F495336

General Info

Members Datasets Scaffolds Average Seq Length
1687 710 1509 257

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10030614|Ga0157369_100306147
Length 307
Sequence MPAHLLACMRRNASRSWRWLSEQAPQAPRAEPAASNPERPHQRYWQNCKIMALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDQRDLILPIIEAVASQVFIPLTVGGGVRAVEDVRRLLNAGADKISMNSSAVANPQLVKDATDKYGSQCIVVAIDAKRVSADGEPPRWEVFTHGGRKATGLEAVEWARKMAELGAGEILLTSMDRDGTKSGFDLALTRAVSDAVPIPVIASGGVGNLQHLADGIKNGHADAVLAASIFHYGEHTVGEAKRFMAGQGISVRL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
4 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
5 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
6 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
7 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
8 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
9 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
10 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
11 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
12 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
13 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
14 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
15 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
16 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
17 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
18 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
19 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
20 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
21 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
22 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
23 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
24 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
25 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
26 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
27 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
28 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
29 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
30 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
31 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
32 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
33 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
34 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
35 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
36 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
37 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
38 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
39 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
40 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
41 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
42 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
43 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
44 2643221591 Devosia sp. Root685 Isolate Unclassified
45 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
46 2643221660 Methylibium sp. Root1272 Isolate Unclassified
47 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
48 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
49 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
50 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
51 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
52 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
53 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
54 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
55 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
56 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
57 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
58 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
59 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
60 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
61 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
62 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
63 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
64 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
65 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
66 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
67 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
68 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
69 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
70 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
71 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
72 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
73 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
74 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
75 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
76 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
77 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
78 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
79 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
80 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
81 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
82 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
83 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
84 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
85 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
86 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
87 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
88 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
89 2818991450 Burkholderia sp. 604 Isolate Unclassified
90 2818991452 Burkholderia cepacia 561 Isolate Unclassified
91 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
92 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
93 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
94 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
95 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
96 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
97 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
98 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
99 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
100 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
101 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
102 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
103 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
104 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
105 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
106 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
107 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
108 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
109 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
110 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
111 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
112 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
113 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
114 2904564687 Burkholderia sp. 571 Isolate Unclassified
115 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
116 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
117 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
118 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
119 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
120 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
121 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
122 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
123 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
124 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
125 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
126 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
127 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
128 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
129 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
130 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
131 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
132 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
133 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
134 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
135 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
136 2928163908 Burkholderia sp. 567 Isolate Unclassified
137 2928170801 Burkholderia sp. 572 Isolate Unclassified
138 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
139 2928536128 Burkholderia sola 565 Isolate Unclassified
140 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
141 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
142 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
143 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
144 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
145 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
146 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
147 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
148 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
149 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
150 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
151 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
152 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
153 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
154 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
155 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
156 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
157 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
158 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
159 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
160 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
161 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
162 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
163 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
164 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
165 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
166 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
167 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
168 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
169 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
170 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
171 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
172 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
173 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
174 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
175 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
176 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
177 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
178 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
179 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
180 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
181 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
182 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
183 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
184 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
185 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
186 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
187 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
188 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
189 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
190 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
191 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
192 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
193 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
194 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
195 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
196 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
197 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
198 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
199 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
200 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
201 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
202 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
203 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
204 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
205 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
206 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
207 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
208 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
209 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
210 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
211 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
212 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
213 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
214 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
215 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
216 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
217 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
218 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
219 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
220 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
221 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
222 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
223 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
224 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
225 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
226 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
227 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
228 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
229 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
230 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
231 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
232 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
233 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
234 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
235 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
236 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
237 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
238 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
239 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
240 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
241 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
242 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
243 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
244 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
245 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
246 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
247 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
248 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
249 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
250 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
251 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
252 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
253 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
254 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
255 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
256 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
257 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
258 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
259 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
260 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
261 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
262 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
263 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
264 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
265 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
266 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
267 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
268 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
269 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
270 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
271 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
272 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
273 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
274 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
275 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
276 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
277 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
278 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
279 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
280 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
281 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
282 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
283 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
284 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
285 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
286 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
287 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
288 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
289 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
290 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
291 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
292 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
293 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
294 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
295 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
296 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
297 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
298 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
299 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
300 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
301 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
302 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
303 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
304 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
305 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
306 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
313 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
315 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
316 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
319 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
320 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
321 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
323 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
324 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
325 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
326 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
327 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
328 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
387 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
389 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
391 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
392 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
393 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
394 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
398 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
399 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
400 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
401 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
402 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
403 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
404 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
405 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
406 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
407 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
408 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
409 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
410 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
411 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
412 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
413 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
414 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
415 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
416 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
417 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
418 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
419 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
420 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
421 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
422 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
423 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
424 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
425 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
426 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
427 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
428 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
429 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
430 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
431 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
432 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
433 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
434 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
435 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
436 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
437 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
439 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
440 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
441 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
442 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
443 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
444 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
445 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
446 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
447 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
448 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
449 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
450 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
451 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
452 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
453 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
454 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
455 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
456 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
457 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
458 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
459 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
460 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
461 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
462 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
463 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
464 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
465 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
466 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
467 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
468 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
469 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
470 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
471 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
472 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
473 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
474 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
475 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
476 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
477 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
478 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
479 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
480 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
481 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
482 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
483 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
484 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
485 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
486 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
487 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
488 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
489 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
490 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
491 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
492 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
493 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
494 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
495 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
496 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
497 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
498 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
499 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
500 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
501 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
502 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
503 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
504 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
505 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
506 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
507 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
508 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
509 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
510 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
511 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
512 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
513 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
514 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
515 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
516 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
517 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
518 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
519 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
520 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
521 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
522 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
523 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
524 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
525 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
526 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
527 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
528 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
529 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
530 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
