ga0105238_104450843 173
451 3300009553 Ga0105249_10000619 Ga0105249_100006196 173
452 3300009553 Ga0105249_10006121 Ga0105249_100061219 173
453 3300009553 Ga0105249_10167887 Ga0105249_101678872 173
454 3300009553 Ga0105249_10232301 Ga0105249_102323012 173
455 3300009553 Ga0105249_10552813 Ga0105249_105528133 173
456 3300009553 Ga0105249_11338543 Ga0105249_113385431 173
457 3300010375 Ga0105239_10009439 Ga0105239_100094396 173
458 3300010375 Ga0105239_10502046 Ga0105239_105020461 173
459 3300010375 Ga0105239_10600385 Ga0105239_106003852 173
460 3300010375 Ga0105239_11028342 Ga0105239_110283421 173
461 3300010375 Ga0105239_11682895 Ga0105239_116828952 173
462 3300011119 Ga0105246_10058712 Ga0105246_100587123 173
463 3300011119 Ga0105246_10189507 Ga0105246_101895073 173
464 3300011119 Ga0105246_10205486 Ga0105246_102054862 173
465 3300011119 Ga0105246_10858141 Ga0105246_108581412 173
466 3300011119 Ga0105246_11230945 Ga0105246_112309452 173
467 3300012490 Ga0157322_1019757 Ga0157322_10197571 173
468 3300012494 Ga0157341_1006144 Ga0157341_10061441 173
469 3300012507 Ga0157342_1052715 Ga0157342_10527151 173
470 3300013100 Ga0157373_10422359 Ga0157373_104223592 173
471 3300013100 Ga0157373_10448527 Ga0157373_104485271 173
472 3300013102 Ga0157371_10193956 Ga0157371_101939562 173
473 3300013102 Ga0157371_10408218 Ga0157371_104082182 173
474 3300013104 Ga0157370_10005806 Ga0157370_1000580615 173
475 3300013104 Ga0157370_10162514 Ga0157370_101625142 173
476 3300013105 Ga0157369_10000348 Ga0157369_1000034870 173
477 3300013105 Ga0157369_10474664 Ga0157369_104746642 173
478 3300013105 Ga0157369_11021349 Ga0157369_110213492 173
479 3300013296 Ga0157374_10010605 Ga0157374_1001060511 173
480 3300013296 Ga0157374_10132226 Ga0157374_101322262 173
481 3300013297 Ga0157378_10008849 Ga0157378_1000884911 173
482 3300013297 Ga0157378_10019158 Ga0157378_100191585 173
483 3300013297 Ga0157378_10212935 Ga0157378_102129352 173
484 3300013297 Ga0157378_10754836 Ga0157378_107548361 173
485 3300013297 Ga0157378_10793228 Ga0157378_107932282 173
486 3300013306 Ga0163162_10074005 Ga0163162_100740055 173
487 3300013306 Ga0163162_10295726 Ga0163162_102957262 173
488 3300013306 Ga0163162_10606543 Ga0163162_106065432 173
489 3300013306 Ga0163162_10802526 Ga0163162_108025262 173
490 3300013306 Ga0163162_10911901 Ga0163162_109119012 173
491 3300013306 Ga0163162_10944300 Ga0163162_109443002 173
492 3300013306 Ga0163162_11426830 Ga0163162_114268302 173
493 3300013307 Ga0157372_10008684 Ga0157372_100086841 173
494 3300013307 Ga0157372_10021856 Ga0157372_1002185611 173
495 3300013307 Ga0157372_10487963 Ga0157372_104879633 173
496 3300013307 Ga0157372_10656824 Ga0157372_106568242 173
497 3300013307 Ga0157372_12070956 Ga0157372_120709561 173
498 3300013308 Ga0157375_10001799 Ga0157375_1000179920 173
499 3300013308 Ga0157375_10004307 Ga0157375_1000430713 173
500 3300013308 Ga0157375_10137679 Ga0157375_101376793 173
501 3300013308 Ga0157375_10404272 Ga0157375_104042722 173
502 3300013308 Ga0157375_10417239 Ga0157375_104172392 173
503 3300013308 Ga0157375_10519179 Ga0157375_105191793 173
504 3300014325 Ga0163163_10044683 Ga0163163_100446835 173
505 3300014325 Ga0163163_10217286 Ga0163163_102172862 173
506 3300014325 Ga0163163_10357688 Ga0163163_103576882 173
507 3300014325 Ga0163163_12224147 Ga0163163_122241471 173
508 3300014326 Ga0157380_10168899 Ga0157380_101688992 173
509 3300014326 Ga0157380_10560983 Ga0157380_105609832 173
510 3300014326 Ga0157380_10563105 Ga0157380_105631052 173
511 3300014497 Ga0182008_10068735 Ga0182008_100687352 173
512 3300014497 Ga0182008_10135099 Ga0182008_101350992 173
513 3300014497 Ga0182008_10545947 Ga0182008_105459471 173
514 3300014745 Ga0157377_10018963 Ga0157377_100189632 173
515 3300014745 Ga0157377_10208736 Ga0157377_102087362 173
516 3300014745 Ga0157377_10224613 Ga0157377_102246132 173
517 3300014968 Ga0157379_10041544 Ga0157379_100415449 173
518 3300014968 Ga0157379_10132596 Ga0157379_101325962 173
519 3300014968 Ga0157379_10531944 Ga0157379_105319442 173
520 3300014969 Ga0157376_10014477 Ga0157376_100144776 173
521 3300014969 Ga0157376_10023185 Ga0157376_100231854 173
522 3300014969 Ga0157376_10175114 Ga0157376_101751142 173
523 3300014969 Ga0157376_10572978 Ga0157376_105729782 173
524 3300014969 Ga0157376_10813484 Ga0157376_108134842 173
525 3300015262 Ga0182007_10139929 Ga0182007_101399292 173
526 3300015265 Ga0182005_1157453 Ga0182005_11574532 173
527 3300017792 Ga0163161_10000013 Ga0163161_10000013189 173
528 3300017792 Ga0163161_10022200 Ga0163161_100222002 173
529 3300020069 Ga0197907_10226004 Ga0197907_102260042 173
530 3300020069 Ga0197907_10263697 Ga0197907_102636972 173
531 3300020069 Ga0197907_10502577 Ga0197907_105025773 173
532 3300020069 Ga0197907_11319355 Ga0197907_113193551 173
533 3300020070 Ga0206356_10319799 Ga0206356_103197992 173
534 3300020070 Ga0206356_11054826 Ga0206356_110548263 173
535 3300020070 Ga0206356_11287848 Ga0206356_112878481 173
536 3300020070 Ga0206356_11691794 Ga0206356_116917942 173
537 3300020070 Ga0206356_11746000 Ga0206356_117460001 173
538 3300020076 Ga0206355_1427505 Ga0206355_14275052 173
539 3300020076 Ga0206355_1710056 Ga0206355_17100563 173
540 3300020077 Ga0206351_10453586 Ga0206351_104535863 173
541 3300020080 Ga0206350_10199528 Ga0206350_101995282 173
542 3300020080 Ga0206350_10542446 Ga0206350_105424461 173
543 3300020082 Ga0206353_11117576 Ga0206353_111175763 173
544 3300020082 Ga0206353_11725351 Ga0206353_117253512 173
545 3300020082 Ga0206353_11838604 Ga0206353_118386041 173
546 3300020082 Ga0206353_12051169 Ga0206353_120511692 173
547 3300020610 Ga0154015_1602182 Ga0154015_16021821 173
548 3300020610 Ga0154015_1695541 Ga0154015_16955412 173
549 3300021358 Ga0213873_10008616 Ga0213873_100086163 173
550 3300021377 Ga0213874_10001182 Ga0213874_100011825 173
551 3300021384 Ga0213876_10016117 Ga0213876_100161172 173
552 3300021384 Ga0213876_10026178 Ga0213876_100261782 173
553 3300021384 Ga0213876_10032232 Ga0213876_100322325 173
554 3300021384 Ga0213876_10062337 Ga0213876_100623372 173
555 3300021388 Ga0213875_10000432 Ga0213875_100004326 173
556 3300021388 Ga0213875_10016820 Ga0213875_100168204 173
557 3300021388 Ga0213875_10022860 Ga0213875_100228604 173
558 3300021388 Ga0213875_10028272 Ga0213875_100282722 173
559 3300021388 Ga0213875_10054690 Ga0213875_100546903 173
560 3300021388 Ga0213875_10187856 Ga0213875_101878562 173
561 3300022467 Ga0224712_10038884 Ga0224712_100388842 173
562 3300022467 Ga0224712_10056499 Ga0224712_100564992 173
563 3300022467 Ga0224712_10066318 Ga0224712_100663181 173
564 3300025321 Ga0207656_10013897 Ga0207656_100138974 173
565 3300025885 Ga0207653_10037946 Ga0207653_100379462 173
566 3300025893 Ga0207682_10000008 Ga0207682_1000000841 173
567 3300025898 Ga0207692_10000003 Ga0207692_10000003342 173
568 3300025899 Ga0207642_10000001 Ga0207642_100000016 173
569 3300025899 Ga0207642_10000003 Ga0207642_100000036 173
570 3300025899 Ga0207642_10000004 Ga0207642_100000046 173
571 3300025899 Ga0207642_10000008 Ga0207642_100000085 173
572 3300025899 Ga0207642_10190036 Ga0207642_101900362 173
573 3300025899 Ga0207642_10257967 Ga0207642_102579672 173
574 3300025899 Ga0207642_10344649 Ga0207642_103446492 173
575 3300025900 Ga0207710_10000220 Ga0207710_1000022013 173
576 3300025900 Ga0207710_10058868 Ga0207710_100588682 173
577 3300025900 Ga0207710_10182630 Ga0207710_101826302 173
578 3300025901 Ga0207688_10007210 Ga0207688_100072103 173
579 3300025901 Ga0207688_10018227 Ga0207688_100182272 173
580 3300025904 Ga0207647_10107536 Ga0207647_101075363 173
581 3300025904 Ga0207647_10262583 Ga0207647_102625832 173
582 3300025904 Ga0207647_10498231 Ga0207647_104982312 173
583 3300025905 Ga0207685_10000003 Ga0207685_10000003220 173
584 3300025906 Ga0207699_10030456 Ga0207699_100304562 173
585 3300025907 Ga0207645_10344637 Ga0207645_103446372 173
586 3300025907 Ga0207645_10358374 Ga0207645_103583742 173
587 3300025908 Ga0207643_10076612 Ga0207643_100766122 173
588 3300025908 Ga0207643_10188526 Ga0207643_101885262 173
589 3300025912 Ga0207707_10005257 Ga0207707_100052575 173
590 3300025912 Ga0207707_10009788 Ga0207707_1000978811 173
591 3300025912 Ga0207707_10213426 Ga0207707_102134263 173
592 3300025913 Ga0207695_10088255 Ga0207695_100882553 173
593 3300025913 Ga0207695_10303936 Ga0207695_103039363 173
594 3300025914 Ga0207671_10416437 Ga0207671_104164372 173
595 3300025914 Ga0207671_10490687 Ga0207671_104906871 173
596 3300025915 Ga0207693_10000046 Ga0207693_1000004699 173
597 3300025915 Ga0207693_10004849 Ga0207693_100048496 173
598 3300025915 Ga0207693_10004896 Ga0207693_100048962 173
599 3300025915 Ga0207693_10026794 Ga0207693_100267944 173
600 3300025915 Ga0207693_10070542 Ga0207693_100705423 173
601 3300025915 Ga0207693_10295902 Ga0207693_102959022 173
602 3300025915 Ga0207693_10644642 Ga0207693_106446422 173
603 3300025916 Ga0207663_10278393 Ga0207663_102783932 173
604 3300025916 Ga0207663_10485787 Ga0207663_104857871 173
605 3300025916 Ga0207663_10659680 Ga0207663_106596802 173
606 3300025916 Ga0207663_10963102 Ga0207663_109631022 173
607 3300025917 Ga0207660_10092024 Ga0207660_100920244 173
608 3300025917 Ga0207660_10552817 Ga0207660_105528172 173
609 3300025918 Ga0207662_10272477 Ga0207662_102724772 173
610 3300025918 Ga0207662_10676925 Ga0207662_106769251 173
611 3300025919 Ga0207657_10139550 Ga0207657_101395503 173
612 3300025919 Ga0207657_10165059 Ga0207657_101650593 173
613 3300025919 Ga0207657_10171939 Ga0207657_101719393 173
614 3300025919 Ga0207657_10206589 Ga0207657_102065892 173
615 3300025919 Ga0207657_10295437 Ga0207657_102954372 173
616 3300025920 Ga0207649_10000388 Ga0207649_1000038812 173
617 3300025920 Ga0207649_10056686 Ga0207649_100566862 173
618 3300025920 Ga0207649_10193371 Ga0207649_101933711 173
619 3300025921 Ga0207652_10000687 Ga0207652_1000068714 173
620 3300025921 Ga0207652_10004160 Ga0207652_100041605 173
621 3300025921 Ga0207652_10476352 Ga0207652_104763522 173
622 3300025921 Ga0207652_11063708 Ga0207652_110637081 173
623 3300025922 Ga0207646_10686815 Ga0207646_106868151 173
624 3300025923 Ga0207681_10013602 Ga0207681_100136022 173
625 3300025924 Ga0207694_10000008 Ga0207694_1000000884 173
626 3300025925 Ga0207650_10754383 Ga0207650_107543832 173
627 3300025926 Ga0207659_10000054 Ga0207659_1000005474 173
628 3300025926 Ga0207659_10210571 Ga0207659_102105711 173
629 3300025927 Ga0207687_10000027 Ga0207687_100000277 173
630 3300025927 Ga0207687_10000039 Ga0207687_1000003929 173
