F495276

General Info

Members Datasets Scaffolds Average Seq Length
1669 686 1480 135

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10006154|Ga0182007_100061548
Length 142
Sequence MSSSNVSMNIFDVAGSAMSAQSQRMNVTASNLANADSVSGPDGQPYRAKQVVFAVAAGDQQDGAAAVGGVQVTGVVEDQSPLRMVYNPKHPLADASGYVTMPNVNVVEEMVNMISASRSYQANVEVLNTAKTMMLKTLTIGQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
6 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
7 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
8 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
9 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
10 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
11 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
12 2547132181 Kosakonia sacchari SP1 Isolate Stem
13 2547132374 Acidovorax radicis N35 Isolate Unclassified
14 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
15 2561511199 Enterobacter sp. R4-368 Isolate Nodule
16 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
17 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
18 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
19 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
20 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
21 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
22 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
23 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
24 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
25 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
26 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
27 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
28 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
29 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
30 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
31 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
32 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
33 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
34 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
35 2643221569 Achromobacter sp. Root565 Isolate Unclassified
36 2643221570 Acidovorax sp. Root568 Isolate Unclassified
37 2643221594 Achromobacter sp. Root170 Isolate Unclassified
38 2643221596 Acidovorax sp. Root70 Isolate Unclassified
39 2643221609 Acidovorax sp. Root217 Isolate Unclassified
40 2643221611 Acidovorax sp. Root219 Isolate Unclassified
41 2643221621 Achromobacter sp. Root83 Isolate Unclassified
42 2643221652 Acidovorax sp. Root402 Isolate Unclassified
43 2643221683 Variovorax sp. Root473 Isolate Unclassified
44 2643221717 Acidovorax sp. Root267 Isolate Unclassified
45 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
46 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
47 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
48 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
49 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
50 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
51 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
52 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
53 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
54 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
55 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
56 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
57 2738541277 Variovorax sp. GV051 Isolate Unclassified
58 2738541307 Variovorax sp. GV008 Isolate Unclassified
59 2738543012 Acidovorax sp. CF301 Isolate Unclassified
60 2738543013 Variovorax sp. BT01 Isolate Unclassified
61 2738543019 Variovorax sp. GV040 Isolate Unclassified
62 2751185917 Enterobacter sp. HK169 Isolate Unclassified
63 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
64 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
65 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
66 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
67 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
68 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
69 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
70 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
71 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
72 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
73 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
74 2816332133 Acidovorax radicis 2721A Isolate Unclassified
75 2818991436 Collimonas arenae 515 Isolate Unclassified
76 2818991446 Variovorax sp. 1180 Isolate Unclassified
77 2821118458 Enterobacter asburiae 609 Isolate Unclassified
78 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
79 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
80 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
81 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
82 2842677519 Variovorax sp. R-72495 Isolate Unclassified
83 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
84 2842733646 Variovorax sp. R-72446 Isolate Unclassified
85 2842747753 Variovorax sp. R-72060 Isolate Unclassified
86 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
87 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
88 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
89 2847085930 Erwinia persicina B64 Isolate Bulb
90 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
91 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
92 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
93 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
94 2855730933 Achromobacter sp. HZ28 Isolate Nodule
95 2855767633 Achromobacter sp. HZ34 Isolate Nodule
96 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
97 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
98 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
99 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
100 2858950400 Achromobacter sp. K91 Isolate Unclassified
101 2865014394 Pantoea sp. R-71966 Isolate Unclassified
102 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
103 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
104 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
105 2876601092 Pantoea endophytica 596 Isolate Unclassified
106 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
107 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
108 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
109 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
110 2885198086 Variovorax sp. 679 Isolate Unclassified
111 2885211737 Variovorax sp. 553 Isolate Unclassified
112 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
113 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
114 2899924645 Variovorax sp. 369 Isolate Unclassified
115 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
116 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
117 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
118 2904456579 Variovorax sp. 2002 Isolate Unclassified
119 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
120 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
121 2919150387 Rahnella aceris 1817 Isolate Unclassified
122 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
123 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
124 2927143783 Rahnella sp. 2050 Isolate Unclassified
125 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
126 2928037797 Variovorax sp. 1126 Isolate Unclassified
127 2928044640 Variovorax sp. 1128 Isolate Unclassified
128 2928051484 Variovorax sp. 1133 Isolate Unclassified
129 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
130 2928070936 Variovorax gossypii 1167 Isolate Unclassified
131 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
132 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
133 2929520902 Variovorax beijingensis 502 Isolate Unclassified
134 2932406140 Serratia sp. 2723 Isolate Rhizosphere
135 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
136 2937539931 Pantoea sp. LS15 Isolate Unclassified
137 2937967321 Serratia sp. YC16 Isolate Unclassified
138 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
139 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
140 2939577877 Serratia sp. 509 Isolate Rhizosphere
141 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
142 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
143 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
144 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
145 2941479691
146 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
147 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
148 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
149 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
150 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
151 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
152 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
153 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
154 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
155 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
156 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
157 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
158 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
159 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
160 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
161 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
162 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
163 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
164 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
165 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
166 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
167 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
168 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
169 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
170 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
171 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
172 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
173 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
174 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
175 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
176 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
177 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
178 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
179 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
180 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
181 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
182 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
184 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
185 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
186 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
187 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
188 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
189 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
190 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
191 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
192 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
193 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
194 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
195 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
196 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
197 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
198 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
199 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
200 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
201 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
202 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
203 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
205 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
206 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
207 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
208 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
209 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
210 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
211 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
212 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
213 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
214 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
215 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
216 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
217 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
218 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
219 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
220 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
221 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
222 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
223 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
224 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
225 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
226 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
227 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