531 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
532 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
533 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
534 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
535 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
536 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
537 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
538 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
539 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
540 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
541 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
542 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
543 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
544 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
545 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
546 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
547 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
548 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
549 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
550 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
551 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
552 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
553 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
554 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
555 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
556 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
557 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
558 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
559 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
560 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
561 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
562 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
563 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
564 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
565 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
566 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
567 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
568 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
569 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
570 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
571 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
572 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
573 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
574 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
575 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
576 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
577 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
578 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
579 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
580 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
581 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
582 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
583 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
584 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
585 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
586 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
587 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
588 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
589 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
590 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
591 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
592 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
593 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
594 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
595 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
596 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
597 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
598 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
599 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
600 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
601 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
602 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
603 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
604 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
605 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
606 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
607 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
608 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
609 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
610 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
611 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
612 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
613 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
614 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
615 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
616 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
617 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
618 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
619 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
620 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
621 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
622 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
623 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
624 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
625 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
626 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
627 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
628 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
629 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
630 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
631 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
632 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
633 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
634 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
635 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
636 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
637 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
638 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
639 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
640 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
641 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
642 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
643 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
644 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
645 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
646 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
647 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
648 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
649 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
650 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
651 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
652 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
653 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
654 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
655 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
656 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
657 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
658 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
659 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
660 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
661 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
662 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
663 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
664 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
665 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
666 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
667 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
668 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
669 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
670 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
671 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
672 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
673 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
674 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
675 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
676 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
677 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
678 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
679 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
680 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
681 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
682 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
683 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
684 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
685 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
686 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
687 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
688 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
689 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
690 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
691 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
692 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
693 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
694 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
695 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
696 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
697 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
698 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
699 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
700 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
701 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
702 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
703 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
704 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
705 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
706 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
707 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
708 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
709 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
710 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.92
Metatranscriptomes 0.53
Isolates 10.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 5.81
Nodule 0.95
Rhizoplane 5.45
Rhizosphere 77.77
Stem 0
Stem Tuber 0
Unclassified 9.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1951000 2162886007 Bacteria 2738
2 JGI24736J21556_1007916 3300001904 Bacteria 1776
3 JGI24740J21852_10000985 3300001979 Bacteria 12731
4 JGI24740J21852_10008500 3300001979 Bacteria 4089
5 JGI24739J22299_10011896 3300001989 Bacteria 3203
6 JGI24735J21928_10000566 3300002067 Bacteria 12974
7 JGI24735J21928_10001570 3300002067 Bacteria 8103
8 JGI24735J21928_10004545 3300002067 Bacteria 4663
9 JGI24735J21928_10004725 3300002067 Bacteria 4546
10 JGI24735J21928_10013067 3300002067 Bacteria 2616
11 JGI24738J21930_10002006 3300002075 Bacteria 5470
12 JGI25156J39149_1007606 3300002705 Bacteria 2823
13 JGI25156J39149_1015378 3300002705 Bacteria 1532
14 JGI25406J46586_10009582 3300003203 Bacteria 4333
15 JGI25165J46597_1000794 3300003214 Bacteria 23941
16 JGI25160J50197_1000146 3300003354 Bacteria 63378
17 JGI25160J50197_1042858 3300003354 Bacteria 1025
18 Ga0055538_1000038 3300003751 Bacteria 186588
19 Ga0055538_1000115 3300003751 Bacteria 61470
20 Ga0055539_1000049 3300003752 Bacteria 186588
21 Ga0055539_1000162 3300003752 Bacteria 61470
22 Ga0055533_1000060 3300003756 Bacteria 186588
23 Ga0055533_1000164 3300003756 Bacteria 61470
24 Ga0055533_1000476 3300003756 Bacteria 15060
25 Ga0055532_1000092 3300003758 Bacteria 103243
26 Ga0055532_1000153 3300003758 Bacteria 61470
27 Ga0055525_1000068 3300003759 Bacteria 186588
28 Ga0055525_1000224 3300003759 Bacteria 61470
29 Ga0055527_1000035 3300003760 Bacteria 138481
30 Ga0055527_1000754 3300003760 Bacteria 9044
31 Ga0055535_1000050 3300003761 Bacteria 138481
32 Ga0055542_1000120 3300003762 Bacteria 103243
33 Ga0055542_1006002 3300003762 Bacteria 2654
34 Ga0055542_1006397 3300003762 Bacteria 2522
35 Ga0055529_1000089 3300003763 Bacteria 138481
36 Ga0055529_1002076 3300003763 Bacteria 4325
37 Ga0055528_1003212 3300003790 Bacteria 8351
38 Ga0055541_1000036 3300003841 Bacteria 186588
39 Ga0055541_1000107 3300003841 Bacteria 61470
40 Ga0058692_1002418 3300003856 Bacteria 6253
41 Ga0065165_1000648 3300005262 Bacteria 50260
42 Ga0065714_10012015 3300005288 Bacteria 2667
43 Ga0065712_10068411 3300005290 Bacteria 10856
44 Ga0065712_10087084 3300005290 Bacteria 2594
45 Ga0065707_10003041 3300005295 Bacteria 7882
46 Ga0070658_10004543 3300005327 Bacteria 11280
47 Ga0070658_10004734 3300005327 Bacteria 11068
48 Ga0070658_10016121 3300005327 Bacteria 5977
49 Ga0070658_10030943 3300005327 Bacteria 4299
50 Ga0070658_10065021 3300005327 Bacteria 2976
51 Ga0070683_100001760 3300005329 Bacteria 16847
52 Ga0070683_100067502 3300005329 Bacteria 3331
53 Ga0070683_100178539 3300005329 Bacteria 2015
54 Ga0070690_100003073 3300005330 Bacteria 9074
55 Ga0070690_100082320 3300005330 Bacteria 2107
56 Ga0070670_100004565 3300005331 Bacteria 11615
57 Ga0070670_100012109 3300005331 Bacteria 7376
58 Ga0070677_10091714 3300005333 Bacteria 1323
59 Ga0070666_10027412 3300005335 Bacteria 3732
60 Ga0070666_10030868 3300005335 Bacteria 3534
61 Ga0070680_100378244 3300005336 Bacteria 1205
62 Ga0070682_100042623 3300005337 Bacteria 2803
63 Ga0070682_100126100 3300005337 Bacteria 1726
64 Ga0070682_100198046 3300005337 Bacteria 1415
65 Ga0070682_100201650 3300005337 Bacteria 1404
66 Ga0068868_100355321 3300005338 Bacteria 1256
67 Ga0070660_100000025 3300005339 Bacteria 90277
68 Ga0070660_100000555 3300005339 Bacteria 25061
69 Ga0070660_100241946 3300005339 Bacteria 1470
70 Ga0070689_100000017 3300005340 Bacteria 158871
71 Ga0070689_100036969 3300005340 Bacteria 3735
72 Ga0070689_100039277 3300005340 Bacteria 3623
73 Ga0070687_100002682 3300005343 Bacteria 6731
74 Ga0070661_100004487 3300005344 Bacteria 9623
75 Ga0070661_100083767 3300005344 Bacteria 2356
76 Ga0070692_10030730 3300005345 Bacteria 2687
77 Ga0070692_10331746 3300005345 Bacteria 939
78 Ga0070669_100001095 3300005353 Bacteria 19842
79 Ga0070669_100043163 3300005353 Bacteria 3283
80 Ga0070671_100326186 3300005355 Bacteria 1308
81 Ga0070674_100009439 3300005356 Bacteria 5842
82 Ga0070674_100017948 3300005356 Bacteria 4462
83 Ga0070674_100142516 3300005356 Bacteria 1800
84 Ga0070674_100239156 3300005356 Bacteria 1421
85 Ga0070674_100374530 3300005356 Bacteria 1157
86 Ga0070673_100000620 3300005364 Bacteria 19450
87 Ga0070673_100022396 3300005364 Bacteria 4598
88 Ga0070673_100521336 3300005364 Bacteria 1077
89 Ga0070688_100010556 3300005365 Bacteria 5099
90 Ga0070659_100000264 3300005366 Bacteria 41481
91 Ga0070659_100231168 3300005366 Bacteria 1528
92 Ga0070659_100543731 3300005366 Bacteria 994
93 Ga0070667_100082688 3300005367 Bacteria 2750
94 Ga0070703_10071547 3300005406 Bacteria 1160
95 Ga0070709_10067503 3300005434 Bacteria 2296
96 Ga0070714_100239131 3300005435 Bacteria 1675
97 Ga0070714_100869380 3300005435 Bacteria 875
98 Ga0070713_100063796 3300005436 Bacteria 3090
99 Ga0070713_100338234 3300005436 Bacteria 1394
100 Ga0070711_100015814 3300005439 Bacteria 4779
101 Ga0070711_100504944 3300005439 Bacteria 998
102 Ga0070708_100000301 3300005445 Bacteria 37024
103 Ga0070708_100009986 3300005445 Bacteria 7679
104 Ga0070708_100058087 3300005445 Bacteria 3446
105 Ga0070708_100207972 3300005445 Bacteria 1833
106 Ga0070708_100553667 3300005445 Bacteria 1085
107 Ga0070708_100627710 3300005445 Bacteria 1013
108 Ga0070663_100000091 3300005455 Bacteria 40975
109 Ga0070663_100030019 3300005455 Bacteria 3721
110 Ga0070663_100133146 3300005455 Bacteria 1890
111 Ga0070662_100000855 3300005457 Bacteria 18716
112 Ga0070681_10006771 3300005458 Bacteria 11155
113 Ga0070681_10022668 3300005458 Bacteria 6308
114 Ga0070681_10079056 3300005458 Bacteria 3246
115 Ga0070681_10133753 3300005458 Bacteria 2411
116 Ga0068867_100005433 3300005459 Bacteria 9017
117 Ga0068867_100043008 3300005459 Bacteria 3306
118 Ga0070685_10173695 3300005466 Bacteria 1382
119 Ga0070706_100000675 3300005467 Bacteria 38685
120 Ga0070706_100001950 3300005467 Bacteria 21262
121 Ga0070706_100126979 3300005467 Bacteria 2379
122 Ga0070707_100002396 3300005468 Bacteria 17896
123 Ga0070707_100216066 3300005468 Bacteria 1868
124 Ga0070698_100018223 3300005471 Bacteria 7394
125 Ga0070698_100021077 3300005471 Bacteria 6826
126 Ga0070698_100445832 3300005471 Bacteria 1230
127 Ga0070699_100002387 3300005518 Bacteria 16842
128 Ga0070699_100019780 3300005518 Bacteria 5803
129 Ga0070699_100254187 3300005518 Bacteria 1570
130 Ga0070699_100538822 3300005518 Bacteria 1062
131 Ga0070679_100014023 3300005530 Bacteria 7684
132 Ga0070679_100014273 3300005530 Bacteria 7627
133 Ga0070679_100014417 3300005530 Bacteria 7591
134 Ga0070679_100025092 3300005530 Bacteria 5846
135 Ga0070679_100098050 3300005530 Bacteria 2919
136 Ga0070679_100192113 3300005530 Bacteria 2010
137 Ga0070679_100342278 3300005530 Bacteria 1443
138 Ga0070684_100129164 3300005535 Bacteria 2279
139 Ga0070697_100001239 3300005536 Bacteria 19305
140 Ga0070697_100012683 3300005536 Bacteria 6602
141 Ga0070697_100054173 3300005536 Bacteria 3260
142 Ga0068853_100000029 3300005539 Bacteria 121775
143 Ga0068853_100102759 3300005539 Bacteria 2529
144 Ga0068853_100680949 3300005539 Bacteria 980
145 Ga0070672_100021623 3300005543 Bacteria 4711
146 Ga0070672_100079752 3300005543 Bacteria 2621
147 Ga0070672_100110384 3300005543 Bacteria 2241
148 Ga0070686_100001282 3300005544 Bacteria 14217
149 Ga0070695_100015052 3300005545 Bacteria 4668
150 Ga0070696_100082908 3300005546 Bacteria 2273
151 Ga0070665_100042512 3300005548 Bacteria 4568
152 Ga0068855_100027271 3300005563 Bacteria 6834
153 Ga0068855_100028719 3300005563 Bacteria 6655
154 Ga0068855_100051124 3300005563 Bacteria 4868
155 Ga0068855_100056021 3300005563 Bacteria 4627
156 Ga0068855_100216195 3300005563 Bacteria 2151
157 Ga0068855_100398032 3300005563 Bacteria 1509
158 Ga0068855_100756845 3300005563 Bacteria 1035
159 Ga0070664_100011142 3300005564 Bacteria 7293
160 Ga0070664_100052183 3300005564 Bacteria 3463
161 Ga0068857_100053732 3300005577 Bacteria 3573
162 Ga0068857_100058082 3300005577 Bacteria 3435
163 Ga0068857_100081747 3300005577 Bacteria 2885
164 Ga0068854_100001922 3300005578 Bacteria 12666
165 Ga0068856_100079027 3300005614 Bacteria 3262
166 Ga0068856_100101735 3300005614 Bacteria 2866
167 Ga0068856_100143192 3300005614 Bacteria 2398
168 Ga0068856_100398169 3300005614 Bacteria 1397
169 Ga0068852_100020390 3300005616 Bacteria 5272
170 Ga0068852_100190519 3300005616 Bacteria 1935
171 Ga0068852_100270227 3300005616 Bacteria 1636
172 Ga0068859_100018925 3300005617 Bacteria 6918
173 Ga0068859_100103229 3300005617 Bacteria 2909
174 Ga0068866_10116709 3300005718 Bacteria 1498
175 Ga0068866_10234347 3300005718 Bacteria 1115
176 Ga0068851_10000035 3300005834 Bacteria 106588
177 Ga0068851_10038719 3300005834 Bacteria 2393
178 Ga0068863_100214669 3300005841 Bacteria 1853
179 Ga0068863_100429489 3300005841 Bacteria 1295
180 Ga0068858_100021735 3300005842 Bacteria 5994
181 Ga0068858_100035861 3300005842 Bacteria 4599
182 Ga0068858_100226662 3300005842 Bacteria 1771
183 Ga0068860_100115367 3300005843 Bacteria 2569
184 Ga0068862_100262270 3300005844 Bacteria 1578
185 Ga0068862_100550588 3300005844 Bacteria 1101
186 Ga0081455_10222811 3300005937 Bacteria 1396
187 Ga0081540_1006469 3300005983 Bacteria 8524
188 Ga0081540_1018894 3300005983 Bacteria 4210
189 Ga0081539_10001498 3300005985 Bacteria 39469
190 Ga0070717_10089874 3300006028 Bacteria 2591
191 Ga0070717_10200561 3300006028 Bacteria 1747
192 Ga0070717_10327078 3300006028 Bacteria 1367
193 Ga0075363_100064189 3300006048 Bacteria 1983
194 Ga0075364_10296513 3300006051 Bacteria 1100
195 Ga0070716_100055301 3300006173 Bacteria 2270
196 Ga0070716_100157463 3300006173 Bacteria 1468
197 Ga0070716_100215352 3300006173 Bacteria 1286
198 Ga0075367_10027238 3300006178 Bacteria 3250
199 Ga0075367_10073286 3300006178 Bacteria 2063
200 Ga0075367_10075508 3300006178 Bacteria 2033
201 Ga0075366_10040495 3300006195 Bacteria 2756
202 Ga0075366_10258459 3300006195 Bacteria 1063
203 Ga0097621_100015272 3300006237 Bacteria 5774
204 Ga0097621_100265574 3300006237 Bacteria 1507
205 Ga0075370_10107977 3300006353 Bacteria 1614
206 Ga0075370_10222138 3300006353 Bacteria 1117
207 Ga0068871_100531551 3300006358 Bacteria 1063
208 Ga0075428_100386262 3300006844 Bacteria 1501
209 Ga0075430_100037292 3300006846 Bacteria 4121
210 Ga0075430_100069476 3300006846 Bacteria 2955
211 Ga0075430_100160725 3300006846 Bacteria 1870
212 Ga0075431_100000766 3300006847 Bacteria 27825
213 Ga0075431_100024177 3300006847 Bacteria 6221
214 Ga0075431_100047007 3300006847 Bacteria 4450
215 Ga0075431_100150816 3300006847 Bacteria 2393
216 Ga0075431_100274545 3300006847 Bacteria 1707
217 Ga0075433_10442273 3300006852 Bacteria 1146
218 Ga0075434_100008839 3300006871 Bacteria 9374
219 Ga0075434_100094551 3300006871 Bacteria 2994
220 Ga0075434_100297456 3300006871 Bacteria 1634
221 Ga0075429_100042397 3300006880 Bacteria 3960
222 Ga0075429_100046650 3300006880 Bacteria 3770
223 Ga0075429_100108275 3300006880 Bacteria 2429
224 Ga0068865_100000463 3300006881 Bacteria 22698
225 Ga0075436_100199569 3300006914 Bacteria 1417
226 Ga0097620_100018925 3300006931 Bacteria 6918
227 Ga0097620_100103222 3300006931 Bacteria 2909
228 Ga0075435_100157349 3300007076 Bacteria 1912
229 Ga0099794_10010321 3300007265 Bacteria 3961
230 Ga0099795_10014037 3300007788 Bacteria 2473
231 Ga0105251_10000009 3300009011 Bacteria 192384
232 Ga0105251_10000781 3300009011 Bacteria 28894
233 Ga0105251_10004276 3300009011 Bacteria 9817
234 Ga0105251_10004471 3300009011 Bacteria 9497
235 Ga0105251_10006725 3300009011 Bacteria 7257
236 Ga0105251_10027875 3300009011 Bacteria 2858
237 Ga0105251_10039795 3300009011 Bacteria 2294
238 Ga0105244_10011664 3300009036 Bacteria 5248
239 Ga0105244_10012264 3300009036 Bacteria 5075
240 Ga0105244_10015770 3300009036 Bacteria 4325
241 Ga0105244_10031576 3300009036 Bacteria 2810
242 Ga0105244_10049313 3300009036 Bacteria 2152
243 Ga0105250_10001470 3300009092 Bacteria 12739
244 Ga0105250_10002368 3300009092 Bacteria 9521
245 Ga0105250_10002788 3300009092 Bacteria 8571
246 Ga0105250_10020938 3300009092 Bacteria 2640
247 Ga0105250_10029714 3300009092 Bacteria 2199
248 Ga0105240_10001157 3300009093 Bacteria 46192
249 Ga0105240_10055159 3300009093 Bacteria 4977
250 Ga0105240_10058928 3300009093 Bacteria 4793
251 Ga0105240_10090508 3300009093 Bacteria 3739
252 Ga0105240_10103759 3300009093 Bacteria 3453
253 Ga0105240_10148476 3300009093 Bacteria 2794
254 Ga0105240_10616615 3300009093 Bacteria 1193
255 Ga0111539_10013445 3300009094 Bacteria 10230
256 Ga0111539_10020447 3300009094 Bacteria 8152
257 Ga0111539_10083256 3300009094 Bacteria 3762
258 Ga0111539_10203392 3300009094 Bacteria 2309
259 Ga0111539_10526935 3300009094 Bacteria 1376
260 Ga0105245_10199064 3300009098 Bacteria 1923
261 Ga0105245_10850295 3300009098 Bacteria 952
262 Ga0105247_10316444 3300009101 Bacteria 1087
263 Ga0114129_10212920 3300009147 Bacteria 2611
264 Ga0114129_10572092 3300009147 Bacteria 1467
265 Ga0114129_10940148 3300009147 Bacteria 1093
266 Ga0105243_10040823 3300009148 Bacteria 3626
267 Ga0105243_10084814 3300009148 Bacteria 2595
268 Ga0105243_10145723 3300009148 Bacteria 2026
269 Ga0105241_10682856 3300009174 Bacteria 936
270 Ga0105242_10000465 3300009176 Bacteria 32243
271 Ga0105248_10013830 3300009177 Bacteria 8880
272 Ga0105248_10047554 3300009177 Bacteria 4812
273 Ga0105248_10095787 3300009177 Bacteria 3341
274 Ga0105248_10408521 3300009177 Bacteria 1529
275 Ga0105237_10003215 3300009545 Bacteria 19566
276 Ga0105237_10004566 3300009545 Bacteria 15986
277 Ga0105237_10258586 3300009545 Bacteria 1744
278 Ga0105238_10000037 3300009551 Bacteria 163954
279 Ga0105238_10001318 3300009551 Bacteria 24876
280 Ga0105238_10003778 3300009551 Bacteria 15045
281 Ga0105238_10004242 3300009551 Bacteria 14244
282 Ga0105238_10064293 3300009551 Bacteria 3669
283 Ga0105238_10155824 3300009551 Bacteria 2259
284 Ga0105238_10250065 3300009551 Bacteria 1751
285 Ga0105249_10032517 3300009553 Bacteria 4720
286 Ga0105249_10181359 3300009553 Bacteria 2049
287 Ga0105249_10216673 3300009553 Bacteria 1882
288 Ga0105239_10003694 3300010375 Bacteria 18647
289 Ga0105239_10003869 3300010375 Bacteria 18166
290 Ga0105239_10008689 3300010375 Bacteria 11501
291 Ga0105239_10039665 3300010375 Bacteria 5159
292 Ga0105239_10131957 3300010375 Bacteria 2779
293 Ga0105239_10682159 3300010375 Bacteria 1174
294 Ga0105246_10014482 3300011119 Bacteria 4961
295 Ga0157371_10017064 3300013102 Bacteria 5401
296 Ga0157371_10074427 3300013102 Bacteria 2405
297 Ga0157370_10000390 3300013104 Bacteria 55059
298 Ga0157370_10000560 3300013104 Bacteria 46440
299 Ga0157370_10029498 3300013104 Bacteria 5381
300 Ga0157370_10052390 3300013104 Bacteria 3896
301 Ga0157369_10000147 3300013105 Bacteria 100084
302 Ga0157369_10000872 3300013105 Bacteria 38509
303 Ga0157369_10002777 3300013105 Bacteria 20906
304 Ga0157369_10003810 3300013105 Bacteria 17909
305 Ga0157369_10029479 3300013105 Bacteria 6063
306 Ga0157369_10030614 3300013105 Bacteria 5934
307 Ga0157369_10124862 3300013105 Bacteria 2730
308 Ga0157369_10602500 3300013105 Bacteria 1134
309 Ga0157374_10000251 3300013296 Bacteria 49614
310 Ga0157374_10012779 3300013296 Bacteria 7315
311 Ga0157374_10182419 3300013296 Bacteria 2051
312 Ga0157374_10201408 3300013296 Bacteria 1949
313 Ga0157378_10037095 3300013297 Bacteria 4316
314 Ga0157378_10114219 3300013297 Bacteria 2480
315 Ga0163162_10232003 3300013306 Bacteria 1976
316 Ga0157372_10000323 3300013307 Bacteria 52602
317 Ga0157375_10011856 3300013308 Bacteria 7711
318 Ga0157375_10057467 3300013308 Bacteria 3846
319 Ga0163163_10009138 3300014325 Bacteria 8833
320 Ga0163163_10051441 3300014325 Bacteria 4063
321 Ga0182008_10020191 3300014497 Bacteria 3432
322 Ga0182008_10061566 3300014497 Bacteria 1850
323 Ga0182008_10126410 3300014497 Bacteria 1273
324 Ga0157379_10030536 3300014968 Bacteria 4797
325 Ga0157376_10041971 3300014969 Bacteria 3748
326 Ga0157376_10293828 3300014969 Bacteria 1535
327 Ga0182006_1004523 3300015261 Bacteria 6847
328 Ga0182007_10000932 3300015262 Bacteria 16098
329 Ga0182007_10025299 3300015262 Bacteria 2069
330 Ga0182007_10042080 3300015262 Bacteria 1521
331 Ga0182005_1005113 3300015265 Bacteria 4134
332 Ga0183361_10015 3300016635 Bacteria 166772