631 3300025927 Ga0207687_10003143 Ga0207687_100031432 173
632 3300025927 Ga0207687_10038127 Ga0207687_100381274 173
633 3300025927 Ga0207687_10045423 Ga0207687_100454232 173
634 3300025927 Ga0207687_10062650 Ga0207687_100626503 173
635 3300025927 Ga0207687_10189472 Ga0207687_101894722 173
636 3300025927 Ga0207687_10704599 Ga0207687_107045992 173
637 3300025928 Ga0207700_10017789 Ga0207700_100177893 173
638 3300025928 Ga0207700_10220752 Ga0207700_102207523 173
639 3300025929 Ga0207664_10000105 Ga0207664_100001054 173
640 3300025929 Ga0207664_10026964 Ga0207664_100269644 173
641 3300025929 Ga0207664_10044906 Ga0207664_100449064 173
642 3300025929 Ga0207664_10151835 Ga0207664_101518353 173
643 3300025929 Ga0207664_10270430 Ga0207664_102704302 173
644 3300025929 Ga0207664_10402962 Ga0207664_104029622 173
645 3300025929 Ga0207664_10964641 Ga0207664_109646412 173
646 3300025931 Ga0207644_10558913 Ga0207644_105589131 173
647 3300025932 Ga0207690_10000367 Ga0207690_1000036726 173
648 3300025932 Ga0207690_10003175 Ga0207690_100031757 173
649 3300025932 Ga0207690_10068817 Ga0207690_100688174 173
650 3300025932 Ga0207690_10163371 Ga0207690_101633712 173
651 3300025932 Ga0207690_10873376 Ga0207690_108733761 173
652 3300025933 Ga0207706_10000018 Ga0207706_10000018174 173
653 3300025933 Ga0207706_10002496 Ga0207706_100024964 173
654 3300025933 Ga0207706_10339377 Ga0207706_103393772 173
655 3300025933 Ga0207706_10555586 Ga0207706_105555862 173
656 3300025933 Ga0207706_10580362 Ga0207706_105803622 173
657 3300025934 Ga0207686_10000394 Ga0207686_100003946 173
658 3300025934 Ga0207686_10001080 Ga0207686_1000108012 173
659 3300025934 Ga0207686_10010468 Ga0207686_100104682 173
660 3300025934 Ga0207686_10035482 Ga0207686_100354826 173
661 3300025934 Ga0207686_10101719 Ga0207686_101017192 173
662 3300025934 Ga0207686_10235135 Ga0207686_102351353 173
663 3300025934 Ga0207686_10270794 Ga0207686_102707942 173
664 3300025935 Ga0207709_10017975 Ga0207709_100179752 173
665 3300025935 Ga0207709_10083807 Ga0207709_100838073 173
666 3300025935 Ga0207709_10253474 Ga0207709_102534742 173
667 3300025935 Ga0207709_10270399 Ga0207709_102703992 173
668 3300025936 Ga0207670_10083182 Ga0207670_100831823 173
669 3300025937 Ga0207669_10000041 Ga0207669_1000004179 173
670 3300025937 Ga0207669_10000083 Ga0207669_1000008315 173
671 3300025937 Ga0207669_10009064 Ga0207669_100090644 173
672 3300025937 Ga0207669_10399615 Ga0207669_103996152 173
673 3300025937 Ga0207669_10970496 Ga0207669_109704961 173
674 3300025938 Ga0207704_10000092 Ga0207704_1000009238 173
675 3300025938 Ga0207704_10072943 Ga0207704_100729433 173
676 3300025939 Ga0207665_10023069 Ga0207665_100230696 173
677 3300025939 Ga0207665_10111835 Ga0207665_101118352 173
678 3300025939 Ga0207665_10256760 Ga0207665_102567602 173
679 3300025940 Ga0207691_10000005 Ga0207691_10000005161 173
680 3300025941 Ga0207711_10000011 Ga0207711_100000116 173
681 3300025942 Ga0207689_10019813 Ga0207689_100198134 173
682 3300025942 Ga0207689_10637904 Ga0207689_106379042 173
683 3300025944 Ga0207661_10000155 Ga0207661_1000015548 173
684 3300025944 Ga0207661_10001735 Ga0207661_1000173516 173
685 3300025944 Ga0207661_10007230 Ga0207661_100072305 173
686 3300025944 Ga0207661_10007883 Ga0207661_100078833 173
687 3300025944 Ga0207661_10090386 Ga0207661_100903863 173
688 3300025944 Ga0207661_10091970 Ga0207661_100919702 173
689 3300025944 Ga0207661_10195721 Ga0207661_101957212 173
690 3300025944 Ga0207661_10302055 Ga0207661_103020552 173
691 3300025944 Ga0207661_11254215 Ga0207661_112542151 173
692 3300025945 Ga0207679_10021872 Ga0207679_100218725 173
693 3300025945 Ga0207679_10724315 Ga0207679_107243152 173
694 3300025949 Ga0207667_10568816 Ga0207667_105688162 173
695 3300025949 Ga0207667_10583565 Ga0207667_105835652 173
696 3300025960 Ga0207651_10464808 Ga0207651_104648082 173
697 3300025961 Ga0207712_10000067 Ga0207712_1000006735 173
698 3300025961 Ga0207712_10003594 Ga0207712_100035946 173
699 3300025961 Ga0207712_10115729 Ga0207712_101157293 173
700 3300025961 Ga0207712_10347240 Ga0207712_103472401 173
701 3300025961 Ga0207712_10376202 Ga0207712_103762022 173
702 3300025972 Ga0207668_10105990 Ga0207668_101059903 173
703 3300025972 Ga0207668_10106757 Ga0207668_101067572 173
704 3300025972 Ga0207668_10149199 Ga0207668_101491992 173
705 3300025972 Ga0207668_10264596 Ga0207668_102645962 173
706 3300025972 Ga0207668_10275682 Ga0207668_102756821 173
707 3300025972 Ga0207668_10366195 Ga0207668_103661952 173
708 3300025972 Ga0207668_10658903 Ga0207668_106589032 173
709 3300025981 Ga0207640_10426896 Ga0207640_104268962 173
710 3300025986 Ga0207658_10002450 Ga0207658_100024504 173
711 3300025986 Ga0207658_10379597 Ga0207658_103795971 173
712 3300026023 Ga0207677_10002371 Ga0207677_100023719 173
713 3300026023 Ga0207677_10117124 Ga0207677_101171242 173
714 3300026023 Ga0207677_10504716 Ga0207677_105047162 173
715 3300026035 Ga0207703_10001660 Ga0207703_100016607 173
716 3300026035 Ga0207703_10002059 Ga0207703_100020597 173
717 3300026035 Ga0207703_10146711 Ga0207703_101467114 173
718 3300026035 Ga0207703_10522313 Ga0207703_105223132 173
719 3300026041 Ga0207639_10581900 Ga0207639_105819001 173
720 3300026067 Ga0207678_10167792 Ga0207678_101677922 173
721 3300026067 Ga0207678_10384162 Ga0207678_103841622 173
722 3300026067 Ga0207678_10422686 Ga0207678_104226862 173
723 3300026067 Ga0207678_11124798 Ga0207678_111247982 173
724 3300026075 Ga0207708_10003287 Ga0207708_1000328711 173
725 3300026075 Ga0207708_10039146 Ga0207708_100391465 173
726 3300026075 Ga0207708_10052314 Ga0207708_100523144 173
727 3300026075 Ga0207708_10055912 Ga0207708_100559123 173
728 3300026075 Ga0207708_10097197 Ga0207708_100971972 173
729 3300026075 Ga0207708_10108440 Ga0207708_101084404 173
730 3300026075 Ga0207708_10159916 Ga0207708_101599162 173
731 3300026075 Ga0207708_10208275 Ga0207708_102082753 173
732 3300026075 Ga0207708_10219051 Ga0207708_102190513 173
733 3300026075 Ga0207708_11219944 Ga0207708_112199441 173
734 3300026078 Ga0207702_10001995 Ga0207702_100019955 173
735 3300026078 Ga0207702_10020931 Ga0207702_100209318 173
736 3300026078 Ga0207702_10024809 Ga0207702_100248096 173
737 3300026078 Ga0207702_10052280 Ga0207702_100522803 173
738 3300026078 Ga0207702_10098300 Ga0207702_100983004 173
739 3300026078 Ga0207702_10571588 Ga0207702_105715882 173
740 3300026078 Ga0207702_11104578 Ga0207702_111045782 173
741 3300026088 Ga0207641_10000065 Ga0207641_1000006568 173
742 3300026088 Ga0207641_10562518 Ga0207641_105625181 173
743 3300026089 Ga0207648_10001221 Ga0207648_100012212 173
744 3300026089 Ga0207648_10194748 Ga0207648_101947482 173
745 3300026089 Ga0207648_10422278 Ga0207648_104222782 173
746 3300026089 Ga0207648_10879638 Ga0207648_108796382 173
747 3300026095 Ga0207676_10000025 Ga0207676_100000258 173
748 3300026095 Ga0207676_10128753 Ga0207676_101287533 173
749 3300026095 Ga0207676_10874321 Ga0207676_108743212 173
750 3300026116 Ga0207674_10070823 Ga0207674_100708232 173
751 3300026116 Ga0207674_10129140 Ga0207674_101291402 173
752 3300026116 Ga0207674_10258055 Ga0207674_102580552 173
753 3300026116 Ga0207674_10258327 Ga0207674_102583273 173
754 3300026116 Ga0207674_10729752 Ga0207674_107297522 173
755 3300026116 Ga0207674_10753394 Ga0207674_107533942 173
756 3300026118 Ga0207675_100007075 Ga0207675_1000070752 173
757 3300026118 Ga0207675_100137263 Ga0207675_1001372633 173
758 3300026118 Ga0207675_100228775 Ga0207675_1002287753 173
759 3300026118 Ga0207675_100356283 Ga0207675_1003562831 173
760 3300026118 Ga0207675_100400936 Ga0207675_1004009362 173
761 3300026118 Ga0207675_100499335 Ga0207675_1004993353 173
762 3300026121 Ga0207683_10018525 Ga0207683_100185256 173
763 3300026121 Ga0207683_10063110 Ga0207683_100631105 173
764 3300026121 Ga0207683_10193235 Ga0207683_101932351 173
765 3300026121 Ga0207683_10340628 Ga0207683_103406283 173
766 3300026121 Ga0207683_10597506 Ga0207683_105975061 173
767 3300026121 Ga0207683_10742687 Ga0207683_107426872 173
768 3300026121 Ga0207683_10960721 Ga0207683_109607212 173
769 3300026121 Ga0207683_11197277 Ga0207683_111972772 173
770 3300026142 Ga0207698_10000014 Ga0207698_1000001426 173
771 3300026142 Ga0207698_10003054 Ga0207698_100030545 173
772 3300026142 Ga0207698_10347926 Ga0207698_103479261 173
773 3300026142 Ga0207698_10459174 Ga0207698_104591742 173
774 3300026142 Ga0207698_11078117 Ga0207698_110781172 173
775 3300026142 Ga0207698_11453610 Ga0207698_114536101 173
776 3300027907 Ga0207428_10039865 Ga0207428_100398654 173
777 3300027907 Ga0207428_10043666 Ga0207428_100436662 173
778 3300027907 Ga0207428_10098732 Ga0207428_100987324 173
779 3300027907 Ga0207428_10132411 Ga0207428_101324112 173
780 3300027907 Ga0207428_10163197 Ga0207428_101631973 173
781 3300027907 Ga0207428_10228513 Ga0207428_102285132 173
782 3300027907 Ga0207428_10266475 Ga0207428_102664752 173
783 3300028379 Ga0268266_10000029 Ga0268266_1000002933 173
784 3300028379 Ga0268266_10003036 Ga0268266_100030364 173
785 3300028380 Ga0268265_10002323 Ga0268265_100023238 173
786 3300028380 Ga0268265_10483785 Ga0268265_104837852 173
787 3300028380 Ga0268265_11196951 Ga0268265_111969511 173
788 3300028380 Ga0268265_11230038 Ga0268265_112300382 173
789 3300028381 Ga0268264_10007803 Ga0268264_100078039 173
790 3300028381 Ga0268264_10054875 Ga0268264_100548751 173
791 3300028381 Ga0268264_10204628 Ga0268264_102046283 173
792 3300028556 Ga0265337_1000032 Ga0265337_100003252 173
793 3300028558 Ga0265326_10000182 Ga0265326_100001823 173
794 3300028558 Ga0265326_10000391 Ga0265326_100003914 173
795 3300028563 Ga0265319_1006490 Ga0265319_10064905 173
796 3300028563 Ga0265319_1101708 Ga0265319_11017081 173
797 3300028573 Ga0265334_10000050 Ga0265334_1000005037 173
798 3300028577 Ga0265318_10036076 Ga0265318_100360763 173
799 3300028654 Ga0265322_10000012 Ga0265322_1000001212 173
800 3300028654 Ga0265322_10122887 Ga0265322_101228872 173
801 3300028666 Ga0265336_10004549 Ga0265336_100045496 173
802 3300028666 Ga0265336_10007107 Ga0265336_100071075 173
803 3300028800 Ga0265338_10086859 Ga0265338_100868593 173
804 3300029957 Ga0265324_10000620 Ga0265324_1000062025 173
805 3300031240 Ga0265320_10000001 Ga0265320_10000001712 173
806 3300031241 Ga0265325_10037045 Ga0265325_100370455 173
807 3300031242 Ga0265329_10001617 Ga0265329_100016176 173
808 3300031250 Ga0265331_10001949 Ga0265331_100019497 173
809 3300031251 Ga0265327_10000003 Ga0265327_10000003712 173
810 3300031251 Ga0265327_10038308 Ga0265327_100383084 173