228 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
229 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
230 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
231 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
232 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
233 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
234 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
235 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
236 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
237 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
238 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
239 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
240 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
241 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
242 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
243 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
244 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
245 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
246 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
247 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
248 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
249 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
250 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
251 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
252 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
253 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
254 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
255 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
256 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
257 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
258 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
259 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
260 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
261 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
262 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
263 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
264 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
265 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
266 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
267 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
268 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
269 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
270 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
271 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
272 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
273 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
274 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
275 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
276 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
277 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
278 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
279 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
280 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
281 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
282 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
283 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
284 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
285 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
286 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
287 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
288 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
289 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
290 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
291 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
292 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
293 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
294 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
295 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
296 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
297 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
299 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
300 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
301 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
302 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
309 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
310 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
312 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
315 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
316 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
317 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
319 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
320 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
321 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
323 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
324 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
325 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
327 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
328 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
329 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
375 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
376 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
377 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
378 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
379 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
380 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
381 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
382 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
386 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
387 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
388 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
389 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
390 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
391 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
392 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
393 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
394 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
395 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
396 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
397 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
398 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
399 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
400 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
401 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
402 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
403 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
404 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
405 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
406 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
407 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
408 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
409 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
410 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
411 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
412 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
413 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
414 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
415 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
416 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
417 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
418 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
419 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
420 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
421 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
422 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
424 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
425 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
426 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
427 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
428 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
429 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
430 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
431 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
432 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
433 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
434 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
435 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
436 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
437 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
438 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
439 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
440 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
441 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
442 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
443 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
444 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
445 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
446 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
447 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
448 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
449 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
450 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
451 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
452 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
453 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
454 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
455 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
456 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
457 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
458 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
459 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
460 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
461 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
462 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
463 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
464 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
465 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
466 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
467 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
468 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
469 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
470 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
471 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
472 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
473 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
474 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
475 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
476 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
477 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
478 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
479 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
480 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
481 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
482 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
483 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
484 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
485 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
486 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
487 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
488 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
489 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
490 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
491 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
492 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
493 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
494 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
495 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
496 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
497 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
498 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
499 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
500 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
501 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
502 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
503 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
504 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
505 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
506 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
507 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
508 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
509 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
510 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
511 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
512 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