333 Ga0163161_10055657 3300017792 Bacteria 2872
334 Ga0206356_11626400 3300020070 Bacteria 5245
335 Ga0206356_11640873 3300020070 Bacteria 1603
336 Ga0206354_10295002 3300020081 Bacteria 6820
337 Ga0206353_10258239 3300020082 Bacteria 1846
338 Ga0206353_10332135 3300020082 Bacteria 974
339 Ga0206353_10944309 3300020082 Bacteria 5042
340 Ga0206353_11407798 3300020082 Bacteria 1142
341 Ga0213873_10041970 3300021358 Bacteria 1181
342 Ga0213872_10001084 3300021361 Bacteria 18723
343 Ga0213872_10011215 3300021361 Bacteria 4244
344 Ga0213872_10091915 3300021361 Bacteria 1358
345 Ga0213872_10114800 3300021361 Bacteria 1194
346 Ga0213876_10065273 3300021384 Bacteria 1921
347 Ga0213876_10102796 3300021384 Bacteria 1515
348 Ga0213875_10026941 3300021388 Bacteria 2734
349 Ga0224712_10000002 3300022467 Bacteria 45137
350 Ga0209435_102153 3300025206 Bacteria 2347
351 Ga0209784_100021 3300025224 Bacteria 408534
352 Ga0209784_100087 3300025224 Bacteria 122062
353 Ga0209566_100039 3300025225 Bacteria 303368
354 Ga0209566_100106 3300025225 Bacteria 122062
355 Ga0209566_101146 3300025225 Bacteria 9967
356 Ga0209674_100036 3300025226 Bacteria 408534
357 Ga0209674_100128 3300025226 Bacteria 122062
358 Ga0209674_100153 3300025226 Bacteria 94333
359 Ga0209674_100296 3300025226 Bacteria 34844
360 Ga0209672_100054 3300025228 Bacteria 222217
361 Ga0209672_100072 3300025228 Bacteria 167942
362 Ga0209672_100073 3300025228 Bacteria 166621
363 Ga0209672_100570 3300025228 Bacteria 19598
364 Ga0209147_100085 3300025229 Bacteria 185813
365 Ga0209147_100093 3300025229 Bacteria 167196
366 Ga0209147_100100 3300025229 Bacteria 162747
367 Ga0209147_100129 3300025229 Bacteria 122062
368 Ga0209563_100040 3300025230 Bacteria 408534
369 Ga0209563_100122 3300025230 Bacteria 122062
370 Ga0207427_103353 3300025231 Bacteria 3432
371 Ga0209258_100140 3300025242 Bacteria 167245
372 Ga0209258_100168 3300025242 Bacteria 145329
373 Ga0209258_100352 3300025242 Bacteria 64206
374 Ga0209258_100397 3300025242 Bacteria 54750
375 Ga0209646_1000310 3300025246 Bacteria 38640
376 Ga0209026_1004124 3300025250 Bacteria 4465
377 Ga0209677_100023 3300025253 Bacteria 408534
378 Ga0209677_100078 3300025253 Bacteria 122062
379 Ga0209148_1000119 3300025254 Bacteria 188079
380 Ga0209148_1000140 3300025254 Bacteria 166819
381 Ga0209148_1004328 3300025254 Bacteria 3528
382 Ga0209759_1000281 3300025256 Bacteria 71594
383 Ga0209759_1000329 3300025256 Bacteria 62253
384 Ga0209759_1000362 3300025256 Bacteria 58080
385 Ga0209759_1004329 3300025256 Bacteria 5341
386 Ga0209759_1005092 3300025256 Bacteria 4697
387 Ga0209759_1014467 3300025256 Bacteria 2086
388 Ga0209759_1025149 3300025256 Bacteria 1273
389 Ga0209233_1000173 3300025261 Bacteria 145995
390 Ga0209565_1009798 3300025263 Bacteria 2405
391 Ga0209455_1000125 3300025272 Bacteria 166819
392 Ga0209455_1000217 3300025272 Bacteria 80610
393 Ga0209673_1000098 3300025273 Bacteria 193352
394 Ga0209130_1011394 3300025284 Bacteria 2383
395 Ga0209675_1004204 3300025291 Bacteria 6504
396 Ga0209025_1000853 3300025294 Bacteria 48270
397 Ga0209564_1017081 3300025295 Bacteria 2850
398 Ga0207426_1000199 3300025302 Bacteria 145826
399 Ga0207426_1002772 3300025302 Bacteria 10553
400 Ga0207656_10000008 3300025321 Bacteria 275365
401 Ga0207696_1000020 3300025711 Bacteria 434998
402 Ga0207696_1000084 3300025711 Bacteria 196086
403 Ga0207696_1025259 3300025711 Bacteria 1855
404 Ga0207655_1000495 3300025728 Bacteria 50771
405 Ga0207655_1052827 3300025728 Bacteria 1631
406 Ga0207713_1000032 3300025735 Bacteria 276465
407 Ga0207713_1000186 3300025735 Bacteria 87336
408 Ga0207713_1001816 3300025735 Bacteria 16301
409 Ga0207713_1002540 3300025735 Bacteria 13201
410 Ga0207713_1010399 3300025735 Bacteria 5150
411 Ga0207713_1036728 3300025735 Bacteria 2098
412 Ga0207653_10090442 3300025885 Bacteria 1071
413 Ga0207682_10016787 3300025893 Bacteria 2857
414 Ga0207692_10095192 3300025898 Bacteria 1623
415 Ga0207688_10270571 3300025901 Bacteria 1033
416 Ga0207680_10101560 3300025903 Bacteria 1849
417 Ga0207647_10000126 3300025904 Bacteria 59628
418 Ga0207647_10010761 3300025904 Bacteria 6442
419 Ga0207647_10062309 3300025904 Bacteria 2273
420 Ga0207685_10004056 3300025905 Bacteria 3662
421 Ga0207699_10204695 3300025906 Bacteria 1339
422 Ga0207645_10002491 3300025907 Bacteria 14450
423 Ga0207705_10006000 3300025909 Bacteria 9043
424 Ga0207705_10011142 3300025909 Bacteria 6517
425 Ga0207705_10019586 3300025909 Bacteria 4838
426 Ga0207705_10057687 3300025909 Bacteria 2800
427 Ga0207705_10120295 3300025909 Bacteria 1948
428 Ga0207705_10218594 3300025909 Bacteria 1447
429 Ga0207684_10018222 3300025910 Bacteria 6014
430 Ga0207684_10019787 3300025910 Bacteria 5757
431 Ga0207684_10029562 3300025910 Bacteria 4665
432 Ga0207684_10236181 3300025910 Bacteria 1577
433 Ga0207707_10011890 3300025912 Bacteria 7572
434 Ga0207707_10014353 3300025912 Bacteria 6899
435 Ga0207707_10065293 3300025912 Bacteria 3170
436 Ga0207695_10001836 3300025913 Bacteria 33328
437 Ga0207695_10004822 3300025913 Bacteria 18234
438 Ga0207695_10016358 3300025913 Bacteria 8681
439 Ga0207695_10022014 3300025913 Bacteria 7255
440 Ga0207695_10030027 3300025913 Bacteria 5993
441 Ga0207695_10109628 3300025913 Bacteria 2742
442 Ga0207695_10112231 3300025913 Bacteria 2704
443 Ga0207671_10000015 3300025914 Bacteria 439607
444 Ga0207671_10000351 3300025914 Bacteria 66364
445 Ga0207671_10029655 3300025914 Bacteria 4084
446 Ga0207671_10084561 3300025914 Bacteria 2383
447 Ga0207671_10097780 3300025914 Bacteria 2220
448 Ga0207671_10358813 3300025914 Bacteria 1156
449 Ga0207693_10010921 3300025915 Bacteria 7362
450 Ga0207693_10064340 3300025915 Bacteria 2873
451 Ga0207693_10108597 3300025915 Bacteria 2176
452 Ga0207693_10307327 3300025915 Bacteria 1242
453 Ga0207663_10115737 3300025916 Bacteria 1827
454 Ga0207662_10005509 3300025918 Bacteria 6758
455 Ga0207662_10038480 3300025918 Bacteria 2803
456 Ga0207662_10091271 3300025918 Bacteria 1874
457 Ga0207657_10000065 3300025919 Bacteria 98751
458 Ga0207657_10001751 3300025919 Bacteria 23419
459 Ga0207649_10000001 3300025920 Bacteria 537851
460 Ga0207652_10000514 3300025921 Bacteria 39197
461 Ga0207652_10006010 3300025921 Bacteria 9824
462 Ga0207646_10002645 3300025922 Bacteria 21032
463 Ga0207646_10010060 3300025922 Bacteria 9273
464 Ga0207646_10030001 3300025922 Bacteria 4936
465 Ga0207646_10118367 3300025922 Bacteria 2380
466 Ga0207646_10283317 3300025922 Bacteria 1498
467 Ga0207646_10551624 3300025922 Bacteria 1036
468 Ga0207681_10001783 3300025923 Bacteria 13821
469 Ga0207681_10016535 3300025923 Bacteria 4616
470 Ga0207694_10000054 3300025924 Bacteria 152124
471 Ga0207694_10016623 3300025924 Bacteria 5558
472 Ga0207694_10017087 3300025924 Bacteria 5481
473 Ga0207694_10030031 3300025924 Bacteria 4150
474 Ga0207694_10056136 3300025924 Bacteria 3058
475 Ga0207694_10146909 3300025924 Bacteria 1898
476 Ga0207694_10163751 3300025924 Bacteria 1798
477 Ga0207650_10000186 3300025925 Bacteria 72380
478 Ga0207650_10000741 3300025925 Bacteria 25168
479 Ga0207650_10006857 3300025925 Bacteria 7767
480 Ga0207659_10030526 3300025926 Bacteria 3684
481 Ga0207700_10093859 3300025928 Bacteria 2376
482 Ga0207700_10177607 3300025928 Bacteria 1780
483 Ga0207664_10070679 3300025929 Bacteria 2810
484 Ga0207664_10175704 3300025929 Bacteria 1836
485 Ga0207664_10203833 3300025929 Bacteria 1708
486 Ga0207664_10616399 3300025929 Bacteria 975
487 Ga0207690_10000040 3300025932 Bacteria 130300
488 Ga0207690_10283960 3300025932 Bacteria 1290
489 Ga0207690_10315813 3300025932 Bacteria 1227
490 Ga0207706_10000081 3300025933 Bacteria 98791
491 Ga0207706_10132919 3300025933 Bacteria 2188
492 Ga0207706_10201166 3300025933 Bacteria 1747
493 Ga0207706_10226294 3300025933 Bacteria 1637
494 Ga0207686_10012980 3300025934 Bacteria 4597
495 Ga0207686_10019792 3300025934 Bacteria 3835
496 Ga0207709_10075656 3300025935 Bacteria 2152
497 Ga0207709_10092553 3300025935 Bacteria 1980
498 Ga0207670_10000017 3300025936 Bacteria 158856
499 Ga0207670_10004256 3300025936 Bacteria 7680
500 Ga0207670_10114254 3300025936 Bacteria 1951
501 Ga0207669_10284058 3300025937 Bacteria 1250
502 Ga0207669_10285816 3300025937 Bacteria 1246
503 Ga0207704_10033009 3300025938 Bacteria 2938
504 Ga0207704_10331162 3300025938 Bacteria 1178
505 Ga0207665_10011235 3300025939 Bacteria 5875
506 Ga0207665_10141468 3300025939 Bacteria 1716
507 Ga0207665_10173570 3300025939 Bacteria 1558
508 Ga0207665_10319162 3300025939 Bacteria 1165
509 Ga0207665_10362970 3300025939 Bacteria 1096
510 Ga0207665_10492875 3300025939 Bacteria 946
511 Ga0207691_10149091 3300025940 Bacteria 2057
512 Ga0207691_10182104 3300025940 Bacteria 1835
513 Ga0207691_10410815 3300025940 Bacteria 1154
514 Ga0207711_10011206 3300025941 Bacteria 7451
515 Ga0207711_10262959 3300025941 Bacteria 1586
516 Ga0207661_10003719 3300025944 Bacteria 10634
517 Ga0207661_10260714 3300025944 Bacteria 1544
518 Ga0207679_10000009 3300025945 Bacteria 357262
519 Ga0207679_10153200 3300025945 Bacteria 1879
520 Ga0207667_10000043 3300025949 Bacteria 261426
521 Ga0207667_10008425 3300025949 Bacteria 12250
522 Ga0207667_10010182 3300025949 Bacteria 11012
523 Ga0207667_10021698 3300025949 Bacteria 7115
524 Ga0207651_10009202 3300025960 Bacteria 5388
525 Ga0207651_10045649 3300025960 Bacteria 2940
526 Ga0207712_10290394 3300025961 Bacteria 1338
527 Ga0207712_10366796 3300025961 Bacteria 1201
528 Ga0207712_10789112 3300025961 Bacteria 834
529 Ga0207668_10034688 3300025972 Bacteria 3352
530 Ga0207640_10047283 3300025981 Bacteria 2774
531 Ga0207677_10008799 3300026023 Bacteria 5657
532 Ga0207677_10115507 3300026023 Bacteria 2008
533 Ga0207703_10086473 3300026035 Bacteria 2626
534 Ga0207703_10243596 3300026035 Bacteria 1617
535 Ga0207639_10000090 3300026041 Bacteria 76134
536 Ga0207639_10001959 3300026041 Bacteria 13826
537 Ga0207678_10002149 3300026067 Bacteria 17846
538 Ga0207678_10038889 3300026067 Bacteria 4130
539 Ga0207678_10049586 3300026067 Bacteria 3628
540 Ga0207678_10264295 3300026067 Bacteria 1475
541 Ga0207641_10146083 3300026088 Bacteria 2138
542 Ga0207641_10526722 3300026088 Bacteria 1150
543 Ga0207648_10008005 3300026089 Bacteria 10305
544 Ga0207648_10042868 3300026089 Bacteria 3973
545 Ga0207648_10056307 3300026089 Bacteria 3432
546 Ga0207648_10246171 3300026089 Bacteria 1593
547 Ga0207674_10137634 3300026116 Bacteria 2403
548 Ga0207674_10137814 3300026116 Bacteria 2401
549 Ga0207674_10141753 3300026116 Bacteria 2363
550 Ga0207674_10158271 3300026116 Bacteria 2220
551 Ga0207674_10213518 3300026116 Bacteria 1878
552 Ga0207674_10317004 3300026116 Bacteria 1508
553 Ga0207674_10788727 3300026116 Bacteria 917
554 Ga0207675_100340995 3300026118 Bacteria 1467
555 Ga0207675_100367975 3300026118 Bacteria 1411
556 Ga0207675_100659210 3300026118 Bacteria 1053
557 Ga0207683_10069976 3300026121 Bacteria 3099
558 Ga0207683_10149860 3300026121 Bacteria 2105
559 Ga0207698_10128635 3300026142 Bacteria 2160
560 Ga0207698_10833454 3300026142 Bacteria 926
561 Ga0209371_1000141 3300027312 Bacteria 118767
562 Ga0209371_1003202 3300027312 Bacteria 8247
563 Ga0209179_1011067 3300027512 Bacteria 1589
564 Ga0209983_1007221 3300027665 Bacteria 2278
565 Ga0209588_1007394 3300027671 Bacteria 3228
566 Ga0209971_1002033 3300027682 Bacteria 4918
567 Ga0209813_10144592 3300027866 Bacteria 847
568 Ga0209974_10001114 3300027876 Bacteria 9526
569 Ga0207428_10021207 3300027907 Bacteria 5503
570 Ga0207428_10026521 3300027907 Bacteria 4837
571 Ga0268266_10069228 3300028379 Bacteria 3057
572 Ga0268266_10078546 3300028379 Bacteria 2872
573 Ga0268266_10079585 3300028379 Bacteria 2854
574 Ga0268265_10115957 3300028380 Bacteria 2197
575 Ga0268265_10270496 3300028380 Bacteria 1515
576 Ga0268264_10020417 3300028381 Bacteria 5414
577 Ga0268264_10124342 3300028381 Bacteria 2277
578 Ga0265337_1012674 3300028556 Bacteria 2856
579 Ga0265318_10000066 3300028577 Bacteria 101380
580 Ga0265318_10000460 3300028577 Bacteria 30388
581 Ga0265318_10085159 3300028577 Bacteria 1165
582 Ga0265323_10014974 3300028653 Bacteria 3056
583 Ga0265323_10069988 3300028653 Bacteria 1201
584 Ga0265323_10094172 3300028653 Unclassified 997
585 Ga0265322_10034269 3300028654 Bacteria 1447
586 Ga0307515_10001873 3300028794 Bacteria 46808
587 Ga0307515_10010443 3300028794 Bacteria 17789
588 Ga0307515_10020861 3300028794 Bacteria 11649
589 Ga0265338_10003131 3300028800 Bacteria 23632
590 Ga0265338_10014668 3300028800 Bacteria 8688
591 Ga0265324_10000134 3300029957 Bacteria 58308
592 Ga0265324_10008346 3300029957 Bacteria 4120
593 Ga0268256_1000205 3300030500 Bacteria 67044
594 Ga0268256_1002888 3300030500 Bacteria 8247
595 Ga0307512_10095322 3300030522 Bacteria 2048
596 Ga0265330_10000221 3300031235 Bacteria 43507
597 Ga0265330_10000713 3300031235 Bacteria 21000
598 Ga0265330_10000949 3300031235 Bacteria 17886
599 Ga0265330_10001677 3300031235 Bacteria 12549
600 Ga0265330_10010021 3300031235 Bacteria 4484
601 Ga0265330_10119838 3300031235 Bacteria 1121
602 Ga0265332_10000177 3300031238 Bacteria 52614
603 Ga0265332_10003497 3300031238 Bacteria 7556
604 Ga0265332_10017861 3300031238 Bacteria 3128
605 Ga0265332_10033961 3300031238 Bacteria 2219
606 Ga0265328_10000273 3300031239 Bacteria 23951
607 Ga0265328_10003483 3300031239 Bacteria 6947
608 Ga0265328_10006586 3300031239 Bacteria 4895
609 Ga0265328_10065585 3300031239 Bacteria 1334
610 Ga0265320_10000060 3300031240 Bacteria 101623
611 Ga0265320_10003883 3300031240 Bacteria 9892
612 Ga0265320_10005658 3300031240 Bacteria 7980
613 Ga0265320_10008484 3300031240 Bacteria 6287
614 Ga0265320_10035342 3300031240 Bacteria 2534
615 Ga0265325_10007036 3300031241 Bacteria 6783
616 Ga0265325_10041411 3300031241 Bacteria 2414
617 Ga0265325_10088440 3300031241 Bacteria 1530
618 Ga0265329_10000004 3300031242 Bacteria 108465
619 Ga0265329_10001182 3300031242 Bacteria 12828
620 Ga0265329_10005020 3300031242 Bacteria 5405
621 Ga0265340_10000043 3300031247 Bacteria 57790
622 Ga0265340_10048960 3300031247 Bacteria 2054
623 Ga0265339_10000010 3300031249 Bacteria 214721
624 Ga0265339_10000982 3300031249 Bacteria 21848
625 Ga0265339_10005541 3300031249 Bacteria 8390
626 Ga0265339_10006031 3300031249 Bacteria 8010
627 Ga0265339_10013410 3300031249 Bacteria 4968
628 Ga0265331_10000124 3300031250 Bacteria 101315
629 Ga0265331_10003155 3300031250 Bacteria 10764
630 Ga0265331_10003933 3300031250 Bacteria 9388
631 Ga0265327_10000027 3300031251 Bacteria 364541
632 Ga0265316_10000046 3300031344 Bacteria 129393
633 Ga0265316_10001763 3300031344 Bacteria 22895
634 Ga0265316_10009372 3300031344 Bacteria 9016
635 Ga0265316_10014604 3300031344 Bacteria 6904
636 Ga0265316_10014941 3300031344 Bacteria 6809
637 Ga0265316_10018469 3300031344 Bacteria 5991
638 Ga0265316_10029799 3300031344 Bacteria 4482
639 Ga0265316_10055719 3300031344 Bacteria 3091
640 Ga0265316_10118095 3300031344 Unclassified 2004
641 Ga0265316_10269487 3300031344 Bacteria 1246
642 Ga0265316_10443151 3300031344 Unclassified 932
643 Ga0307513_10039995 3300031456 Bacteria 5190
644 Ga0307513_10152482 3300031456 Bacteria 2217
645 Ga0307513_10243994 3300031456 Bacteria 1598
646 Ga0307509_10023873 3300031507 Bacteria 6855
647 Ga0307408_100000005 3300031548 Bacteria 529098
648 Ga0307408_100000019 3300031548 Bacteria 344502
649 Ga0265313_10000104 3300031595 Bacteria 85002
650 Ga0265313_10000227 3300031595 Bacteria 60770
651 Ga0265313_10003430 3300031595 Bacteria 12830
652 Ga0265313_10007578 3300031595 Bacteria 7379
653 Ga0265313_10008438 3300031595 Bacteria 6841
654 Ga0265313_10011389 3300031595 Bacteria 5535
655 Ga0265313_10022527 3300031595 Bacteria 3414
656 Ga0265313_10026527 3300031595 Bacteria 3050
657 Ga0265313_10094113 3300031595 Bacteria 1339
658 Ga0307508_10000053 3300031616 Bacteria 128020
659 Ga0316575_10025801 3300031665 Bacteria 2281
660 Ga0316575_10026544 3300031665 Bacteria 2251
661 Ga0316575_10152295 3300031665 Bacteria 954
662 Ga0265314_10000008 3300031711 Bacteria 485166
663 Ga0265314_10000165 3300031711 Bacteria 101034
664 Ga0265314_10002294 3300031711 Bacteria 19784
665 Ga0265314_10002874 3300031711 Bacteria 17106
666 Ga0265314_10004332 3300031711 Bacteria 13234
667 Ga0265314_10046901 3300031711 Bacteria 3045
668 Ga0265314_10049587 3300031711 Bacteria 2938
669 Ga0265314_10052404 3300031711 Bacteria 2836
670 Ga0265314_10126530 3300031711 Bacteria 1599
671 Ga0265342_10000048 3300031712 Bacteria 126158
672 Ga0265342_10000171 3300031712 Bacteria 71706
673 Ga0265342_10000465 3300031712 Bacteria 43891
674 Ga0265342_10000520 3300031712 Bacteria 40945
675 Ga0265342_10001286 3300031712 Bacteria 23595
676 Ga0265342_10006466 3300031712 Bacteria 8725
677 Ga0265342_10036144 3300031712 Bacteria 3019
678 Ga0265342_10055814 3300031712 Bacteria 2343
679 Ga0265342_10074140 3300031712 Bacteria 1978
680 Ga0316576_10087596 3300031727 Bacteria 2317
681 Ga0316576_10119682 3300031727 Bacteria 1976
682 Ga0316578_10030993 3300031728 Bacteria 3044
683 Ga0316578_10179638 3300031728 Bacteria 1275
684 Ga0307516_10005097 3300031730 Bacteria 15875
685 Ga0307405_10513353 3300031731 Bacteria 963
686 Ga0307413_10087243 3300031824 Bacteria 2020
687 Ga0307406_10000030 3300031901 Bacteria 87564
688 Ga0307412_10000056 3300031911 Bacteria 145861
689 Ga0307412_10042058 3300031911 Bacteria 2966
690 Ga0307412_10095110 3300031911 Bacteria 2094
691 Ga0307414_10070567 3300032004 Bacteria 2516
692 Ga0307411_10355928 3300032005 Bacteria 1195
693 Ga0307415_100496728 3300032126 Bacteria 1066
694 Ga0316583_10010602 3300032133 Bacteria 3324
695 Ga0316585_10006317 3300032137 Bacteria 3384
696 Ga0316593_10004055 3300032168 Bacteria 3712
697 Ga0307507_10088285 3300033179 Bacteria 2675
698 Ga0307510_10025504 3300033180 Bacteria 6815
699 Ga0307510_10320578 3300033180 Bacteria 1007
700 Ga0373950_0000009 3300034818 Bacteria 379994
701 Ga0373950_0000027 3300034818 Bacteria 172704
702 Ga0373934_0039874 3300035086 Bacteria 1852
703 Ga0373934_0080280 3300035086 Bacteria 1310
704 Ga0373944_0003204 3300035089 Bacteria 4205
705 Ga0373944_0003597 3300035089 Bacteria 4005
706 Ga0373944_0011316 3300035089 Bacteria 2443
707 Ga0373951_0068437 3300035091 Bacteria 901
708 Ga0373936_0017884 3300035113 Bacteria 2733
709 Ga0373936_0034498 3300035113 Bacteria 2010
710 Ga0373945_0008499 3300035116 Bacteria 3346
711 Ga0373945_0014169 3300035116 Bacteria 2667
712 Ga0373945_0114616 3300035116 Bacteria 1066
713 Ga0373953_0004396 3300035117 Bacteria 4492
714 Ga0373953_0101754 3300035117 Bacteria 1210
715 Ga0373953_0118001 3300035117 Bacteria 1126
716 Ga0373954_0004893 3300035118 Bacteria 5780
717 Ga0373954_0030168 3300035118 Bacteria 2500
718 Ga0373956_0019878 3300035119 Bacteria 2852
719 Ga0373956_0051238 3300035119 Bacteria 1855
720 Ga0373957_0034962 3300035120 Bacteria 1864
721 Ga0373957_0108939 3300035120 Bacteria 1114
722 Ga0373943_0001682 3300035170 Bacteria 10041
723 Ga0373943_0003799 3300035170 Bacteria 6857
724 Ga0373943_0003862 3300035170 Bacteria 6813
725 Ga0373943_0117031 3300035170 Bacteria 1412
726 Ga0373943_0122348 3300035170 Bacteria 1384
727 Ga0373946_0002630 3300035171 Bacteria 6347
728 Ga0373946_0005184 3300035171 Bacteria 4697
729 Ga0373946_0005647 3300035171 Bacteria 4519
730 Ga0373946_0086275 3300035171 Bacteria 1383
731 Ga0373955_0005503 3300035172 Bacteria 5696
732 Ga0373955_0026549 3300035172 Bacteria 2984
733 Ga0373955_0061554 3300035172 Bacteria 2073
734 Ga0373955_0090811 3300035172 Bacteria 1740
735 Ga0373955_0112963 3300035172 Bacteria 1572
736 Ga0316574_0091960 3300035398 Bacteria 1935
737 Ga0373924_0017160 3300035410 Bacteria 2773
738 Ga0373931_0180127 3300035691 Bacteria 1251
739 Ga0373935_0018390 3300035692 Bacteria 4250
740 Ga0373935_0036770 3300035692 Bacteria 3063
741 Ga0373935_0067268 3300035692 Bacteria 2303
742 Ga0373927_0001909 3300035695 Bacteria 15400
743 Ga0373927_0020354 3300035695 Bacteria 4351
744 Ga0373927_0032514 3300035695 Bacteria 3397
745 Ga0373927_0139475 3300035695 Bacteria 1585
746 Ga0373927_0213872 3300035695 Bacteria 1266
747 Ga0373933_0000595 3300035724 Bacteria 22662
748 Ga0373933_0005874 3300035724 Bacteria 6673
749 Ga0373933_0012986 3300035724 Bacteria 4608
750 Ga0373933_0042623 3300035724 Bacteria 2683
751 Ga0373933_0072407 3300035724 Bacteria 2099
752 Ga0373933_0175115 3300035724 Bacteria 1366
753 Ga0373933_0359263 3300035724 Bacteria 947
754 Ga0373947_0000076 3300035725 Bacteria 49938
755 Ga0373947_0016858 3300035725 Bacteria 4196
756 Ga0373947_0203418 3300035725 Bacteria 1296
757 Ga0373947_0206908 3300035725 Bacteria 1286
758 Ga0373947_0312101 3300035725 Bacteria 1050
759 Ga0373937_0001254 3300036401 Bacteria 21310
760 Ga0373937_0002237 3300036401 Bacteria 16169
761 Ga0373937_0021827 3300036401 Bacteria 5747
762 Ga0373937_0033718 3300036401 Bacteria 4652
763 Ga0373937_0117510 3300036401 Bacteria 2477
764 Ga0373937_0184345 3300036401 Bacteria 1960
765 Ga0373937_0335433 3300036401 Bacteria 1432
766 Ga0373937_0368203 3300036401 Bacteria 1362
767 Ga0373937_0675206 3300036401 Bacteria 979
768 Ga0316582_0026501 3300036647 Bacteria 3490
769 Ga0316584_0011567 3300036712 Bacteria 6204
770 Ga0373925_0001700 3300037068 Bacteria 18531
771 Ga0373925_0053765 3300037068 Bacteria 3011
772 Ga0373925_0060417 3300037068 Bacteria 2846
773 Ga0373925_0097434 3300037068 Bacteria 2255
774 Ga0373925_0098718 3300037068 Bacteria 2242
775 Ga0373925_0147634 3300037068 Bacteria 1844
776 Ga0373925_0276252 3300037068 Bacteria 1352
777 Ga0373925_0279829 3300037068 Bacteria 1343
778 Ga0395899_0000025 3300037312 Bacteria 350927
779 Ga0395899_0000080 3300037312 Bacteria 171568
780 Ga0395899_0034281 3300037312 Bacteria 3811
781 Ga0395899_0251776 3300037312 Bacteria 1212
782 Ga0395900_0000087 3300037418 Bacteria 171568
783 Ga0395900_0011661 3300037418 Bacteria 8991
784 Ga0395900_0027951 3300037418 Bacteria 5777
785 Ga0395900_0028750 3300037418 Bacteria 5699
786 Ga0395900_0242617 3300037418 Bacteria 1807
787 Ga0395900_0370595 3300037418 Bacteria 1402
788 Ga0395898_0000448 3300037466 Bacteria 84953
789 Ga0395898_0003576 3300037466 Bacteria 17324
790 Ga0395898_0079730 3300037466 Bacteria 3158
791 Ga0395905_0000166 3300037471 Bacteria 108507
792 Ga0395905_0006640 3300037471 Bacteria 11600
793 Ga0395905_0082903 3300037471 Bacteria 3004
794 Ga0395905_0213367 3300037471 Bacteria 1808
795 Ga0395905_0344608 3300037471 Bacteria 1381
796 Ga0436364_0001427 3300037853 Bacteria 2021
797 Ga0436364_1187922 3300037853 Bacteria 5613
798 Ga0395901_0000053 3300038443 Bacteria 163807
799 Ga0395901_0000924 3300038443 Bacteria 31960
800 Ga0395901_0009275 3300038443 Bacteria 9977
801 Ga0395901_0131413 3300038443 Bacteria 2631
802 Ga0436365_0299452 3300039437 Bacteria 2840
803 Ga0436365_0345262 3300039437 Bacteria 1241
804 Ga0436365_0653371 3300039437 Bacteria 4259
805 Ga0436365_1094339 3300039437 Bacteria 1531
806 Ga0436365_1601665 3300039437 Bacteria 1746
807 Ga0436360_0606587 3300039438 Bacteria 1830
808 Ga0436360_0694350 3300039438 Bacteria 2338
809 Ga0436361_0094671 3300039447 Bacteria 4600
810 Ga0436361_0161349 3300039447 Bacteria 1188
811 Ga0436361_0704696 3300039447 Bacteria 13555
812 Ga0436361_0912154 3300039447 Bacteria 4178
813 Ga0436363_1483284 3300039450 Bacteria 1210
814 Ga0436363_1591489 3300039450 Bacteria 3842
815 Ga0436362_0474698 3300039453 Bacteria 1181
816 Ga0439436_0000248 3300041404 Bacteria 13012
817 Ga0439438_001451 3300041405 Bacteria 10450
818 Ga0439438_010213 3300041405 Bacteria 2982
819 Ga0439466_0008880 3300041411 Bacteria 3780
820 Ga0439431_0012148 3300041997 Bacteria 1976
821 Ga0439431_0046292 3300041997 Bacteria 1119
822 Ga0439437_000185 3300042000 Bacteria 5359
823 Ga0439441_024973 3300042001 Bacteria 1126
824 Ga0439448_0005884 3300042005 Bacteria 3506
825 Ga0439452_001217 3300042010 Bacteria 11003
826 Ga0439463_000906 3300042016 Bacteria 8134
827 Ga0450911_000003 3300042115 Bacteria 237055
828 Ga0450904_000746 3300042139 Bacteria 5617
829 Ga0439446_0007456 3300042156 Bacteria 2877
830 Ga0439435_0048506 3300042436 Bacteria 1209
831 Ga0450916_002100 3300042530 Bacteria 2073
832 Ga0451577_0001015 3300042876 Bacteria 40836
833 Ga0451577_0003091 3300042876 Bacteria 18789
834 Ga0451577_0339237 3300042876 Bacteria 1363
835 Ga0451577_0355078 3300042876 Bacteria 1330
836 Ga0466969_0002952 3300044656 Bacteria 9080
837 Ga0466972_0011154 3300044658 Bacteria 4510
838 Ga0453683_0069890 3300044673 Bacteria 2196
839 Ga0466965_0004436 3300044683 Bacteria 6242
840 Ga0466965_0007844 3300044683 Bacteria 4921
841 Ga0466965_0155241 3300044683 Bacteria 1198
842 Ga0466966_0000070 3300044684 Bacteria 67510
843 Ga0466966_0000237 3300044684 Bacteria 36471
844 Ga0466966_0013362 3300044684 Bacteria 5435
845 Ga0466961_0000382 3300044693 Bacteria 28543
846 Ga0466961_0000919 3300044693 Bacteria 18224
847 Ga0466961_0013337 3300044693 Bacteria 5261
848 Ga0466961_0260480 3300044693 Bacteria 1063
849 Ga0466961_0356678 3300044693 Bacteria 890
850 Ga0466963_0006323 3300044694 Bacteria 7003
851 Ga0466963_0041349 3300044694 Bacteria 3023
852 Ga0466963_0130738 3300044694 Bacteria 1734
853 Ga0466963_0171357 3300044694 Bacteria 1513
854 Ga0466964_0000768 3300044706 Bacteria 10433
855 Ga0466964_0090707 3300044706 Bacteria 1329
856 Ga0466964_0157361 3300044706 Bacteria 1059
857 Ga0453684_0000009 3300044712 Bacteria 1139914
858 Ga0453684_0016566 3300044712 Bacteria 11508
859 Ga0453684_0067401 3300044712 Bacteria 4551
860 Ga0453684_0105566 3300044712 Bacteria 3435
861 Ga0453684_0122058 3300044712 Bacteria 3144
862 Ga0453684_0134345 3300044712 Bacteria 2964
863 Ga0453684_0388020 3300044712 Bacteria 1567
864 Ga0466971_0015917 3300044719 Bacteria 3314
865 Ga0466971_0021297 3300044719 Bacteria 2885
866 Ga0466971_0063188 3300044719 Bacteria 1676
867 Ga0466957_0024690 3300044842 Bacteria 3559
868 Ga0466957_0146104 3300044842 Bacteria 1526
869 Ga0466957_0207443 3300044842 Bacteria 1289
870 Ga0466960_0234496 3300044901 Bacteria 1014
871 Ga0466959_0004089 3300045049 Bacteria 9711
872 Ga0466959_0099539 3300045049 Bacteria 2081
873 Ga0466959_0119380 3300045049 Bacteria 1876
874 Ga0451576_0117052 3300045051 Bacteria 2774
875 Ga0451576_0207630 3300045051 Bacteria 2045
876 Ga0451576_0218916 3300045051 Bacteria 1988
877 Ga0451576_0292685 3300045051 Unclassified 1702
878 Ga0466958_0001258 3300045836 Bacteria 11879
879 Ga0466958_0003330 3300045836 Bacteria 8322
880 Ga0466958_0003740 3300045836 Bacteria 7947
881 Ga0466958_0103154 3300045836 Bacteria 1775
882 Ga0495617_032756 3300046452 Bacteria 1745
883 Ga0495617_069003 3300046452 Bacteria 1163
884 Ga0495627_000102 3300046453 Bacteria 104889
885 Ga0495627_000192 3300046453 Bacteria 67494
886 Ga0495627_003255 3300046453 Bacteria 7285
887 Ga0495592_0025939 3300046454 Bacteria 4447
888 Ga0495592_0266375 3300046454 Bacteria 1126
889 Ga0495603_0003797 3300046455 Bacteria 8993
890 Ga0495603_0032675 3300046455 Bacteria 3130
891 Ga0495603_0041103 3300046455 Bacteria 2765