811 3300031251 Ga0265327_10108155 Ga0265327_101081552 173
812 3300031344 Ga0265316_10025457 Ga0265316_100254573 173
813 3300031548 Ga0307408_100342149 Ga0307408_1003421492 173
814 3300031548 Ga0307408_100345327 Ga0307408_1003453272 173
815 3300031548 Ga0307408_100741977 Ga0307408_1007419772 173
816 3300031711 Ga0265314_10000178 Ga0265314_1000017879 173
817 3300031727 Ga0316576_10069035 Ga0316576_100690353 173
818 3300031731 Ga0307405_10051289 Ga0307405_100512894 173
819 3300031731 Ga0307405_10114950 Ga0307405_101149503 173
820 3300031731 Ga0307405_10120355 Ga0307405_101203552 173
821 3300031824 Ga0307413_10007576 Ga0307413_100075765 173
822 3300031824 Ga0307413_10149331 Ga0307413_101493312 173
823 3300031824 Ga0307413_10304501 Ga0307413_103045013 173
824 3300031824 Ga0307413_10792947 Ga0307413_107929471 173
825 3300031852 Ga0307410_10020361 Ga0307410_100203616 173
826 3300031852 Ga0307410_10020508 Ga0307410_100205083 173
827 3300031852 Ga0307410_10068568 Ga0307410_100685682 173
828 3300031852 Ga0307410_10461715 Ga0307410_104617152 173
829 3300031889 Ga0326468_10002833 Ga0326468_100028332 173
830 3300031901 Ga0307406_10043957 Ga0307406_100439574 173
831 3300031901 Ga0307406_10190419 Ga0307406_101904193 173
832 3300031901 Ga0307406_10204848 Ga0307406_102048482 173
833 3300031903 Ga0307407_10019802 Ga0307407_100198025 173
834 3300031903 Ga0307407_10030089 Ga0307407_100300894 173
835 3300031903 Ga0307407_10044272 Ga0307407_100442721 173
836 3300031903 Ga0307407_10059200 Ga0307407_100592004 173
837 3300031903 Ga0307407_10312298 Ga0307407_103122982 173
838 3300031903 Ga0307407_10325366 Ga0307407_103253661 173
839 3300031903 Ga0307407_10408666 Ga0307407_104086662 173
840 3300031911 Ga0307412_10249148 Ga0307412_102491482 173
841 3300031911 Ga0307412_10666697 Ga0307412_106666972 173
842 3300031995 Ga0307409_100000534 Ga0307409_1000005347 173
843 3300031995 Ga0307409_100032385 Ga0307409_1000323854 173
844 3300031995 Ga0307409_100036124 Ga0307409_1000361244 173
845 3300031995 Ga0307409_100053888 Ga0307409_1000538883 173
846 3300031995 Ga0307409_100059238 Ga0307409_1000592383 173
847 3300031995 Ga0307409_100088264 Ga0307409_1000882641 173
848 3300031995 Ga0307409_100126674 Ga0307409_1001266742 173
849 3300031995 Ga0307409_100267682 Ga0307409_1002676821 173
850 3300031995 Ga0307409_100404794 Ga0307409_1004047942 173
851 3300031995 Ga0307409_100520432 Ga0307409_1005204322 173
852 3300031995 Ga0307409_101600301 Ga0307409_1016003011 173
853 3300031995 Ga0307409_101756305 Ga0307409_1017563051 173
854 3300032002 Ga0307416_100004671 Ga0307416_10000467114 173
855 3300032002 Ga0307416_100018928 Ga0307416_1000189283 173
856 3300032002 Ga0307416_100050895 Ga0307416_1000508952 173
857 3300032002 Ga0307416_100082233 Ga0307416_1000822332 173
858 3300032002 Ga0307416_100090547 Ga0307416_1000905473 173
859 3300032002 Ga0307416_100096755 Ga0307416_1000967552 173
860 3300032002 Ga0307416_100205805 Ga0307416_1002058052 173
861 3300032002 Ga0307416_100435480 Ga0307416_1004354803 173
862 3300032002 Ga0307416_100706519 Ga0307416_1007065192 173
863 3300032002 Ga0307416_100808962 Ga0307416_1008089622 173
864 3300032002 Ga0307416_101273321 Ga0307416_1012733212 173
865 3300032002 Ga0307416_101502622 Ga0307416_1015026222 173
866 3300032004 Ga0307414_10366487 Ga0307414_103664872 173
867 3300032004 Ga0307414_10404034 Ga0307414_104040343 173
868 3300032004 Ga0307414_10640388 Ga0307414_106403882 173
869 3300032005 Ga0307411_10153303 Ga0307411_101533032 173
870 3300032005 Ga0307411_10156586 Ga0307411_101565863 173
871 3300032005 Ga0307411_10887820 Ga0307411_108878202 173
872 3300032126 Ga0307415_100000877 Ga0307415_10000087710 173
873 3300032126 Ga0307415_100003728 Ga0307415_1000037284 173
874 3300032126 Ga0307415_100149326 Ga0307415_1001493262 173
875 3300032126 Ga0307415_100177819 Ga0307415_1001778192 173
876 3300032126 Ga0307415_100194643 Ga0307415_1001946432 173
877 3300032126 Ga0307415_100322513 Ga0307415_1003225132 173
878 3300032126 Ga0307415_100367101 Ga0307415_1003671013 173
879 3300032126 Ga0307415_100586140 Ga0307415_1005861401 173
880 3300032126 Ga0307415_100751978 Ga0307415_1007519782 173
881 3300032126 Ga0307415_100970861 Ga0307415_1009708612 173
882 3300035089 Ga0373944_0078673 Ga0373944_0078673_534_1055 173
883 3300035091 Ga0373951_0106443 Ga0373951_0106443_194_715 173
884 3300035092 Ga0373952_0044480 Ga0373952_0044480_220_741 173
885 3300035118 Ga0373954_0087815 Ga0373954_0087815_916_1437 173
886 3300035170 Ga0373943_0079353 Ga0373943_0079353_674_1195 173
887 3300035171 Ga0373946_0114228 Ga0373946_0114228_519_1040 173
888 3300035172 Ga0373955_0068713 Ga0373955_0068713_735_1256 173
889 3300035172 Ga0373955_0106906 Ga0373955_0106906_924_1448 173
890 3300035241 Ga0373961_0037079 Ga0373961_0037079_724_1245 173
891 3300035398 Ga0316574_0073643 Ga0316574_0073643_1007_1534 173
892 3300035398 Ga0316574_0082301 Ga0316574_0082301_208_729 173
893 3300035398 Ga0316574_0343618 Ga0316574_0343618_395_916 173
894 3300035410 Ga0373924_0055972 Ga0373924_0055972_167_688 173
895 3300035691 Ga0373931_0575766 Ga0373931_0575766_19_540 173
896 3300035692 Ga0373935_0123234 Ga0373935_0123234_1095_1616 173
897 3300035692 Ga0373935_0363191 Ga0373935_0363191_216_737 173
898 3300035692 Ga0373935_0781808 Ga0373935_0781808_75_596 173
899 3300035695 Ga0373927_0122321 Ga0373927_0122321_1032_1553 173
900 3300035724 Ga0373933_0049145 Ga0373933_0049145_1704_2228 173
901 3300035724 Ga0373933_0199053 Ga0373933_0199053_326_847 173
902 3300035725 Ga0373947_0189914 Ga0373947_0189914_797_1318 173
903 3300036401 Ga0373937_0004250 Ga0373937_0004250_5473_5997 173
904 3300036401 Ga0373937_0049210 Ga0373937_0049210_2309_2833 173
905 3300036401 Ga0373937_0152541 Ga0373937_0152541_1595_2116 173
906 3300036401 Ga0373937_0333997 Ga0373937_0333997_391_915 173
907 3300036401 Ga0373937_0846820 Ga0373937_0846820_201_725 173
908 3300036647 Ga0316582_0186344 Ga0316582_0186344_503_1024 173
909 3300036712 Ga0316584_0011612 Ga0316584_0011612_3212_3733 173
910 3300037068 Ga0373925_1122623 Ga0373925_1122623_106_630 173
911 3300037312 Ga0395899_0190943 Ga0395899_0190943_406_927 173
912 3300037312 Ga0395899_0200259 Ga0395899_0200259_334_855 173
913 3300037418 Ga0395900_0024946 Ga0395900_0024946_564_1085 173
914 3300037418 Ga0395900_0207637 Ga0395900_0207637_854_1375 173
915 3300037418 Ga0395900_0234875 Ga0395900_0234875_289_810 173
916 3300037418 Ga0395900_0299334 Ga0395900_0299334_572_1093 173
917 3300037418 Ga0395900_0331014 Ga0395900_0331014_652_1173 173
918 3300037418 Ga0395900_0694007 Ga0395900_0694007_70_591 173
919 3300037466 Ga0395898_0006808 Ga0395898_0006808_1735_2256 173
920 3300037466 Ga0395898_0029500 Ga0395898_0029500_4343_4864 173
921 3300037466 Ga0395898_0093235 Ga0395898_0093235_631_1152 173
922 3300037466 Ga0395898_0157094 Ga0395898_0157094_1212_1733 173
923 3300037466 Ga0395898_0161043 Ga0395898_0161043_488_1009 173
924 3300037466 Ga0395898_0181431 Ga0395898_0181431_301_822 173
925 3300037466 Ga0395898_0321199 Ga0395898_0321199_729_1250 173
926 3300037466 Ga0395898_0496511 Ga0395898_0496511_109_630 173
927 3300037466 Ga0395898_0548426 Ga0395898_0548426_283_804 173
928 3300037466 Ga0395898_0617276 Ga0395898_0617276_461_982 173
929 3300037466 Ga0395898_0815380 Ga0395898_0815380_175_696 173
930 3300037466 Ga0395898_0949921 Ga0395898_0949921_222_743 173
931 3300037471 Ga0395905_0103388 Ga0395905_0103388_1326_1847 173
932 3300037471 Ga0395905_0195984 Ga0395905_0195984_689_1210 173
933 3300037471 Ga0395905_0340529 Ga0395905_0340529_696_1217 173
934 3300037471 Ga0395905_0712930 Ga0395905_0712930_101_622 173
935 3300037853 Ga0436364_0106860 Ga0436364_0106860_356_877 173
936 3300037853 Ga0436364_0143102 Ga0436364_0143102_355_876 173
937 3300037853 Ga0436364_0232403 Ga0436364_0232403_2458_2979 173
938 3300037853 Ga0436364_0285692 Ga0436364_0285692_4490_5011 173
939 3300037853 Ga0436364_0346470 Ga0436364_0346470_258_779 173
940 3300037853 Ga0436364_0346957 Ga0436364_0346957_1695_2216 173
941 3300037853 Ga0436364_0472975 Ga0436364_0472975_61_582 173
942 3300037853 Ga0436364_0561523 Ga0436364_0561523_285_806 173
943 3300037853 Ga0436364_0829524 Ga0436364_0829524_31_552 173
944 3300037853 Ga0436364_1031907 Ga0436364_1031907_8032_8553 173
945 3300037853 Ga0436364_1056938 Ga0436364_1056938_84_605 173
946 3300037853 Ga0436364_1160444 Ga0436364_1160444_56_577 173
947 3300037853 Ga0436364_1168699 Ga0436364_1168699_326_847 173
948 3300038443 Ga0395901_0005610 Ga0395901_0005610_225_746 173
949 3300038443 Ga0395901_0076584 Ga0395901_0076584_802_1323 173
950 3300038443 Ga0395901_0105378 Ga0395901_0105378_440_961 173
951 3300038443 Ga0395901_0252827 Ga0395901_0252827_767_1288 173
952 3300038443 Ga0395901_0340599 Ga0395901_0340599_857_1378 173
953 3300038443 Ga0395901_0463896 Ga0395901_0463896_179_700 173
954 3300038443 Ga0395901_0651066 Ga0395901_0651066_190_711 173
955 3300038443 Ga0395901_0703038 Ga0395901_0703038_22_543 173
956 3300038443 Ga0395901_1033471 Ga0395901_1033471_237_758 173
957 3300038443 Ga0395901_1038483 Ga0395901_1038483_199_720 173
958 3300038443 Ga0395901_1047997 Ga0395901_1047997_130_651 173
959 3300038443 Ga0395901_1761399 Ga0395901_1761399_26_547 173
960 3300039437 Ga0436365_0221050 Ga0436365_0221050_63_584 173
961 3300039437 Ga0436365_0229613 Ga0436365_0229613_336_857 173
962 3300039437 Ga0436365_0654188 Ga0436365_0654188_374_895 173
963 3300039437 Ga0436365_0699626 Ga0436365_0699626_2436_2957 173
964 3300039437 Ga0436365_0941052 Ga0436365_0941052_1923_2444 173
965 3300039437 Ga0436365_1067328 Ga0436365_1067328_145_666 173
966 3300039437 Ga0436365_1154041 Ga0436365_1154041_80_601 173
967 3300039437 Ga0436365_1233534 Ga0436365_1233534_2501_3022 173
968 3300039437 Ga0436365_1418397 Ga0436365_1418397_2204_2725 173
969 3300039437 Ga0436365_1481388 Ga0436365_1481388_77_598 173
970 3300039438 Ga0436360_0821324 Ga0436360_0821324_15_536 173
971 3300039438 Ga0436360_1134058 Ga0436360_1134058_225_746 173
972 3300039447 Ga0436361_1070910 Ga0436361_1070910_30_551 173
973 3300039450 Ga0436363_0074967 Ga0436363_0074967_82_603 173
974 3300039450 Ga0436363_0545932 Ga0436363_0545932_118_639 173
975 3300039450 Ga0436363_0627696 Ga0436363_0627696_5414_5935 173
976 3300039450 Ga0436363_0676392 Ga0436363_0676392_2404_2925 173
977 3300039450 Ga0436363_0732988 Ga0436363_0732988_29_550 173
978 3300039450 Ga0436363_0989127 Ga0436363_0989127_334_855 173
979 3300039450 Ga0436363_1432928 Ga0436363_1432928_108_629 173
980 3300039453 Ga0436362_0042707 Ga0436362_0042707_64_585 173
981 3300039453 Ga0436362_0080939 Ga0436362_0080939_49_570 173
982 3300039453 Ga0436362_0150515 Ga0436362_0150515_56_577 173
983 3300039453 Ga0436362_0306467 Ga0436362_0306467_471_992 173
984 3300039453 Ga0436362_0708969 Ga0436362_0708969_1943_2464 173
985 3300039453 Ga0436362_0785080 Ga0436362_0785080_51_572 173
986 3300039453 Ga0436362_0872615 Ga0436362_0872615_1096_1617 173
987 3300039453 Ga0436362_1013764 Ga0436362_1013764_111_632 173
988 3300041443 Ga0451789_0352119 Ga0451789_0352119_20_541 173
989 3300041460 Ga0451802_1133852 Ga0451802_1133852_143_664 173
990 3300041460 Ga0451802_1973824 Ga0451802_1973824_136_657 173
991 3300041461 Ga0451805_065324 Ga0451805_065324_49_570 173
992 3300041491 Ga0451833_0037273 Ga0451833_0037273_1388_1909 173
993 3300041494 Ga0451837_1082767 Ga0451837_1082767_491_1012 173
994 3300041496 Ga0451839_1032745 Ga0451839_1032745_18_539 173
995 3300041503 Ga0451847_0347266 Ga0451847_0347266_301_822 173
996 3300041505 Ga0451849_1511113 Ga0451849_1511113_81_602 173
997 3300041512 Ga0451853_0867433 Ga0451853_0867433_22_543 173
998 3300041512 Ga0451853_2250389 Ga0451853_2250389_348_869 173
999 3300041512 Ga0451853_2281280 Ga0451853_2281280_19_540 173
1000 3300041512 Ga0451853_2975849 Ga0451853_2975849_135_659 173
1001 3300042005 Ga0439448_0028541 Ga0439448_0028541_732_1253 173
1002 3300042011 Ga0439454_016321 Ga0439454_016321_305_826 173
1003 3300042016 Ga0439463_070705 Ga0439463_070705_298_819 173
1004 3300042120 Ga0450917_003657 Ga0450917_003657_542_1063 173
1005 3300042156 Ga0439446_0245051 Ga0439446_0245051_52_573 173
1006 3300042157 Ga0439458_0081323 Ga0439458_0081323_102_623 173
1007 3300042438 Ga0439459_0012694 Ga0439459_0012694_193_714 173
1008 3300042438 Ga0439459_0162681 Ga0439459_0162681_18_539 173
1009 3300042993 Ga0439440_0034182 Ga0439440_0034182_103_624 173
1010 3300044656 Ga0466969_0036435 Ga0466969_0036435_1218_1739 173
1011 3300044656 Ga0466969_0073210 Ga0466969_0073210_213_734 173
1012 3300044658 Ga0466972_0061896 Ga0466972_0061896_864_1385 173
1013 3300044683 Ga0466965_0204056 Ga0466965_0204056_183_704 173
1014 3300044684 Ga0466966_0023720 Ga0466966_0023720_1678_2199 173
1015 3300044684 Ga0466966_0118848 Ga0466966_0118848_224_745 173
1016 3300044684 Ga0466966_0133761 Ga0466966_0133761_902_1423 173
1017 3300044684 Ga0466966_0161683 Ga0466966_0161683_147_668 173
1018 3300044684 Ga0466966_0282218 Ga0466966_0282218_288_809 173
1019 3300044684 Ga0466966_0307169 Ga0466966_0307169_93_614 173
1020 3300044693 Ga0466961_0003639 Ga0466961_0003639_2055_2576 173
1021 3300044693 Ga0466961_0033037 Ga0466961_0033037_1854_2375 173
1022 3300044693 Ga0466961_0038935 Ga0466961_0038935_2077_2598 173
1023 3300044693 Ga0466961_0119231 Ga0466961_0119231_658_1179 173
1024 3300044693 Ga0466961_0264626 Ga0466961_0264626_511_1032 173
1025 3300044693 Ga0466961_0377469 Ga0466961_0377469_121_642 173
1026 3300044693 Ga0466961_0458547 Ga0466961_0458547_53_574 173
1027 3300044693 Ga0466961_0604665 Ga0466961_0604665_39_560 173
1028 3300044694 Ga0466963_0001627 Ga0466963_0001627_4778_5302 173
1029 3300044694 Ga0466963_0015440 Ga0466963_0015440_1759_2280 173
1030 3300044694 Ga0466963_0020681 Ga0466963_0020681_3411_3932 173
1031 3300044694 Ga0466963_0029245 Ga0466963_0029245_2700_3221 173
1032 3300044694 Ga0466963_0036608 Ga0466963_0036608_1681_2202 173
1033 3300044694 Ga0466963_0302185 Ga0466963_0302185_533_1054 173
1034 3300044694 Ga0466963_0382950 Ga0466963_0382950_212_733 173
1035 3300044694 Ga0466963_0440550 Ga0466963_0440550_181_702 173
1036 3300044694 Ga0466963_0675908 Ga0466963_0675908_62_583 173
1037 3300044706 Ga0466964_0042874 Ga0466964_0042874_289_810 173
1038 3300044706 Ga0466964_0243801 Ga0466964_0243801_343_864 173
1039 3300044719 Ga0466971_0008251 Ga0466971_0008251_2151_2672 173
1040 3300044719 Ga0466971_0013912 Ga0466971_0013912_1938_2459 173
1041 3300044719 Ga0466971_0035443 Ga0466971_0035443_667_1188 173
1042 3300044719 Ga0466971_0056109 Ga0466971_0056109_441_962 173
1043 3300044719 Ga0466971_0084538 Ga0466971_0084538_273_794 173
1044 3300044719 Ga0466971_0245336 Ga0466971_0245336_229_750 173
1045 3300044719 Ga0466971_0354122 Ga0466971_0354122_75_596 173
1046 3300044735 Ga0466968_0015354 Ga0466968_0015354_1230_1751 173
1047 3300044735 Ga0466968_0039733 Ga0466968_0039733_460_981 173
1048 3300044735 Ga0466968_0080927 Ga0466968_0080927_135_656 173
1049 3300044735 Ga0466968_0106982 Ga0466968_0106982_605_1132 173
1050 3300044735 Ga0466968_0263216 Ga0466968_0263216_220_741 173
1051 3300044765 Ga0466970_0041505 Ga0466970_0041505_425_946 173
1052 3300044765 Ga0466970_0172160 Ga0466970_0172160_344_865 173
1053 3300044765 Ga0466970_0227408 Ga0466970_0227408_339_860 173
1054 3300044765 Ga0466970_0597831 Ga0466970_0597831_26_547 173
1055 3300044842 Ga0466957_0007191 Ga0466957_0007191_4735_5256 173
1056 3300044842 Ga0466957_0061370 Ga0466957_0061370_255_776 173
1057 3300044842 Ga0466957_0354022 Ga0466957_0354022_198_719 173
1058 3300044842 Ga0466957_0428596 Ga0466957_0428596_140_661 173
1059 3300044842 Ga0466957_0467800 Ga0466957_0467800_35_556 173
1060 3300044842 Ga0466957_0536966 Ga0466957_0536966_252_773 173
1061 3300044842 Ga0466957_0542711 Ga0466957_0542711_252_773 173
1062 3300044842 Ga0466957_0834617 Ga0466957_0834617_93_614 173
1063 3300044901 Ga0466960_0004643 Ga0466960_0004643_2905_3426 173
1064 3300044901 Ga0466960_0025223 Ga0466960_0025223_2103_2624 173
1065 3300044901 Ga0466960_0039158 Ga0466960_0039158_231_752 173
1066 3300044901 Ga0466960_0163038 Ga0466960_0163038_411_932 173
1067 3300044901 Ga0466960_0770998 Ga0466960_0770998_41_562 173
1068 3300044901 Ga0466960_0806992 Ga0466960_0806992_12_533 173
1069 3300045049 Ga0466959_0001493 Ga0466959_0001493_5266_5787 173
1070 3300045049 Ga0466959_0035180 Ga0466959_0035180_2085_2606 173
1071 3300045049 Ga0466959_0042982 Ga0466959_0042982_2353_2874 173
1072 3300045049 Ga0466959_0062522 Ga0466959_0062522_551_1072 173
1073 3300045049 Ga0466959_0097947 Ga0466959_0097947_265_786 173
1074 3300045049 Ga0466959_0112458 Ga0466959_0112458_667_1188 173
1075 3300045049 Ga0466959_0148873 Ga0466959_0148873_491_1012 173
1076 3300045049 Ga0466959_0176995 Ga0466959_0176995_377_898 173
1077 3300045049 Ga0466959_0216504 Ga0466959_0216504_563_1084 173
1078 3300045049 Ga0466959_0288069 Ga0466959_0288069_156_677 173
1079 3300045049 Ga0466959_0397876 Ga0466959_0397876_211_732 173
1080 3300045049 Ga0466959_0447995 Ga0466959_0447995_88_609 173
1081 3300045049 Ga0466959_0473332 Ga0466959_0473332_108_629 173
1082 3300045049 Ga0466959_0484004 Ga0466959_0484004_160_681 173
1083 3300045049 Ga0466959_0577843 Ga0466959_0577843_192_713 173
1084 3300045836 Ga0466958_0003781 Ga0466958_0003781_6123_6644 173
1085 3300045836 Ga0466958_0013647 Ga0466958_0013647_2852_3373 173
1086 3300045836 Ga0466958_0038178 Ga0466958_0038178_669_1190 173
1087 3300045836 Ga0466958_0051714 Ga0466958_0051714_321_842 173
1088 3300045836 Ga0466958_0053421 Ga0466958_0053421_1691_2212 173
1089 3300045836 Ga0466958_0073140 Ga0466958_0073140_1314_1835 173
1090 3300045836 Ga0466958_0073657 Ga0466958_0073657_1374_1895 173
1091 3300045836 Ga0466958_0078070 Ga0466958_0078070_76_597 173
1092 3300045836 Ga0466958_0096115 Ga0466958_0096115_470_991 173
1093 3300045836 Ga0466958_0156443 Ga0466958_0156443_597_1118 173
1094 3300045836 Ga0466958_0180271 Ga0466958_0180271_807_1328 173
1095 3300045836 Ga0466958_0296187 Ga0466958_0296187_220_741 173
1096 3300045836 Ga0466958_0304484 Ga0466958_0304484_409_930 173
1097 3300045836 Ga0466958_0439622 Ga0466958_0439622_242_763 173
1098 3300045836 Ga0466958_0847933 Ga0466958_0847933_24_545 173
1099 3300045836 Ga0466958_0853695 Ga0466958_0853695_39_560 173
1100 3300045976 Ga0466967_0000003 Ga0466967_0000003_67610_68131 173
1101 3300045976 Ga0466967_0022464 Ga0466967_0022464_3815_4336 173
1102 3300045976 Ga0466967_0039117 Ga0466967_0039117_3106_3627 173
1103 3300045976 Ga0466967_0074773 Ga0466967_0074773_2266_2787 173
1104 3300045976 Ga0466967_0094671 Ga0466967_0094671_1353_1874 173
1105 3300045976 Ga0466967_0125691 Ga0466967_0125691_400_921 173
1106 3300045976 Ga0466967_0226700 Ga0466967_0226700_117_638 173
1107 3300045976 Ga0466967_0309116 Ga0466967_0309116_791_1312 173
1108 3300045976 Ga0466967_0335370 Ga0466967_0335370_219_740 173
1109 3300045976 Ga0466967_0356617 Ga0466967_0356617_597_1118 173
1110 3300045976 Ga0466967_0404473 Ga0466967_0404473_781_1305 173
1111 3300045976 Ga0466967_0605596 Ga0466967_0605596_404_925 173
1112 3300045976 Ga0466967_0663928 Ga0466967_0663928_137_658 173
1113 3300045976 Ga0466967_0718885 Ga0466967_0718885_311_832 173
1114 3300045976 Ga0466967_1102080 Ga0466967_1102080_117_638 173
1115 3300045976 Ga0466967_1223502 Ga0466967_1223502_209_730 173
1116 3300045976 Ga0466967_1282231 Ga0466967_1282231_176_697 173
1117 3300046454 Ga0495592_0003637 Ga0495592_0003637_4996_5520 173
1118 3300046454 Ga0495592_0026155 Ga0495592_0026155_1384_1905 173
1119 3300046454 Ga0495592_0049814 Ga0495592_0049814_125_649 173
1120 3300046454 Ga0495592_0189881 Ga0495592_0189881_266_790 173
1121 3300046454 Ga0495592_0206161 Ga0495592_0206161_19_543 173
1122 3300046454 Ga0495592_0221337 Ga0495592_0221337_83_604 173
1123 3300046454 Ga0495592_0389058 Ga0495592_0389058_211_732 173
1124 3300046455 Ga0495603_0000744 Ga0495603_0000744_8076_8597 173
1125 3300046455 Ga0495603_0002184 Ga0495603_0002184_7544_8068 173
1126 3300046455 Ga0495603_0003928 Ga0495603_0003928_5748_6272 173
1127 3300046455 Ga0495603_0067458 Ga0495603_0067458_555_1076 173
1128 3300046455 Ga0495603_0069459 Ga0495603_0069459_1459_1980 173
1129 3300046458 Ga0495591_082635 Ga0495591_082635_23_547 173
1130 3300046459 Ga0495629_0000091 Ga0495629_0000091_71887_72408 173
1131 3300046459 Ga0495629_0034425 Ga0495629_0034425_2499_3023 173
1132 3300046460 Ga0495638_0017341 Ga0495638_0017341_1172_1693 173
1133 3300046461 Ga0495641_0000400 Ga0495641_0000400_31595_32119 173
1134 3300046461 Ga0495641_0008386 Ga0495641_0008386_3555_4076 173
1135 3300046461 Ga0495641_0010702 Ga0495641_0010702_529_1050 173
1136 3300046461 Ga0495641_0232571 Ga0495641_0232571_249_770 173
1137 3300046462 Ga0495651_0000497 Ga0495651_0000497_6905_7426 173
1138 3300046462 Ga0495651_0034052 Ga0495651_0034052_103_627 173
1139 3300046462 Ga0495651_0138845 Ga0495651_0138845_196_717 173
1140 3300046462 Ga0495651_0435924 Ga0495651_0435924_307_831 173
1141 3300046463 Ga0495653_0119872 Ga0495653_0119872_249_773 173
1142 3300046463 Ga0495653_0132302 Ga0495653_0132302_581_1105 173