892 Ga0495603_0077747 3300046455 Bacteria 1946
893 Ga0495603_0157397 3300046455 Bacteria 1318
894 Ga0495590_0000811 3300046457 Bacteria 14198
895 Ga0495590_0004725 3300046457 Bacteria 5463
896 Ga0495591_000105 3300046458 Bacteria 97199
897 Ga0495591_000563 3300046458 Bacteria 28482
898 Ga0495591_029119 3300046458 Bacteria 1681
899 Ga0495591_048747 3300046458 Bacteria 1166
900 Ga0495629_0000162 3300046459 Bacteria 58860
901 Ga0495629_0000590 3300046459 Bacteria 29493
902 Ga0495629_0011251 3300046459 Bacteria 6499
903 Ga0495629_0023475 3300046459 Bacteria 4394
904 Ga0495629_0064524 3300046459 Bacteria 2557
905 Ga0495629_0179718 3300046459 Bacteria 1467
906 Ga0495629_0227933 3300046459 Bacteria 1284
907 Ga0495638_0004511 3300046460 Bacteria 10547
908 Ga0495638_0095900 3300046460 Bacteria 1781
909 Ga0495638_0193154 3300046460 Bacteria 1154
910 Ga0495641_0029465 3300046461 Bacteria 2644
911 Ga0495641_0075948 3300046461 Bacteria 1506
912 Ga0495641_0084540 3300046461 Bacteria 1421
913 Ga0495651_0018953 3300046462 Bacteria 5330
914 Ga0495651_0022047 3300046462 Bacteria 4953
915 Ga0495651_0392719 3300046462 Bacteria 907
916 Ga0495653_0008754 3300046463 Bacteria 8287
917 Ga0495653_0019819 3300046463 Bacteria 5452
918 Ga0495653_0048078 3300046463 Bacteria 3295
919 Ga0495653_0068884 3300046463 Bacteria 2652
920 Ga0495653_0107121 3300046463 Bacteria 2014
921 Ga0495653_0266859 3300046463 Bacteria 1129
922 Ga0495653_0334268 3300046463 Bacteria 978
923 Ga0495650_0000578 3300046471 Bacteria 51315
924 Ga0495650_0004932 3300046471 Bacteria 8912
925 Ga0495650_0008617 3300046471 Bacteria 5915
926 Ga0495650_0009882 3300046471 Bacteria 5380
927 Ga0495580_0000302 3300046472 Bacteria 40112
928 Ga0495580_0017511 3300046472 Bacteria 5356
929 Ga0495580_0020781 3300046472 Bacteria 4852
930 Ga0495580_0053538 3300046472 Bacteria 2847
931 Ga0495580_0159836 3300046472 Bacteria 1559
932 Ga0495580_0180076 3300046472 Bacteria 1459
933 Ga0495580_0190539 3300046472 Bacteria 1414
934 Ga0495580_0217047 3300046472 Bacteria 1315
935 Ga0495582_0016136 3300046473 Bacteria 4093
936 Ga0495582_0019516 3300046473 Bacteria 3707
937 Ga0495582_0021979 3300046473 Bacteria 3490
938 Ga0495582_0042487 3300046473 Bacteria 2503
939 Ga0495605_0000019 3300046474 Bacteria 270010
940 Ga0495605_0000620 3300046474 Bacteria 27429
941 Ga0495605_0000714 3300046474 Bacteria 24495
942 Ga0495605_0002635 3300046474 Bacteria 11010
943 Ga0495605_0002760 3300046474 Bacteria 10716
944 Ga0495605_0005245 3300046474 Bacteria 7563
945 Ga0495605_0015811 3300046474 Bacteria 4098
946 Ga0495605_0124585 3300046474 Bacteria 1166
947 Ga0495639_0009880 3300046475 Bacteria 4097
948 Ga0495639_0063030 3300046475 Bacteria 1701
949 Ga0495639_0198471 3300046475 Bacteria 981
950 Ga0495662_0004393 3300046476 Bacteria 7081
951 Ga0495662_0009283 3300046476 Bacteria 4825
952 Ga0495662_0023573 3300046476 Bacteria 2971
953 Ga0495662_0252500 3300046476 Bacteria 868
954 Ga0495664_0000368 3300046477 Bacteria 21935
955 Ga0495664_0003278 3300046477 Bacteria 8798
956 Ga0495664_0003946 3300046477 Bacteria 8095
957 Ga0495664_0018698 3300046477 Bacteria 3975
958 Ga0495664_0075808 3300046477 Bacteria 2012
959 Ga0495664_0163358 3300046477 Bacteria 1351
960 Ga0495664_0247820 3300046477 Bacteria 1077
961 Ga0495584_0011090 3300046491 Bacteria 4622
962 Ga0495584_0017720 3300046491 Bacteria 3623
963 Ga0495584_0084026 3300046491 Bacteria 1603
964 Ga0495585_0010183 3300046492 Bacteria 5613
965 Ga0495585_0025360 3300046492 Bacteria 3397
966 Ga0495594_0003233 3300046499 Bacteria 8442
967 Ga0495594_0014492 3300046499 Bacteria 4132
968 Ga0495596_0002359 3300046500 Bacteria 10215
969 Ga0495596_0004685 3300046500 Bacteria 6618
970 Ga0495596_0079811 3300046500 Bacteria 1270
971 Ga0495607_0000173 3300046501 Bacteria 68694
972 Ga0495607_0001049 3300046501 Bacteria 25238
973 Ga0495607_0001370 3300046501 Bacteria 21666
974 Ga0495607_0003053 3300046501 Bacteria 13031
975 Ga0495607_0004095 3300046501 Bacteria 10894
976 Ga0495607_0034758 3300046501 Bacteria 3055
977 Ga0495607_0047788 3300046501 Bacteria 2504
978 Ga0495583_0000146 3300046506 Bacteria 119793
979 Ga0495583_0003951 3300046506 Bacteria 10951
980 Ga0495583_0004397 3300046506 Bacteria 10113
981 Ga0495583_0008614 3300046506 Bacteria 6208
982 Ga0495583_0009324 3300046506 Bacteria 5874
983 Ga0495583_0009485 3300046506 Bacteria 5806
984 Ga0495583_0012139 3300046506 Bacteria 4899
985 Ga0495606_0000083 3300046507 Bacteria 159263
986 Ga0495606_0001016 3300046507 Bacteria 40685
987 Ga0495606_0001114 3300046507 Bacteria 38407
988 Ga0495606_0011642 3300046507 Bacteria 7147
989 Ga0495606_0025241 3300046507 Bacteria 4260
990 Ga0495606_0031076 3300046507 Bacteria 3718
991 Ga0495608_0005734 3300046511 Bacteria 8861
992 Ga0495610_0002177 3300046512 Bacteria 16638
993 Ga0495610_0002536 3300046512 Bacteria 15230
994 Ga0495610_0025793 3300046512 Bacteria 3148
995 Ga0495610_0173122 3300046512 Bacteria 903
996 Ga0495618_0002173 3300046514 Bacteria 12828
997 Ga0495618_0004385 3300046514 Bacteria 8678
998 Ga0495618_0032319 3300046514 Bacteria 3277
999 Ga0495618_0041962 3300046514 Bacteria 2882
1000 Ga0495618_0051105 3300046514 Bacteria 2612
1001 Ga0495620_0000311 3300046515 Bacteria 34734
1002 Ga0495620_0006655 3300046515 Bacteria 6332
1003 Ga0495620_0034135 3300046515 Bacteria 2302
1004 Ga0495628_0002322 3300046516 Bacteria 17200
1005 Ga0495628_0011538 3300046516 Bacteria 7471
1006 Ga0495628_0011640 3300046516 Bacteria 7434
1007 Ga0495628_0089758 3300046516 Bacteria 2379
1008 Ga0495628_0183538 3300046516 Bacteria 1581
1009 Ga0495628_0248316 3300046516 Bacteria 1329
1010 Ga0495630_0004921 3300046517 Bacteria 9389
1011 Ga0495630_0019641 3300046517 Bacteria 4969
1012 Ga0495630_0028264 3300046517 Bacteria 4167
1013 Ga0495630_0042860 3300046517 Bacteria 3379
1014 Ga0495630_0086304 3300046517 Bacteria 2370
1015 Ga0495630_0119584 3300046517 Bacteria 1998
1016 Ga0495630_0149167 3300046517 Bacteria 1779
1017 Ga0495630_0501666 3300046517 Bacteria 930
1018 Ga0495631_0002354 3300046518 Bacteria 10750
1019 Ga0495631_0003218 3300046518 Bacteria 8996
1020 Ga0495632_0072815 3300046519 Bacteria 1648
1021 Ga0495637_0002217 3300046520 Bacteria 10851
1022 Ga0495637_0002388 3300046520 Bacteria 10395
1023 Ga0495637_0030057 3300046520 Bacteria 2412
1024 Ga0495643_0001534 3300046522 Bacteria 20737
1025 Ga0495643_0002216 3300046522 Bacteria 15800
1026 Ga0495643_0004880 3300046522 Bacteria 9237
1027 Ga0495643_0040147 3300046522 Bacteria 2556
1028 Ga0495644_0000563 3300046523 Bacteria 15597
1029 Ga0495648_0007724 3300046524 Bacteria 8565
1030 Ga0495648_0011548 3300046524 Bacteria 6643
1031 Ga0495648_0024339 3300046524 Bacteria 4125
1032 Ga0495648_0044955 3300046524 Bacteria 2751
1033 Ga0495648_0063307 3300046524 Bacteria 2184
1034 Ga0495666_0000199 3300046526 Bacteria 25643
1035 Ga0495666_0030492 3300046526 Bacteria 2646
1036 Ga0495642_0087232 3300046528 Bacteria 1319
1037 Ga0495642_0098883 3300046528 Bacteria 1240
1038 Ga0495642_0101026 3300046528 Bacteria 1227
1039 Ga0495642_0113054 3300046528 Bacteria 1162
1040 Ga0495652_0024449 3300046529 Bacteria 5346
1041 Ga0495652_0030018 3300046529 Bacteria 4770
1042 Ga0495652_0037097 3300046529 Bacteria 4231
1043 Ga0495652_0088897 3300046529 Bacteria 2531
1044 Ga0495652_0120322 3300046529 Bacteria 2096
1045 Ga0495652_0149091 3300046529 Bacteria 1829
1046 Ga0495652_0164502 3300046529 Bacteria 1718
1047 Ga0495654_0001519 3300046530 Bacteria 15829
1048 Ga0495654_0008371 3300046530 Bacteria 5717
1049 Ga0495654_0008437 3300046530 Bacteria 5692
1050 Ga0495665_0004130 3300046531 Bacteria 7829
1051 Ga0495665_0006502 3300046531 Bacteria 6312
1052 Ga0495665_0026932 3300046531 Bacteria 3086
1053 Ga0495665_0031947 3300046531 Bacteria 2816
1054 Ga0495665_0039911 3300046531 Bacteria 2500
1055 Ga0495665_0160542 3300046531 Bacteria 1172
1056 Ga0495640_0002756 3300046533 Bacteria 14127
1057 Ga0495640_0004166 3300046533 Bacteria 11565
1058 Ga0495640_0037530 3300046533 Bacteria 3417
1059 Ga0495640_0065580 3300046533 Bacteria 2451
1060 Ga0495640_0129596 3300046533 Bacteria 1633
1061 Ga0495586_0000571 3300046535 Bacteria 21399
1062 Ga0495586_0016484 3300046535 Bacteria 3930
1063 Ga0495586_0018700 3300046535 Bacteria 3688
1064 Ga0495587_0006284 3300046536 Bacteria 7754
1065 Ga0495587_0007690 3300046536 Bacteria 6972
1066 Ga0495587_0026521 3300046536 Bacteria 3533
1067 Ga0495598_0001551 3300046537 Bacteria 4600
1068 Ga0495609_0000023 3300046538 Bacteria 269702
1069 Ga0495609_0000101 3300046538 Bacteria 100818
1070 Ga0495609_0000773 3300046538 Bacteria 23957
1071 Ga0495609_0164626 3300046538 Bacteria 938
1072 Ga0495597_0000139 3300046542 Bacteria 65492
1073 Ga0495597_0005726 3300046542 Bacteria 6528
1074 Ga0495597_0060552 3300046542 Bacteria 1651
1075 Ga0495645_0001460 3300046543 Bacteria 15984
1076 Ga0495645_0002870 3300046543 Bacteria 11701
1077 Ga0495645_0007542 3300046543 Bacteria 7567
1078 Ga0495645_0046069 3300046543 Bacteria 3179
1079 Ga0495645_0069879 3300046543 Bacteria 2534
1080 Ga0495622_0001598 3300046557 Bacteria 11193
1081 Ga0495633_0000129 3300046558 Bacteria 100833
1082 Ga0495633_0006536 3300046558 Bacteria 6889
1083 Ga0495667_0051382 3300046559 Bacteria 2719
1084 Ga0495656_0000123 3300046615 Bacteria 29630
1085 Ga0495668_0026762 3300046616 Bacteria 3271
1086 Ga0495668_0245411 3300046616 Bacteria 980
1087 Ga0495634_0004264 3300046642 Bacteria 11270
1088 Ga0495634_0015968 3300046642 Bacteria 5378
1089 Ga0495634_0038681 3300046642 Bacteria 3251
1090 Ga0495634_0050291 3300046642 Bacteria 2799
1091 Ga0495634_0112819 3300046642 Bacteria 1746
1092 Ga0495611_0004020 3300046648 Bacteria 6404
1093 Ga0495611_0009781 3300046648 Bacteria 4054
1094 Ga0495611_0032270 3300046648 Bacteria 2307
1095 Ga0495625_0000187 3300046660 Bacteria 97797
1096 Ga0495625_0001672 3300046660 Bacteria 25960
1097 Ga0495635_0004608 3300046663 Bacteria 9563
1098 Ga0495635_0006555 3300046663 Bacteria 8123
1099 Ga0495635_0006792 3300046663 Bacteria 7999
1100 Ga0495635_0119946 3300046663 Bacteria 1794
1101 Ga0495635_0167774 3300046663 Bacteria 1493
1102 Ga0495635_0169459 3300046663 Bacteria 1485
1103 Ga0495659_0000384 3300046664 Bacteria 17032
1104 Ga0495661_0000758 3300046665 Bacteria 31237
1105 Ga0495661_0000760 3300046665 Bacteria 31156
1106 Ga0495661_0005349 3300046665 Bacteria 9128
1107 Ga0495661_0005985 3300046665 Bacteria 8586
1108 Ga0495661_0006686 3300046665 Bacteria 8094
1109 Ga0495661_0046850 3300046665 Bacteria 2637
1110 Ga0495588_0036385 3300046674 Bacteria 2497
1111 Ga0495588_0154148 3300046674 Bacteria 1214
1112 Ga0495588_0224006 3300046674 Bacteria 992
1113 Ga0495588_0259206 3300046674 Bacteria 916
1114 Ga0495599_0009062 3300046678 Bacteria 6064
1115 Ga0495599_0402882 3300046678 Bacteria 815
1116 Ga0495623_0008745 3300046679 Bacteria 6574
1117 Ga0495623_0011620 3300046679 Bacteria 5703
1118 Ga0495623_0024404 3300046679 Bacteria 3896
1119 Ga0495623_0100027 3300046679 Bacteria 1768
1120 Ga0495623_0169278 3300046679 Bacteria 1277
1121 Ga0495646_0002147 3300046680 Bacteria 11979
1122 Ga0495646_0007283 3300046680 Bacteria 7026
1123 Ga0495646_0015048 3300046680 Bacteria 4914
1124 Ga0495646_0028558 3300046680 Bacteria 3491
1125 Ga0495646_0071872 3300046680 Bacteria 2035
1126 Ga0495646_0084387 3300046680 Bacteria 1844
1127 Ga0495646_0146645 3300046680 Bacteria 1315
1128 Ga0495647_0005854 3300046681 Bacteria 4046
1129 Ga0495658_0023495 3300046683 Bacteria 3272
1130 Ga0495658_0048760 3300046683 Bacteria 2390
1131 Ga0495669_0037876 3300046684 Bacteria 2135
1132 Ga0495669_0089342 3300046684 Bacteria 1421
1133 Ga0495613_0002201 3300046689 Bacteria 14753
1134 Ga0495613_0005270 3300046689 Bacteria 9710
1135 Ga0495613_0027432 3300046689 Bacteria 4237
1136 Ga0495613_0164055 3300046689 Bacteria 1579
1137 Ga0495624_0005977 3300046690 Bacteria 8690
1138 Ga0495624_0011101 3300046690 Bacteria 6198
1139 Ga0495624_0013135 3300046690 Bacteria 5647
1140 Ga0495624_0013148 3300046690 Bacteria 5645
1141 Ga0495624_0021591 3300046690 Bacteria 4267
1142 Ga0495624_0023975 3300046690 Bacteria 4019
1143 Ga0495624_0047820 3300046690 Bacteria 2717
1144 Ga0495624_0059865 3300046690 Bacteria 2388
1145 Ga0495624_0082914 3300046690 Bacteria 1983
1146 Ga0495670_0000220 3300046691 Bacteria 25973
1147 Ga0495670_0039768 3300046691 Bacteria 2345
1148 Ga0495670_0072318 3300046691 Bacteria 1746
1149 Ga0495671_0012954 3300046692 Bacteria 4537
1150 Ga0495671_0021416 3300046692 Bacteria 3396
1151 Ga0495649_0001623 3300046694 Bacteria 16726
1152 Ga0495649_0009004 3300046694 Bacteria 5961
1153 Ga0495649_0018484 3300046694 Bacteria 3921
1154 Ga0495649_0029959 3300046694 Bacteria 3006
1155 Ga0495649_0032033 3300046694 Bacteria 2898
1156 Ga0495649_0032059 3300046694 Bacteria 2897
1157 Ga0495649_0071082 3300046694 Bacteria 1865
1158 Ga0495589_0006374 3300046794 Bacteria 6234
1159 Ga0495589_0063290 3300046794 Bacteria 1815
1160 Ga0495589_0121709 3300046794 Bacteria 1256
1161 Ga0495589_0133425 3300046794 Bacteria 1191
1162 Ga0495600_0012417 3300046809 Bacteria 5326
1163 Ga0495600_0020782 3300046809 Bacteria 4200
1164 Ga0495600_0027359 3300046809 Bacteria 3684
1165 Ga0495660_0009479 3300046810 Bacteria 5677
1166 Ga0495660_0032968 3300046810 Bacteria 2907
1167 Ga0495660_0043756 3300046810 Bacteria 2467
1168 Ga0495660_0047205 3300046810 Bacteria 2359
1169 Ga0495581_0000213 3300047315 Bacteria 27408
1170 Ga0495581_0004435 3300047315 Bacteria 8111
1171 Ga0495581_0007273 3300047315 Bacteria 6404
1172 Ga0495581_0038053 3300047315 Bacteria 2783
1173 Ga0495604_0009492 3300047317 Bacteria 7690
1174 Ga0495604_0010125 3300047317 Bacteria 7468
1175 Ga0495604_0046297 3300047317 Bacteria 3391
1176 Ga0495604_0179595 3300047317 Bacteria 1481
1177 Ga0495604_0406238 3300047317 Bacteria 896
1178 Ga0495674_0005870 3300047319 Bacteria 11780
1179 Ga0495674_0008178 3300047319 Bacteria 9978
1180 Ga0495674_0045155 3300047319 Bacteria 3912
1181 Ga0495674_0061701 3300047319 Bacteria 3266
1182 Ga0495674_0069863 3300047319 Bacteria 3036
1183 Ga0495674_0077262 3300047319 Bacteria 2862
1184 Ga0495674_0080226 3300047319 Bacteria 2800
1185 Ga0495674_0098583 3300047319 Bacteria 2488
1186 Ga0495674_0111023 3300047319 Bacteria 2324
1187 Ga0495674_0137310 3300047319 Bacteria 2056
1188 Ga0495674_0175389 3300047319 Bacteria 1787
1189 Ga0495672_0001885 3300047320 Bacteria 19961
1190 Ga0495672_0015722 3300047320 Bacteria 5127
1191 Ga0495672_0076570 3300047320 Bacteria 1878
1192 Ga0495672_0115265 3300047320 Bacteria 1436
1193 Ga0495676_0000011 3300047321 Bacteria 242612
1194 Ga0495676_0010144 3300047321 Bacteria 8553
1195 Ga0495676_0070585 3300047321 Bacteria 2689
1196 Ga0495676_0080480 3300047321 Bacteria 2473
1197 Ga0495676_0081674 3300047321 Bacteria 2449
1198 Ga0495676_0240270 3300047321 Bacteria 1240
1199 Ga0495680_0006145 3300047322 Bacteria 11209
1200 Ga0495680_0023334 3300047322 Bacteria 5146
1201 Ga0495680_0030003 3300047322 Bacteria 4445
1202 Ga0495680_0047162 3300047322 Bacteria 3391
1203 Ga0495680_0220222 3300047322 Bacteria 1355
1204 Ga0495683_0000075 3300047323 Bacteria 100715
1205 Ga0495683_0001275 3300047323 Bacteria 17066
1206 Ga0495683_0012219 3300047323 Bacteria 4513
1207 Ga0495683_0092360 3300047323 Bacteria 1464
1208 Ga0495687_000216 3300047443 Bacteria 81734
1209 Ga0495687_003465 3300047443 Bacteria 11403
1210 Ga0495687_012354 3300047443 Bacteria 4520
1211 Ga0495687_013318 3300047443 Bacteria 4303
1212 Ga0495675_0027553 3300047444 Bacteria 3620
1213 Ga0495675_0153662 3300047444 Bacteria 1420
1214 Ga0495679_000742 3300047446 Bacteria 20949
1215 Ga0495679_002129 3300047446 Bacteria 10417
1216 Ga0495679_004723 3300047446 Bacteria 6187
1217 Ga0495679_016801 3300047446 Bacteria 2637
1218 Ga0495679_021103 3300047446 Bacteria 2256
1219 Ga0495685_060275 3300047447 Bacteria 1280
1220 Ga0495673_0000222 3300047469 Bacteria 84272
1221 Ga0495673_0003752 3300047469 Bacteria 9862
1222 Ga0495673_0004563 3300047469 Bacteria 8643
1223 Ga0495673_0006893 3300047469 Bacteria 6621
1224 Ga0495673_0008865 3300047469 Bacteria 5610
1225 Ga0495673_0012689 3300047469 Bacteria 4452
1226 Ga0495673_0016808 3300047469 Bacteria 3730
1227 Ga0495673_0126745 3300047469 Bacteria 1006
1228 Ga0495681_0013105 3300047470 Bacteria 4834
1229 Ga0495681_0024139 3300047470 Bacteria 3212
1230 Ga0495684_0001940 3300047471 Bacteria 16582
1231 Ga0495684_0002684 3300047471 Bacteria 14089
1232 Ga0495684_0005580 3300047471 Bacteria 9799
1233 Ga0495684_0033516 3300047471 Bacteria 3939
1234 Ga0495686_0000214 3300047472 Bacteria 106493
1235 Ga0495593_0003130 3300047673 Bacteria 9940
1236 Ga0495593_0008505 3300047673 Bacteria 5967
1237 Ga0495593_0014728 3300047673 Bacteria 4444
1238 Ga0495593_0018733 3300047673 Bacteria 3887
1239 Ga0495593_0018744 3300047673 Bacteria 3886
1240 Ga0495593_0024505 3300047673 Bacteria 3343
1241 Ga0495602_0015069 3300048088 Bacteria 7818
1242 Ga0495602_0015119 3300048088 Bacteria 7802
1243 Ga0495602_0024836 3300048088 Bacteria 5809
1244 Ga0495614_0001465 3300048089 Bacteria 10197
1245 Ga0495614_0033092 3300048089 Bacteria 2223
1246 Ga0495626_0000068 3300048091 Bacteria 139126
1247 Ga0496100_0026625 3300048903 Bacteria 3547
1248 Ga0496100_0066086 3300048903 Bacteria 2398
1249 Ga0496100_0081723 3300048903 Bacteria 2183
1250 Ga0496100_0412644 3300048903 Bacteria 1030
1251 Ga0496101_0007572 3300048904 Bacteria 7045
1252 Ga0496101_0014875 3300048904 Bacteria 5237
1253 Ga0496101_0066149 3300048904 Bacteria 2636
1254 Ga0496101_0129863 3300048904 Bacteria 1912
1255 Ga0496101_0140383 3300048904 Bacteria 1841
1256 Ga0496102_0013604 3300048905 Bacteria 7053
1257 Ga0496102_0030165 3300048905 Bacteria 4853
1258 Ga0496102_0078141 3300048905 Bacteria 3046
1259 Ga0496103_0004000 3300048906 Bacteria 8954
1260 Ga0496103_0007750 3300048906 Bacteria 6384
1261 Ga0496103_0372887 3300048906 Bacteria 917
1262 Ga0496104_0056004 3300048907 Bacteria 3728
1263 Ga0496104_0101437 3300048907 Bacteria 2755
1264 Ga0496104_0118746 3300048907 Bacteria 2539
1265 Ga0496104_0436351 3300048907 Bacteria 1221
1266 Ga0496105_0002468 3300048908 Bacteria 13388
1267 Ga0496105_0013587 3300048908 Bacteria 6467
1268 Ga0496105_0072398 3300048908 Bacteria 2848
1269 Ga0496105_0111048 3300048908 Bacteria 2263
1270 Ga0496106_0000162 3300048909 Bacteria 48305
1271 Ga0496106_0019573 3300048909 Bacteria 5022
1272 Ga0496106_0057462 3300048909 Bacteria 2942
1273 Ga0496106_0106952 3300048909 Bacteria 2175
1274 Ga0496107_0017260 3300048910 Bacteria 5076
1275 Ga0496107_0061224 3300048910 Bacteria 2725
1276 Ga0496107_0139575 3300048910 Bacteria 1791
1277 Ga0496107_0270261 3300048910 Bacteria 1265
1278 Ga0496108_0011142 3300048911 Bacteria 7307
1279 Ga0496108_0177069 3300048911 Bacteria 1846
1280 Ga0496108_0179872 3300048911 Bacteria 1831
1281 Ga0496108_0255585 3300048911 Bacteria 1524
1282 Ga0496108_0499148 3300048911 Bacteria 1063
1283 Ga0496109_0003965 3300048912 Bacteria 12359
1284 Ga0496109_0272952 3300048912 Bacteria 1593
1285 Ga0496109_0386450 3300048912 Bacteria 1322
1286 Ga0496109_0546768 3300048912 Bacteria 1092
1287 Ga0496110_0061581 3300048913 Bacteria 3312
1288 Ga0496110_0135781 3300048913 Bacteria 2223
1289 Ga0496110_0184133 3300048913 Bacteria 1896
1290 Ga0496111_0006988 3300048914 Bacteria 7369
1291 Ga0496111_0123409 3300048914 Bacteria 1914
1292 Ga0496112_0000845 3300048915 Bacteria 21851
1293 Ga0496112_0023150 3300048915 Bacteria 5930
1294 Ga0496112_0303883 3300048915 Bacteria 1541
1295 Ga0496112_0384387 3300048915 Bacteria 1344
1296 Ga0496112_0533653 3300048915 Bacteria 1108
1297 Ga0496112_0535298 3300048915 Bacteria 1106
1298 Ga0496112_0671763 3300048915 Bacteria 965
1299 Ga0496113_0000630 3300048916 Bacteria 17715
1300 Ga0496113_0014789 3300048916 Bacteria 5338
1301 Ga0496113_0087366 3300048916 Bacteria 2397
1302 Ga0496113_0198384 3300048916 Bacteria 1595
1303 Ga0496114_0001670 3300048917 Bacteria 16838
1304 Ga0496114_0002335 3300048917 Bacteria 14443
1305 Ga0496114_0002636 3300048917 Bacteria 13685
1306 Ga0496114_0068547 3300048917 Bacteria 2978
1307 Ga0496114_0156957 3300048917 Bacteria 1976
1308 Ga0496114_0261378 3300048917 Bacteria 1524
1309 Ga0496114_0369877 3300048917 Bacteria 1269
1310 Ga0496114_0500655 3300048917 Bacteria 1075
1311 Ga0496115_0003790 3300048918 Bacteria 10875
1312 Ga0496115_0038982 3300048918 Bacteria 3773
1313 Ga0496115_0055221 3300048918 Bacteria 3190
1314 Ga0496115_0129922 3300048918 Bacteria 2076
1315 Ga0496115_0187849 3300048918 Bacteria 1707
1316 Ga0496115_0189548 3300048918 Bacteria 1699
1317 Ga0496115_0349899 3300048918 Bacteria 1205
1318 Ga0496116_0002301 3300048919 Bacteria 20255
1319 Ga0496116_0181336 3300048919 Bacteria 1127
1320 Ga0496117_0024649 3300048920 Bacteria 4749
1321 Ga0496117_0036473 3300048920 Bacteria 3678
1322 Ga0496117_0041767 3300048920 Bacteria 3355
1323 Ga0496118_0002594 3300048921 Bacteria 24086
1324 Ga0496118_0016936 3300048921 Bacteria 6656
1325 Ga0496118_0017073 3300048921 Bacteria 6625
1326 Ga0496118_0020754 3300048921 Bacteria 5816
1327 Ga0496118_0039102 3300048921 Bacteria 3790
1328 Ga0496118_0041701 3300048921 Bacteria 3629
1329 Ga0496118_0044043 3300048921 Bacteria 3498
1330 Ga0496118_0048156 3300048921 Bacteria 3296
1331 Ga0496118_0088824 3300048921 Bacteria 2136
1332 Ga0496119_0000996 3300048922 Bacteria 36307
1333 Ga0496119_0119467 3300048922 Bacteria 1451
1334 Ga0496121_0002966 3300048924 Bacteria 24708
1335 Ga0496121_0003706 3300048924 Bacteria 21439
1336 Ga0496121_0015441 3300048924 Bacteria 8003
1337 Ga0496121_0020087 3300048924 Bacteria 6636
1338 Ga0496121_0028670 3300048924 Bacteria 5176
1339 Ga0496121_0072309 3300048924 Bacteria 2769
1340 Ga0496121_0118850 3300048924 Bacteria 2000
1341 Ga0496121_0171217 3300048924 Bacteria 1577
1342 Ga0496121_0245885 3300048924 Bacteria 1243
1343 Ga0496121_0248018 3300048924 Bacteria 1236
1344 Ga0496122_0001467 3300048925 Bacteria 37972
1345 Ga0496122_0006509 3300048925 Bacteria 13375
1346 Ga0496122_0021646 3300048925 Bacteria 5746
1347 Ga0496123_0000191 3300048926 Bacteria 124299
1348 Ga0496123_0057977 3300048926 Bacteria 2516
1349 Ga0496123_0123328 3300048926 Bacteria 1452
1350 Ga0496124_0000073 3300048927 Bacteria 219306
1351 Ga0496124_0000108 3300048927 Bacteria 167473
1352 Ga0496124_0009527 3300048927 Bacteria 9988
1353 Ga0496124_0010447 3300048927 Bacteria 9396
1354 Ga0496124_0012421 3300048927 Bacteria 8409
1355 Ga0496124_0020326 3300048927 Bacteria 6140
1356 Ga0496125_0005828 3300048928 Bacteria 13535
1357 Ga0496125_0008324 3300048928 Bacteria 10885
1358 Ga0496126_0000538 3300048929 Bacteria 73271
1359 Ga0496126_0001364 3300048929 Bacteria 38662
1360 Ga0496126_0004863 3300048929 Bacteria 15732
1361 Ga0496126_0007775 3300048929 Bacteria 11683
1362 Ga0496126_0030353 3300048929 Bacteria 5122
1363 Ga0496126_0246307 3300048929 Bacteria 1491
1364 Ga0496126_0343709 3300048929 Bacteria 1222
1365 Ga0495678_000106 3300049459 Bacteria 100780
1366 Ga0495678_000404 3300049459 Bacteria 43644
1367 Ga0495678_012240 3300049459 Bacteria 4072
1368 Ga0495678_042773 3300049459 Bacteria 1804
1369 Ga0495678_081193 3300049459 Bacteria 1164
1370 Ga0495682_0000681 3300049460 Bacteria 22388
1371 Ga0495682_0006043 3300049460 Bacteria 4938
1372 Ga0495682_0011445 3300049460 Bacteria 3413
1373 Ga0501032_0268913 3300049569 Bacteria 1105
1374 Ga0501032_0325381 3300049569 Bacteria 992
1375 Ga0501032_0448041 3300049569 Bacteria 827
1376 Ga0501034_0000134 3300049571 Bacteria 137745
1377 Ga0501034_0000630 3300049571 Bacteria 54662
1378 Ga0501034_0068121 3300049571 Bacteria 3571
1379 Ga0501034_0129981 3300049571 Bacteria 2502
1380 Ga0501034_0143088 3300049571 Bacteria 2370
1381 Ga0501034_0186525 3300049571 Bacteria 2037
1382 Ga0501034_0212561 3300049571 Bacteria 1889
1383 Ga0501034_0473107 3300049571 Bacteria 1169
1384 Ga0501038_0058071 3300049574 Bacteria 3319
1385 Ga0501038_0305761 3300049574 Bacteria 1247
1386 Ga0501040_0151167 3300049576 Bacteria 1638
1387 Ga0501043_0001257 3300049579 Bacteria 22355
1388 Ga0501046_0003144 3300049580 Bacteria 15248
1389 Ga0501047_0000011 3300049581 Bacteria 409778
1390 Ga0501047_0283247 3300049581 Bacteria 1502
1391 Ga0501047_0388776 3300049581 Bacteria 1229
1392 Ga0501048_0001652 3300049582 Bacteria 16986
1393 Ga0501048_0196986 3300049582 Bacteria 1428
1394 Ga0501067_0000014 3300049583 Bacteria 110569
1395 Ga0501067_0014311 3300049583 Bacteria 4391
1396 Ga0501067_0049093 3300049583 Bacteria 2339
1397 Ga0501067_0066240 3300049583 Bacteria 1999
1398 Ga0501068_0006611 3300049584 Bacteria 6398
1399 Ga0501068_0161639 3300049584 Bacteria 1412
1400 Ga0501068_0437617 3300049584 Bacteria 845
1401 Ga0501069_0016266 3300049585 Bacteria 3993
1402 Ga0501069_0025182 3300049585 Bacteria 3250
1403 Ga0501069_0324401 3300049585 Bacteria 905
1404 Ga0501070_0000007 3300049586 Bacteria 219869
1405 Ga0501070_0002576 3300049586 Bacteria 15852
1406 Ga0501070_0073326 3300049586 Bacteria 2832
1407 Ga0501071_0262725 3300049587 Bacteria 1304
1408 Ga0501071_0341863 3300049587 Bacteria 1138
1409 Ga0501072_0000030 3300049588 Bacteria 133181
1410 Ga0501072_0002898 3300049588 Bacteria 12907
1411 Ga0501072_0253544 3300049588 Bacteria 1401
1412 Ga0501073_0000375 3300049589 Bacteria 30104
1413 Ga0501073_0002477 3300049589 Bacteria 13780
1414 Ga0501073_0002807 3300049589 Bacteria 13036
1415 Ga0501073_0012973 3300049589 Bacteria 6073
1416 Ga0501073_0029633 3300049589 Bacteria 3910
1417 Ga0501073_0113464 3300049589 Bacteria 1879
1418 Ga0501073_0143354 3300049589 Bacteria 1655
1419 Ga0501074_0002648 3300049590 Bacteria 12542
1420 Ga0501074_0046924 3300049590 Bacteria 3123
1421 Ga0501074_0170050 3300049590 Bacteria 1556
1422 Ga0501076_0148100 3300049592 Bacteria 1909
1423 Ga0501077_0287001 3300049593 Bacteria 1048
1424 Ga0501209_000447 3300049656 Bacteria 5030
1425 Ga0501079_0000466 3300049741 Bacteria 26666
1426 Ga0501079_0356413 3300049741 Bacteria 1146
1427 Ga0501079_0624047 3300049741 Bacteria 848
1428 Ga0501080_0009497 3300049742 Bacteria 8875
1429 Ga0501080_0055655 3300049742 Bacteria 3684
1430 Ga0501080_0061304 3300049742 Bacteria 3502
1431 Ga0501080_0063571 3300049742 Bacteria 3435
1432 Ga0501080_0077547 3300049742 Bacteria 3090
1433 Ga0501080_0227717 3300049742 Bacteria 1704
1434 Ga0501081_0051061 3300049743 Bacteria 2851
1435 Ga0501081_0071881 3300049743 Bacteria 2412
1436 Ga0501083_0000084 3300049744 Bacteria 63937
1437 Ga0501083_0009195 3300049744 Bacteria 6979
1438 Ga0501083_0060273 3300049744 Bacteria 2535
1439 Ga0501083_0092936 3300049744 Bacteria 1991
1440 Ga0501280_000724 3300049776 Bacteria 7284
1441 Ga0501282_000631 3300049778 Bacteria 4063
1442 Ga0501044_0030135 3300049823 Bacteria 5719
1443 Ga0501044_0119058 3300049823 Bacteria 2643
1444 Ga0501044_0464918 3300049823 Bacteria 1170
1445 Ga0501044_0514588 3300049823 Bacteria 1097
1446 Ga0501226_000035 3300049853 Bacteria 68083
1447 nmdc:mga00v17_164738_c1 3300050491 Bacteria 1428
1448 nmdc:mga0yw44_172048_c1 3300050492 Bacteria 1422