1143 3300046463 Ga0495653_0132681 Ga0495653_0132681_192_716 173
1144 3300046463 Ga0495653_0136154 Ga0495653_0136154_11_532 173
1145 3300046463 Ga0495653_0242536 Ga0495653_0242536_409_933 173
1146 3300046471 Ga0495650_0000188 Ga0495650_0000188_14973_15494 173
1147 3300046472 Ga0495580_0094112 Ga0495580_0094112_466_987 173
1148 3300046472 Ga0495580_0386661 Ga0495580_0386661_188_709 173
1149 3300046472 Ga0495580_0500982 Ga0495580_0500982_197_718 173
1150 3300046473 Ga0495582_0000006 Ga0495582_0000006_12193_12717 173
1151 3300046473 Ga0495582_0046569 Ga0495582_0046569_495_1016 173
1152 3300046473 Ga0495582_0513287 Ga0495582_0513287_100_621 173
1153 3300046474 Ga0495605_0121670 Ga0495605_0121670_605_1126 173
1154 3300046475 Ga0495639_0025364 Ga0495639_0025364_931_1455 173
1155 3300046475 Ga0495639_0171256 Ga0495639_0171256_208_729 173
1156 3300046475 Ga0495639_0263081 Ga0495639_0263081_64_588 173
1157 3300046476 Ga0495662_0003307 Ga0495662_0003307_3172_3693 173
1158 3300046476 Ga0495662_0008091 Ga0495662_0008091_2287_2811 173
1159 3300046476 Ga0495662_0220124 Ga0495662_0220124_176_700 173
1160 3300046477 Ga0495664_0106141 Ga0495664_0106141_427_951 173
1161 3300046477 Ga0495664_0272353 Ga0495664_0272353_213_734 173
1162 3300046491 Ga0495584_0241531 Ga0495584_0241531_74_595 173
1163 3300046491 Ga0495584_0313339 Ga0495584_0313339_12_533 173
1164 3300046491 Ga0495584_0327596 Ga0495584_0327596_132_653 173
1165 3300046492 Ga0495585_0314618 Ga0495585_0314618_138_659 173
1166 3300046499 Ga0495594_0000001 Ga0495594_0000001_5339_5860 173
1167 3300046499 Ga0495594_0422241 Ga0495594_0422241_219_740 173
1168 3300046500 Ga0495596_0100336 Ga0495596_0100336_454_975 173
1169 3300046500 Ga0495596_0131698 Ga0495596_0131698_428_949 173
1170 3300046501 Ga0495607_0253618 Ga0495607_0253618_112_633 173
1171 3300046507 Ga0495606_0000283 Ga0495606_0000283_84738_85259 173
1172 3300046511 Ga0495608_0000010 Ga0495608_0000010_216330_216851 173
1173 3300046511 Ga0495608_0000184 Ga0495608_0000184_34207_34731 173
1174 3300046511 Ga0495608_0000564 Ga0495608_0000564_1948_2469 173
1175 3300046511 Ga0495608_0056368 Ga0495608_0056368_1966_2490 173
1176 3300046512 Ga0495610_0193131 Ga0495610_0193131_65_586 173
1177 3300046513 Ga0495616_0130736 Ga0495616_0130736_615_1136 173
1178 3300046514 Ga0495618_0000037 Ga0495618_0000037_9905_10429 173
1179 3300046514 Ga0495618_0412151 Ga0495618_0412151_140_664 173
1180 3300046515 Ga0495620_0000730 Ga0495620_0000730_9326_9850 173
1181 3300046515 Ga0495620_0163560 Ga0495620_0163560_141_662 173
1182 3300046515 Ga0495620_0181769 Ga0495620_0181769_277_798 173
1183 3300046516 Ga0495628_0015314 Ga0495628_0015314_1714_2238 173
1184 3300046516 Ga0495628_0032702 Ga0495628_0032702_1349_1870 173
1185 3300046517 Ga0495630_0000378 Ga0495630_0000378_17017_17538 173
1186 3300046517 Ga0495630_0004380 Ga0495630_0004380_2772_3296 173
1187 3300046517 Ga0495630_0169576 Ga0495630_0169576_820_1341 173
1188 3300046517 Ga0495630_0259155 Ga0495630_0259155_663_1187 173
1189 3300046517 Ga0495630_0376446 Ga0495630_0376446_141_662 173
1190 3300046517 Ga0495630_0756871 Ga0495630_0756871_188_712 173
1191 3300046517 Ga0495630_0863445 Ga0495630_0863445_53_574 173
1192 3300046518 Ga0495631_0048284 Ga0495631_0048284_889_1410 173
1193 3300046518 Ga0495631_0091740 Ga0495631_0091740_478_999 173
1194 3300046519 Ga0495632_0284274 Ga0495632_0284274_198_719 173
1195 3300046522 Ga0495643_0140303 Ga0495643_0140303_44_565 173
1196 3300046523 Ga0495644_0150844 Ga0495644_0150844_244_768 173
1197 3300046525 Ga0495663_0034943 Ga0495663_0034943_412_933 173
1198 3300046525 Ga0495663_0104730 Ga0495663_0104730_401_922 173
1199 3300046525 Ga0495663_0284553 Ga0495663_0284553_10_531 173
1200 3300046526 Ga0495666_0245355 Ga0495666_0245355_63_584 173
1201 3300046528 Ga0495642_0393762 Ga0495642_0393762_19_540 173
1202 3300046529 Ga0495652_0000009 Ga0495652_0000009_255525_256046 173
1203 3300046529 Ga0495652_0008763 Ga0495652_0008763_6794_7318 173
1204 3300046529 Ga0495652_0118252 Ga0495652_0118252_1006_1527 173
1205 3300046531 Ga0495665_0507316 Ga0495665_0507316_36_557 173
1206 3300046533 Ga0495640_0010112 Ga0495640_0010112_6042_6566 173
1207 3300046533 Ga0495640_0044573 Ga0495640_0044573_1020_1541 173
1208 3300046535 Ga0495586_0002482 Ga0495586_0002482_2317_2841 173
1209 3300046536 Ga0495587_0048315 Ga0495587_0048315_1106_1630 173
1210 3300046536 Ga0495587_0068246 Ga0495587_0068246_1437_1961 173
1211 3300046536 Ga0495587_0362367 Ga0495587_0362367_123_644 173
1212 3300046537 Ga0495598_0000130 Ga0495598_0000130_10292_10816 173
1213 3300046538 Ga0495609_0048160 Ga0495609_0048160_173_694 173
1214 3300046539 Ga0495621_0003784 Ga0495621_0003784_457_981 173
1215 3300046539 Ga0495621_0107551 Ga0495621_0107551_249_770 173
1216 3300046539 Ga0495621_0221092 Ga0495621_0221092_222_743 173
1217 3300046542 Ga0495597_0308454 Ga0495597_0308454_17_538 173
1218 3300046543 Ga0495645_0007960 Ga0495645_0007960_3953_4477 173
1219 3300046557 Ga0495622_0000069 Ga0495622_0000069_7853_8374 173
1220 3300046558 Ga0495633_0093797 Ga0495633_0093797_513_1037 173
1221 3300046559 Ga0495667_0000067 Ga0495667_0000067_73346_73867 173
1222 3300046559 Ga0495667_0028867 Ga0495667_0028867_1174_1695 173
1223 3300046559 Ga0495667_0275040 Ga0495667_0275040_355_879 173
1224 3300046559 Ga0495667_0548583 Ga0495667_0548583_63_587 173
1225 3300046559 Ga0495667_0730516 Ga0495667_0730516_68_592 173
1226 3300046615 Ga0495656_0001302 Ga0495656_0001302_3136_3660 173
1227 3300046615 Ga0495656_0074702 Ga0495656_0074702_137_658 173
1228 3300046615 Ga0495656_0079291 Ga0495656_0079291_779_1300 173
1229 3300046615 Ga0495656_0220350 Ga0495656_0220350_277_798 173
1230 3300046616 Ga0495668_0231312 Ga0495668_0231312_55_576 173
1231 3300046616 Ga0495668_0357744 Ga0495668_0357744_242_766 173
1232 3300046642 Ga0495634_0001020 Ga0495634_0001020_2781_3305 173
1233 3300046642 Ga0495634_0058229 Ga0495634_0058229_1594_2118 173
1234 3300046642 Ga0495634_0068451 Ga0495634_0068451_1784_2308 173
1235 3300046642 Ga0495634_0116088 Ga0495634_0116088_25_549 173
1236 3300046642 Ga0495634_0258533 Ga0495634_0258533_434_958 173
1237 3300046660 Ga0495625_0000109 Ga0495625_0000109_109326_109847 173
1238 3300046663 Ga0495635_0000006 Ga0495635_0000006_103759_104283 173
1239 3300046663 Ga0495635_0015170 Ga0495635_0015170_3504_4028 173
1240 3300046663 Ga0495635_0024519 Ga0495635_0024519_1259_1780 173
1241 3300046663 Ga0495635_0079576 Ga0495635_0079576_989_1513 173
1242 3300046663 Ga0495635_0081937 Ga0495635_0081937_734_1258 173
1243 3300046674 Ga0495588_0135324 Ga0495588_0135324_249_770 173
1244 3300046674 Ga0495588_0542005 Ga0495588_0542005_26_547 173
1245 3300046675 Ga0495657_0000005 Ga0495657_0000005_38010_38531 173
1246 3300046675 Ga0495657_0008079 Ga0495657_0008079_496_1020 173
1247 3300046675 Ga0495657_0008679 Ga0495657_0008679_6984_7505 173
1248 3300046678 Ga0495599_0030022 Ga0495599_0030022_2788_3312 173
1249 3300046678 Ga0495599_0042683 Ga0495599_0042683_678_1199 173
1250 3300046679 Ga0495623_0134696 Ga0495623_0134696_204_725 173
1251 3300046680 Ga0495646_0105124 Ga0495646_0105124_574_1095 173
1252 3300046681 Ga0495647_0000010 Ga0495647_0000010_59855_60379 173
1253 3300046681 Ga0495647_0210033 Ga0495647_0210033_273_797 173
1254 3300046681 Ga0495647_0235687 Ga0495647_0235687_172_696 173
1255 3300046683 Ga0495658_0000094 Ga0495658_0000094_34021_34545 173
1256 3300046683 Ga0495658_0294258 Ga0495658_0294258_298_822 173
1257 3300046683 Ga0495658_0299473 Ga0495658_0299473_186_707 173
1258 3300046683 Ga0495658_0308808 Ga0495658_0308808_372_893 173
1259 3300046689 Ga0495613_0000087 Ga0495613_0000087_52752_53273 173
1260 3300046689 Ga0495613_0000329 Ga0495613_0000329_30166_30690 173
1261 3300046689 Ga0495613_0076443 Ga0495613_0076443_175_699 173
1262 3300046690 Ga0495624_0000259 Ga0495624_0000259_7547_8068 173
1263 3300046690 Ga0495624_0000576 Ga0495624_0000576_17930_18454 173
1264 3300046690 Ga0495624_0053030 Ga0495624_0053030_714_1238 173
1265 3300046690 Ga0495624_0656024 Ga0495624_0656024_80_601 173
1266 3300046691 Ga0495670_0122781 Ga0495670_0122781_738_1259 173
1267 3300046691 Ga0495670_0193363 Ga0495670_0193363_19_543 173
1268 3300046691 Ga0495670_0368989 Ga0495670_0368989_97_618 173
1269 3300046692 Ga0495671_0351615 Ga0495671_0351615_165_686 173
1270 3300046694 Ga0495649_0069927 Ga0495649_0069927_187_711 173
1271 3300046694 Ga0495649_0156280 Ga0495649_0156280_290_811 173
1272 3300046694 Ga0495649_0392111 Ga0495649_0392111_159_680 173
1273 3300046794 Ga0495589_0098492 Ga0495589_0098492_27_548 173
1274 3300046794 Ga0495589_0299342 Ga0495589_0299342_211_732 173
1275 3300046794 Ga0495589_0310472 Ga0495589_0310472_143_664 173
1276 3300046794 Ga0495589_0326316 Ga0495589_0326316_148_669 173
1277 3300046809 Ga0495600_0003402 Ga0495600_0003402_3451_3975 173
1278 3300046809 Ga0495600_0017923 Ga0495600_0017923_1292_1813 173
1279 3300046809 Ga0495600_0204674 Ga0495600_0204674_721_1245 173
1280 3300046810 Ga0495660_0119480 Ga0495660_0119480_471_992 173
1281 3300047315 Ga0495581_0026510 Ga0495581_0026510_481_1002 173
1282 3300047315 Ga0495581_0106703 Ga0495581_0106703_348_869 173
1283 3300047315 Ga0495581_0339534 Ga0495581_0339534_22_546 173
1284 3300047315 Ga0495581_0581516 Ga0495581_0581516_33_554 173
1285 3300047317 Ga0495604_0000294 Ga0495604_0000294_41488_42012 173
1286 3300047317 Ga0495604_0000460 Ga0495604_0000460_31465_31986 173
1287 3300047317 Ga0495604_0011664 Ga0495604_0011664_4550_5071 173
1288 3300047317 Ga0495604_0068212 Ga0495604_0068212_1998_2522 173
1289 3300047317 Ga0495604_0249119 Ga0495604_0249119_21_542 173
1290 3300047317 Ga0495604_0552315 Ga0495604_0552315_75_596 173
1291 3300047318 Ga0495636_0237661 Ga0495636_0237661_68_589 173
1292 3300047319 Ga0495674_0000115 Ga0495674_0000115_14022_14543 173
1293 3300047319 Ga0495674_0088536 Ga0495674_0088536_447_968 173
1294 3300047319 Ga0495674_0453826 Ga0495674_0453826_321_842 173
1295 3300047320 Ga0495672_0045216 Ga0495672_0045216_931_1452 173
1296 3300047320 Ga0495672_0148439 Ga0495672_0148439_549_1070 173
1297 3300047320 Ga0495672_0188564 Ga0495672_0188564_261_782 173
1298 3300047321 Ga0495676_0000405 Ga0495676_0000405_32488_33009 173
1299 3300047321 Ga0495676_0003648 Ga0495676_0003648_10364_10888 173
1300 3300047321 Ga0495676_0036586 Ga0495676_0036586_2610_3131 173
1301 3300047321 Ga0495676_0095537 Ga0495676_0095537_686_1207 173
1302 3300047321 Ga0495676_0241321 Ga0495676_0241321_44_565 173
1303 3300047321 Ga0495676_0506358 Ga0495676_0506358_57_578 173