1449 nmdc:mga0k408_129707_c1 3300050493 Bacteria 1135
1450 nmdc:mga0k408_177122_c1 3300050493 Bacteria 1271
1451 nmdc:mga0k408_80326_c1 3300050493 Bacteria 1909
1452 nmdc:mga06z11_26757_c1 3300050494 Bacteria 2749
1453 nmdc:mga06z11_3256_c1 3300050494 Bacteria 6274
1454 nmdc:mga07m45_51257_c2 3300050496 Bacteria 1036
1455 nmdc:mga07m45_93936_c1 3300050496 Bacteria 1719
1456 nmdc:mga05p37_11562_c1 3300050507 Bacteria 10515
1457 nmdc:mga05p37_899361_c1 3300050507 Bacteria 955
1458 nmdc:mga09592_237171_c1 3300050508 Bacteria 1580
1459 nmdc:mga09592_47800_c1 3300050508 Bacteria 3606
1460 nmdc:mga0qj67_22237_c1 3300050509 Bacteria 4870
1461 nmdc:mga0qj67_26838_c1 3300050509 Bacteria 4460
1462 nmdc:mga06r32_10171_c1 3300050510 Bacteria 8492
1463 nmdc:mga06r32_245187_c1 3300050510 Bacteria 1779
1464 nmdc:mga06r32_303991_c1 3300050510 Bacteria 1581
1465 nmdc:mga06r32_69355_c1 3300050510 Bacteria 3407
1466 nmdc:mga06r32_79886_c1 3300050510 Bacteria 3182
1467 nmdc:mga08y16_1326_c1 3300050511 Bacteria 24646
1468 nmdc:mga08y16_638094_c1 3300050511 Bacteria 1070
1469 nmdc:mga08y16_68226_c1 3300050511 Bacteria 3708
1470 nmdc:mga08y16_820193_c1 3300050511 Bacteria 922
1471 nmdc:mga0n895_293592_c1 3300050512 Bacteria 1648
1472 nmdc:mga0n895_57547_c1 3300050512 Bacteria 3832
1473 nmdc:mga0n895_77979_c1 3300050512 Bacteria 3296
1474 nmdc:mga0rr50_180962_c1 3300050513 Bacteria 1723
1475 nmdc:mga0a205_105801_c1 3300050515 Bacteria 2712
1476 nmdc:mga0sz30_65123_c1 3300050516 Bacteria 1562
1477 Ga0495601_0020354 3300053077 Bacteria 4052
1478 Ga0495601_0033030 3300053077 Bacteria 3223
1479 Ga0495601_0233210 3300053077 Bacteria 1202
1480 Ga0495612_0006404 3300053078 Bacteria 4839
1481 Ga0495612_0012283 3300053078 Bacteria 3452
1482 Ga0495655_0048286 3300053083 Bacteria 1117
1483 Ga0495595_0003605 3300053084 Bacteria 6150
1484 Ga0495595_0022421 3300053084 Bacteria 2773
1485 Ga0495595_0245306 3300053084 Bacteria 896
1486 Ga0495619_0021688 3300053085 Bacteria 4103
1487 Ga0495619_0043631 3300053085 Bacteria 2940
1488 Ga0500650_0000375 3300053098 Bacteria 10900
1489 Ga0500555_047598 3300053103 Bacteria 1179
1490 Ga0500562_000052 3300053108 Bacteria 59070
1491 Ga0500562_035932 3300053108 Bacteria 1313
1492 Ga0500642_0002314 3300053130 Bacteria 5570
1493 Ga0500642_0050089 3300053130 Bacteria 1840
1494 Ga0500652_097351 3300053131 Bacteria 1229
1495 Ga0500559_0011496 3300053136 Bacteria 3781
1496 Ga0500604_0019975 3300053151 Bacteria 1881
1497 Ga0500616_0005724 3300053153 Bacteria 8365
1498 Ga0500616_0032008 3300053153 Bacteria 2876
1499 Ga0500552_000406 3300053733 Bacteria 3953
1500 Ga0501084_0000413 3300054114 Bacteria 33035
1501 Ga0501084_0269080 3300054114 Bacteria 1439
1502 Ga0501084_0304297 3300054114 Bacteria 1347
1503 Ga0501084_0645596 3300054114 Bacteria 894
1504 Ga0590071_006457 3300059421 Bacteria 2790
1505 Ga0501082_0015664 3300060353 Bacteria 6523
1506 Ga0501082_0044529 3300060353 Bacteria 3827
1507 Ga0501082_0157499 3300060353 Bacteria 1973
1508 Ga0466962_0014505 3300061719 Bacteria 3798
1509 Ga0530510_0162323 3300061734 Bacteria 1653

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050515 nmdc:mga0a205_105801_c1 nmdc:mga0a205_105801_c1_275_973 231
2 3300048907 Ga0496104_0118746 Ga0496104_0118746_859_1605 244
3 3300049585 Ga0501069_0025182 Ga0501069_0025182_2223_2990 246
4 iso_pu_bacteria 2738541273 2738700685 246
5 iso_pu_bacteria 2738543014 2739254434 246
6 3300061734 Ga0530510_0162323 Ga0530510_0162323_253_1128 248
7 iso_pu_bacteria 2511231026 2511385823 248
8 iso_pu_bacteria 2521172590 2521560062 248
9 iso_pu_bacteria 2551306416 2553008068 248
10 iso_pu_bacteria 2585428062 2587758444 248
11 iso_pu_bacteria 2643221644 2644244842 248
12 iso_pu_bacteria 2643221660 2644341106 248
13 iso_pu_bacteria 2808606373 2808906311 248
14 iso_pu_bacteria 2818991449 2819616425 248
15 iso_pu_bacteria 2904439833 2904440904 248
16 iso_pu_bacteria 2904530477 2904535506 248
17 iso_pu_bacteria 2904584206 2904588353 248
18 iso_pu_bacteria 2904589729 2904594759 248
19 iso_pu_bacteria 2904601388 2904606022 248
20 iso_pu_bacteria 2919046199 2919049071 248
21 iso_pu_bacteria 2919079590 2919084680 248
22 iso_pu_bacteria 2923510766 2923513793 248
23 iso_pu_bacteria 2928130867 2928134367 248
24 3300006178 Ga0075367_10027238 Ga0075367_100272383 249
25 3300021388 Ga0213875_10026941 Ga0213875_100269413 249
26 3300044712 Ga0453684_0105566 Ga0453684_0105566_102_893 249
27 3300046678 Ga0495599_0402882 Ga0495599_0402882_43_801 249
28 3300050494 nmdc:mga06z11_26757_c1 nmdc:mga06z11_26757_c1_796_1566 249
29 3300005356 Ga0070674_100142516 Ga0070674_1001425163 250
30 3300009101 Ga0105247_10316444 Ga0105247_103164442 250
31 3300009148 Ga0105243_10145723 Ga0105243_101457232 250
32 3300009553 Ga0105249_10032517 Ga0105249_100325174 250
33 3300021384 Ga0213876_10102796 Ga0213876_101027961 250
34 3300037312 Ga0395899_0000025 Ga0395899_0000025_221907_222662 250
35 3300037418 Ga0395900_0028750 Ga0395900_0028750_73_828 250
36 3300037853 Ga0436364_1187922 Ga0436364_1187922_347_1117 250
37 3300039437 Ga0436365_0299452 Ga0436365_0299452_367_1125 250
38 3300039438 Ga0436360_0606587 Ga0436360_0606587_872_1630 250
39 3300042001 Ga0439441_024973 Ga0439441_024973_315_1076 250
40 3300042876 Ga0451577_0001015 Ga0451577_0001015_26173_26928 250
41 3300044712 Ga0453684_0000009 Ga0453684_0000009_518991_519746 250
42 3300044901 Ga0466960_0234496 Ga0466960_0234496_205_984 250
43 3300048916 Ga0496113_0198384 Ga0496113_0198384_290_1045 250
44 3300048929 Ga0496126_0246307 Ga0496126_0246307_593_1351 250
45 3300049571 Ga0501034_0186525 Ga0501034_0186525_1075_1848 250
46 3300053103 Ga0500555_047598 Ga0500555_047598_368_1126 250
47 3300053108 Ga0500562_035932 Ga0500562_035932_339_1097 250
48 3300005327 Ga0070658_10016121 Ga0070658_100161218 251
49 3300005345 Ga0070692_10331746 Ga0070692_103317462 251
50 3300005435 Ga0070714_100869380 Ga0070714_1008693801 251
51 3300005445 Ga0070708_100000301 Ga0070708_10000030115 251
52 3300005539 Ga0068853_100680949 Ga0068853_1006809491 251
53 3300006178 Ga0075367_10073286 Ga0075367_100732864 251
54 3300006195 Ga0075366_10040495 Ga0075366_100404956 251
55 3300006353 Ga0075370_10107977 Ga0075370_101079773 251
56 3300006353 Ga0075370_10222138 Ga0075370_102221382 251
57 3300006847 Ga0075431_100047007 Ga0075431_1000470075 251
58 3300009098 Ga0105245_10850295 Ga0105245_108502952 251
59 3300021361 Ga0213872_10001084 Ga0213872_100010844 251
60 3300025922 Ga0207646_10118367 Ga0207646_101183673 251
61 3300026116 Ga0207674_10158271 Ga0207674_101582713 251
62 3300028653 Ga0265323_10094172 Ga0265323_100941722 251
63 3300031344 Ga0265316_10018469 Ga0265316_100184694 251
64 3300031344 Ga0265316_10118095 Ga0265316_101180951 251
65 3300031344 Ga0265316_10443151 Ga0265316_104431511 251
66 3300031711 Ga0265314_10046901 Ga0265314_100469013 251
67 3300032126 Ga0307415_100496728 Ga0307415_1004967282 251
68 3300035691 Ga0373931_0180127 Ga0373931_0180127_114_887 251
69 3300037853 Ga0436364_0001427 Ga0436364_0001427_841_1617 251
70 3300039437 Ga0436365_0345262 Ga0436365_0345262_424_1200 251
71 3300042876 Ga0451577_0003091 Ga0451577_0003091_1444_2208 251
72 3300042876 Ga0451577_0355078 Ga0451577_0355078_50_832 251
73 3300044684 Ga0466966_0013362 Ga0466966_0013362_4234_4995 251
74 3300044712 Ga0453684_0016566 Ga0453684_0016566_4002_4760 251
75 3300044712 Ga0453684_0067401 Ga0453684_0067401_1725_2486 251
76 3300044712 Ga0453684_0388020 Ga0453684_0388020_652_1413 251
77 3300045051 Ga0451576_0218916 Ga0451576_0218916_976_1776 251
78 3300045051 Ga0451576_0292685 Ga0451576_0292685_361_1119 251
79 3300045836 Ga0466958_0001258 Ga0466958_0001258_9064_9825 251
80 3300046517 Ga0495630_0019641 Ga0495630_0019641_960_1718 251
81 3300046663 Ga0495635_0119946 Ga0495635_0119946_200_961 251
82 3300046794 Ga0495589_0063290 Ga0495589_0063290_469_1227 251
83 3300048915 Ga0496112_0671763 Ga0496112_0671763_167_931 251
84 3300048929 Ga0496126_0030353 Ga0496126_0030353_3481_4239 251
85 3300049581 Ga0501047_0283247 Ga0501047_0283247_732_1490 251
86 3300049656 Ga0501209_000447 Ga0501209_000447_1805_2563 251
87 3300049744 Ga0501083_0000084 Ga0501083_0000084_42030_42788 251
88 3300050496 nmdc:mga07m45_93936_c1 nmdc:mga07m45_93936_c1_310_1071 251
89 3300050510 nmdc:mga06r32_69355_c1 nmdc:mga06r32_69355_c1_1623_2384 251
90 3300053130 Ga0500642_0002314 Ga0500642_0002314_3403_4167 251
91 3300053733 Ga0500552_000406 Ga0500552_000406_1045_1818 251
92 3300061719 Ga0466962_0014505 Ga0466962_0014505_1232_1993 251
93 iso_pu_bacteria 2671180139 2671693538 251
94 iso_pu_bacteria 2842698319 2842700866 251
95 iso_pu_bacteria 2902405164 2902410291 251
96 iso_pu_bacteria 2919450847 2919452818 251
97 iso_pu_bacteria 2939669807 2939673299 251
98 3300003751 Ga0055538_1000038 Ga0055538_1000038122 252
99 3300003752 Ga0055539_1000049 Ga0055539_1000049122 252
100 3300003756 Ga0055533_1000060 Ga0055533_1000060122 252
101 3300003759 Ga0055525_1000068 Ga0055525_100006873 252
102 3300003841 Ga0055541_1000036 Ga0055541_100003673 252
103 3300005329 Ga0070683_100067502 Ga0070683_1000675024 252
104 3300005445 Ga0070708_100009986 Ga0070708_1000099867 252
105 3300005445 Ga0070708_100207972 Ga0070708_1002079723 252
106 3300005445 Ga0070708_100627710 Ga0070708_1006277102 252
107 3300005467 Ga0070706_100000675 Ga0070706_1000006755 252
108 3300005467 Ga0070706_100001950 Ga0070706_10000195014 252
109 3300005467 Ga0070706_100126979 Ga0070706_1001269792 252
110 3300005468 Ga0070707_100002396 Ga0070707_10000239612 252
111 3300005471 Ga0070698_100018223 Ga0070698_1000182236 252
112 3300005471 Ga0070698_100445832 Ga0070698_1004458321 252
113 3300005518 Ga0070699_100002387 Ga0070699_10000238710 252
114 3300005518 Ga0070699_100254187 Ga0070699_1002541872 252
115 3300005535 Ga0070684_100129164 Ga0070684_1001291643 252
116 3300005536 Ga0070697_100012683 Ga0070697_1000126837 252
117 3300005577 Ga0068857_100053732 Ga0068857_1000537323 252
118 3300005843 Ga0068860_100115367 Ga0068860_1001153673 252
119 3300006028 Ga0070717_10327078 Ga0070717_103270782 252
120 3300006048 Ga0075363_100064189 Ga0075363_1000641892 252
121 3300006178 Ga0075367_10075508 Ga0075367_100755082 252
122 3300006871 Ga0075434_100297456 Ga0075434_1002974562 252
123 3300009093 Ga0105240_10103759 Ga0105240_101037597 252
124 3300009545 Ga0105237_10258586 Ga0105237_102585862 252
125 3300009551 Ga0105238_10000037 Ga0105238_1000003719 252
126 3300010375 Ga0105239_10003694 Ga0105239_1000369418 252
127 3300013296 Ga0157374_10201408 Ga0157374_102014083 252
128 3300017792 Ga0163161_10055657 Ga0163161_100556573 252
129 3300025224 Ga0209784_100021 Ga0209784_100021222 252
130 3300025225 Ga0209566_100039 Ga0209566_100039223 252
131 3300025226 Ga0209674_100036 Ga0209674_100036222 252
132 3300025230 Ga0209563_100040 Ga0209563_100040222 252
133 3300025250 Ga0209026_1004124 Ga0209026_10041245 252
134 3300025253 Ga0209677_100023 Ga0209677_100023222 252
135 3300025291 Ga0209675_1004204 Ga0209675_10042044 252
136 3300025910 Ga0207684_10018222 Ga0207684_100182222 252
137 3300025910 Ga0207684_10019787 Ga0207684_100197874 252
138 3300025913 Ga0207695_10004822 Ga0207695_100048227 252
139 3300025914 Ga0207671_10029655 Ga0207671_100296553 252
140 3300025915 Ga0207693_10010921 Ga0207693_100109213 252
141 3300025915 Ga0207693_10307327 Ga0207693_103073273 252
142 3300025918 Ga0207662_10038480 Ga0207662_100384802 252
143 3300025922 Ga0207646_10002645 Ga0207646_100026458 252
144 3300025922 Ga0207646_10010060 Ga0207646_100100603 252
145 3300025924 Ga0207694_10000054 Ga0207694_1000005420 252
146 3300025928 Ga0207700_10177607 Ga0207700_101776072 252
147 3300025939 Ga0207665_10319162 Ga0207665_103191622 252
148 3300025949 Ga0207667_10000043 Ga0207667_1000004319 252
149 3300025949 Ga0207667_10008425 Ga0207667_1000842514 252
150 3300025981 Ga0207640_10047283 Ga0207640_100472834 252
151 3300026116 Ga0207674_10141753 Ga0207674_101417532 252
152 3300026116 Ga0207674_10317004 Ga0207674_103170042 252
153 3300028381 Ga0268264_10124342 Ga0268264_101243422 252
154 3300028556 Ga0265337_1012674 Ga0265337_10126743 252
155 3300028653 Ga0265323_10014974 Ga0265323_100149743 252
156 3300028653 Ga0265323_10069988 Ga0265323_100699882 252
157 3300028654 Ga0265322_10034269 Ga0265322_100342692 252
158 3300028794 Ga0307515_10001873 Ga0307515_1000187312 252
159 3300028794 Ga0307515_10010443 Ga0307515_1001044319 252
160 3300028794 Ga0307515_10020861 Ga0307515_1002086112 252
161 3300028800 Ga0265338_10014668 Ga0265338_100146685 252
162 3300029957 Ga0265324_10000134 Ga0265324_1000013426 252
163 3300029957 Ga0265324_10008346 Ga0265324_100083463 252
164 3300030522 Ga0307512_10095322 Ga0307512_100953223 252
165 3300031235 Ga0265330_10000949 Ga0265330_1000094919 252
166 3300031235 Ga0265330_10001677 Ga0265330_100016773 252
167 3300031235 Ga0265330_10010021 Ga0265330_100100212 252
168 3300031238 Ga0265332_10017861 Ga0265332_100178613 252
169 3300031239 Ga0265328_10003483 Ga0265328_100034833 252
170 3300031240 Ga0265320_10003883 Ga0265320_100038832 252
171 3300031240 Ga0265320_10008484 Ga0265320_100084842 252
172 3300031241 Ga0265325_10007036 Ga0265325_100070363 252
173 3300031242 Ga0265329_10000004 Ga0265329_1000000435 252
174 3300031247 Ga0265340_10000043 Ga0265340_1000004316 252
175 3300031249 Ga0265339_10000010 Ga0265339_1000001029 252
176 3300031249 Ga0265339_10000982 Ga0265339_1000098212 252
177 3300031249 Ga0265339_10005541 Ga0265339_100055413 252
178 3300031249 Ga0265339_10013410 Ga0265339_100134103 252
179 3300031250 Ga0265331_10003155 Ga0265331_100031557 252
180 3300031344 Ga0265316_10000046 Ga0265316_1000004662 252
181 3300031344 Ga0265316_10009372 Ga0265316_100093729 252
182 3300031344 Ga0265316_10014941 Ga0265316_100149418 252
183 3300031344 Ga0265316_10269487 Ga0265316_102694872 252
184 3300031456 Ga0307513_10152482 Ga0307513_101524822 252
185 3300031595 Ga0265313_10003430 Ga0265313_100034307 252
186 3300031595 Ga0265313_10022527 Ga0265313_100225272 252
187 3300031616 Ga0307508_10000053 Ga0307508_1000005381 252
188 3300031711 Ga0265314_10000008 Ga0265314_10000008116 252
189 3300031711 Ga0265314_10002294 Ga0265314_100022949 252
190 3300031711 Ga0265314_10002874 Ga0265314_100028743 252
191 3300031711 Ga0265314_10049587 Ga0265314_100495872 252
192 3300031711 Ga0265314_10126530 Ga0265314_101265302 252
193 3300031712 Ga0265342_10000048 Ga0265342_1000004895 252
194 3300031712 Ga0265342_10000171 Ga0265342_1000017137 252
195 3300031712 Ga0265342_10000465 Ga0265342_1000046519 252
196 3300031712 Ga0265342_10001286 Ga0265342_1000128617 252
197 3300031712 Ga0265342_10055814 Ga0265342_100558142 252
198 3300031728 Ga0316578_10179638 Ga0316578_101796381 252
199 3300031730 Ga0307516_10005097 Ga0307516_1000509710 252
200 3300031731 Ga0307405_10513353 Ga0307405_105133532 252
201 3300031911 Ga0307412_10095110 Ga0307412_100951102 252
202 3300033179 Ga0307507_10088285 Ga0307507_100882854 252
203 3300035172 Ga0373955_0061554 Ga0373955_0061554_830_1615 252
204 3300035724 Ga0373933_0005874 Ga0373933_0005874_3083_3868 252
205 3300035725 Ga0373947_0206908 Ga0373947_0206908_413_1198 252
206 3300037068 Ga0373925_0098718 Ga0373925_0098718_162_947 252
207 3300037068 Ga0373925_0147634 Ga0373925_0147634_367_1155 252
208 3300037471 Ga0395905_0344608 Ga0395905_0344608_555_1319 252
209 3300038443 Ga0395901_0131413 Ga0395901_0131413_277_1041 252
210 3300039438 Ga0436360_0694350 Ga0436360_0694350_926_1690 252
211 3300039447 Ga0436361_0704696 Ga0436361_0704696_10577_11341 252
212 3300042876 Ga0451577_0339237 Ga0451577_0339237_213_989 252
213 3300044658 Ga0466972_0011154 Ga0466972_0011154_3512_4276 252
214 3300044683 Ga0466965_0004436 Ga0466965_0004436_2807_3571 252
215 3300044712 Ga0453684_0122058 Ga0453684_0122058_1663_2427 252
216 3300044712 Ga0453684_0134345 Ga0453684_0134345_57_821 252
217 3300044842 Ga0466957_0024690 Ga0466957_0024690_2415_3179 252
218 3300046507 Ga0495606_0025241 Ga0495606_0025241_3369_4133 252
219 3300046512 Ga0495610_0025793 Ga0495610_0025793_435_1196 252
220 3300046519 Ga0495632_0072815 Ga0495632_0072815_554_1315 252
221 3300046522 Ga0495643_0002216 Ga0495643_0002216_11304_12068 252
222 3300046528 Ga0495642_0101026 Ga0495642_0101026_38_802 252
223 3300046542 Ga0495597_0060552 Ga0495597_0060552_791_1555 252
224 3300046660 Ga0495625_0001672 Ga0495625_0001672_3828_4589 252
225 3300047443 Ga0495687_003465 Ga0495687_003465_7579_8343 252
226 3300047443 Ga0495687_012354 Ga0495687_012354_583_1347 252
227 3300048903 Ga0496100_0412644 Ga0496100_0412644_49_813 252
228 3300048918 Ga0496115_0349899 Ga0496115_0349899_168_932 252
229 3300048924 Ga0496121_0072309 Ga0496121_0072309_577_1341 252
230 3300049569 Ga0501032_0268913 Ga0501032_0268913_122_895 252
231 3300049574 Ga0501038_0305761 Ga0501038_0305761_22_786 252
232 3300049584 Ga0501068_0161639 Ga0501068_0161639_52_825 252
233 3300050491 nmdc:mga00v17_164738_c1 nmdc:mga00v17_164738_c1_54_830 252
234 3300050493 nmdc:mga0k408_177122_c1 nmdc:mga0k408_177122_c1_485_1246 252
235 3300050493 nmdc:mga0k408_80326_c1 nmdc:mga0k408_80326_c1_958_1719 252
236 3300050494 nmdc:mga06z11_3256_c1 nmdc:mga06z11_3256_c1_5261_6079 252
237 3300050496 nmdc:mga07m45_51257_c2 nmdc:mga07m45_51257_c2_54_830 252
238 3300050516 nmdc:mga0sz30_65123_c1 nmdc:mga0sz30_65123_c1_557_1333 252
239 3300053108 Ga0500562_000052 Ga0500562_000052_14951_15712 252
240 3300053153 Ga0500616_0005724 Ga0500616_0005724_1957_2733 252
241 3300054114 Ga0501084_0645596 Ga0501084_0645596_27_800 252
242 iso_pu_bacteria 2508501125 2509130778 252
243 iso_pu_bacteria 2510065045 2510252518 252
244 iso_pu_bacteria 2510065053 2510283078 252
245 iso_pu_bacteria 2510065055 2510293752 252
246 iso_pu_bacteria 2510065058 2510310642 252
247 iso_pu_bacteria 2512047030 2512348375 252
248 iso_pu_bacteria 2513237151 2513962666 252
249 iso_pu_bacteria 2513237166 2514050834 252
250 iso_pu_bacteria 2515154122 2515684795 252
251 iso_pu_bacteria 2526164713 2527079962 252
252 iso_pu_bacteria 2554235132 2554818189 252
253 iso_pu_bacteria 2554235231 2555247004 252
254 iso_pu_bacteria 2562617112 2563061595 252
255 iso_pu_bacteria 2582581311 2585294088 252
256 iso_pu_bacteria 2597489888 2597861562 252
257 iso_pu_bacteria 2597489889 2597867283 252
258 iso_pu_bacteria 2599185167 2599398962 252
259 iso_pu_bacteria 2599185179 2599451014 252
260 iso_pu_bacteria 2599185189 2599506333 252
261 iso_pu_bacteria 2599185190 2599514040 252
262 iso_pu_bacteria 2599185191 2599518638 252
263 iso_pu_bacteria 2599185239 2599741107 252
264 iso_pu_bacteria 2599185240 2599748414 252
265 iso_pu_bacteria 2599185288 2599882555 252
266 iso_pu_bacteria 2599185290 2599893625 252
267 iso_pu_bacteria 2599185303 2599950527 252
268 iso_pu_bacteria 2599185307 2599972239 252
269 iso_pu_bacteria 2599185311 2599996094 252
270 iso_pu_bacteria 2599185355 2600210326 252
271 iso_pu_bacteria 2600254954 2600445748 252
272 iso_pu_bacteria 2600255067 2600813858 252
273 iso_pu_bacteria 2600255283 2601627328 252
274 iso_pu_bacteria 2600255296 2601692244 252
275 iso_pu_bacteria 2600255389 2602011132 252
276 iso_pu_bacteria 2606217733 2608380513 252
277 iso_pu_bacteria 2619619299 2621302275 252
278 iso_pu_bacteria 2643221571 2643872722 252
279 iso_pu_bacteria 2643221591 2643966626 252
280 iso_pu_bacteria 2643221713 2644619545 252
281 iso_pu_bacteria 2675903129 2676745749 252
282 iso_pu_bacteria 2675903420 2677898318 252
283 iso_pu_bacteria 2711768613 2713478539 252
284 iso_pu_bacteria 2718217991 2719641616 252
285 iso_pu_bacteria 2721755607 2723246450 252
286 iso_pu_bacteria 2728369097 2729146772 252
287 iso_pu_bacteria 2738541265 2738674938 252
288 iso_pu_bacteria 2738541271 2738691924 252
289 iso_pu_bacteria 2738541282 2738753331 252
290 iso_pu_bacteria 2738541294 2738808022 252
291 iso_pu_bacteria 2738541296 2738823959 252
292 iso_pu_bacteria 2738541298 2738836350 252
293 iso_pu_bacteria 2738541303 2738862530 252
294 iso_pu_bacteria 2738541306 2738877880 252
295 iso_pu_bacteria 2738541309 2738895382 252
296 iso_pu_bacteria 2738543002 2739189586 252
297 iso_pu_bacteria 2738543008 2739224473 252
298 iso_pu_bacteria 2738543016 2739263326 252
299 iso_pu_bacteria 2738543020 2739287152 252
300 iso_pu_bacteria 2738543021 2739292465 252
301 iso_pu_bacteria 2744054900 2746087293 252
302 iso_pu_bacteria 2744054901 2746093200 252
303 iso_pu_bacteria 2751185846 2753566133 252
304 iso_pu_bacteria 2773857672 2774131223 252
305 iso_pu_bacteria 2791355137 2792837001 252
306 iso_pu_bacteria 2808606384 2808972918 252
307 iso_pu_bacteria 2808606385 2808976768 252
308 iso_pu_bacteria 2808606388 2808991794 252
309 iso_pu_bacteria 2808606390 2809007917 252
310 iso_pu_bacteria 2808606391 2809015443 252
311 iso_pu_bacteria 2811994881 2812370075 252
312 iso_pu_bacteria 2816332253 2817259767 252
313 iso_pu_bacteria 2816332256 2817277436 252
314 iso_pu_bacteria 2816332286 2817453602 252
315 iso_pu_bacteria 2816332298 2817488299 252
316 iso_pu_bacteria 2818991452 2819636863 252
317 iso_pu_bacteria 2826581358 2826582947 252
318 iso_pu_bacteria 2834028612 2834032313 252
319 iso_pu_bacteria 2842324504 2842332117 252
320 iso_pu_bacteria 2842348783 2842356431 252
321 iso_pu_bacteria 2842454564 2842461215 252
322 iso_pu_bacteria 2842805378 2842809828 252
323 iso_pu_bacteria 2842815866 2842820011 252
324 iso_pu_bacteria 2842826826 2842830615 252
325 iso_pu_bacteria 2842837860 2842838518 252
326 iso_pu_bacteria 2842849001 2842851485 252
327 iso_pu_bacteria 2852612431 2852616969 252
328 iso_pu_bacteria 2852667396 2852672042 252
329 iso_pu_bacteria 2860867994 2860868342 252
330 iso_pu_bacteria 2863421361 2863426431 252
331 iso_pu_bacteria 2870068957 2870069337 252
332 iso_pu_bacteria 2885270888 2885272428 252
333 iso_pu_bacteria 2900634093 2900637140 252
334 iso_pu_bacteria 2902682994 2902686743 252
335 iso_pu_bacteria 2904483920 2904490186 252
336 iso_pu_bacteria 2904564687 2904569404 252
337 iso_pu_bacteria 2904571731 2904576759 252
338 iso_pu_bacteria 2904615490 2904621501 252
339 iso_pu_bacteria 2908446538 2908446924 252
340 iso_pu_bacteria 2917832318 2917837026 252
341 iso_pu_bacteria 2919125081 2919127163 252
342 iso_pu_bacteria 2919501602 2919505804 252
343 iso_pu_bacteria 2919527303 2919533355 252
344 iso_pu_bacteria 2921643360 2921647681 252
345 iso_pu_bacteria 2923519811 2923524161 252
346 iso_pu_bacteria 2926063275 2926067919 252
347 iso_pu_bacteria 2928108538 2928114143 252
348 iso_pu_bacteria 2928135762 2928141109 252
349 iso_pu_bacteria 2928157003 2928163111 252
350 iso_pu_bacteria 2928163908 2928170139 252
351 iso_pu_bacteria 2928170801 2928176269 252
352 iso_pu_bacteria 2928503688 2928509138 252
353 iso_pu_bacteria 2928536128 2928542081 252
354 iso_pu_bacteria 2929189879 2929190200 252
355 iso_pu_bacteria 2931390751 2931391269 252
356 iso_pu_bacteria 2945928738 2945930282 252
357 iso_pu_bacteria 2945934425 2945934497 252
358 iso_pu_bacteria 2945961074 2945967489 252
359 iso_pu_bacteria 2946006987 2946012619 252
360 iso_pu_bacteria 2946027586 2946028541 252
361 iso_pu_bacteria 2947233263 2947235073 252
362 iso_pu_bacteria 2974298342 2974302709 252
363 iso_pu_bacteria 2981990288 2981996042 252
364 iso_pu_bacteria 2984499530 2984499705 252
365 iso_pu_bacteria 2984504281 2984506085 252
366 iso_pu_bacteria 2990196909 2990197564 252
367 iso_pu_bacteria 2990703756 2990704944 252
368 iso_pu_bacteria 3007614139 3007617432 252
369 iso_pu_bacteria 641736151 642426608 252
370 iso_pu_bacteria 641736154 642416508 252
371 iso_pu_bacteria 642555112 642594549 252
372 iso_pu_bacteria 642555113 642623134 252
373 iso_pu_bacteria 8016728285 8016731939 252
374 iso_pu_bacteria 8018845410 8018847994 252
375 iso_pu_bacteria 8020807995 8020813979 252
376 iso_pu_bacteria 8020938398 8020938981 252
377 iso_pu_bacteria 8020945358 8020947697 252
378 iso_pu_bacteria 8020953355 8020953472 252
379 iso_pu_bacteria 8021120328 8021127578 252
380 iso_pu_bacteria 8034962539 8034966544 252
381 iso_pu_bacteria 8039098773 8039099728 252
382 iso_pu_bacteria 8040167225 8040171556 252
383 iso_pu_bacteria 8040173305 8040174170 252
384 iso_pu_bacteria 8054285046 8054286097 252
385 iso_pu_bacteria 8054347763 8054350227 252
386 iso_pu_bacteria 8054503363 8054503846 252
387 iso_pu_bacteria 8055266321 8055269494 252
388 iso_pu_bacteria 8055301274 8055307344 252
389 iso_pu_bacteria 8055817908 8055818247 252
390 iso_pu_bacteria 8056131705 8056132230 252
391 iso_pu_bacteria 8056148874 8056152372 252
392 iso_pu_bacteria 8056161164 8056164229 252
393 3300005330 Ga0070690_100003073 Ga0070690_1000030733 253
394 3300005337 Ga0070682_100126100 Ga0070682_1001261002 253
395 3300005340 Ga0070689_100036969 Ga0070689_1000369693 253
396 3300005340 Ga0070689_100039277 Ga0070689_1000392773 253
397 3300005343 Ga0070687_100002682 Ga0070687_1000026825 253
398 3300005345 Ga0070692_10030730 Ga0070692_100307304 253
399 3300005353 Ga0070669_100043163 Ga0070669_1000431634 253
400 3300005356 Ga0070674_100239156 Ga0070674_1002391562 253
401 3300005364 Ga0070673_100000620 Ga0070673_10000062011 253
402 3300005365 Ga0070688_100010556 Ga0070688_1000105563 253
403 3300005445 Ga0070708_100058087 Ga0070708_1000580873 253
404 3300005458 Ga0070681_10022668 Ga0070681_100226687 253
405 3300005459 Ga0068867_100005433 Ga0068867_1000054332 253
406 3300005459 Ga0068867_100043008 Ga0068867_1000430082 253
407 3300005471 Ga0070698_100021077 Ga0070698_1000210774 253
408 3300005518 Ga0070699_100019780 Ga0070699_1000197802 253
409 3300005530 Ga0070679_100014023 Ga0070679_1000140237 253
410 3300005530 Ga0070679_100014273 Ga0070679_1000142734 253
411 3300005530 Ga0070679_100098050 Ga0070679_1000980502 253
412 3300005536 Ga0070697_100054173 Ga0070697_1000541734 253
413 3300005543 Ga0070672_100021623 Ga0070672_1000216233 253
414 3300005544 Ga0070686_100001282 Ga0070686_1000012825 253
415 3300005614 Ga0068856_100398169 Ga0068856_1003981692 253
416 3300005718 Ga0068866_10116709 Ga0068866_101167092 253
417 3300005841 Ga0068863_100214669 Ga0068863_1002146693 253
418 3300005841 Ga0068863_100429489 Ga0068863_1004294892 253
419 3300005842 Ga0068858_100021735 Ga0068858_1000217357 253
420 3300005844 Ga0068862_100262270 Ga0068862_1002622702 253
421 3300005937 Ga0081455_10222811 Ga0081455_102228112 253
422 3300005983 Ga0081540_1006469 Ga0081540_10064696 253
423 3300006195 Ga0075366_10258459 Ga0075366_102584591 253
424 3300006871 Ga0075434_100008839 Ga0075434_10000883910 253
425 3300006881 Ga0068865_100000463 Ga0068865_10000046310 253
426 3300006914 Ga0075436_100199569 Ga0075436_1001995692 253
427 3300009147 Ga0114129_10940148 Ga0114129_109401481 253
428 3300009553 Ga0105249_10181359 Ga0105249_101813593 253
429 3300013297 Ga0157378_10114219 Ga0157378_101142192 253
430 3300025901 Ga0207688_10270571 Ga0207688_102705712 253
431 3300025907 Ga0207645_10002491 Ga0207645_1000249110 253
432 3300025910 Ga0207684_10236181 Ga0207684_102361812 253
433 3300025912 Ga0207707_10011890 Ga0207707_100118907 253