1304 3300047321 Ga0495676_0831824 Ga0495676_0831824_50_571 173
1305 3300047322 Ga0495680_0000336 Ga0495680_0000336_9847_10371 173
1306 3300047322 Ga0495680_0003588 Ga0495680_0003588_7177_7698 173
1307 3300047322 Ga0495680_0005033 Ga0495680_0005033_10705_11226 173
1308 3300047322 Ga0495680_0005621 Ga0495680_0005621_2819_3343 173
1309 3300047322 Ga0495680_0070802 Ga0495680_0070802_1857_2378 173
1310 3300047322 Ga0495680_0357979 Ga0495680_0357979_224_745 173
1311 3300047444 Ga0495675_0000004 Ga0495675_0000004_206384_206905 173
1312 3300047445 Ga0495677_0158529 Ga0495677_0158529_342_863 173
1313 3300047470 Ga0495681_0343793 Ga0495681_0343793_16_537 173
1314 3300047471 Ga0495684_0189733 Ga0495684_0189733_862_1383 173
1315 3300047471 Ga0495684_0918320 Ga0495684_0918320_11_532 173
1316 3300047472 Ga0495686_0079517 Ga0495686_0079517_953_1474 173
1317 3300047472 Ga0495686_0170121 Ga0495686_0170121_531_1052 173
1318 3300047472 Ga0495686_0305462 Ga0495686_0305462_88_609 173
1319 3300047673 Ga0495593_0041904 Ga0495593_0041904_1185_1709 173
1320 3300047673 Ga0495593_0167787 Ga0495593_0167787_416_937 173
1321 3300048088 Ga0495602_0001468 Ga0495602_0001468_17986_18507 173
1322 3300048088 Ga0495602_0018692 Ga0495602_0018692_4841_5362 173
1323 3300048088 Ga0495602_0103437 Ga0495602_0103437_1769_2290 173
1324 3300048088 Ga0495602_0271048 Ga0495602_0271048_209_730 173
1325 3300048088 Ga0495602_0657412 Ga0495602_0657412_103_624 173
1326 3300048091 Ga0495626_0116807 Ga0495626_0116807_59_580 173
1327 3300048903 Ga0496100_0000004 Ga0496100_0000004_285960_286484 173
1328 3300048903 Ga0496100_0000056 Ga0496100_0000056_10243_10764 173
1329 3300048903 Ga0496100_0005784 Ga0496100_0005784_3066_3587 173
1330 3300048903 Ga0496100_0033831 Ga0496100_0033831_1281_1802 173
1331 3300048903 Ga0496100_0733267 Ga0496100_0733267_241_762 173
1332 3300048903 Ga0496100_0771249 Ga0496100_0771249_128_649 173
1333 3300048904 Ga0496101_0000005 Ga0496101_0000005_274144_274665 173
1334 3300048904 Ga0496101_0000007 Ga0496101_0000007_285960_286484 173
1335 3300048904 Ga0496101_0002691 Ga0496101_0002691_4288_4809 173
1336 3300048904 Ga0496101_0002990 Ga0496101_0002990_2351_2872 173
1337 3300048904 Ga0496101_0004434 Ga0496101_0004434_7611_8132 173
1338 3300048904 Ga0496101_0144656 Ga0496101_0144656_483_1004 173
1339 3300048904 Ga0496101_0548829 Ga0496101_0548829_55_576 173
1340 3300048904 Ga0496101_0567771 Ga0496101_0567771_266_787 173
1341 3300048904 Ga0496101_0650387 Ga0496101_0650387_99_620 173
1342 3300048905 Ga0496102_0000021 Ga0496102_0000021_200666_201187 173
1343 3300048905 Ga0496102_0023697 Ga0496102_0023697_2811_3332 173
1344 3300048905 Ga0496102_0025474 Ga0496102_0025474_1855_2376 173
1345 3300048905 Ga0496102_0034667 Ga0496102_0034667_2006_2527 173
1346 3300048905 Ga0496102_0035755 Ga0496102_0035755_3431_3952 173
1347 3300048905 Ga0496102_0053517 Ga0496102_0053517_911_1432 173
1348 3300048905 Ga0496102_0059461 Ga0496102_0059461_908_1429 173
1349 3300048905 Ga0496102_0201315 Ga0496102_0201315_1000_1521 173
1350 3300048905 Ga0496102_0217864 Ga0496102_0217864_1035_1556 173
1351 3300048905 Ga0496102_0259072 Ga0496102_0259072_785_1306 173
1352 3300048905 Ga0496102_0441570 Ga0496102_0441570_491_1012 173
1353 3300048905 Ga0496102_0462427 Ga0496102_0462427_636_1157 173
1354 3300048905 Ga0496102_0545543 Ga0496102_0545543_449_973 173
1355 3300048905 Ga0496102_0581379 Ga0496102_0581379_34_555 173
1356 3300048905 Ga0496102_0666006 Ga0496102_0666006_23_544 173
1357 3300048906 Ga0496103_0000001 Ga0496103_0000001_394720_395241 173
1358 3300048906 Ga0496103_0013036 Ga0496103_0013036_2342_2863 173
1359 3300048906 Ga0496103_0122963 Ga0496103_0122963_303_824 173
1360 3300048906 Ga0496103_0222089 Ga0496103_0222089_620_1141 173
1361 3300048906 Ga0496103_0264922 Ga0496103_0264922_312_836 173
1362 3300048906 Ga0496103_0392541 Ga0496103_0392541_218_739 173
1363 3300048907 Ga0496104_0000007 Ga0496104_0000007_14152_14673 173
1364 3300048907 Ga0496104_0000008 Ga0496104_0000008_511391_511915 173
1365 3300048907 Ga0496104_0000307 Ga0496104_0000307_24013_24534 173
1366 3300048907 Ga0496104_0030956 Ga0496104_0030956_37_558 173
1367 3300048907 Ga0496104_0067190 Ga0496104_0067190_1618_2139 173
1368 3300048907 Ga0496104_0176982 Ga0496104_0176982_364_885 173
1369 3300048907 Ga0496104_0477701 Ga0496104_0477701_59_580 173
1370 3300048908 Ga0496105_0000002 Ga0496105_0000002_217091_217612 173
1371 3300048908 Ga0496105_0000003 Ga0496105_0000003_511391_511915 173
1372 3300048908 Ga0496105_0000070 Ga0496105_0000070_35641_36162 173
1373 3300048908 Ga0496105_0038744 Ga0496105_0038744_2152_2673 173
1374 3300048908 Ga0496105_0048146 Ga0496105_0048146_236_757 173
1375 3300048908 Ga0496105_0204644 Ga0496105_0204644_952_1473 173
1376 3300048908 Ga0496105_0593772 Ga0496105_0593772_244_765 173
1377 3300048908 Ga0496105_1197804 Ga0496105_1197804_24_545 173
1378 3300048909 Ga0496106_0000004 Ga0496106_0000004_247374_247898 173
1379 3300048909 Ga0496106_0000099 Ga0496106_0000099_8203_8724 173
1380 3300048909 Ga0496106_0000446 Ga0496106_0000446_4898_5422 173
1381 3300048909 Ga0496106_0011248 Ga0496106_0011248_6000_6521 173
1382 3300048909 Ga0496106_0061201 Ga0496106_0061201_1770_2291 173
1383 3300048909 Ga0496106_0100122 Ga0496106_0100122_46_567 173
1384 3300048909 Ga0496106_0143507 Ga0496106_0143507_1068_1589 173
1385 3300048909 Ga0496106_0379963 Ga0496106_0379963_463_984 173
1386 3300048909 Ga0496106_0605167 Ga0496106_0605167_255_776 173
1387 3300048910 Ga0496107_0000001 Ga0496107_0000001_285960_286484 173
1388 3300048910 Ga0496107_0000004 Ga0496107_0000004_274361_274882 173
1389 3300048910 Ga0496107_0008595 Ga0496107_0008595_4741_5262 173
1390 3300048910 Ga0496107_0029766 Ga0496107_0029766_40_561 173
1391 3300048910 Ga0496107_0076994 Ga0496107_0076994_1194_1715 173
1392 3300048910 Ga0496107_0167809 Ga0496107_0167809_996_1517 173
1393 3300048910 Ga0496107_0214825 Ga0496107_0214825_420_941 173
1394 3300048910 Ga0496107_0423424 Ga0496107_0423424_183_704 173
1395 3300048910 Ga0496107_0569402 Ga0496107_0569402_30_554 173
1396 3300048910 Ga0496107_1040197 Ga0496107_1040197_57_578 173
1397 3300048911 Ga0496108_0000004 Ga0496108_0000004_44221_44745 173
1398 3300048911 Ga0496108_0001764 Ga0496108_0001764_11001_11522 173
1399 3300048911 Ga0496108_0007661 Ga0496108_0007661_2800_3324 173
1400 3300048911 Ga0496108_0022549 Ga0496108_0022549_2727_3248 173
1401 3300048911 Ga0496108_0068405 Ga0496108_0068405_1317_1838 173
1402 3300048911 Ga0496108_0072629 Ga0496108_0072629_2142_2663 173
1403 3300048911 Ga0496108_0078136 Ga0496108_0078136_177_698 173
1404 3300048911 Ga0496108_0397186 Ga0496108_0397186_263_784 173
1405 3300048911 Ga0496108_0460348 Ga0496108_0460348_525_1046 173
1406 3300048911 Ga0496108_0492087 Ga0496108_0492087_22_543 173
1407 3300048911 Ga0496108_0612431 Ga0496108_0612431_129_650 173
1408 3300048911 Ga0496108_0638648 Ga0496108_0638648_373_894 173
1409 3300048912 Ga0496109_0000036 Ga0496109_0000036_109228_109752 173
1410 3300048912 Ga0496109_0000062 Ga0496109_0000062_67444_67965 173
1411 3300048912 Ga0496109_0000081 Ga0496109_0000081_74864_75385 173
1412 3300048912 Ga0496109_0001426 Ga0496109_0001426_18543_19067 173
1413 3300048912 Ga0496109_0007548 Ga0496109_0007548_165_686 173
1414 3300048912 Ga0496109_0029920 Ga0496109_0029920_1311_1832 173
1415 3300048912 Ga0496109_0042469 Ga0496109_0042469_720_1241 173
1416 3300048912 Ga0496109_0042974 Ga0496109_0042974_3535_4056 173
1417 3300048912 Ga0496109_0048970 Ga0496109_0048970_69_590 173
1418 3300048912 Ga0496109_0088745 Ga0496109_0088745_1848_2369 173
1419 3300048912 Ga0496109_0141955 Ga0496109_0141955_1108_1629 173
1420 3300048912 Ga0496109_0144134 Ga0496109_0144134_1377_1898 173
1421 3300048912 Ga0496109_0379874 Ga0496109_0379874_609_1130 173
1422 3300048912 Ga0496109_0686349 Ga0496109_0686349_430_951 173
1423 3300048912 Ga0496109_0693729 Ga0496109_0693729_213_734 173
1424 3300048912 Ga0496109_0752392 Ga0496109_0752392_276_797 173
1425 3300048913 Ga0496110_0005253 Ga0496110_0005253_5978_6502 173
1426 3300048913 Ga0496110_0025910 Ga0496110_0025910_2496_3017 173
1427 3300048913 Ga0496110_0027349 Ga0496110_0027349_2401_2922 173
1428 3300048913 Ga0496110_0030606 Ga0496110_0030606_3805_4326 173
1429 3300048913 Ga0496110_0051197 Ga0496110_0051197_517_1041 173
1430 3300048913 Ga0496110_0056256 Ga0496110_0056256_318_839 173
1431 3300048913 Ga0496110_0065198 Ga0496110_0065198_882_1403 173
1432 3300048913 Ga0496110_0078356 Ga0496110_0078356_884_1405 173
1433 3300048913 Ga0496110_0082247 Ga0496110_0082247_2096_2617 173
1434 3300048913 Ga0496110_0225864 Ga0496110_0225864_627_1148 173
1435 3300048913 Ga0496110_0331477 Ga0496110_0331477_43_564 173
1436 3300048913 Ga0496110_0335009 Ga0496110_0335009_85_606 173
1437 3300048913 Ga0496110_0696896 Ga0496110_0696896_111_632 173
1438 3300048913 Ga0496110_0765691 Ga0496110_0765691_17_538 173
1439 3300048914 Ga0496111_0000013 Ga0496111_0000013_7179_7700 173
1440 3300048914 Ga0496111_0007431 Ga0496111_0007431_5475_5996 173
1441 3300048914 Ga0496111_0010466 Ga0496111_0010466_1496_2017 173
1442 3300048914 Ga0496111_0011719 Ga0496111_0011719_2030_2551 173
1443 3300048914 Ga0496111_0056259 Ga0496111_0056259_983_1504 173
1444 3300048914 Ga0496111_0056339 Ga0496111_0056339_452_976 173
1445 3300048914 Ga0496111_0105485 Ga0496111_0105485_112_633 173
1446 3300048914 Ga0496111_0371183 Ga0496111_0371183_167_688 173
1447 3300048914 Ga0496111_0621043 Ga0496111_0621043_223_744 173
1448 3300048915 Ga0496112_0000002 Ga0496112_0000002_252589_253113 173
1449 3300048915 Ga0496112_0008410 Ga0496112_0008410_6637_7158 173
1450 3300048915 Ga0496112_0022659 Ga0496112_0022659_5390_5911 173
1451 3300048915 Ga0496112_0052822 Ga0496112_0052822_2807_3328 173
1452 3300048915 Ga0496112_0129411 Ga0496112_0129411_1618_2139 173
1453 3300048915 Ga0496112_0146080 Ga0496112_0146080_948_1469 173
1454 3300048915 Ga0496112_0157546 Ga0496112_0157546_1184_1705 173
1455 3300048915 Ga0496112_0411782 Ga0496112_0411782_244_765 173
1456 3300048915 Ga0496112_0458832 Ga0496112_0458832_482_1003 173
1457 3300048915 Ga0496112_1039697 Ga0496112_1039697_191_715 173
1458 3300048916 Ga0496113_0005015 Ga0496113_0005015_2118_2639 173
1459 3300048916 Ga0496113_0011837 Ga0496113_0011837_4478_5002 173
1460 3300048916 Ga0496113_0017170 Ga0496113_0017170_4138_4659 173
1461 3300048916 Ga0496113_0046403 Ga0496113_0046403_744_1268 173
1462 3300048916 Ga0496113_0046981 Ga0496113_0046981_2013_2534 173
1463 3300048916 Ga0496113_0173068 Ga0496113_0173068_216_740 173