434 3300025918 Ga0207662_10005509 Ga0207662_100055092 253
435 3300025921 Ga0207652_10006010 Ga0207652_100060104 253
436 3300025922 Ga0207646_10030001 Ga0207646_100300013 253
437 3300025923 Ga0207681_10016535 Ga0207681_100165354 253
438 3300025929 Ga0207664_10616399 Ga0207664_106163992 253
439 3300025936 Ga0207670_10004256 Ga0207670_100042567 253
440 3300025936 Ga0207670_10114254 Ga0207670_101142542 253
441 3300025938 Ga0207704_10033009 Ga0207704_100330092 253
442 3300025939 Ga0207665_10362970 Ga0207665_103629701 253
443 3300025940 Ga0207691_10182104 Ga0207691_101821042 253
444 3300025944 Ga0207661_10260714 Ga0207661_102607142 253
445 3300025960 Ga0207651_10009202 Ga0207651_100092022 253
446 3300025972 Ga0207668_10034688 Ga0207668_100346882 253
447 3300026088 Ga0207641_10146083 Ga0207641_101460833 253
448 3300026089 Ga0207648_10008005 Ga0207648_1000800510 253
449 3300026116 Ga0207674_10137814 Ga0207674_101378142 253
450 3300026118 Ga0207675_100367975 Ga0207675_1003679752 253
451 3300026118 Ga0207675_100659210 Ga0207675_1006592102 253
452 3300026142 Ga0207698_10128635 Ga0207698_101286352 253
453 3300028380 Ga0268265_10270496 Ga0268265_102704962 253
454 3300028381 Ga0268264_10020417 Ga0268264_100204172 253
455 3300031456 Ga0307513_10243994 Ga0307513_102439942 253
456 3300032005 Ga0307411_10355928 Ga0307411_103559281 253
457 3300039450 Ga0436363_1483284 Ga0436363_1483284_179_961 253
458 3300044693 Ga0466961_0260480 Ga0466961_0260480_195_974 253
459 3300044693 Ga0466961_0356678 Ga0466961_0356678_32_814 253
460 3300044694 Ga0466963_0006323 Ga0466963_0006323_319_1098 253
461 3300044706 Ga0466964_0090707 Ga0466964_0090707_417_1196 253
462 3300044719 Ga0466971_0021297 Ga0466971_0021297_29_808 253
463 3300044842 Ga0466957_0146104 Ga0466957_0146104_516_1295 253
464 3300045049 Ga0466959_0119380 Ga0466959_0119380_825_1607 253
465 3300045051 Ga0451576_0117052 Ga0451576_0117052_1714_2487 253
466 3300045051 Ga0451576_0207630 Ga0451576_0207630_113_892 253
467 3300045836 Ga0466958_0103154 Ga0466958_0103154_90_869 253
468 3300046679 Ga0495623_0100027 Ga0495623_0100027_379_1161 253
469 3300048910 Ga0496107_0270261 Ga0496107_0270261_49_822 253
470 3300048911 Ga0496108_0499148 Ga0496108_0499148_77_859 253
471 3300048924 Ga0496121_0020087 Ga0496121_0020087_3575_4354 253
472 3300048927 Ga0496124_0000108 Ga0496124_0000108_139990_140769 253
473 3300048928 Ga0496125_0008324 Ga0496125_0008324_2178_2957 253
474 3300050493 nmdc:mga0k408_129707_c1 nmdc:mga0k408_129707_c1_177_956 253
475 3300050511 nmdc:mga08y16_638094_c1 nmdc:mga08y16_638094_c1_100_864 253
476 3300050512 nmdc:mga0n895_57547_c1 nmdc:mga0n895_57547_c1_1546_2316 253
477 3300005330 Ga0070690_100082320 Ga0070690_1000823204 254
478 3300005335 Ga0070666_10027412 Ga0070666_100274123 254
479 3300005364 Ga0070673_100521336 Ga0070673_1005213362 254
480 3300005436 Ga0070713_100338234 Ga0070713_1003382342 254
481 3300005439 Ga0070711_100504944 Ga0070711_1005049441 254
482 3300005530 Ga0070679_100014417 Ga0070679_1000144176 254
483 3300005543 Ga0070672_100110384 Ga0070672_1001103843 254
484 3300005563 Ga0068855_100216195 Ga0068855_1002161952 254
485 3300005614 Ga0068856_100079027 Ga0068856_1000790276 254
486 3300005617 Ga0068859_100103229 Ga0068859_1001032292 254
487 3300005834 Ga0068851_10038719 Ga0068851_100387193 254
488 3300005842 Ga0068858_100035861 Ga0068858_1000358614 254
489 3300005844 Ga0068862_100550588 Ga0068862_1005505882 254
490 3300006237 Ga0097621_100015272 Ga0097621_1000152726 254
491 3300006358 Ga0068871_100531551 Ga0068871_1005315512 254
492 3300006846 Ga0075430_100037292 Ga0075430_1000372921 254
493 3300006847 Ga0075431_100000766 Ga0075431_10000076618 254
494 3300006880 Ga0075429_100046650 Ga0075429_1000466505 254
495 3300006931 Ga0097620_100103222 Ga0097620_1001032226 254
496 3300009093 Ga0105240_10616615 Ga0105240_106166151 254
497 3300009094 Ga0111539_10083256 Ga0111539_100832562 254
498 3300009094 Ga0111539_10526935 Ga0111539_105269352 254
499 3300009098 Ga0105245_10199064 Ga0105245_101990643 254
500 3300009177 Ga0105248_10095787 Ga0105248_100957875 254
501 3300013296 Ga0157374_10182419 Ga0157374_101824192 254
502 3300013297 Ga0157378_10037095 Ga0157378_100370954 254
503 3300013306 Ga0163162_10232003 Ga0163162_102320034 254
504 3300013308 Ga0157375_10057467 Ga0157375_100574675 254
505 3300014325 Ga0163163_10051441 Ga0163163_100514411 254
506 3300014968 Ga0157379_10030536 Ga0157379_100305368 254
507 3300014969 Ga0157376_10041971 Ga0157376_100419715 254
508 3300020082 Ga0206353_11407798 Ga0206353_114077982 254
509 3300025926 Ga0207659_10030526 Ga0207659_100305264 254
510 3300025933 Ga0207706_10226294 Ga0207706_102262942 254
511 3300025934 Ga0207686_10012980 Ga0207686_100129803 254
512 3300025937 Ga0207669_10284058 Ga0207669_102840582 254
513 3300026035 Ga0207703_10086473 Ga0207703_100864732 254
514 3300026089 Ga0207648_10042868 Ga0207648_100428682 254
515 3300026089 Ga0207648_10246171 Ga0207648_102461711 254
516 3300026121 Ga0207683_10069976 Ga0207683_100699764 254
517 3300028379 Ga0268266_10079585 Ga0268266_100795854 254
518 3300028380 Ga0268265_10115957 Ga0268265_101159572 254
519 3300031665 Ga0316575_10025801 Ga0316575_100258014 254
520 3300031711 Ga0265314_10004332 Ga0265314_100043323 254
521 3300031727 Ga0316576_10119682 Ga0316576_101196822 254
522 3300031728 Ga0316578_10030993 Ga0316578_100309934 254
523 3300032133 Ga0316583_10010602 Ga0316583_100106023 254
524 3300032137 Ga0316585_10006317 Ga0316585_100063173 254
525 3300035117 Ga0373953_0101754 Ga0373953_0101754_327_1118 254
526 3300035117 Ga0373953_0118001 Ga0373953_0118001_55_831 254
527 3300035118 Ga0373954_0030168 Ga0373954_0030168_25_813 254
528 3300035119 Ga0373956_0051238 Ga0373956_0051238_673_1461 254
529 3300035120 Ga0373957_0034962 Ga0373957_0034962_301_1089 254
530 3300035172 Ga0373955_0090811 Ga0373955_0090811_48_836 254
531 3300035398 Ga0316574_0091960 Ga0316574_0091960_91_858 254
532 3300035724 Ga0373933_0042623 Ga0373933_0042623_414_1190 254
533 3300035724 Ga0373933_0175115 Ga0373933_0175115_418_1206 254
534 3300035724 Ga0373933_0359263 Ga0373933_0359263_61_861 254
535 3300036401 Ga0373937_0001254 Ga0373937_0001254_5793_6581 254
536 3300036401 Ga0373937_0184345 Ga0373937_0184345_353_1141 254
537 3300036401 Ga0373937_0368203 Ga0373937_0368203_92_880 254
538 3300036647 Ga0316582_0026501 Ga0316582_0026501_2450_3217 254
539 3300036712 Ga0316584_0011567 Ga0316584_0011567_4022_4789 254
540 3300037471 Ga0395905_0082903 Ga0395905_0082903_1453_2262 254
541 3300037471 Ga0395905_0213367 Ga0395905_0213367_223_1017 254
542 3300048909 Ga0496106_0106952 Ga0496106_0106952_1031_1801 254
543 3300048910 Ga0496107_0061224 Ga0496107_0061224_69_869 254
544 3300048911 Ga0496108_0179872 Ga0496108_0179872_1009_1779 254
545 3300048917 Ga0496114_0002636 Ga0496114_0002636_9864_10658 254
546 3300048917 Ga0496114_0068547 Ga0496114_0068547_836_1606 254
547 3300048917 Ga0496114_0369877 Ga0496114_0369877_71_841 254
548 3300049583 Ga0501067_0014311 Ga0501067_0014311_1242_2033 254
549 3300049584 Ga0501068_0437617 Ga0501068_0437617_23_814 254
550 3300049741 Ga0501079_0624047 Ga0501079_0624047_37_810 254
551 3300049776 Ga0501280_000724 Ga0501280_000724_3613_4383 254
552 3300049778 Ga0501282_000631 Ga0501282_000631_433_1203 254
553 3300050508 nmdc:mga09592_47800_c1 nmdc:mga09592_47800_c1_1401_2171 254
554 3300050509 nmdc:mga0qj67_22237_c1 nmdc:mga0qj67_22237_c1_1496_2266 254
555 3300050510 nmdc:mga06r32_10171_c1 nmdc:mga06r32_10171_c1_3964_4734 254
556 3300050511 nmdc:mga08y16_68226_c1 nmdc:mga08y16_68226_c1_2625_3395 254
557 3300050511 nmdc:mga08y16_820193_c1 nmdc:mga08y16_820193_c1_92_862 254
558 3300053084 Ga0495595_0245306 Ga0495595_0245306_10_798 254
559 3300059421 Ga0590071_006457 Ga0590071_006457_161_952 254
560 3300003203 JGI25406J46586_10009582 JGI25406J46586_100095825 255
561 3300005295 Ga0065707_10003041 Ga0065707_100030412 255
562 3300005327 Ga0070658_10004543 Ga0070658_100045437 255
563 3300005329 Ga0070683_100001760 Ga0070683_10000176012 255
564 3300005329 Ga0070683_100178539 Ga0070683_1001785391 255
565 3300005331 Ga0070670_100004565 Ga0070670_1000045659 255
566 3300005333 Ga0070677_10091714 Ga0070677_100917141 255
567 3300005336 Ga0070680_100378244 Ga0070680_1003782442 255
568 3300005337 Ga0070682_100042623 Ga0070682_1000426232 255
569 3300005337 Ga0070682_100201650 Ga0070682_1002016502 255
570 3300005338 Ga0068868_100355321 Ga0068868_1003553212 255
571 3300005340 Ga0070689_100000017 Ga0070689_10000001733 255
572 3300005355 Ga0070671_100326186 Ga0070671_1003261862 255
573 3300005356 Ga0070674_100009439 Ga0070674_1000094392 255
574 3300005356 Ga0070674_100017948 Ga0070674_1000179486 255
575 3300005356 Ga0070674_100374530 Ga0070674_1003745301 255
576 3300005364 Ga0070673_100022396 Ga0070673_1000223963 255
577 3300005366 Ga0070659_100231168 Ga0070659_1002311682 255
578 3300005366 Ga0070659_100543731 Ga0070659_1005437311 255
579 3300005367 Ga0070667_100082688 Ga0070667_1000826883 255
580 3300005406 Ga0070703_10071547 Ga0070703_100715472 255
581 3300005434 Ga0070709_10067503 Ga0070709_100675034 255
582 3300005435 Ga0070714_100239131 Ga0070714_1002391312 255
583 3300005436 Ga0070713_100063796 Ga0070713_1000637964 255
584 3300005439 Ga0070711_100015814 Ga0070711_1000158141 255
585 3300005445 Ga0070708_100553667 Ga0070708_1005536671 255
586 3300005455 Ga0070663_100133146 Ga0070663_1001331463 255
587 3300005458 Ga0070681_10006771 Ga0070681_1000677111 255
588 3300005458 Ga0070681_10079056 Ga0070681_100790563 255
589 3300005458 Ga0070681_10133753 Ga0070681_101337533 255
590 3300005466 Ga0070685_10173695 Ga0070685_101736952 255
591 3300005468 Ga0070707_100216066 Ga0070707_1002160662 255
592 3300005518 Ga0070699_100538822 Ga0070699_1005388221 255
593 3300005530 Ga0070679_100025092 Ga0070679_1000250923 255
594 3300005530 Ga0070679_100192113 Ga0070679_1001921131 255
595 3300005530 Ga0070679_100342278 Ga0070679_1003422782 255
596 3300005536 Ga0070697_100001239 Ga0070697_10000123919 255
597 3300005543 Ga0070672_100079752 Ga0070672_1000797522 255
598 3300005545 Ga0070695_100015052 Ga0070695_1000150521 255
599 3300005546 Ga0070696_100082908 Ga0070696_1000829082 255
600 3300005563 Ga0068855_100028719 Ga0068855_1000287196 255
601 3300005563 Ga0068855_100051124 Ga0068855_1000511243 255
602 3300005563 Ga0068855_100756845 Ga0068855_1007568452 255
603 3300005564 Ga0070664_100052183 Ga0070664_1000521835 255
604 3300005577 Ga0068857_100081747 Ga0068857_1000817473 255
605 3300005614 Ga0068856_100101735 Ga0068856_1001017353 255
606 3300005616 Ga0068852_100270227 Ga0068852_1002702272 255
607 3300005718 Ga0068866_10234347 Ga0068866_102343471 255
608 3300005983 Ga0081540_1018894 Ga0081540_10188942 255
609 3300005985 Ga0081539_10001498 Ga0081539_1000149838 255
610 3300006028 Ga0070717_10089874 Ga0070717_100898742 255
611 3300006028 Ga0070717_10200561 Ga0070717_102005613 255
612 3300006173 Ga0070716_100055301 Ga0070716_1000553012 255
613 3300006173 Ga0070716_100157463 Ga0070716_1001574632 255
614 3300006173 Ga0070716_100215352 Ga0070716_1002153522 255
615 3300006237 Ga0097621_100265574 Ga0097621_1002655742 255
616 3300006844 Ga0075428_100386262 Ga0075428_1003862622 255
617 3300006846 Ga0075430_100069476 Ga0075430_1000694762 255
618 3300006847 Ga0075431_100024177 Ga0075431_1000241775 255
619 3300006847 Ga0075431_100150816 Ga0075431_1001508162 255
620 3300006847 Ga0075431_100274545 Ga0075431_1002745452 255
621 3300006852 Ga0075433_10442273 Ga0075433_104422732 255
622 3300006871 Ga0075434_100094551 Ga0075434_1000945512 255
623 3300006880 Ga0075429_100042397 Ga0075429_1000423971 255
624 3300006880 Ga0075429_100108275 Ga0075429_1001082752 255
625 3300007076 Ga0075435_100157349 Ga0075435_1001573492 255
626 3300007265 Ga0099794_10010321 Ga0099794_100103215 255
627 3300007788 Ga0099795_10014037 Ga0099795_100140372 255
628 3300009093 Ga0105240_10001157 Ga0105240_1000115728 255
629 3300009093 Ga0105240_10058928 Ga0105240_100589287 255
630 3300009094 Ga0111539_10013445 Ga0111539_100134457 255
631 3300009094 Ga0111539_10020447 Ga0111539_100204477 255
632 3300009147 Ga0114129_10212920 Ga0114129_102129203 255
633 3300009147 Ga0114129_10572092 Ga0114129_105720922 255
634 3300009148 Ga0105243_10084814 Ga0105243_100848141 255
635 3300009545 Ga0105237_10003215 Ga0105237_100032159 255
636 3300009551 Ga0105238_10001318 Ga0105238_100013188 255
637 3300009551 Ga0105238_10003778 Ga0105238_100037788 255
638 3300009551 Ga0105238_10250065 Ga0105238_102500652 255
639 3300009553 Ga0105249_10216673 Ga0105249_102166733 255
640 3300010375 Ga0105239_10008689 Ga0105239_100086896 255
641 3300010375 Ga0105239_10131957 Ga0105239_101319573 255
642 3300014325 Ga0163163_10009138 Ga0163163_100091384 255
643 3300014497 Ga0182008_10061566 Ga0182008_100615661 255
644 3300015262 Ga0182007_10025299 Ga0182007_100252993 255
645 3300020070 Ga0206356_11640873 Ga0206356_116408733 255
646 3300020082 Ga0206353_10258239 Ga0206353_102582392 255
647 3300020082 Ga0206353_10332135 Ga0206353_103321351 255
648 3300021361 Ga0213872_10011215 Ga0213872_100112152 255
649 3300021361 Ga0213872_10114800 Ga0213872_101148002 255
650 3300021384 Ga0213876_10065273 Ga0213876_100652733 255
651 3300025294 Ga0209025_1000853 Ga0209025_100085331 255
652 3300025885 Ga0207653_10090442 Ga0207653_100904422 255
653 3300025893 Ga0207682_10016787 Ga0207682_100167874 255
654 3300025898 Ga0207692_10095192 Ga0207692_100951922 255
655 3300025905 Ga0207685_10004056 Ga0207685_100040565 255
656 3300025906 Ga0207699_10204695 Ga0207699_102046952 255
657 3300025909 Ga0207705_10011142 Ga0207705_100111426 255
658 3300025909 Ga0207705_10218594 Ga0207705_102185942 255
659 3300025910 Ga0207684_10029562 Ga0207684_100295624 255
660 3300025912 Ga0207707_10014353 Ga0207707_100143533 255
661 3300025912 Ga0207707_10065293 Ga0207707_100652935 255
662 3300025913 Ga0207695_10001836 Ga0207695_1000183620 255
663 3300025914 Ga0207671_10000351 Ga0207671_100003517 255
664 3300025915 Ga0207693_10064340 Ga0207693_100643403 255
665 3300025915 Ga0207693_10108597 Ga0207693_101085972 255
666 3300025916 Ga0207663_10115737 Ga0207663_101157372 255
667 3300025918 Ga0207662_10091271 Ga0207662_100912713 255
668 3300025921 Ga0207652_10000514 Ga0207652_1000051431 255
669 3300025922 Ga0207646_10283317 Ga0207646_102833172 255
670 3300025922 Ga0207646_10551624 Ga0207646_105516242 255
671 3300025924 Ga0207694_10030031 Ga0207694_100300312 255
672 3300025924 Ga0207694_10163751 Ga0207694_101637512 255
673 3300025925 Ga0207650_10006857 Ga0207650_100068574 255
674 3300025928 Ga0207700_10093859 Ga0207700_100938594 255
675 3300025929 Ga0207664_10070679 Ga0207664_100706792 255
676 3300025929 Ga0207664_10175704 Ga0207664_101757042 255
677 3300025929 Ga0207664_10203833 Ga0207664_102038332 255
678 3300025932 Ga0207690_10283960 Ga0207690_102839602 255
679 3300025932 Ga0207690_10315813 Ga0207690_103158132 255
680 3300025933 Ga0207706_10201166 Ga0207706_102011662 255
681 3300025935 Ga0207709_10092553 Ga0207709_100925533 255
682 3300025936 Ga0207670_10000017 Ga0207670_1000001796 255
683 3300025937 Ga0207669_10285816 Ga0207669_102858162 255
684 3300025938 Ga0207704_10331162 Ga0207704_103311621 255
685 3300025939 Ga0207665_10011235 Ga0207665_100112356 255
686 3300025939 Ga0207665_10141468 Ga0207665_101414682 255
687 3300025939 Ga0207665_10173570 Ga0207665_101735702 255
688 3300025939 Ga0207665_10492875 Ga0207665_104928751 255
689 3300025940 Ga0207691_10410815 Ga0207691_104108152 255
690 3300025944 Ga0207661_10003719 Ga0207661_100037197 255
691 3300025945 Ga0207679_10153200 Ga0207679_101532003 255
692 3300025960 Ga0207651_10045649 Ga0207651_100456491 255
693 3300025961 Ga0207712_10290394 Ga0207712_102903942 255
694 3300025961 Ga0207712_10366796 Ga0207712_103667962 255
695 3300025961 Ga0207712_10789112 Ga0207712_107891121 255
696 3300026023 Ga0207677_10008799 Ga0207677_100087991 255
697 3300026023 Ga0207677_10115507 Ga0207677_101155071 255
698 3300026067 Ga0207678_10264295 Ga0207678_102642952 255
699 3300026088 Ga0207641_10526722 Ga0207641_105267222 255
700 3300026089 Ga0207648_10056307 Ga0207648_100563074 255
701 3300026116 Ga0207674_10213518 Ga0207674_102135182 255
702 3300026118 Ga0207675_100340995 Ga0207675_1003409951 255
703 3300026142 Ga0207698_10833454 Ga0207698_108334541 255
704 3300027512 Ga0209179_1011067 Ga0209179_10110672 255
705 3300027671 Ga0209588_1007394 Ga0209588_10073942 255
706 3300027866 Ga0209813_10144592 Ga0209813_101445921 255
707 3300027907 Ga0207428_10021207 Ga0207428_100212075 255
708 3300027907 Ga0207428_10026521 Ga0207428_100265215 255
709 3300028379 Ga0268266_10078546 Ga0268266_100785463 255
710 3300028577 Ga0265318_10000066 Ga0265318_1000006655 255
711 3300028577 Ga0265318_10000460 Ga0265318_100004605 255
712 3300028577 Ga0265318_10085159 Ga0265318_100851592 255
713 3300031235 Ga0265330_10000221 Ga0265330_1000022134 255
714 3300031235 Ga0265330_10000713 Ga0265330_1000071314 255
715 3300031235 Ga0265330_10119838 Ga0265330_101198382 255
716 3300031238 Ga0265332_10000177 Ga0265332_1000017719 255
717 3300031238 Ga0265332_10003497 Ga0265332_100034975 255
718 3300031238 Ga0265332_10033961 Ga0265332_100339612 255
719 3300031239 Ga0265328_10000273 Ga0265328_100002739 255
720 3300031239 Ga0265328_10006586 Ga0265328_100065863 255
721 3300031239 Ga0265328_10065585 Ga0265328_100655852 255
722 3300031240 Ga0265320_10000060 Ga0265320_1000006032 255
723 3300031240 Ga0265320_10005658 Ga0265320_100056586 255
724 3300031240 Ga0265320_10035342 Ga0265320_100353422 255
725 3300031241 Ga0265325_10041411 Ga0265325_100414112 255
726 3300031241 Ga0265325_10088440 Ga0265325_100884402 255
727 3300031242 Ga0265329_10001182 Ga0265329_100011828 255
728 3300031242 Ga0265329_10005020 Ga0265329_100050201 255
729 3300031247 Ga0265340_10048960 Ga0265340_100489602 255
730 3300031249 Ga0265339_10006031 Ga0265339_100060313 255
731 3300031250 Ga0265331_10000124 Ga0265331_1000012455 255
732 3300031250 Ga0265331_10003933 Ga0265331_100039335 255
733 3300031344 Ga0265316_10001763 Ga0265316_1000176315 255
734 3300031344 Ga0265316_10014604 Ga0265316_100146044 255
735 3300031344 Ga0265316_10029799 Ga0265316_100297993 255
736 3300031344 Ga0265316_10055719 Ga0265316_100557193 255
737 3300031456 Ga0307513_10039995 Ga0307513_100399954 255
738 3300031595 Ga0265313_10000104 Ga0265313_1000010432 255
739 3300031595 Ga0265313_10000227 Ga0265313_1000022752 255
740 3300031595 Ga0265313_10007578 Ga0265313_100075783 255
741 3300031595 Ga0265313_10008438 Ga0265313_100084384 255
742 3300031595 Ga0265313_10011389 Ga0265313_100113895 255
743 3300031595 Ga0265313_10026527 Ga0265313_100265272 255
744 3300031595 Ga0265313_10094113 Ga0265313_100941132 255
745 3300031665 Ga0316575_10026544 Ga0316575_100265443 255
746 3300031665 Ga0316575_10152295 Ga0316575_101522952 255
747 3300031711 Ga0265314_10000165 Ga0265314_1000016555 255
748 3300031711 Ga0265314_10052404 Ga0265314_100524044 255
749 3300031712 Ga0265342_10000520 Ga0265342_1000052021 255
750 3300031712 Ga0265342_10006466 Ga0265342_100064664 255
751 3300031712 Ga0265342_10036144 Ga0265342_100361443 255
752 3300031712 Ga0265342_10074140 Ga0265342_100741403 255
753 3300033180 Ga0307510_10320578 Ga0307510_103205781 255
754 3300034818 Ga0373950_0000009 Ga0373950_0000009_241139_241924 255
755 3300034818 Ga0373950_0000027 Ga0373950_0000027_62123_62917 255
756 3300035086 Ga0373934_0039874 Ga0373934_0039874_283_1059 255
757 3300035086 Ga0373934_0080280 Ga0373934_0080280_157_933 255
758 3300035089 Ga0373944_0003204 Ga0373944_0003204_1649_2425 255
759 3300035089 Ga0373944_0003597 Ga0373944_0003597_2139_2915 255
760 3300035089 Ga0373944_0011316 Ga0373944_0011316_1629_2405 255
761 3300035091 Ga0373951_0068437 Ga0373951_0068437_102_878 255
762 3300035113 Ga0373936_0017884 Ga0373936_0017884_747_1523 255
763 3300035113 Ga0373936_0034498 Ga0373936_0034498_539_1315 255
764 3300035116 Ga0373945_0008499 Ga0373945_0008499_1764_2540 255
765 3300035116 Ga0373945_0014169 Ga0373945_0014169_1264_2040 255
766 3300035116 Ga0373945_0114616 Ga0373945_0114616_58_834 255
767 3300035117 Ga0373953_0004396 Ga0373953_0004396_2956_3732 255
768 3300035118 Ga0373954_0004893 Ga0373954_0004893_1454_2230 255
769 3300035119 Ga0373956_0019878 Ga0373956_0019878_1529_2305 255
770 3300035120 Ga0373957_0108939 Ga0373957_0108939_241_1035 255
771 3300035170 Ga0373943_0001682 Ga0373943_0001682_5968_6744 255
772 3300035170 Ga0373943_0003799 Ga0373943_0003799_2251_3033 255
773 3300035170 Ga0373943_0003862 Ga0373943_0003862_5830_6606 255
774 3300035170 Ga0373943_0117031 Ga0373943_0117031_596_1372 255
775 3300035170 Ga0373943_0122348 Ga0373943_0122348_326_1120 255
776 3300035171 Ga0373946_0002630 Ga0373946_0002630_3916_4692 255
777 3300035171 Ga0373946_0005184 Ga0373946_0005184_1820_2596 255
778 3300035171 Ga0373946_0005647 Ga0373946_0005647_3203_3979 255
779 3300035171 Ga0373946_0086275 Ga0373946_0086275_525_1301 255
780 3300035172 Ga0373955_0005503 Ga0373955_0005503_2312_3088 255
781 3300035172 Ga0373955_0026549 Ga0373955_0026549_720_1496 255
782 3300035172 Ga0373955_0112963 Ga0373955_0112963_177_971 255
783 3300035410 Ga0373924_0017160 Ga0373924_0017160_1205_1981 255
784 3300035692 Ga0373935_0018390 Ga0373935_0018390_680_1456 255
785 3300035692 Ga0373935_0036770 Ga0373935_0036770_132_908 255
786 3300035692 Ga0373935_0067268 Ga0373935_0067268_849_1625 255
787 3300035695 Ga0373927_0001909 Ga0373927_0001909_7274_8050 255
788 3300035695 Ga0373927_0020354 Ga0373927_0020354_1280_2056 255
789 3300035695 Ga0373927_0032514 Ga0373927_0032514_800_1576 255
790 3300035695 Ga0373927_0139475 Ga0373927_0139475_652_1434 255
791 3300035695 Ga0373927_0213872 Ga0373927_0213872_82_858 255
792 3300035724 Ga0373933_0000595 Ga0373933_0000595_1787_2581 255
793 3300035724 Ga0373933_0012986 Ga0373933_0012986_2531_3307 255
794 3300035724 Ga0373933_0072407 Ga0373933_0072407_798_1574 255
795 3300035725 Ga0373947_0000076 Ga0373947_0000076_6594_7370 255
796 3300035725 Ga0373947_0016858 Ga0373947_0016858_2292_3068 255
797 3300035725 Ga0373947_0203418 Ga0373947_0203418_479_1255 255
798 3300035725 Ga0373947_0312101 Ga0373947_0312101_235_1017 255
799 3300036401 Ga0373937_0002237 Ga0373937_0002237_7530_8306 255
800 3300036401 Ga0373937_0021827 Ga0373937_0021827_2516_3310 255
801 3300036401 Ga0373937_0033718 Ga0373937_0033718_1506_2282 255
802 3300036401 Ga0373937_0117510 Ga0373937_0117510_42_851 255
803 3300036401 Ga0373937_0335433 Ga0373937_0335433_599_1375 255
804 3300036401 Ga0373937_0675206 Ga0373937_0675206_122_898 255
805 3300037068 Ga0373925_0001700 Ga0373925_0001700_13402_14178 255
806 3300037068 Ga0373925_0053765 Ga0373925_0053765_989_1771 255
807 3300037068 Ga0373925_0060417 Ga0373925_0060417_1241_2017 255
808 3300037068 Ga0373925_0097434 Ga0373925_0097434_567_1343 255
809 3300037068 Ga0373925_0276252 Ga0373925_0276252_466_1242 255
810 3300037068 Ga0373925_0279829 Ga0373925_0279829_112_888 255
811 3300037418 Ga0395900_0027951 Ga0395900_0027951_2467_3240 255
812 3300037418 Ga0395900_0370595 Ga0395900_0370595_571_1347 255
813 3300039437 Ga0436365_0653371 Ga0436365_0653371_906_1682 255
814 3300039437 Ga0436365_1094339 Ga0436365_1094339_147_923 255
815 3300039447 Ga0436361_0094671 Ga0436361_0094671_3419_4189 255
816 3300039450 Ga0436363_1591489 Ga0436363_1591489_2709_3485 255
817 3300042436 Ga0439435_0048506 Ga0439435_0048506_19_795 255
818 3300044673 Ga0453683_0069890 Ga0453683_0069890_586_1362 255
819 3300044694 Ga0466963_0171357 Ga0466963_0171357_670_1446 255
820 3300044719 Ga0466971_0063188 Ga0466971_0063188_221_997 255
821 3300046452 Ga0495617_032756 Ga0495617_032756_161_937 255
822 3300046452 Ga0495617_069003 Ga0495617_069003_119_895 255
823 3300046454 Ga0495592_0266375 Ga0495592_0266375_192_968 255
824 3300046455 Ga0495603_0003797 Ga0495603_0003797_3111_3887 255
825 3300046455 Ga0495603_0041103 Ga0495603_0041103_1255_2031 255
826 3300046455 Ga0495603_0157397 Ga0495603_0157397_345_1121 255
827 3300046459 Ga0495629_0179718 Ga0495629_0179718_172_942 255
828 3300046459 Ga0495629_0227933 Ga0495629_0227933_491_1267 255
829 3300046460 Ga0495638_0095900 Ga0495638_0095900_375_1151 255
830 3300046460 Ga0495638_0193154 Ga0495638_0193154_331_1107 255
831 3300046461 Ga0495641_0029465 Ga0495641_0029465_1254_2030 255
832 3300046461 Ga0495641_0084540 Ga0495641_0084540_325_1119 255
833 3300046462 Ga0495651_0022047 Ga0495651_0022047_2642_3418 255
834 3300046463 Ga0495653_0008754 Ga0495653_0008754_3752_4528 255
835 3300046463 Ga0495653_0334268 Ga0495653_0334268_16_792 255
836 3300046472 Ga0495580_0020781 Ga0495580_0020781_3226_4002 255
837 3300046472 Ga0495580_0217047 Ga0495580_0217047_405_1181 255
838 3300046473 Ga0495582_0019516 Ga0495582_0019516_2101_2877 255
839 3300046473 Ga0495582_0042487 Ga0495582_0042487_416_1192 255
840 3300046475 Ga0495639_0009880 Ga0495639_0009880_394_1170 255
841 3300046475 Ga0495639_0063030 Ga0495639_0063030_257_1033 255
842 3300046476 Ga0495662_0009283 Ga0495662_0009283_1678_2454 255
843 3300046476 Ga0495662_0023573 Ga0495662_0023573_1574_2350 255
844 3300046477 Ga0495664_0000368 Ga0495664_0000368_8765_9541 255
845 3300046477 Ga0495664_0003946 Ga0495664_0003946_6035_6811 255
846 3300046491 Ga0495584_0011090 Ga0495584_0011090_3746_4522 255
847 3300046492 Ga0495585_0010183 Ga0495585_0010183_3652_4428 255
848 3300046499 Ga0495594_0014492 Ga0495594_0014492_2102_2878 255
849 3300046501 Ga0495607_0004095 Ga0495607_0004095_8130_8906 255
850 3300046511 Ga0495608_0005734 Ga0495608_0005734_6841_7617 255
851 3300046514 Ga0495618_0032319 Ga0495618_0032319_2406_3182 255
852 3300046514 Ga0495618_0041962 Ga0495618_0041962_411_1187 255
853 3300046516 Ga0495628_0011538 Ga0495628_0011538_1606_2382 255
854 3300046516 Ga0495628_0248316 Ga0495628_0248316_440_1216 255
855 3300046517 Ga0495630_0028264 Ga0495630_0028264_2829_3605 255
856 3300046517 Ga0495630_0119584 Ga0495630_0119584_971_1753 255
857 3300046517 Ga0495630_0149167 Ga0495630_0149167_591_1367 255
858 3300046523 Ga0495644_0000563 Ga0495644_0000563_4692_5468 255
859 3300046526 Ga0495666_0030492 Ga0495666_0030492_616_1392 255
860 3300046528 Ga0495642_0087232 Ga0495642_0087232_137_913 255
861 3300046529 Ga0495652_0024449 Ga0495652_0024449_1529_2305 255
862 3300046529 Ga0495652_0088897 Ga0495652_0088897_370_1146 255
863 3300046529 Ga0495652_0120322 Ga0495652_0120322_1075_1851 255
864 3300046531 Ga0495665_0026932 Ga0495665_0026932_473_1249 255
865 3300046533 Ga0495640_0002756 Ga0495640_0002756_5525_6301 255
866 3300046533 Ga0495640_0037530 Ga0495640_0037530_346_1122 255
867 3300046533 Ga0495640_0065580 Ga0495640_0065580_1092_1868 255
868 3300046535 Ga0495586_0016484 Ga0495586_0016484_1529_2305 255
869 3300046535 Ga0495586_0018700 Ga0495586_0018700_2029_2811 255
870 3300046536 Ga0495587_0026521 Ga0495587_0026521_1328_2104 255
871 3300046537 Ga0495598_0001551 Ga0495598_0001551_3233_4009 255
872 3300046538 Ga0495609_0164626 Ga0495609_0164626_79_855 255
873 3300046543 Ga0495645_0007542 Ga0495645_0007542_3693_4469 255
874 3300046558 Ga0495633_0006536 Ga0495633_0006536_3007_3783 255
875 3300046559 Ga0495667_0051382 Ga0495667_0051382_1203_1979 255
876 3300046615 Ga0495656_0000123 Ga0495656_0000123_7416_8192 255
877 3300046642 Ga0495634_0004264 Ga0495634_0004264_166_948 255
878 3300046642 Ga0495634_0015968 Ga0495634_0015968_2989_3765 255
879 3300046642 Ga0495634_0038681 Ga0495634_0038681_652_1428 255
880 3300046642 Ga0495634_0050291 Ga0495634_0050291_1678_2454 255
881 3300046663 Ga0495635_0006555 Ga0495635_0006555_1734_2510 255
882 3300046663 Ga0495635_0006792 Ga0495635_0006792_3300_4076 255
883 3300046663 Ga0495635_0167774 Ga0495635_0167774_122_898 255
884 3300046663 Ga0495635_0169459 Ga0495635_0169459_662_1438 255
885 3300046664 Ga0495659_0000384 Ga0495659_0000384_912_1688 255
886 3300046665 Ga0495661_0046850 Ga0495661_0046850_1008_1784 255
887 3300046674 Ga0495588_0036385 Ga0495588_0036385_1514_2290 255
888 3300046678 Ga0495599_0009062 Ga0495599_0009062_3661_4437 255
889 3300046680 Ga0495646_0015048 Ga0495646_0015048_2102_2878 255
890 3300046680 Ga0495646_0084387 Ga0495646_0084387_983_1759 255
891 3300046681 Ga0495647_0005854 Ga0495647_0005854_2730_3506 255
892 3300046683 Ga0495658_0023495 Ga0495658_0023495_807_1583 255
893 3300046683 Ga0495658_0048760 Ga0495658_0048760_739_1515 255
894 3300046689 Ga0495613_0027432 Ga0495613_0027432_1975_2751 255
895 3300046689 Ga0495613_0164055 Ga0495613_0164055_503_1279 255
896 3300046690 Ga0495624_0005977 Ga0495624_0005977_7629_8405 255
897 3300046690 Ga0495624_0013135 Ga0495624_0013135_4526_5302 255
898 3300046690 Ga0495624_0013148 Ga0495624_0013148_3051_3827 255
899 3300046690 Ga0495624_0047820 Ga0495624_0047820_1493_2269 255
900 3300046691 Ga0495670_0000220 Ga0495670_0000220_11195_11971 255
901 3300046809 Ga0495600_0027359 Ga0495600_0027359_1379_2155 255
902 3300047315 Ga0495581_0007273 Ga0495581_0007273_1736_2512 255
903 3300047315 Ga0495581_0038053 Ga0495581_0038053_553_1329 255
904 3300047317 Ga0495604_0010125 Ga0495604_0010125_5187_5963 255
905 3300047319 Ga0495674_0005870 Ga0495674_0005870_336_1118 255
906 3300047319 Ga0495674_0077262 Ga0495674_0077262_346_1122 255
907 3300047319 Ga0495674_0111023 Ga0495674_0111023_346_1122 255
908 3300047319 Ga0495674_0175389 Ga0495674_0175389_994_1770 255
909 3300047321 Ga0495676_0081674 Ga0495676_0081674_110_886 255
910 3300047322 Ga0495680_0023334 Ga0495680_0023334_1530_2306 255
911 3300047322 Ga0495680_0220222 Ga0495680_0220222_36_812 255
912 3300047446 Ga0495679_021103 Ga0495679_021103_118_894 255
913 3300047471 Ga0495684_0001940 Ga0495684_0001940_3381_4157 255
914 3300047471 Ga0495684_0002684 Ga0495684_0002684_12401_13177 255
915 3300047471 Ga0495684_0005580 Ga0495684_0005580_2885_3661 255
916 3300047673 Ga0495593_0008505 Ga0495593_0008505_729_1505 255
917 3300047673 Ga0495593_0018733 Ga0495593_0018733_2199_2975 255
918 3300048903 Ga0496100_0081723 Ga0496100_0081723_699_1475 255
919 3300048904 Ga0496101_0066149 Ga0496101_0066149_1615_2391 255
920 3300048904 Ga0496101_0140383 Ga0496101_0140383_803_1579 255
921 3300048905 Ga0496102_0030165 Ga0496102_0030165_1984_2760 255
922 3300048906 Ga0496103_0004000 Ga0496103_0004000_7887_8663 255
923 3300048906 Ga0496103_0372887 Ga0496103_0372887_103_879 255
924 3300048907 Ga0496104_0056004 Ga0496104_0056004_2422_3198 255
925 3300048907 Ga0496104_0101437 Ga0496104_0101437_792_1568 255
926 3300048908 Ga0496105_0002468 Ga0496105_0002468_11896_12672 255
927 3300048908 Ga0496105_0111048 Ga0496105_0111048_266_1042 255
928 3300048909 Ga0496106_0057462 Ga0496106_0057462_519_1301 255
929 3300048910 Ga0496107_0139575 Ga0496107_0139575_188_964 255
930 3300048911 Ga0496108_0011142 Ga0496108_0011142_579_1361 255
931 3300048911 Ga0496108_0177069 Ga0496108_0177069_399_1175 255
932 3300048911 Ga0496108_0255585 Ga0496108_0255585_178_954 255
933 3300048912 Ga0496109_0003965 Ga0496109_0003965_5442_6218 255
934 3300048912 Ga0496109_0272952 Ga0496109_0272952_645_1427 255
935 3300048912 Ga0496109_0386450 Ga0496109_0386450_103_879 255
936 3300048913 Ga0496110_0061581 Ga0496110_0061581_503_1279 255
937 3300048913 Ga0496110_0135781 Ga0496110_0135781_970_1743 255
938 3300048913 Ga0496110_0184133 Ga0496110_0184133_37_813 255
939 3300048914 Ga0496111_0006988 Ga0496111_0006988_4233_5009 255
940 3300048915 Ga0496112_0000845 Ga0496112_0000845_8321_9097 255
941 3300048915 Ga0496112_0023150 Ga0496112_0023150_794_1576 255
942 3300048915 Ga0496112_0303883 Ga0496112_0303883_416_1201 255
943 3300048915 Ga0496112_0384387 Ga0496112_0384387_207_983 255
944 3300048915 Ga0496112_0533653 Ga0496112_0533653_189_971 255
945 3300048915 Ga0496112_0535298 Ga0496112_0535298_317_1093 255
946 3300048916 Ga0496113_0000630 Ga0496113_0000630_11483_12259 255
947 3300048917 Ga0496114_0001670 Ga0496114_0001670_2142_2924 255
948 3300048917 Ga0496114_0156957 Ga0496114_0156957_955_1731 255
949 3300048917 Ga0496114_0261378 Ga0496114_0261378_133_909 255
950 3300048917 Ga0496114_0500655 Ga0496114_0500655_248_1033 255
951 3300048918 Ga0496115_0003790 Ga0496115_0003790_8023_8805 255
952 3300048918 Ga0496115_0055221 Ga0496115_0055221_1702_2478 255
953 3300048918 Ga0496115_0187849 Ga0496115_0187849_223_999 255
954 3300049569 Ga0501032_0325381 Ga0501032_0325381_116_892 255
955 3300049569 Ga0501032_0448041 Ga0501032_0448041_21_797 255
956 3300049571 Ga0501034_0000134 Ga0501034_0000134_17334_18104 255
957 3300049571 Ga0501034_0000630 Ga0501034_0000630_35000_35794 255
958 3300049571 Ga0501034_0129981 Ga0501034_0129981_835_1611 255
959 3300049571 Ga0501034_0143088 Ga0501034_0143088_96_872 255
960 3300049571 Ga0501034_0212561 Ga0501034_0212561_197_973 255
961 3300049571 Ga0501034_0473107 Ga0501034_0473107_205_981 255
962 3300049574 Ga0501038_0058071 Ga0501038_0058071_1425_2219 255
963 3300049576 Ga0501040_0151167 Ga0501040_0151167_789_1580 255
964 3300049579 Ga0501043_0001257 Ga0501043_0001257_20025_20819 255
965 3300049580 Ga0501046_0003144 Ga0501046_0003144_12296_13090 255
966 3300049581 Ga0501047_0000011 Ga0501047_0000011_279627_280421 255
967 3300049581 Ga0501047_0388776 Ga0501047_0388776_385_1164 255
968 3300049582 Ga0501048_0001652 Ga0501048_0001652_4185_4979 255
969 3300049582 Ga0501048_0196986 Ga0501048_0196986_486_1277 255
970 3300049583 Ga0501067_0000014 Ga0501067_0000014_75556_76341 255
971 3300049583 Ga0501067_0049093 Ga0501067_0049093_1298_2083 255
972 3300049583 Ga0501067_0066240 Ga0501067_0066240_1016_1798 255
973 3300049584 Ga0501068_0006611 Ga0501068_0006611_1563_2357 255
974 3300049585 Ga0501069_0016266 Ga0501069_0016266_2199_2984 255
975 3300049585 Ga0501069_0324401 Ga0501069_0324401_43_819 255
976 3300049586 Ga0501070_0000007 Ga0501070_0000007_156252_157037 255
977 3300049586 Ga0501070_0002576 Ga0501070_0002576_4794_5588 255
978 3300049586 Ga0501070_0073326 Ga0501070_0073326_196_972 255
979 3300049587 Ga0501071_0262725 Ga0501071_0262725_235_1011 255
980 3300049587 Ga0501071_0341863 Ga0501071_0341863_111_902 255
981 3300049588 Ga0501072_0000030 Ga0501072_0000030_58251_59045 255
982 3300049588 Ga0501072_0002898 Ga0501072_0002898_6992_7768 255
983 3300049588 Ga0501072_0253544 Ga0501072_0253544_412_1203 255
984 3300049589 Ga0501073_0000375 Ga0501073_0000375_17485_18270 255
985 3300049589 Ga0501073_0002477 Ga0501073_0002477_1462_2244 255
986 3300049589 Ga0501073_0002807 Ga0501073_0002807_9162_9947 255
987 3300049589 Ga0501073_0012973 Ga0501073_0012973_1392_2186 255
988 3300049589 Ga0501073_0029633 Ga0501073_0029633_2857_3642 255
989 3300049589 Ga0501073_0113464 Ga0501073_0113464_231_1007 255
990 3300049589 Ga0501073_0143354 Ga0501073_0143354_623_1420 255
991 3300049590 Ga0501074_0002648 Ga0501074_0002648_3894_4688 255
992 3300049590 Ga0501074_0046924 Ga0501074_0046924_2278_3063 255
993 3300049590 Ga0501074_0170050 Ga0501074_0170050_446_1222 255
994 3300049592 Ga0501076_0148100 Ga0501076_0148100_890_1681 255
995 3300049593 Ga0501077_0287001 Ga0501077_0287001_85_861 255
996 3300049741 Ga0501079_0000466 Ga0501079_0000466_4161_4955 255
997 3300049741 Ga0501079_0356413 Ga0501079_0356413_191_976 255
998 3300049742 Ga0501080_0009497 Ga0501080_0009497_271_1056 255
999 3300049742 Ga0501080_0055655 Ga0501080_0055655_88_885 255
1000 3300049742 Ga0501080_0061304 Ga0501080_0061304_659_1453 255
1001 3300049742 Ga0501080_0063571 Ga0501080_0063571_1175_1960 255
1002 3300049742 Ga0501080_0077547 Ga0501080_0077547_2159_2953 255
1003 3300049742 Ga0501080_0227717 Ga0501080_0227717_148_924 255
1004 3300049743 Ga0501081_0051061 Ga0501081_0051061_584_1360 255
1005 3300049743 Ga0501081_0071881 Ga0501081_0071881_1016_1801 255
1006 3300049744 Ga0501083_0009195 Ga0501083_0009195_4794_5588 255
1007 3300049744 Ga0501083_0060273 Ga0501083_0060273_1235_2020 255
1008 3300049744 Ga0501083_0092936 Ga0501083_0092936_972_1769 255
1009 3300049823 Ga0501044_0030135 Ga0501044_0030135_74_856 255
1010 3300049823 Ga0501044_0119058 Ga0501044_0119058_949_1725 255
1011 3300049823 Ga0501044_0464918 Ga0501044_0464918_238_1014 255
1012 3300049823 Ga0501044_0514588 Ga0501044_0514588_206_1000 255
1013 3300050492 nmdc:mga0yw44_172048_c1 nmdc:mga0yw44_172048_c1_582_1358 255
1014 3300050507 nmdc:mga05p37_11562_c1 nmdc:mga05p37_11562_c1_7605_8381 255
1015 3300050507 nmdc:mga05p37_899361_c1 nmdc:mga05p37_899361_c1_142_918 255
1016 3300050508 nmdc:mga09592_237171_c1 nmdc:mga09592_237171_c1_701_1477 255
1017 3300050509 nmdc:mga0qj67_26838_c1 nmdc:mga0qj67_26838_c1_326_1102 255
1018 3300050510 nmdc:mga06r32_245187_c1 nmdc:mga06r32_245187_c1_281_1057 255
1019 3300050510 nmdc:mga06r32_303991_c1 nmdc:mga06r32_303991_c1_438_1214 255
1020 3300050511 nmdc:mga08y16_1326_c1 nmdc:mga08y16_1326_c1_21085_21876 255
1021 3300050512 nmdc:mga0n895_293592_c1 nmdc:mga0n895_293592_c1_735_1511 255
1022 3300050512 nmdc:mga0n895_77979_c1 nmdc:mga0n895_77979_c1_2350_3126 255
1023 3300050513 nmdc:mga0rr50_180962_c1 nmdc:mga0rr50_180962_c1_439_1215 255
1024 3300053077 Ga0495601_0020354 Ga0495601_0020354_283_1059 255
1025 3300053077 Ga0495601_0033030 Ga0495601_0033030_572_1348 255
1026 3300053077 Ga0495601_0233210 Ga0495601_0233210_128_904 255
1027 3300053078 Ga0495612_0006404 Ga0495612_0006404_2120_2896 255
1028 3300053078 Ga0495612_0012283 Ga0495612_0012283_743_1519 255
1029 3300053083 Ga0495655_0048286 Ga0495655_0048286_267_1043 255
1030 3300053084 Ga0495595_0003605 Ga0495595_0003605_747_1523 255
1031 3300053084 Ga0495595_0022421 Ga0495595_0022421_667_1443 255
1032 3300053085 Ga0495619_0021688 Ga0495619_0021688_1459_2235 255
1033 3300053085 Ga0495619_0043631 Ga0495619_0043631_1252_2028 255
1034 3300053130 Ga0500642_0050089 Ga0500642_0050089_517_1293 255
1035 3300053136 Ga0500559_0011496 Ga0500559_0011496_2495_3283 255
1036 3300053151 Ga0500604_0019975 Ga0500604_0019975_84_860 255
1037 3300054114 Ga0501084_0000413 Ga0501084_0000413_26515_27309 255
1038 3300054114 Ga0501084_0269080 Ga0501084_0269080_617_1414 255
1039 3300054114 Ga0501084_0304297 Ga0501084_0304297_120_893 255
1040 3300060353 Ga0501082_0015664 Ga0501082_0015664_936_1730 255
1041 3300060353 Ga0501082_0044529 Ga0501082_0044529_2807_3592 255
1042 3300060353 Ga0501082_0157499 Ga0501082_0157499_445_1221 255
1043 2162886007 SwRhRL2b_contig_1951000 SwRhRL2b_0273.00001170 256
1044 3300001904 JGI24736J21556_1007916 JGI24736J21556_10079162 256
1045 3300001979 JGI24740J21852_10000985 JGI24740J21852_100009852 256
1046 3300001979 JGI24740J21852_10008500 JGI24740J21852_100085004 256
1047 3300001989 JGI24739J22299_10011896 JGI24739J22299_100118962 256
1048 3300002067 JGI24735J21928_10000566 JGI24735J21928_100005669 256
1049 3300002067 JGI24735J21928_10001570 JGI24735J21928_100015709 256
1050 3300002067 JGI24735J21928_10004545 JGI24735J21928_100045458 256
1051 3300002067 JGI24735J21928_10004725 JGI24735J21928_100047251 256
1052 3300002067 JGI24735J21928_10013067 JGI24735J21928_100130672 256
1053 3300002075 JGI24738J21930_10002006 JGI24738J21930_100020066 256
1054 3300002705 JGI25156J39149_1007606 JGI25156J39149_10076064 256
1055 3300002705 JGI25156J39149_1015378 JGI25156J39149_10153781 256
1056 3300003214 JGI25165J46597_1000794 JGI25165J46597_100079413 256
1057 3300003354 JGI25160J50197_1000146 JGI25160J50197_100014646 256
1058 3300003354 JGI25160J50197_1042858 JGI25160J50197_10428581 256
1059 3300003751 Ga0055538_1000115 Ga0055538_100011530 256
1060 3300003752 Ga0055539_1000162 Ga0055539_100016230 256
1061 3300003756 Ga0055533_1000164 Ga0055533_100016430 256
1062 3300003756 Ga0055533_1000476 Ga0055533_100047611 256
1063 3300003758 Ga0055532_1000092 Ga0055532_100009241 256
1064 3300003758 Ga0055532_1000153 Ga0055532_100015337 256
1065 3300003759 Ga0055525_1000224 Ga0055525_100022430 256
1066 3300003760 Ga0055527_1000035 Ga0055527_100003579 256
1067 3300003760 Ga0055527_1000754 Ga0055527_100075411 256
1068 3300003761 Ga0055535_1000050 Ga0055535_100005079 256
1069 3300003762 Ga0055542_1000120 Ga0055542_100012041 256
1070 3300003762 Ga0055542_1006002 Ga0055542_10060022 256
1071 3300003762 Ga0055542_1006397 Ga0055542_10063973 256
1072 3300003763 Ga0055529_1000089 Ga0055529_100008979 256
1073 3300003763 Ga0055529_1002076 Ga0055529_10020765 256
1074 3300003790 Ga0055528_1003212 Ga0055528_10032126 256
1075 3300003841 Ga0055541_1000107 Ga0055541_100010730 256
1076 3300003856 Ga0058692_1002418 Ga0058692_10024188 256
1077 3300005262 Ga0065165_1000648 Ga0065165_100064812 256
1078 3300005288 Ga0065714_10012015 Ga0065714_100120153 256
1079 3300005290 Ga0065712_10068411 Ga0065712_100684116 256
1080 3300005290 Ga0065712_10087084 Ga0065712_100870843 256
1081 3300005327 Ga0070658_10004734 Ga0070658_100047348 256
1082 3300005327 Ga0070658_10030943 Ga0070658_100309436 256
1083 3300005327 Ga0070658_10065021 Ga0070658_100650212 256
1084 3300005331 Ga0070670_100012109 Ga0070670_1000121096 256
1085 3300005335 Ga0070666_10030868 Ga0070666_100308686 256
1086 3300005337 Ga0070682_100198046 Ga0070682_1001980462 256
1087 3300005339 Ga0070660_100000025 Ga0070660_10000002525 256
1088 3300005339 Ga0070660_100000555 Ga0070660_1000005555 256
1089 3300005339 Ga0070660_100241946 Ga0070660_1002419462 256
1090 3300005344 Ga0070661_100004487 Ga0070661_1000044875 256
1091 3300005344 Ga0070661_100083767 Ga0070661_1000837672 256
1092 3300005353 Ga0070669_100001095 Ga0070669_10000109517 256
1093 3300005366 Ga0070659_100000264 Ga0070659_10000026424 256
1094 3300005455 Ga0070663_100000091 Ga0070663_10000009117 256
1095 3300005455 Ga0070663_100030019 Ga0070663_1000300192 256
1096 3300005457 Ga0070662_100000855 Ga0070662_10000085517 256
1097 3300005539 Ga0068853_100000029 Ga0068853_10000002976 256
1098 3300005539 Ga0068853_100102759 Ga0068853_1001027593 256
1099 3300005548 Ga0070665_100042512 Ga0070665_1000425124 256
1100 3300005563 Ga0068855_100027271 Ga0068855_1000272715 256
1101 3300005563 Ga0068855_100056021 Ga0068855_1000560212 256
1102 3300005563 Ga0068855_100398032 Ga0068855_1003980322 256
1103 3300005564 Ga0070664_100011142 Ga0070664_1000111421 256
1104 3300005577 Ga0068857_100058082 Ga0068857_1000580822 256
1105 3300005578 Ga0068854_100001922 Ga0068854_10000192211 256
1106 3300005614 Ga0068856_100143192 Ga0068856_1001431922 256
1107 3300005616 Ga0068852_100020390 Ga0068852_1000203905 256
1108 3300005616 Ga0068852_100190519 Ga0068852_1001905192 256
1109 3300005617 Ga0068859_100018925 Ga0068859_1000189253 256
1110 3300005834 Ga0068851_10000035 Ga0068851_1000003560 256
1111 3300005842 Ga0068858_100226662 Ga0068858_1002266622 256
1112 3300006051 Ga0075364_10296513 Ga0075364_102965132 256
1113 3300006846 Ga0075430_100160725 Ga0075430_1001607252 256
1114 3300006931 Ga0097620_100018925 Ga0097620_1000189253 256
1115 3300009011 Ga0105251_10000009 Ga0105251_1000000920 256
1116 3300009011 Ga0105251_10000781 Ga0105251_1000078126 256
1117 3300009011 Ga0105251_10004276 Ga0105251_100042761 256
1118 3300009011 Ga0105251_10004471 Ga0105251_100044719 256
1119 3300009011 Ga0105251_10006725 Ga0105251_100067252 256
1120 3300009011 Ga0105251_10027875 Ga0105251_100278753 256
1121 3300009011 Ga0105251_10039795 Ga0105251_100397951 256
1122 3300009036 Ga0105244_10011664 Ga0105244_100116642 256
1123 3300009036 Ga0105244_10012264 Ga0105244_100122641 256
1124 3300009036 Ga0105244_10015770 Ga0105244_100157705 256
1125 3300009036 Ga0105244_10031576 Ga0105244_100315763 256
1126 3300009036 Ga0105244_10049313 Ga0105244_100493132 256
1127 3300009092 Ga0105250_10001470 Ga0105250_100014705 256
1128 3300009092 Ga0105250_10002368 Ga0105250_100023682 256
1129 3300009092 Ga0105250_10002788 Ga0105250_100027887 256
1130 3300009092 Ga0105250_10020938 Ga0105250_100209383 256
1131 3300009092 Ga0105250_10029714 Ga0105250_100297143 256
1132 3300009093 Ga0105240_10055159 Ga0105240_100551597 256
1133 3300009093 Ga0105240_10090508 Ga0105240_100905087 256
1134 3300009093 Ga0105240_10148476 Ga0105240_101484763 256
1135 3300009094 Ga0111539_10203392 Ga0111539_102033922 256
1136 3300009148 Ga0105243_10040823 Ga0105243_100408233 256
1137 3300009174 Ga0105241_10682856 Ga0105241_106828561 256
1138 3300009176 Ga0105242_10000465 Ga0105242_100004656 256
1139 3300009177 Ga0105248_10013830 Ga0105248_100138304 256
1140 3300009177 Ga0105248_10047554 Ga0105248_100475545 256
1141 3300009177 Ga0105248_10408521 Ga0105248_104085213 256
1142 3300009545 Ga0105237_10004566 Ga0105237_1000456617 256
1143 3300009551 Ga0105238_10004242 Ga0105238_100042429 256
1144 3300009551 Ga0105238_10064293 Ga0105238_100642934 256
1145 3300009551 Ga0105238_10155824 Ga0105238_101558242 256
1146 3300010375 Ga0105239_10003869 Ga0105239_1000386921 256
1147 3300010375 Ga0105239_10039665 Ga0105239_100396656 256
1148 3300010375 Ga0105239_10682159 Ga0105239_106821592 256
1149 3300011119 Ga0105246_10014482 Ga0105246_100144821 256
1150 3300013102 Ga0157371_10017064 Ga0157371_100170642 256
1151 3300013102 Ga0157371_10074427 Ga0157371_100744275 256
1152 3300013104 Ga0157370_10000390 Ga0157370_1000039043 256
1153 3300013104 Ga0157370_10000560 Ga0157370_1000056041 256
1154 3300013104 Ga0157370_10029498 Ga0157370_100294984 256
1155 3300013104 Ga0157370_10052390 Ga0157370_100523902 256
1156 3300013105 Ga0157369_10000147 Ga0157369_1000014759 256
1157 3300013105 Ga0157369_10000872 Ga0157369_1000087228 256
1158 3300013105 Ga0157369_10002777 Ga0157369_1000277713 256
1159 3300013105 Ga0157369_10003810 Ga0157369_100038102 256
1160 3300013105 Ga0157369_10029479 Ga0157369_100294797 256
1161 3300013105 Ga0157369_10030614 Ga0157369_100306147 256
1162 3300013105 Ga0157369_10124862 Ga0157369_101248624 256
1163 3300013105 Ga0157369_10602500 Ga0157369_106025002 256
1164 3300013296 Ga0157374_10000251 Ga0157374_1000025118 256
1165 3300013296 Ga0157374_10012779 Ga0157374_100127797 256
1166 3300013307 Ga0157372_10000323 Ga0157372_1000032341 256
1167 3300013308 Ga0157375_10011856 Ga0157375_1001185612 256
1168 3300014497 Ga0182008_10020191 Ga0182008_100201913 256
1169 3300014497 Ga0182008_10126410 Ga0182008_101264101 256
1170 3300014969 Ga0157376_10293828 Ga0157376_102938281 256
1171 3300015261 Ga0182006_1004523 Ga0182006_10045235 256
1172 3300015262 Ga0182007_10000932 Ga0182007_100009328 256
1173 3300015262 Ga0182007_10042080 Ga0182007_100420802 256
1174 3300015265 Ga0182005_1005113 Ga0182005_10051133 256
1175 3300016635 Ga0183361_10015 Ga0183361_10015110 256
1176 3300020070 Ga0206356_11626400 Ga0206356_116264003 256
1177 3300020081 Ga0206354_10295002 Ga0206354_102950027 256
1178 3300020082 Ga0206353_10944309 Ga0206353_109443093 256
1179 3300021358 Ga0213873_10041970 Ga0213873_100419701 256
1180 3300021361 Ga0213872_10091915 Ga0213872_100919152 256
1181 3300022467 Ga0224712_10000002 Ga0224712_1000000218 256
1182 3300025206 Ga0209435_102153 Ga0209435_1021532 256
1183 3300025224 Ga0209784_100087 Ga0209784_10008739 256
1184 3300025225 Ga0209566_100106 Ga0209566_10010639 256
1185 3300025225 Ga0209566_101146 Ga0209566_10114613 256
1186 3300025226 Ga0209674_100128 Ga0209674_10012839 256
1187 3300025226 Ga0209674_100153 Ga0209674_10015328 256
1188 3300025226 Ga0209674_100296 Ga0209674_10029630 256
1189 3300025228 Ga0209672_100054 Ga0209672_100054160 256
1190 3300025228 Ga0209672_100072 Ga0209672_10007264 256
1191 3300025228 Ga0209672_100073 Ga0209672_10007369 256
1192 3300025228 Ga0209672_100570 Ga0209672_1005707 256
1193 3300025229 Ga0209147_100085 Ga0209147_10008530 256
1194 3300025229 Ga0209147_100093 Ga0209147_10009369 256
1195 3300025229 Ga0209147_100100 Ga0209147_10010056 256
1196 3300025229 Ga0209147_100129 Ga0209147_10012939 256
1197 3300025230 Ga0209563_100122 Ga0209563_10012285 256
1198 3300025231 Ga0207427_103353 Ga0207427_1033534 256
1199 3300025242 Ga0209258_100140 Ga0209258_10014069 256
1200 3300025242 Ga0209258_100168 Ga0209258_10016829 256
1201 3300025242 Ga0209258_100352 Ga0209258_10035231 256
1202 3300025242 Ga0209258_100397 Ga0209258_10039728 256
1203 3300025246 Ga0209646_1000310 Ga0209646_100031023 256
1204 3300025253 Ga0209677_100078 Ga0209677_10007885 256
1205 3300025254 Ga0209148_1000119 Ga0209148_100011986 256
1206 3300025254 Ga0209148_1000140 Ga0209148_100014070 256
1207 3300025254 Ga0209148_1004328 Ga0209148_10043286 256
1208 3300025256 Ga0209759_1000281 Ga0209759_100028111 256
1209 3300025256 Ga0209759_1000329 Ga0209759_100032939 256
1210 3300025256 Ga0209759_1000362 Ga0209759_100036255 256
1211 3300025256 Ga0209759_1004329 Ga0209759_10043293 256
1212 3300025256 Ga0209759_1005092 Ga0209759_10050923 256
1213 3300025256 Ga0209759_1014467 Ga0209759_10144672 256
1214 3300025256 Ga0209759_1025149 Ga0209759_10251492 256
1215 3300025261 Ga0209233_1000173 Ga0209233_100017369 256
1216 3300025263 Ga0209565_1009798 Ga0209565_10097983 256
1217 3300025272 Ga0209455_1000125 Ga0209455_100012570 256
1218 3300025272 Ga0209455_1000217 Ga0209455_100021711 256
1219 3300025273 Ga0209673_1000098 Ga0209673_1000098116 256
1220 3300025284 Ga0209130_1011394 Ga0209130_10113942 256
1221 3300025295 Ga0209564_1017081 Ga0209564_10170815 256
1222 3300025302 Ga0207426_1000199 Ga0207426_100019984 256
1223 3300025302 Ga0207426_1002772 Ga0207426_10027726 256
1224 3300025321 Ga0207656_10000008 Ga0207656_10000008149 256
1225 3300025711 Ga0207696_1000020 Ga0207696_1000020140 256
1226 3300025711 Ga0207696_1000084 Ga0207696_1000084136 256
1227 3300025711 Ga0207696_1025259 Ga0207696_10252592 256
1228 3300025728 Ga0207655_1000495 Ga0207655_100049533 256
1229 3300025728 Ga0207655_1052827 Ga0207655_10528272 256
1230 3300025735 Ga0207713_1000032 Ga0207713_1000032242 256
1231 3300025735 Ga0207713_1000186 Ga0207713_100018626 256
1232 3300025735 Ga0207713_1001816 Ga0207713_10018161 256
1233 3300025735 Ga0207713_1002540 Ga0207713_10025407 256
1234 3300025735 Ga0207713_1010399 Ga0207713_10103991 256
1235 3300025735 Ga0207713_1036728 Ga0207713_10367282 256
1236 3300025903 Ga0207680_10101560 Ga0207680_101015602 256
1237 3300025904 Ga0207647_10000126 Ga0207647_1000012625 256
1238 3300025904 Ga0207647_10010761 Ga0207647_100107614 256
1239 3300025904 Ga0207647_10062309 Ga0207647_100623092 256
1240 3300025909 Ga0207705_10006000 Ga0207705_100060006 256
1241 3300025909 Ga0207705_10019586 Ga0207705_100195862 256
1242 3300025909 Ga0207705_10057687 Ga0207705_100576872 256
1243 3300025909 Ga0207705_10120295 Ga0207705_101202952 256
1244 3300025913 Ga0207695_10016358 Ga0207695_1001635811 256
1245 3300025913 Ga0207695_10022014 Ga0207695_100220149 256
1246 3300025913 Ga0207695_10030027 Ga0207695_100300273 256
1247 3300025913 Ga0207695_10109628 Ga0207695_101096284 256
1248 3300025913 Ga0207695_10112231 Ga0207695_101122315 256
1249 3300025914 Ga0207671_10000015 Ga0207671_10000015142 256
1250 3300025914 Ga0207671_10084561 Ga0207671_100845614 256
1251 3300025914 Ga0207671_10097780 Ga0207671_100977803 256
1252 3300025914 Ga0207671_10358813 Ga0207671_103588132 256
1253 3300025919 Ga0207657_10000065 Ga0207657_1000006529 256
1254 3300025919 Ga0207657_10001751 Ga0207657_100017511 256
1255 3300025920 Ga0207649_10000001 Ga0207649_10000001345 256
1256 3300025923 Ga0207681_10001783 Ga0207681_100017837 256
1257 3300025924 Ga0207694_10016623 Ga0207694_100166232 256
1258 3300025924 Ga0207694_10017087 Ga0207694_100170874 256
1259 3300025924 Ga0207694_10056136 Ga0207694_100561362 256
1260 3300025924 Ga0207694_10146909 Ga0207694_101469092 256
1261 3300025925 Ga0207650_10000186 Ga0207650_1000018620 256
1262 3300025925 Ga0207650_10000741 Ga0207650_1000074118 256
1263 3300025932 Ga0207690_10000040 Ga0207690_1000004029 256
1264 3300025933 Ga0207706_10000081 Ga0207706_1000008188 256
1265 3300025933 Ga0207706_10132919 Ga0207706_101329192 256
1266 3300025934 Ga0207686_10019792 Ga0207686_100197925 256
1267 3300025935 Ga0207709_10075656 Ga0207709_100756563 256
1268 3300025940 Ga0207691_10149091 Ga0207691_101490912 256
1269 3300025941 Ga0207711_10011206 Ga0207711_100112066 256
1270 3300025941 Ga0207711_10262959 Ga0207711_102629592 256
1271 3300025945 Ga0207679_10000009 Ga0207679_10000009277 256
1272 3300025949 Ga0207667_10010182 Ga0207667_100101829 256
1273 3300025949 Ga0207667_10021698 Ga0207667_100216982 256
1274 3300026035 Ga0207703_10243596 Ga0207703_102435962 256
1275 3300026041 Ga0207639_10000090 Ga0207639_1000009034 256
1276 3300026041 Ga0207639_10001959 Ga0207639_100019593 256
1277 3300026067 Ga0207678_10002149 Ga0207678_1000214916 256
1278 3300026067 Ga0207678_10038889 Ga0207678_100388895 256
1279 3300026067 Ga0207678_10049586 Ga0207678_100495862 256
1280 3300026116 Ga0207674_10137634 Ga0207674_101376344 256
1281 3300026116 Ga0207674_10788727 Ga0207674_107887271 256
1282 3300026121 Ga0207683_10149860 Ga0207683_101498602 256
1283 3300027312 Ga0209371_1000141 Ga0209371_100014122 256
1284 3300027312 Ga0209371_1003202 Ga0209371_10032028 256
1285 3300027665 Ga0209983_1007221 Ga0209983_10072212 256
1286 3300027682 Ga0209971_1002033 Ga0209971_10020335 256
1287 3300027876 Ga0209974_10001114 Ga0209974_100011142 256
1288 3300028379 Ga0268266_10069228 Ga0268266_100692284 256
1289 3300028800 Ga0265338_10003131 Ga0265338_100031319 256
1290 3300030500 Ga0268256_1000205 Ga0268256_100020561 256
1291 3300030500 Ga0268256_1002888 Ga0268256_10028884 256
1292 3300031251 Ga0265327_10000027 Ga0265327_10000027289 256
1293 3300031507 Ga0307509_10023873 Ga0307509_100238736 256
1294 3300031548 Ga0307408_100000005 Ga0307408_100000005219 256
1295 3300031548 Ga0307408_100000019 Ga0307408_100000019157 256
1296 3300031727 Ga0316576_10087596 Ga0316576_100875962 256
1297 3300031824 Ga0307413_10087243 Ga0307413_100872432 256
1298 3300031901 Ga0307406_10000030 Ga0307406_1000003025 256
1299 3300031911 Ga0307412_10000056 Ga0307412_1000005692 256
1300 3300031911 Ga0307412_10042058 Ga0307412_100420583 256
1301 3300032004 Ga0307414_10070567 Ga0307414_100705673 256
1302 3300032168 Ga0316593_10004055 Ga0316593_100040554 256
1303 3300033180 Ga0307510_10025504 Ga0307510_100255047 256
1304 3300037312 Ga0395899_0000080 Ga0395899_0000080_72560_73333 256