1464 3300048916 Ga0496113_0259437 Ga0496113_0259437_549_1070 173
1465 3300048916 Ga0496113_0559875 Ga0496113_0559875_140_667 173
1466 3300048916 Ga0496113_0928980 Ga0496113_0928980_126_647 173
1467 3300048917 Ga0496114_0000097 Ga0496114_0000097_3791_4312 173
1468 3300048917 Ga0496114_0016423 Ga0496114_0016423_1962_2483 173
1469 3300048917 Ga0496114_0056702 Ga0496114_0056702_1895_2416 173
1470 3300048917 Ga0496114_0465265 Ga0496114_0465265_323_844 173
1471 3300048917 Ga0496114_1575319 Ga0496114_1575319_11_532 173
1472 3300048918 Ga0496115_0000005 Ga0496115_0000005_154627_155148 173
1473 3300048918 Ga0496115_0000151 Ga0496115_0000151_4899_5420 173
1474 3300048918 Ga0496115_0028068 Ga0496115_0028068_3564_4085 173
1475 3300048918 Ga0496115_0041838 Ga0496115_0041838_3085_3606 173
1476 3300048918 Ga0496115_0384718 Ga0496115_0384718_492_1013 173
1477 3300048918 Ga0496115_0802195 Ga0496115_0802195_172_693 173
1478 3300048922 Ga0496119_0002837 Ga0496119_0002837_17590_18111 173
1479 3300048922 Ga0496119_0145181 Ga0496119_0145181_215_736 173
1480 3300048923 Ga0496120_0309135 Ga0496120_0309135_156_677 173
1481 3300048924 Ga0496121_0001679 Ga0496121_0001679_28570_29091 173
1482 3300048924 Ga0496121_0131489 Ga0496121_0131489_749_1270 173
1483 3300048924 Ga0496121_0222872 Ga0496121_0222872_141_662 173
1484 3300048927 Ga0496124_0030161 Ga0496124_0030161_673_1194 173
1485 3300048927 Ga0496124_0114998 Ga0496124_0114998_558_1079 173
1486 3300048928 Ga0496125_0107993 Ga0496125_0107993_1036_1560 173
1487 3300049127 Ga0501306_036201 Ga0501306_036201_135_656 173
1488 3300049161 Ga0501305_021748 Ga0501305_021748_387_908 173
1489 3300049532 Ga0501316_027908 Ga0501316_027908_149_670 173
1490 3300049539 Ga0501323_027561 Ga0501323_027561_67_588 173
1491 3300049549 Ga0501333_013089 Ga0501333_013089_80_601 173
1492 3300049568 Ga0501031_0015090 Ga0501031_0015090_1445_1966 173
1493 3300049568 Ga0501031_0352908 Ga0501031_0352908_389_910 173
1494 3300049569 Ga0501032_0008313 Ga0501032_0008313_6329_6850 173
1495 3300049570 Ga0501033_0020432 Ga0501033_0020432_2665_3186 173
1496 3300049571 Ga0501034_0197643 Ga0501034_0197643_1360_1881 173
1497 3300049571 Ga0501034_0313295 Ga0501034_0313295_139_660 173
1498 3300049572 Ga0501036_0014315 Ga0501036_0014315_2071_2592 173
1499 3300049572 Ga0501036_0327194 Ga0501036_0327194_725_1246 173
1500 3300049572 Ga0501036_1237899 Ga0501036_1237899_29_550 173
1501 3300049573 Ga0501037_0026869 Ga0501037_0026869_1092_1613 173
1502 3300049574 Ga0501038_0003011 Ga0501038_0003011_12341_12862 173
1503 3300049574 Ga0501038_0388258 Ga0501038_0388258_482_1003 173
1504 3300049574 Ga0501038_1138217 Ga0501038_1138217_23_544 173
1505 3300049575 Ga0501039_0026339 Ga0501039_0026339_2338_2859 173
1506 3300049575 Ga0501039_0032104 Ga0501039_0032104_2463_2984 173
1507 3300049575 Ga0501039_0190871 Ga0501039_0190871_875_1399 173
1508 3300049575 Ga0501039_0380475 Ga0501039_0380475_313_837 173
1509 3300049575 Ga0501039_0415179 Ga0501039_0415179_221_742 173
1510 3300049575 Ga0501039_0593008 Ga0501039_0593008_252_773 173
1511 3300049575 Ga0501039_0792081 Ga0501039_0792081_31_552 173
1512 3300049576 Ga0501040_0117916 Ga0501040_0117916_243_764 173
1513 3300049576 Ga0501040_0560640 Ga0501040_0560640_230_751 173
1514 3300049576 Ga0501040_0942949 Ga0501040_0942949_37_558 173
1515 3300049578 Ga0501042_0132505 Ga0501042_0132505_1248_1772 173
1516 3300049579 Ga0501043_0011801 Ga0501043_0011801_681_1202 173
1517 3300049580 Ga0501046_0076175 Ga0501046_0076175_1753_2274 173
1518 3300049580 Ga0501046_0674221 Ga0501046_0674221_191_712 173
1519 3300049580 Ga0501046_1011150 Ga0501046_1011150_31_555 173
1520 3300049581 Ga0501047_0338849 Ga0501047_0338849_198_719 173
1521 3300049582 Ga0501048_0008605 Ga0501048_0008605_5043_5564 173
1522 3300049582 Ga0501048_0239366 Ga0501048_0239366_94_615 173
1523 3300049582 Ga0501048_0263663 Ga0501048_0263663_486_1007 173
1524 3300049583 Ga0501067_0051717 Ga0501067_0051717_808_1329 173
1525 3300049583 Ga0501067_0250955 Ga0501067_0250955_359_880 173
1526 3300049583 Ga0501067_0287982 Ga0501067_0287982_99_620 173
1527 3300049584 Ga0501068_0053877 Ga0501068_0053877_863_1384 173
1528 3300049585 Ga0501069_0111577 Ga0501069_0111577_81_602 173
1529 3300049586 Ga0501070_0067934 Ga0501070_0067934_198_719 173
1530 3300049586 Ga0501070_0262016 Ga0501070_0262016_68_589 173
1531 3300049586 Ga0501070_1135276 Ga0501070_1135276_58_579 173
1532 3300049587 Ga0501071_0080921 Ga0501071_0080921_1643_2164 173
1533 3300049587 Ga0501071_0149899 Ga0501071_0149899_326_847 173
1534 3300049587 Ga0501071_0471460 Ga0501071_0471460_64_585 173
1535 3300049587 Ga0501071_0631589 Ga0501071_0631589_271_792 173
1536 3300049587 Ga0501071_0830234 Ga0501071_0830234_94_615 173
1537 3300049587 Ga0501071_1097281 Ga0501071_1097281_45_569 173
1538 3300049587 Ga0501071_1101627 Ga0501071_1101627_17_538 173
1539 3300049587 Ga0501071_1218399 Ga0501071_1218399_40_561 173
1540 3300049588 Ga0501072_0030488 Ga0501072_0030488_2223_2744 173
1541 3300049588 Ga0501072_0121295 Ga0501072_0121295_246_767 173
1542 3300049588 Ga0501072_0121706 Ga0501072_0121706_51_572 173
1543 3300049588 Ga0501072_1239257 Ga0501072_1239257_38_559 173
1544 3300049589 Ga0501073_0003341 Ga0501073_0003341_1839_2360 173
1545 3300049590 Ga0501074_0021626 Ga0501074_0021626_2240_2761 173
1546 3300049590 Ga0501074_0889087 Ga0501074_0889087_74_598 173
1547 3300049590 Ga0501074_1032652 Ga0501074_1032652_45_566 173
1548 3300049591 Ga0501075_0002918 Ga0501075_0002918_5798_6322 173
1549 3300049591 Ga0501075_0135998 Ga0501075_0135998_1300_1821 173
1550 3300049591 Ga0501075_0222026 Ga0501075_0222026_896_1417 173
1551 3300049591 Ga0501075_0310350 Ga0501075_0310350_29_550 173
1552 3300049591 Ga0501075_0346006 Ga0501075_0346006_112_633 173
1553 3300049592 Ga0501076_0211765 Ga0501076_0211765_161_682 173
1554 3300049592 Ga0501076_0221083 Ga0501076_0221083_857_1378 173
1555 3300049592 Ga0501076_0652572 Ga0501076_0652572_47_568 173
1556 3300049652 Ga0501202_048696 Ga0501202_048696_395_916 173
1557 3300049741 Ga0501079_0140478 Ga0501079_0140478_1215_1736 173
1558 3300049742 Ga0501080_0009784 Ga0501080_0009784_4176_4697 173
1559 3300049742 Ga0501080_0740409 Ga0501080_0740409_18_539 173
1560 3300049742 Ga0501080_0769568 Ga0501080_0769568_228_749 173
1561 3300049743 Ga0501081_0067501 Ga0501081_0067501_1284_1805 173
1562 3300049743 Ga0501081_0316803 Ga0501081_0316803_188_709 173
1563 3300049743 Ga0501081_0704336 Ga0501081_0704336_77_598 173
1564 3300049744 Ga0501083_0035442 Ga0501083_0035442_757_1278 173
1565 3300049768 Ga0501271_023026 Ga0501271_023026_43_564 173
1566 3300049775 Ga0501279_066755 Ga0501279_066755_27_548 173
1567 3300049822 Ga0501035_0028326 Ga0501035_0028326_1538_2059 173
1568 3300049823 Ga0501044_0197385 Ga0501044_0197385_495_1016 173
1569 3300049824 Ga0501045_0177439 Ga0501045_0177439_124_645 173
1570 3300049824 Ga0501045_0229471 Ga0501045_0229471_649_1170 173
1571 3300049824 Ga0501045_0351247 Ga0501045_0351247_272_793 173
1572 3300049824 Ga0501045_0377504 Ga0501045_0377504_301_822 173
1573 3300049824 Ga0501045_0387686 Ga0501045_0387686_265_786 173
1574 3300049824 Ga0501045_0725964 Ga0501045_0725964_118_642 173
1575 3300049851 Ga0501212_048057 Ga0501212_048057_170_691 173
1576 3300050490 nmdc:mga03n38_311334_c1 nmdc:mga03n38_311334_c1_159_683 173
1577 3300050490 nmdc:mga03n38_393255_c1 nmdc:mga03n38_393255_c1_216_737 173
1578 3300050491 nmdc:mga00v17_28304_c1 nmdc:mga00v17_28304_c1_258_779 173
1579 3300050491 nmdc:mga00v17_40086_c1 nmdc:mga00v17_40086_c1_1290_1811 173
1580 3300050491 nmdc:mga00v17_522877_c1 nmdc:mga00v17_522877_c1_53_577 173
1581 3300050491 nmdc:mga00v17_58083_c1 nmdc:mga00v17_58083_c1_102_623 173
1582 3300050492 nmdc:mga0yw44_108467_c1 nmdc:mga0yw44_108467_c1_20_541 173
1583 3300050492 nmdc:mga0yw44_30865_c1 nmdc:mga0yw44_30865_c1_1305_1826 173
1584 3300050492 nmdc:mga0yw44_31154_c1 nmdc:mga0yw44_31154_c1_190_711 173
1585 3300050492 nmdc:mga0yw44_437561_c1 nmdc:mga0yw44_437561_c1_346_867 173
1586 3300050492 nmdc:mga0yw44_56646_c1 nmdc:mga0yw44_56646_c1_1339_1860 173
1587 3300050492 nmdc:mga0yw44_646909_c1 nmdc:mga0yw44_646909_c1_112_633 173
1588 3300050492 nmdc:mga0yw44_80994_c1 nmdc:mga0yw44_80994_c1_39_560 173
1589 3300050494 nmdc:mga06z11_549858_c1 nmdc:mga06z11_549858_c1_45_566 173
1590 3300050507 nmdc:mga05p37_1046103_c1 nmdc:mga05p37_1046103_c1_198_719 173
1591 3300050507 nmdc:mga05p37_1335450_c1 nmdc:mga05p37_1335450_c1_10_531 173
1592 3300050507 nmdc:mga05p37_1492816_c1 nmdc:mga05p37_1492816_c1_33_554 173
1593 3300050507 nmdc:mga05p37_171058_c1 nmdc:mga05p37_171058_c1_1765_2286 173
1594 3300050507 nmdc:mga05p37_2126_c1 nmdc:mga05p37_2126_c1_3840_4361 173
1595 3300050507 nmdc:mga05p37_215402_c1 nmdc:mga05p37_215402_c1_252_773 173
1596 3300050507 nmdc:mga05p37_229127_c1 nmdc:mga05p37_229127_c1_1458_1979 173
1597 3300050507 nmdc:mga05p37_329197_c1 nmdc:mga05p37_329197_c1_49_570 173
1598 3300050507 nmdc:mga05p37_494716_c1 nmdc:mga05p37_494716_c1_594_1115 173
1599 3300050507 nmdc:mga05p37_803997_c1 nmdc:mga05p37_803997_c1_167_688 173
1600 3300050507 nmdc:mga05p37_871112_c1 nmdc:mga05p37_871112_c1_33_554 173
1601 3300050507 nmdc:mga05p37_916102_c1 nmdc:mga05p37_916102_c1_370_891 173
1602 3300050508 nmdc:mga09592_1040550_c1 nmdc:mga09592_1040550_c1_29_550 173
1603 3300050508 nmdc:mga09592_471723_c1 nmdc:mga09592_471723_c1_309_830 173
1604 3300050508 nmdc:mga09592_659424_c1 nmdc:mga09592_659424_c1_69_590 173
1605 3300050508 nmdc:mga09592_702059_c1 nmdc:mga09592_702059_c1_267_788 173
1606 3300050508 nmdc:mga09592_77107_c1 nmdc:mga09592_77107_c1_988_1509 173
1607 3300050508 nmdc:mga09592_8963_c1 nmdc:mga09592_8963_c1_2666_3187 173
1608 3300050509 nmdc:mga0qj67_283899_c1 nmdc:mga0qj67_283899_c1_271_792 173
1609 3300050509 nmdc:mga0qj67_330662_c1 nmdc:mga0qj67_330662_c1_150_671 173
1610 3300050509 nmdc:mga0qj67_332900_c1 nmdc:mga0qj67_332900_c1_238_759 173
1611 3300050509 nmdc:mga0qj67_37616_c1 nmdc:mga0qj67_37616_c1_2159_2680 173
1612 3300050509 nmdc:mga0qj67_377647_c1 nmdc:mga0qj67_377647_c1_270_791 173
1613 3300050509 nmdc:mga0qj67_3939_c1 nmdc:mga0qj67_3939_c1_7570_8091 173
1614 3300050509 nmdc:mga0qj67_8178_c1 nmdc:mga0qj67_8178_c1_3035_3556 173
1615 3300050510 nmdc:mga06r32_1334885_c1 nmdc:mga06r32_1334885_c1_74_595 173
1616 3300050510 nmdc:mga06r32_13566_c1 nmdc:mga06r32_13566_c1_2487_3008 173
1617 3300050510 nmdc:mga06r32_15290_c1 nmdc:mga06r32_15290_c1_1712_2233 173
1618 3300050510 nmdc:mga06r32_182954_c1 nmdc:mga06r32_182954_c1_1147_1668 173