1305 3300037312 Ga0395899_0034281 Ga0395899_0034281_868_1644 256
1306 3300037312 Ga0395899_0251776 Ga0395899_0251776_372_1145 256
1307 3300037418 Ga0395900_0000087 Ga0395900_0000087_98236_99009 256
1308 3300037418 Ga0395900_0011661 Ga0395900_0011661_7365_8141 256
1309 3300037418 Ga0395900_0242617 Ga0395900_0242617_643_1416 256
1310 3300037466 Ga0395898_0000448 Ga0395898_0000448_72975_73748 256
1311 3300037466 Ga0395898_0003576 Ga0395898_0003576_7685_8458 256
1312 3300037466 Ga0395898_0079730 Ga0395898_0079730_143_916 256
1313 3300037471 Ga0395905_0000166 Ga0395905_0000166_66028_66801 256
1314 3300037471 Ga0395905_0006640 Ga0395905_0006640_9853_10626 256
1315 3300038443 Ga0395901_0000053 Ga0395901_0000053_101691_102464 256
1316 3300038443 Ga0395901_0000924 Ga0395901_0000924_10849_11625 256
1317 3300038443 Ga0395901_0009275 Ga0395901_0009275_8403_9176 256
1318 3300039437 Ga0436365_1601665 Ga0436365_1601665_695_1468 256
1319 3300039447 Ga0436361_0161349 Ga0436361_0161349_303_1079 256
1320 3300039447 Ga0436361_0912154 Ga0436361_0912154_1163_1939 256
1321 3300039453 Ga0436362_0474698 Ga0436362_0474698_105_881 256
1322 3300041404 Ga0439436_0000248 Ga0439436_0000248_6623_7393 256
1323 3300041405 Ga0439438_001451 Ga0439438_001451_6749_7519 256
1324 3300041405 Ga0439438_010213 Ga0439438_010213_1860_2630 256
1325 3300041411 Ga0439466_0008880 Ga0439466_0008880_1325_2095 256
1326 3300041997 Ga0439431_0012148 Ga0439431_0012148_379_1188 256
1327 3300041997 Ga0439431_0046292 Ga0439431_0046292_145_915 256
1328 3300042000 Ga0439437_000185 Ga0439437_000185_2926_3696 256
1329 3300042005 Ga0439448_0005884 Ga0439448_0005884_439_1212 256
1330 3300042010 Ga0439452_001217 Ga0439452_001217_8464_9234 256
1331 3300042016 Ga0439463_000906 Ga0439463_000906_3011_3781 256
1332 3300042115 Ga0450911_000003 Ga0450911_000003_113879_114649 256
1333 3300042139 Ga0450904_000746 Ga0450904_000746_1628_2398 256
1334 3300042156 Ga0439446_0007456 Ga0439446_0007456_1809_2579 256
1335 3300042530 Ga0450916_002100 Ga0450916_002100_1089_1859 256
1336 3300044656 Ga0466969_0002952 Ga0466969_0002952_4140_4913 256
1337 3300044683 Ga0466965_0007844 Ga0466965_0007844_2795_3568 256
1338 3300044683 Ga0466965_0155241 Ga0466965_0155241_189_962 256
1339 3300044684 Ga0466966_0000070 Ga0466966_0000070_8924_9706 256
1340 3300044684 Ga0466966_0000237 Ga0466966_0000237_33831_34607 256
1341 3300044693 Ga0466961_0000382 Ga0466961_0000382_26114_26896 256
1342 3300044693 Ga0466961_0000919 Ga0466961_0000919_11461_12234 256
1343 3300044693 Ga0466961_0013337 Ga0466961_0013337_4214_4987 256
1344 3300044694 Ga0466963_0041349 Ga0466963_0041349_2157_2939 256
1345 3300044694 Ga0466963_0130738 Ga0466963_0130738_911_1684 256
1346 3300044706 Ga0466964_0000768 Ga0466964_0000768_2827_3600 256
1347 3300044706 Ga0466964_0157361 Ga0466964_0157361_170_952 256
1348 3300044719 Ga0466971_0015917 Ga0466971_0015917_1833_2615 256
1349 3300044842 Ga0466957_0207443 Ga0466957_0207443_392_1174 256
1350 3300045049 Ga0466959_0004089 Ga0466959_0004089_8818_9591 256
1351 3300045049 Ga0466959_0099539 Ga0466959_0099539_900_1682 256
1352 3300045836 Ga0466958_0003330 Ga0466958_0003330_3708_4490 256
1353 3300045836 Ga0466958_0003740 Ga0466958_0003740_6584_7357 256
1354 3300046453 Ga0495627_000102 Ga0495627_000102_63839_64609 256
1355 3300046453 Ga0495627_000192 Ga0495627_000192_10054_10824 256
1356 3300046453 Ga0495627_003255 Ga0495627_003255_2947_3717 256
1357 3300046454 Ga0495592_0025939 Ga0495592_0025939_941_1714 256
1358 3300046455 Ga0495603_0032675 Ga0495603_0032675_73_846 256
1359 3300046455 Ga0495603_0077747 Ga0495603_0077747_833_1606 256
1360 3300046457 Ga0495590_0000811 Ga0495590_0000811_9967_10740 256
1361 3300046457 Ga0495590_0004725 Ga0495590_0004725_2973_3746 256
1362 3300046458 Ga0495591_000105 Ga0495591_000105_68038_68808 256
1363 3300046458 Ga0495591_000563 Ga0495591_000563_21068_21838 256
1364 3300046458 Ga0495591_029119 Ga0495591_029119_95_865 256
1365 3300046458 Ga0495591_048747 Ga0495591_048747_80_850 256
1366 3300046459 Ga0495629_0000162 Ga0495629_0000162_24282_25055 256
1367 3300046459 Ga0495629_0000590 Ga0495629_0000590_10079_10852 256
1368 3300046459 Ga0495629_0011251 Ga0495629_0011251_782_1555 256
1369 3300046459 Ga0495629_0023475 Ga0495629_0023475_1901_2674 256
1370 3300046459 Ga0495629_0064524 Ga0495629_0064524_61_834 256
1371 3300046460 Ga0495638_0004511 Ga0495638_0004511_4684_5457 256
1372 3300046461 Ga0495641_0075948 Ga0495641_0075948_550_1323 256
1373 3300046462 Ga0495651_0018953 Ga0495651_0018953_3266_4039 256
1374 3300046462 Ga0495651_0392719 Ga0495651_0392719_43_816 256
1375 3300046463 Ga0495653_0019819 Ga0495653_0019819_566_1339 256
1376 3300046463 Ga0495653_0048078 Ga0495653_0048078_2407_3180 256
1377 3300046463 Ga0495653_0068884 Ga0495653_0068884_1841_2614 256
1378 3300046463 Ga0495653_0107121 Ga0495653_0107121_208_981 256
1379 3300046463 Ga0495653_0266859 Ga0495653_0266859_306_1100 256
1380 3300046471 Ga0495650_0000578 Ga0495650_0000578_11710_12480 256
1381 3300046471 Ga0495650_0004932 Ga0495650_0004932_4820_5593 256
1382 3300046471 Ga0495650_0008617 Ga0495650_0008617_18_791 256
1383 3300046471 Ga0495650_0009882 Ga0495650_0009882_2947_3720 256
1384 3300046472 Ga0495580_0000302 Ga0495580_0000302_3773_4546 256
1385 3300046472 Ga0495580_0017511 Ga0495580_0017511_48_821 256
1386 3300046472 Ga0495580_0053538 Ga0495580_0053538_1772_2545 256
1387 3300046472 Ga0495580_0159836 Ga0495580_0159836_34_861 256
1388 3300046472 Ga0495580_0180076 Ga0495580_0180076_625_1398 256
1389 3300046472 Ga0495580_0190539 Ga0495580_0190539_609_1382 256
1390 3300046473 Ga0495582_0016136 Ga0495582_0016136_2976_3749 256
1391 3300046473 Ga0495582_0021979 Ga0495582_0021979_301_1074 256
1392 3300046474 Ga0495605_0000019 Ga0495605_0000019_188067_188837 256
1393 3300046474 Ga0495605_0000620 Ga0495605_0000620_4892_5662 256
1394 3300046474 Ga0495605_0000714 Ga0495605_0000714_2530_3300 256
1395 3300046474 Ga0495605_0002635 Ga0495605_0002635_7271_8044 256
1396 3300046474 Ga0495605_0002760 Ga0495605_0002760_3311_4081 256
1397 3300046474 Ga0495605_0005245 Ga0495605_0005245_1453_2223 256
1398 3300046474 Ga0495605_0015811 Ga0495605_0015811_1581_2354 256
1399 3300046474 Ga0495605_0124585 Ga0495605_0124585_14_787 256
1400 3300046475 Ga0495639_0198471 Ga0495639_0198471_142_915 256
1401 3300046476 Ga0495662_0004393 Ga0495662_0004393_5867_6640 256
1402 3300046476 Ga0495662_0252500 Ga0495662_0252500_11_784 256
1403 3300046477 Ga0495664_0003278 Ga0495664_0003278_451_1224 256
1404 3300046477 Ga0495664_0018698 Ga0495664_0018698_432_1205 256
1405 3300046477 Ga0495664_0075808 Ga0495664_0075808_1028_1801 256
1406 3300046477 Ga0495664_0163358 Ga0495664_0163358_313_1086 256
1407 3300046477 Ga0495664_0247820 Ga0495664_0247820_54_827 256
1408 3300046491 Ga0495584_0017720 Ga0495584_0017720_1841_2611 256
1409 3300046491 Ga0495584_0084026 Ga0495584_0084026_328_1101 256
1410 3300046492 Ga0495585_0025360 Ga0495585_0025360_558_1328 256
1411 3300046499 Ga0495594_0003233 Ga0495594_0003233_6846_7616 256
1412 3300046500 Ga0495596_0002359 Ga0495596_0002359_4376_5146 256
1413 3300046500 Ga0495596_0004685 Ga0495596_0004685_2141_2914 256
1414 3300046500 Ga0495596_0079811 Ga0495596_0079811_47_820 256
1415 3300046501 Ga0495607_0000173 Ga0495607_0000173_20376_21146 256
1416 3300046501 Ga0495607_0001049 Ga0495607_0001049_1565_2335 256
1417 3300046501 Ga0495607_0001370 Ga0495607_0001370_18404_19174 256
1418 3300046501 Ga0495607_0003053 Ga0495607_0003053_3532_4302 256
1419 3300046501 Ga0495607_0034758 Ga0495607_0034758_669_1439 256
1420 3300046501 Ga0495607_0047788 Ga0495607_0047788_516_1286 256
1421 3300046506 Ga0495583_0000146 Ga0495583_0000146_81109_81879 256
1422 3300046506 Ga0495583_0003951 Ga0495583_0003951_6888_7661 256
1423 3300046506 Ga0495583_0004397 Ga0495583_0004397_6314_7084 256
1424 3300046506 Ga0495583_0008614 Ga0495583_0008614_2853_3623 256
1425 3300046506 Ga0495583_0009324 Ga0495583_0009324_2173_2943 256
1426 3300046506 Ga0495583_0009485 Ga0495583_0009485_3415_4185 256
1427 3300046506 Ga0495583_0012139 Ga0495583_0012139_78_848 256
1428 3300046507 Ga0495606_0000083 Ga0495606_0000083_109634_110404 256
1429 3300046507 Ga0495606_0001016 Ga0495606_0001016_19041_19811 256
1430 3300046507 Ga0495606_0001114 Ga0495606_0001114_115_885 256
1431 3300046507 Ga0495606_0011642 Ga0495606_0011642_2439_3212 256
1432 3300046507 Ga0495606_0031076 Ga0495606_0031076_2692_3465 256
1433 3300046512 Ga0495610_0002177 Ga0495610_0002177_6892_7662 256
1434 3300046512 Ga0495610_0002536 Ga0495610_0002536_8875_9648 256
1435 3300046512 Ga0495610_0173122 Ga0495610_0173122_113_883 256
1436 3300046514 Ga0495618_0002173 Ga0495618_0002173_8947_9720 256
1437 3300046514 Ga0495618_0004385 Ga0495618_0004385_7406_8179 256
1438 3300046514 Ga0495618_0051105 Ga0495618_0051105_1508_2281 256
1439 3300046515 Ga0495620_0000311 Ga0495620_0000311_15042_15812 256
1440 3300046515 Ga0495620_0006655 Ga0495620_0006655_5498_6268 256
1441 3300046515 Ga0495620_0034135 Ga0495620_0034135_41_811 256
1442 3300046516 Ga0495628_0002322 Ga0495628_0002322_8431_9204 256
1443 3300046516 Ga0495628_0011640 Ga0495628_0011640_1581_2354 256
1444 3300046516 Ga0495628_0089758 Ga0495628_0089758_1248_2021 256
1445 3300046516 Ga0495628_0183538 Ga0495628_0183538_503_1276 256
1446 3300046517 Ga0495630_0004921 Ga0495630_0004921_6775_7548 256
1447 3300046517 Ga0495630_0042860 Ga0495630_0042860_230_1003 256
1448 3300046517 Ga0495630_0086304 Ga0495630_0086304_1499_2272 256
1449 3300046517 Ga0495630_0501666 Ga0495630_0501666_16_789 256
1450 3300046518 Ga0495631_0002354 Ga0495631_0002354_9604_10374 256
1451 3300046518 Ga0495631_0003218 Ga0495631_0003218_7559_8329 256
1452 3300046520 Ga0495637_0002217 Ga0495637_0002217_7747_8517 256
1453 3300046520 Ga0495637_0002388 Ga0495637_0002388_7898_8668 256
1454 3300046520 Ga0495637_0030057 Ga0495637_0030057_1587_2357 256
1455 3300046522 Ga0495643_0001534 Ga0495643_0001534_1972_2742 256
1456 3300046522 Ga0495643_0004880 Ga0495643_0004880_783_1553 256
1457 3300046522 Ga0495643_0040147 Ga0495643_0040147_91_861 256
1458 3300046524 Ga0495648_0007724 Ga0495648_0007724_175_948 256
1459 3300046524 Ga0495648_0011548 Ga0495648_0011548_2061_2888 256
1460 3300046524 Ga0495648_0024339 Ga0495648_0024339_984_1757 256
1461 3300046524 Ga0495648_0044955 Ga0495648_0044955_280_1050 256
1462 3300046524 Ga0495648_0063307 Ga0495648_0063307_1035_1805 256
1463 3300046526 Ga0495666_0000199 Ga0495666_0000199_18933_19706 256
1464 3300046528 Ga0495642_0098883 Ga0495642_0098883_407_1180 256
1465 3300046528 Ga0495642_0113054 Ga0495642_0113054_141_941 256
1466 3300046529 Ga0495652_0030018 Ga0495652_0030018_3373_4146 256
1467 3300046529 Ga0495652_0037097 Ga0495652_0037097_2132_2905 256
1468 3300046529 Ga0495652_0149091 Ga0495652_0149091_73_846 256
1469 3300046529 Ga0495652_0164502 Ga0495652_0164502_866_1639 256
1470 3300046530 Ga0495654_0001519 Ga0495654_0001519_2011_2781 256
1471 3300046530 Ga0495654_0008371 Ga0495654_0008371_2120_2890 256
1472 3300046530 Ga0495654_0008437 Ga0495654_0008437_3562_4332 256
1473 3300046531 Ga0495665_0004130 Ga0495665_0004130_3715_4488 256
1474 3300046531 Ga0495665_0006502 Ga0495665_0006502_5127_5900 256
1475 3300046531 Ga0495665_0031947 Ga0495665_0031947_203_976 256
1476 3300046531 Ga0495665_0039911 Ga0495665_0039911_403_1176 256
1477 3300046531 Ga0495665_0160542 Ga0495665_0160542_227_1000 256
1478 3300046533 Ga0495640_0004166 Ga0495640_0004166_2869_3642 256
1479 3300046533 Ga0495640_0129596 Ga0495640_0129596_499_1272 256
1480 3300046535 Ga0495586_0000571 Ga0495586_0000571_19650_20423 256
1481 3300046536 Ga0495587_0006284 Ga0495587_0006284_3200_3973 256
1482 3300046536 Ga0495587_0007690 Ga0495587_0007690_6074_6847 256
1483 3300046538 Ga0495609_0000023 Ga0495609_0000023_183474_184244 256
1484 3300046538 Ga0495609_0000101 Ga0495609_0000101_81107_81877 256
1485 3300046538 Ga0495609_0000773 Ga0495609_0000773_21737_22507 256
1486 3300046542 Ga0495597_0000139 Ga0495597_0000139_28383_29153 256
1487 3300046542 Ga0495597_0005726 Ga0495597_0005726_1901_2671 256
1488 3300046543 Ga0495645_0001460 Ga0495645_0001460_4414_5187 256
1489 3300046543 Ga0495645_0002870 Ga0495645_0002870_855_1628 256
1490 3300046543 Ga0495645_0046069 Ga0495645_0046069_106_879 256
1491 3300046543 Ga0495645_0069879 Ga0495645_0069879_340_1113 256
1492 3300046557 Ga0495622_0001598 Ga0495622_0001598_7204_7977 256
1493 3300046558 Ga0495633_0000129 Ga0495633_0000129_18911_19681 256
1494 3300046616 Ga0495668_0026762 Ga0495668_0026762_829_1599 256
1495 3300046616 Ga0495668_0245411 Ga0495668_0245411_58_828 256
1496 3300046642 Ga0495634_0112819 Ga0495634_0112819_894_1667 256
1497 3300046648 Ga0495611_0004020 Ga0495611_0004020_3794_4564 256
1498 3300046648 Ga0495611_0009781 Ga0495611_0009781_2250_3020 256
1499 3300046648 Ga0495611_0032270 Ga0495611_0032270_974_1747 256
1500 3300046660 Ga0495625_0000187 Ga0495625_0000187_18078_18848 256
1501 3300046663 Ga0495635_0004608 Ga0495635_0004608_1871_2644 256
1502 3300046665 Ga0495661_0000758 Ga0495661_0000758_8640_9410 256
1503 3300046665 Ga0495661_0000760 Ga0495661_0000760_18934_19704 256
1504 3300046665 Ga0495661_0005349 Ga0495661_0005349_8155_8928 256
1505 3300046665 Ga0495661_0005985 Ga0495661_0005985_196_969 256
1506 3300046665 Ga0495661_0006686 Ga0495661_0006686_5223_5993 256
1507 3300046674 Ga0495588_0154148 Ga0495588_0154148_326_1099 256
1508 3300046674 Ga0495588_0224006 Ga0495588_0224006_104_877 256
1509 3300046674 Ga0495588_0259206 Ga0495588_0259206_87_860 256
1510 3300046679 Ga0495623_0008745 Ga0495623_0008745_874_1761 256
1511 3300046679 Ga0495623_0011620 Ga0495623_0011620_1628_2401 256
1512 3300046679 Ga0495623_0024404 Ga0495623_0024404_942_1715 256
1513 3300046679 Ga0495623_0169278 Ga0495623_0169278_257_1030 256
1514 3300046680 Ga0495646_0002147 Ga0495646_0002147_2423_3196 256
1515 3300046680 Ga0495646_0007283 Ga0495646_0007283_315_1088 256
1516 3300046680 Ga0495646_0028558 Ga0495646_0028558_1853_2626 256
1517 3300046680 Ga0495646_0071872 Ga0495646_0071872_34_807 256
1518 3300046680 Ga0495646_0146645 Ga0495646_0146645_199_972 256
1519 3300046684 Ga0495669_0037876 Ga0495669_0037876_879_1652 256
1520 3300046684 Ga0495669_0089342 Ga0495669_0089342_29_802 256
1521 3300046689 Ga0495613_0002201 Ga0495613_0002201_8033_8806 256
1522 3300046689 Ga0495613_0005270 Ga0495613_0005270_5946_6719 256
1523 3300046690 Ga0495624_0011101 Ga0495624_0011101_2335_3108 256
1524 3300046690 Ga0495624_0021591 Ga0495624_0021591_299_1072 256
1525 3300046690 Ga0495624_0023975 Ga0495624_0023975_500_1273 256
1526 3300046690 Ga0495624_0059865 Ga0495624_0059865_641_1414 256
1527 3300046690 Ga0495624_0082914 Ga0495624_0082914_783_1556 256
1528 3300046691 Ga0495670_0039768 Ga0495670_0039768_253_1026 256
1529 3300046691 Ga0495670_0072318 Ga0495670_0072318_660_1430 256
1530 3300046692 Ga0495671_0012954 Ga0495671_0012954_1808_2578 256
1531 3300046692 Ga0495671_0021416 Ga0495671_0021416_821_1591 256
1532 3300046694 Ga0495649_0001623 Ga0495649_0001623_10161_10934 256
1533 3300046694 Ga0495649_0009004 Ga0495649_0009004_3390_4160 256
1534 3300046694 Ga0495649_0018484 Ga0495649_0018484_407_1177 256
1535 3300046694 Ga0495649_0029959 Ga0495649_0029959_684_1457 256
1536 3300046694 Ga0495649_0032033 Ga0495649_0032033_1738_2511 256
1537 3300046694 Ga0495649_0032059 Ga0495649_0032059_868_1641 256
1538 3300046694 Ga0495649_0071082 Ga0495649_0071082_82_852 256
1539 3300046794 Ga0495589_0006374 Ga0495589_0006374_1634_2404 256
1540 3300046794 Ga0495589_0121709 Ga0495589_0121709_300_1127 256
1541 3300046794 Ga0495589_0133425 Ga0495589_0133425_324_1097 256
1542 3300046809 Ga0495600_0012417 Ga0495600_0012417_99_872 256
1543 3300046809 Ga0495600_0020782 Ga0495600_0020782_323_1096 256
1544 3300046810 Ga0495660_0009479 Ga0495660_0009479_988_1758 256
1545 3300046810 Ga0495660_0032968 Ga0495660_0032968_994_1764 256
1546 3300046810 Ga0495660_0043756 Ga0495660_0043756_1147_1917 256
1547 3300046810 Ga0495660_0047205 Ga0495660_0047205_1361_2131 256
1548 3300047315 Ga0495581_0000213 Ga0495581_0000213_20735_21508 256
1549 3300047315 Ga0495581_0004435 Ga0495581_0004435_530_1303 256
1550 3300047317 Ga0495604_0009492 Ga0495604_0009492_819_1706 256
1551 3300047317 Ga0495604_0046297 Ga0495604_0046297_2418_3191 256
1552 3300047317 Ga0495604_0179595 Ga0495604_0179595_501_1274 256
1553 3300047317 Ga0495604_0406238 Ga0495604_0406238_36_809 256
1554 3300047319 Ga0495674_0008178 Ga0495674_0008178_4665_5438 256
1555 3300047319 Ga0495674_0045155 Ga0495674_0045155_269_1042 256
1556 3300047319 Ga0495674_0061701 Ga0495674_0061701_190_963 256
1557 3300047319 Ga0495674_0069863 Ga0495674_0069863_222_1058 256
1558 3300047319 Ga0495674_0080226 Ga0495674_0080226_175_948 256
1559 3300047319 Ga0495674_0098583 Ga0495674_0098583_869_1642 256
1560 3300047319 Ga0495674_0137310 Ga0495674_0137310_913_1686 256
1561 3300047320 Ga0495672_0001885 Ga0495672_0001885_10520_11293 256
1562 3300047320 Ga0495672_0015722 Ga0495672_0015722_3298_4125 256
1563 3300047320 Ga0495672_0076570 Ga0495672_0076570_849_1619 256
1564 3300047320 Ga0495672_0115265 Ga0495672_0115265_575_1345 256
1565 3300047321 Ga0495676_0000011 Ga0495676_0000011_195809_196579 256
1566 3300047321 Ga0495676_0010144 Ga0495676_0010144_7708_8481 256
1567 3300047321 Ga0495676_0070585 Ga0495676_0070585_1548_2321 256
1568 3300047321 Ga0495676_0080480 Ga0495676_0080480_531_1304 256
1569 3300047321 Ga0495676_0240270 Ga0495676_0240270_106_879 256
1570 3300047322 Ga0495680_0006145 Ga0495680_0006145_1379_2152 256
1571 3300047322 Ga0495680_0030003 Ga0495680_0030003_2474_3247 256
1572 3300047322 Ga0495680_0047162 Ga0495680_0047162_1512_2285 256
1573 3300047323 Ga0495683_0000075 Ga0495683_0000075_81012_81782 256
1574 3300047323 Ga0495683_0001275 Ga0495683_0001275_129_902 256
1575 3300047323 Ga0495683_0012219 Ga0495683_0012219_989_1762 256
1576 3300047323 Ga0495683_0092360 Ga0495683_0092360_15_788 256
1577 3300047443 Ga0495687_000216 Ga0495687_000216_70861_71634 256
1578 3300047443 Ga0495687_013318 Ga0495687_013318_1747_2574 256
1579 3300047444 Ga0495675_0027553 Ga0495675_0027553_501_1388 256
1580 3300047444 Ga0495675_0153662 Ga0495675_0153662_220_993 256
1581 3300047446 Ga0495679_000742 Ga0495679_000742_8158_8931 256
1582 3300047446 Ga0495679_002129 Ga0495679_002129_4491_5264 256
1583 3300047446 Ga0495679_004723 Ga0495679_004723_4731_5501 256
1584 3300047446 Ga0495679_016801 Ga0495679_016801_869_1642 256
1585 3300047447 Ga0495685_060275 Ga0495685_060275_117_890 256
1586 3300047469 Ga0495673_0000222 Ga0495673_0000222_20123_20893 256
1587 3300047469 Ga0495673_0003752 Ga0495673_0003752_4160_4933 256
1588 3300047469 Ga0495673_0004563 Ga0495673_0004563_2371_3141 256
1589 3300047469 Ga0495673_0006893 Ga0495673_0006893_5502_6272 256
1590 3300047469 Ga0495673_0008865 Ga0495673_0008865_1356_2183 256
1591 3300047469 Ga0495673_0012689 Ga0495673_0012689_2561_3331 256
1592 3300047469 Ga0495673_0016808 Ga0495673_0016808_2642_3412 256
1593 3300047469 Ga0495673_0126745 Ga0495673_0126745_61_834 256
1594 3300047470 Ga0495681_0013105 Ga0495681_0013105_2398_3168 256
1595 3300047470 Ga0495681_0024139 Ga0495681_0024139_1201_1971 256
1596 3300047471 Ga0495684_0033516 Ga0495684_0033516_2745_3518 256
1597 3300047472 Ga0495686_0000214 Ga0495686_0000214_95077_95976 256
1598 3300047673 Ga0495593_0003130 Ga0495593_0003130_499_1272 256
1599 3300047673 Ga0495593_0014728 Ga0495593_0014728_519_1292 256
1600 3300047673 Ga0495593_0018744 Ga0495593_0018744_3066_3839 256
1601 3300047673 Ga0495593_0024505 Ga0495593_0024505_556_1329 256
1602 3300048088 Ga0495602_0015069 Ga0495602_0015069_3934_4707 256
1603 3300048088 Ga0495602_0015119 Ga0495602_0015119_866_1639 256
1604 3300048088 Ga0495602_0024836 Ga0495602_0024836_30_803 256
1605 3300048089 Ga0495614_0001465 Ga0495614_0001465_8052_8825 256
1606 3300048089 Ga0495614_0033092 Ga0495614_0033092_984_1757 256
1607 3300048091 Ga0495626_0000068 Ga0495626_0000068_103359_104129 256
1608 3300048903 Ga0496100_0026625 Ga0496100_0026625_12_785 256
1609 3300048903 Ga0496100_0066086 Ga0496100_0066086_460_1233 256
1610 3300048904 Ga0496101_0007572 Ga0496101_0007572_6157_6930 256
1611 3300048904 Ga0496101_0014875 Ga0496101_0014875_1199_1972 256
1612 3300048904 Ga0496101_0129863 Ga0496101_0129863_895_1668 256
1613 3300048905 Ga0496102_0013604 Ga0496102_0013604_3163_3936 256
1614 3300048905 Ga0496102_0078141 Ga0496102_0078141_1235_2008 256
1615 3300048906 Ga0496103_0007750 Ga0496103_0007750_3369_4142 256
1616 3300048907 Ga0496104_0436351 Ga0496104_0436351_325_1098 256
1617 3300048908 Ga0496105_0013587 Ga0496105_0013587_5182_6009 256
1618 3300048908 Ga0496105_0072398 Ga0496105_0072398_1585_2358 256
1619 3300048909 Ga0496106_0000162 Ga0496106_0000162_20903_21676 256
1620 3300048909 Ga0496106_0019573 Ga0496106_0019573_4155_4928 256
1621 3300048910 Ga0496107_0017260 Ga0496107_0017260_3413_4186 256
1622 3300048912 Ga0496109_0546768 Ga0496109_0546768_80_853 256
1623 3300048914 Ga0496111_0123409 Ga0496111_0123409_647_1417 256
1624 3300048916 Ga0496113_0014789 Ga0496113_0014789_2823_3650 256
1625 3300048916 Ga0496113_0087366 Ga0496113_0087366_491_1264 256
1626 3300048917 Ga0496114_0002335 Ga0496114_0002335_10051_10824 256
1627 3300048918 Ga0496115_0038982 Ga0496115_0038982_2019_2792 256
1628 3300048918 Ga0496115_0129922 Ga0496115_0129922_588_1361 256
1629 3300048918 Ga0496115_0189548 Ga0496115_0189548_539_1312 256
1630 3300048919 Ga0496116_0002301 Ga0496116_0002301_18898_19671 256
1631 3300048919 Ga0496116_0181336 Ga0496116_0181336_57_830 256
1632 3300048920 Ga0496117_0024649 Ga0496117_0024649_3268_4041 256
1633 3300048920 Ga0496117_0036473 Ga0496117_0036473_2762_3535 256
1634 3300048920 Ga0496117_0041767 Ga0496117_0041767_1250_2023 256
1635 3300048921 Ga0496118_0002594 Ga0496118_0002594_5368_6141 256
1636 3300048921 Ga0496118_0016936 Ga0496118_0016936_5635_6405 256
1637 3300048921 Ga0496118_0017073 Ga0496118_0017073_4350_5123 256
1638 3300048921 Ga0496118_0020754 Ga0496118_0020754_3926_4699 256
1639 3300048921 Ga0496118_0039102 Ga0496118_0039102_855_1628 256
1640 3300048921 Ga0496118_0041701 Ga0496118_0041701_324_1097 256
1641 3300048921 Ga0496118_0044043 Ga0496118_0044043_2624_3397 256
1642 3300048921 Ga0496118_0048156 Ga0496118_0048156_926_1699 256
1643 3300048921 Ga0496118_0088824 Ga0496118_0088824_1196_1969 256
1644 3300048922 Ga0496119_0000996 Ga0496119_0000996_16224_17027 256
1645 3300048922 Ga0496119_0119467 Ga0496119_0119467_299_1072 256
1646 3300048924 Ga0496121_0002966 Ga0496121_0002966_2658_3428 256
1647 3300048924 Ga0496121_0003706 Ga0496121_0003706_10236_11009 256
1648 3300048924 Ga0496121_0015441 Ga0496121_0015441_5072_5845 256
1649 3300048924 Ga0496121_0028670 Ga0496121_0028670_1330_2103 256
1650 3300048924 Ga0496121_0118850 Ga0496121_0118850_308_1081 256
1651 3300048924 Ga0496121_0171217 Ga0496121_0171217_452_1225 256
1652 3300048924 Ga0496121_0245885 Ga0496121_0245885_331_1104 256
1653 3300048924 Ga0496121_0248018 Ga0496121_0248018_131_958 256
1654 3300048925 Ga0496122_0001467 Ga0496122_0001467_17608_18411 256
1655 3300048925 Ga0496122_0006509 Ga0496122_0006509_12102_12872 256
1656 3300048925 Ga0496122_0021646 Ga0496122_0021646_168_941 256
1657 3300048926 Ga0496123_0000191 Ga0496123_0000191_110101_110904 256
1658 3300048926 Ga0496123_0057977 Ga0496123_0057977_801_1571 256
1659 3300048926 Ga0496123_0123328 Ga0496123_0123328_106_876 256
1660 3300048927 Ga0496124_0000073 Ga0496124_0000073_37661_38431 256
1661 3300048927 Ga0496124_0009527 Ga0496124_0009527_2543_3316 256
1662 3300048927 Ga0496124_0010447 Ga0496124_0010447_6676_7446 256
1663 3300048927 Ga0496124_0012421 Ga0496124_0012421_6987_7757 256
1664 3300048927 Ga0496124_0020326 Ga0496124_0020326_4058_4828 256
1665 3300048928 Ga0496125_0005828 Ga0496125_0005828_5673_6446 256
1666 3300048929 Ga0496126_0000538 Ga0496126_0000538_59868_60641 256
1667 3300048929 Ga0496126_0001364 Ga0496126_0001364_12757_13530 256
1668 3300048929 Ga0496126_0004863 Ga0496126_0004863_9541_10314 256
1669 3300048929 Ga0496126_0007775 Ga0496126_0007775_7696_8469 256
1670 3300048929 Ga0496126_0343709 Ga0496126_0343709_189_962 256
1671 3300049459 Ga0495678_000106 Ga0495678_000106_81086_81856 256
1672 3300049459 Ga0495678_000404 Ga0495678_000404_37219_37989 256
1673 3300049459 Ga0495678_012240 Ga0495678_012240_1841_2611 256
1674 3300049459 Ga0495678_042773 Ga0495678_042773_144_971 256
1675 3300049459 Ga0495678_081193 Ga0495678_081193_250_1023 256
1676 3300049460 Ga0495682_0000681 Ga0495682_0000681_19043_19813 256
1677 3300049460 Ga0495682_0006043 Ga0495682_0006043_15_842 256
1678 3300049460 Ga0495682_0011445 Ga0495682_0011445_992_1765 256
1679 3300049571 Ga0501034_0068121 Ga0501034_0068121_945_1718 256
1680 3300049853 Ga0501226_000035 Ga0501226_000035_6653_7423 256
1681 3300050510 nmdc:mga06r32_79886_c1 nmdc:mga06r32_79886_c1_1726_2571 256
1682 3300053098 Ga0500650_0000375 Ga0500650_0000375_7034_7813 256
1683 3300053131 Ga0500652_097351 Ga0500652_097351_214_1017 256
1684 3300053153 Ga0500616_0032008 Ga0500616_0032008_111_890 256
1685 iso_pu_bacteria 2599185155 2599331132 256
1686 iso_pu_bacteria 2808606379 2808939785 256
1687 iso_pu_bacteria 2818991450 2819624231 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

56

290

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wjz-assembly2.cif.gz_E crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.9618 3 256
1gpw-assembly2.cif.gz_C structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. 0.9572 3 256
6vdg-assembly1.cif.gz_A crystal structure of the y182a hisf mutant from thermotoga maritima 0.9571 4 256
4evz-assembly2.cif.gz_B structure of hisf-luca 0.9533 3 256
4evz-assembly1.cif.gz_A structure of hisf-luca 0.9524 3 256
ID Description Score Start End Superfamily
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9651 3 256 3.20.20.70
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.954 3 256 3.20.20.70
af_P60664_1_258_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9454 3 256 3.20.20.70
af_P60664_1_258_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9346 3 256 3.20.20.70
af_Q2FUU3_1_249_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9343 4 252 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3P7EQJ5-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) 0.9988 65 256 GO:0000105
GO:0000107
GO:0016829
AF-A0A257Y9L3-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF) 0.9966 113 256 GO:0000105
GO:0000107
AF-A0A7W9YZV8-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.3.2.10) (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) (IGPS subunit HisF) 0.995 1 256 GO:0000105
GO:0000107
GO:0005737
GO:0016829
AF-A0A529NGL6-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF) 0.9949 68 194 GO:0000105
GO:0000107
AF-A0A4Y7X5H6-F1-model_v4 deleted 0.9938 167 256

Feature Viewer

pLDDT pTM Quality
92.6 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map