1619 3300050510 nmdc:mga06r32_368405_c1 nmdc:mga06r32_368405_c1_189_710 173
1620 3300050510 nmdc:mga06r32_577887_c1 nmdc:mga06r32_577887_c1_402_923 173
1621 3300050510 nmdc:mga06r32_581976_c1 nmdc:mga06r32_581976_c1_390_911 173
1622 3300050510 nmdc:mga06r32_61326_c1 nmdc:mga06r32_61326_c1_1908_2429 173
1623 3300050510 nmdc:mga06r32_787322_c1 nmdc:mga06r32_787322_c1_181_702 173
1624 3300050510 nmdc:mga06r32_8713_c1 nmdc:mga06r32_8713_c1_2506_3027 173
1625 3300050511 nmdc:mga08y16_139552_c1 nmdc:mga08y16_139552_c1_1084_1605 173
1626 3300050511 nmdc:mga08y16_276242_c1 nmdc:mga08y16_276242_c1_334_855 173
1627 3300050511 nmdc:mga08y16_3104_c1 nmdc:mga08y16_3104_c1_4961_5482 173
1628 3300050511 nmdc:mga08y16_478802_c1 nmdc:mga08y16_478802_c1_649_1170 173
1629 3300050511 nmdc:mga08y16_713413_c1 nmdc:mga08y16_713413_c1_206_727 173
1630 3300050511 nmdc:mga08y16_77993_c1 nmdc:mga08y16_77993_c1_956_1477 173
1631 3300050511 nmdc:mga08y16_93351_c1 nmdc:mga08y16_93351_c1_198_719 173
1632 3300050512 nmdc:mga0n895_1276281_c1 nmdc:mga0n895_1276281_c1_40_561 173
1633 3300050512 nmdc:mga0n895_17820_c1 nmdc:mga0n895_17820_c1_4390_4911 173
1634 3300050512 nmdc:mga0n895_204100_c1 nmdc:mga0n895_204100_c1_1446_1967 173
1635 3300050512 nmdc:mga0n895_238971_c1 nmdc:mga0n895_238971_c1_1301_1822 173
1636 3300050512 nmdc:mga0n895_276873_c1 nmdc:mga0n895_276873_c1_662_1183 173
1637 3300050512 nmdc:mga0n895_623428_c1 nmdc:mga0n895_623428_c1_167_688 173
1638 3300050512 nmdc:mga0n895_81940_c1 nmdc:mga0n895_81940_c1_303_824 173
1639 3300050512 nmdc:mga0n895_888939_c1 nmdc:mga0n895_888939_c1_314_835 173
1640 3300050513 nmdc:mga0rr50_21531_c1 nmdc:mga0rr50_21531_c1_3836_4357 173
1641 3300050513 nmdc:mga0rr50_323320_c1 nmdc:mga0rr50_323320_c1_293_814 173
1642 3300050513 nmdc:mga0rr50_690140_c1 nmdc:mga0rr50_690140_c1_263_784 173
1643 3300050513 nmdc:mga0rr50_920489_c1 nmdc:mga0rr50_920489_c1_77_598 173
1644 3300050513 nmdc:mga0rr50_990203_c1 nmdc:mga0rr50_990203_c1_43_567 173
1645 3300050514 nmdc:mga08x19_1014915_c1 nmdc:mga08x19_1014915_c1_53_574 173
1646 3300050515 nmdc:mga0a205_15_c2 nmdc:mga0a205_15_c2_46311_46832 173
1647 3300050515 nmdc:mga0a205_1820_c1 nmdc:mga0a205_1820_c1_5184_5708 173
1648 3300050515 nmdc:mga0a205_193239_c1 nmdc:mga0a205_193239_c1_485_1006 173
1649 3300050515 nmdc:mga0a205_321736_c1 nmdc:mga0a205_321736_c1_831_1352 173
1650 3300050515 nmdc:mga0a205_476559_c1 nmdc:mga0a205_476559_c1_539_1063 173
1651 3300050515 nmdc:mga0a205_6623_c1 nmdc:mga0a205_6623_c1_4111_4632 173
1652 3300053077 Ga0495601_0000065 Ga0495601_0000065_27737_28258 173
1653 3300053077 Ga0495601_0061779 Ga0495601_0061779_238_759 173
1654 3300053077 Ga0495601_0528473 Ga0495601_0528473_51_572 173
1655 3300053077 Ga0495601_0699421 Ga0495601_0699421_56_580 173
1656 3300053078 Ga0495612_0000088 Ga0495612_0000088_15354_15878 173
1657 3300053078 Ga0495612_0001833 Ga0495612_0001833_4804_5328 173
1658 3300053078 Ga0495612_0006647 Ga0495612_0006647_2815_3339 173
1659 3300053078 Ga0495612_0017434 Ga0495612_0017434_548_1072 173
1660 3300053078 Ga0495612_0019021 Ga0495612_0019021_283_804 173
1661 3300053078 Ga0495612_0309315 Ga0495612_0309315_64_588 173
1662 3300053083 Ga0495655_0000013 Ga0495655_0000013_57697_58218 173
1663 3300053083 Ga0495655_0010522 Ga0495655_0010522_387_908 173
1664 3300053084 Ga0495595_0000005 Ga0495595_0000005_41810_42331 173
1665 3300053084 Ga0495595_0000732 Ga0495595_0000732_9984_10508 173
1666 3300053084 Ga0495595_0001765 Ga0495595_0001765_4954_5475 173
1667 3300053084 Ga0495595_0155550 Ga0495595_0155550_590_1114 173
1668 3300053084 Ga0495595_0237743 Ga0495595_0237743_167_691 173
1669 3300053085 Ga0495619_0000036 Ga0495619_0000036_60995_61519 173
1670 3300053085 Ga0495619_0000359 Ga0495619_0000359_7563_8087 173
1671 3300053085 Ga0495619_0002279 Ga0495619_0002279_322_846 173
1672 3300053085 Ga0495619_0002287 Ga0495619_0002287_9436_9960 173
1673 3300053085 Ga0495619_0004256 Ga0495619_0004256_6324_6845 173
1674 3300053085 Ga0495619_0007685 Ga0495619_0007685_3957_4478 173
1675 3300053085 Ga0495619_0007898 Ga0495619_0007898_745_1269 173
1676 3300053085 Ga0495619_0022738 Ga0495619_0022738_2751_3275 173
1677 3300053094 Ga0500566_0003122 Ga0500566_0003122_893_1414 173
1678 3300053096 Ga0500641_0005129 Ga0500641_0005129_1592_2113 173
1679 3300053096 Ga0500641_0186833 Ga0500641_0186833_258_779 173
1680 3300053104 Ga0500556_0000495 Ga0500556_0000495_3641_4162 173
1681 3300053123 Ga0500614_001071 Ga0500614_001071_2148_2672 173
1682 3300053129 Ga0500628_000014 Ga0500628_000014_15224_15745 173
1683 3300053153 Ga0500616_0004626 Ga0500616_0004626_3656_4177 173
1684 3300053153 Ga0500616_0005178 Ga0500616_0005178_5052_5573 173
1685 3300053736 Ga0500599_002071 Ga0500599_002071_1575_2096 173
1686 3300054114 Ga0501084_0101235 Ga0501084_0101235_888_1409 173
1687 3300054114 Ga0501084_0306677 Ga0501084_0306677_139_660 173
1688 3300054114 Ga0501084_0653194 Ga0501084_0653194_25_549 173
1689 3300054114 Ga0501084_0982703 Ga0501084_0982703_159_680 173
1690 3300054114 Ga0501084_1127408 Ga0501084_1127408_122_643 173
1691 3300059477 Ga0587084_008888 Ga0587084_008888_337_861 173
1692 3300059490 Ga0587066_068668 Ga0587066_068668_49_573 173
1693 3300059490 Ga0587066_094613 Ga0587066_094613_55_576 173
1694 3300059491 Ga0587070_042821 Ga0587070_042821_309_830 173
1695 3300059492 Ga0587073_0115117 Ga0587073_0115117_86_607 173
1696 3300059492 Ga0587073_0135538 Ga0587073_0135538_39_560 173
1697 3300059492 Ga0587073_0162632 Ga0587073_0162632_84_605 173
1698 3300059493 Ga0587077_099734 Ga0587077_099734_66_590 173
1699 3300059503 Ga0587080_044053 Ga0587080_044053_108_629 173
1700 3300059504 Ga0587082_028119 Ga0587082_028119_395_916 173
1701 3300059504 Ga0587082_061429 Ga0587082_061429_159_680 173
1702 3300059504 Ga0587082_062097 Ga0587082_062097_40_564 173
1703 3300059505 Ga0587083_0060264 Ga0587083_0060264_22_546 173
1704 3300059505 Ga0587083_0102616 Ga0587083_0102616_158_679 173
1705 3300059505 Ga0587083_0121303 Ga0587083_0121303_79_600 173
1706 3300059505 Ga0587083_0150610 Ga0587083_0150610_68_589 173
1707 3300059507 Ga0587086_033993 Ga0587086_033993_195_719 173
1708 3300059508 Ga0587088_112093 Ga0587088_112093_18_539 173
1709 3300059510 Ga0587090_045691 Ga0587090_045691_47_568 173
1710 3300059510 Ga0587090_080143 Ga0587090_080143_15_536 173
1711 3300059511 Ga0587091_032095 Ga0587091_032095_69_590 173
1712 3300059512 Ga0587092_071989 Ga0587092_071989_34_555 173
1713 3300059605 Ga0587106_029297 Ga0587106_029297_68_589 173
1714 3300059607 Ga0587125_018546 Ga0587125_018546_22_543 173
1715 3300059624 Ga0587109_011473 Ga0587109_011473_340_864 173
1716 3300059625 Ga0587113_029010 Ga0587113_029010_37_558 173
1717 3300059626 Ga0587115_044020 Ga0587115_044020_126_647 173
1718 3300059627 Ga0587117_032539 Ga0587117_032539_226_750 173
1719 3300059628 Ga0587122_020071 Ga0587122_020071_72_593 173
1720 3300059628 Ga0587122_026866 Ga0587122_026866_72_593 173
1721 3300059630 Ga0587128_055827 Ga0587128_055827_125_646 173
1722 3300059630 Ga0587128_071473 Ga0587128_071473_59_580 173
1723 3300059640 Ga0587067_076511 Ga0587067_076511_78_599 173
1724 3300059640 Ga0587067_079836 Ga0587067_079836_34_555 173
1725 3300059641 Ga0587068_058914 Ga0587068_058914_169_690 173
1726 3300059642 Ga0587069_062298 Ga0587069_062298_72_593 173
1727 3300059642 Ga0587069_067361 Ga0587069_067361_33_554 173
1728 3300059642 Ga0587069_081142 Ga0587069_081142_87_611 173
1729 3300059645 Ga0587076_023745 Ga0587076_023745_67_588 173
1730 3300059645 Ga0587076_088975 Ga0587076_088975_30_551 173
1731 3300059647 Ga0587079_042245 Ga0587079_042245_101_622 173
1732 3300059647 Ga0587079_111056 Ga0587079_111056_27_551 173
1733 3300059652 Ga0587107_063546 Ga0587107_063546_62_583 173
1734 3300059655 Ga0587114_069078 Ga0587114_069078_80_601 173
1735 3300060344 Ga0587071_066629 Ga0587071_066629_81_602 173
1736 3300060344 Ga0587071_106116 Ga0587071_106116_17_538 173
1737 3300060344 Ga0587071_117575 Ga0587071_117575_16_537 173
1738 3300060344 Ga0587071_159842 Ga0587071_159842_30_551 173
1739 3300060353 Ga0501082_0080177 Ga0501082_0080177_690_1211 173
1740 3300060353 Ga0501082_0217878 Ga0501082_0217878_70_591 173
1741 3300060353 Ga0501082_0596446 Ga0501082_0596446_123_644 173
1742 3300061719 Ga0466962_0009433 Ga0466962_0009433_1520_2041 173
1743 3300061719 Ga0466962_0106538 Ga0466962_0106538_57_578 173
1744 3300061719 Ga0466962_0160722 Ga0466962_0160722_390_911 173
1745 3300061719 Ga0466962_0262425 Ga0466962_0262425_30_551 173
1746 3300061734 Ga0530510_0009610 Ga0530510_0009610_3611_4132 173
1747 3300061734 Ga0530510_0039682 Ga0530510_0039682_2867_3388 173
1748 3300061734 Ga0530510_0216180 Ga0530510_0216180_497_1018 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02357

NusG

Transcription termination factor nusG

2

108

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kvq-assembly1.cif.gz_G solution structure of nuse:nusg-ctd complex 0.9513 120 173
6c6u-assembly1.cif.gz_N cryoem structure of e.coli rna polymerase elongation complex bound with nusg 0.9285 1 108
5xog-assembly1.cif.gz_W rna polymerase ii elongation complex bound with spt5 kow5 and elf1 0.9234 122 170
4ytl-assembly2.cif.gz_B structure of the kow2-kow3 domain of transcription elongation factor spt5. 0.9141 120 173
5xfo-assembly1.cif.gz_A structure of the n-terminal domains of phf1 0.9058 120 172
ID Description Score Start End Superfamily
af_Q10BA7_272_328_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9662 118 173 2.30.30.30
2xhcA03 Mainly Beta;Roll;SH3 type barrels.; 0.9656 119 173 2.30.30.30
af_Q94AA3_277_328_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9628 120 170 2.30.30.30
1m1gC03 Mainly Beta;Roll;SH3 type barrels.; 0.954 119 172 2.30.30.30
2kvqG00 Mainly Beta;Roll;SH3 type barrels.; 0.9513 120 173 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A3R7WK22-F1-model_v4 deleted 1.002 120 173
AF-A0A7V5R2C2-F1-model_v4 KOW domain-containing protein 0.9984 120 173 GO:0032784
AF-A0A4Q6CKU3-F1-model_v4 Transcription termination/antitermination protein NusG 0.9971 119 173 GO:0005829
GO:0006353
GO:0031564
GO:0032784
AF-A0A496U1S5-F1-model_v4 Transcription termination/antitermination factor NusG 0.9957 119 173 GO:0005829
GO:0006353
GO:0031564
GO:0032784
AF-A0A6V8PM87-F1-model_v4 Transcription termination/antitermination protein NusG 0.9915 119 173 GO:0005829
GO:0006353
GO:0031564
GO:0032784

Feature Viewer

pLDDT pTM Quality
85.94 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map