513 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
514 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
515 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
516 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
517 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
518 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
519 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
520 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
521 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
522 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
523 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
524 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
525 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
526 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
527 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
528 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
529 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
530 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
531 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
532 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
533 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
534 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
535 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
536 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
537 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
538 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
539 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
540 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
541 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
542 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
543 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
544 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
545 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
546 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
547 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
548 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
549 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
550 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
551 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
552 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
553 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
554 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
555 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
556 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
557 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
558 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
559 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
560 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
561 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
562 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
563 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
564 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
565 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
566 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
567 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
568 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
569 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
570 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
571 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
572 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
573 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
574 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
575 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
576 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
577 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
578 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
579 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
580 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
581 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
582 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
583 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
584 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
585 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
587 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
588 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
589 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
592 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
593 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
594 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
595 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
596 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
597 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
598 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
599 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
600 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
601 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
602 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
603 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
604 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
605 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
606 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
607 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
608 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
609 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
610 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
611 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
612 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
613 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
614 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
615 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
616 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
617 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
618 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
619 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
620 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
621 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
622 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
623 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
624 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
625 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
626 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
627 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
628 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
629 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
630 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
631 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
632 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
633 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
634 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
635 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
636 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
637 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
638 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
639 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
640 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
641 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
642 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
643 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
644 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
645 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
646 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
647 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
648 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
649 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
650 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
651 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
652 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
653 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
654 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
655 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
656 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
657 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
658 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
659 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
660 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
661 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
662 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
663 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
664 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
665 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
666 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
667 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
668 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
669 640753048 Serratia proteamaculans 568 Isolate Endosphere
670 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
671 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
672 8004592986 Serratia sp. S119 Isolate Unclassified
673 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
674 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
675 8018221730 Enterobacter sp. CM29 Isolate Unclassified
676 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
677 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
678 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
679 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
680 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
681 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
682 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
683 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
684 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
685 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
686 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.72
Metatranscriptomes 0.96
Isolates 11.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0.06
Endosphere 17.38
Nodule 2.22
Rhizoplane 4.55
Rhizosphere 56.5
Stem 0.12
Stem Tuber 0.36
Unclassified 18.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1532308 2162886007 Bacteria 4061
2 SwRhRL2b_contig_1817389 2162886007 Bacteria 3884
3 SwRhRL2b_contig_211812 2162886007 Bacteria 3566
4 SwRhRL2b_contig_3815225 2162886007 Bacteria 1537
5 SwRhRL2b_contig_648880 2162886007 Bacteria 991
6 SwRhRL2b_contig_811231 2162886007 Bacteria 3323
7 JGI24741J21665_1002439 3300001915 Bacteria 4831
8 JGI24740J21852_10001465 3300001979 Bacteria 10823
9 JGI24740J21852_10005400 3300001979 Bacteria 5412
10 JGI24740J21852_10108564 3300001979 Bacteria 701
11 JGI24739J22299_10000528 3300001989 Bacteria 13630
12 JGI24739J22299_10019327 3300001989 Bacteria 2439
13 JGI25162J39368_1000019 3300002737 Bacteria 262053
14 JGI25162J39368_1000139 3300002737 Bacteria 78439
15 JGI25162J39368_1004044 3300002737 Bacteria 3670
16 JGI25158J39367_1004522 3300002739 Bacteria 2085
17 JGI25158J39367_1014677 3300002739 Bacteria 1009
18 JGI25163J39215_1000008 3300002771 Bacteria 109086
19 JGI25163J39215_1000036 3300002771 Bacteria 61837
20 JGI25163J39215_1001578 3300002771 Bacteria 3464
21 JGI25164J39214_1000011 3300002772 Bacteria 262057
22 JGI25152J39213_1000725 3300002773 Bacteria 16934
23 JGI25152J39213_1001419 3300002773 Bacteria 10372
24 JGI25152J39213_1001623 3300002773 Bacteria 9388
25 JGI25152J39213_1008926 3300002773 Bacteria 2432
26 JGI25150J39212_1001793 3300002774 Bacteria 5716
27 JGI25150J39212_1009982 3300002774 Bacteria 1785
28 JGI25159J45721_1000435 3300002987 Bacteria 19303
29 JGI25159J45721_1001336 3300002987 Bacteria 10374
30 Ga0006759J45824_1061774 3300003163 Bacteria 2780
31 JGI25151J46595_10000198 3300003187 Bacteria 73969
32 JGI25151J46595_10000666 3300003187 Bacteria 29207
33 JGI25151J46595_10000713 3300003187 Bacteria 27800
34 JGI25151J46595_10000957 3300003187 Bacteria 22074
35 JGI25151J46595_10002229 3300003187 Bacteria 11962
36 JGI25151J46595_10011933 3300003187 Bacteria 3970
37 JGI25151J46595_10015566 3300003187 Bacteria 3347
38 JGI25151J46595_10018492 3300003187 Bacteria 2989
39 JGI25151J46595_10064364 3300003187 Bacteria 1148
40 JGI25165J46597_1000227 3300003214 Bacteria 78439
41 JGI25153J46596_10002586 3300003215 Bacteria 10372
42 JGI25153J46596_10027801 3300003215 Bacteria 1974
43 rootH2_10001915 3300003320 Bacteria 32137
44 rootH2_10011746 3300003320 Bacteria 2643
45 rootL2_10010810 3300003322 Bacteria 8638
46 rootL2_10038684 3300003322 Bacteria 7153
47 rootH1_10022702 3300003323 Bacteria 3321
48 JGI25160J50197_1000093 3300003354 Bacteria 89962
49 JGI25160J50197_1001793 3300003354 Bacteria 10374
50 JGI25160J50197_1002516 3300003354 Bacteria 8502
51 JGI25161J50226_1000443 3300003374 Bacteria 19496
52 JGI25161J50226_1001737 3300003374 Bacteria 6161
53 JGI25161J50226_1006112 3300003374 Bacteria 2225
54 Ga0007410J51695_1038845 3300003574 Bacteria 3771
55 Ga0007409J51694_1018424 3300003575 Bacteria 3742
56 Ga0007416J51690_1050216 3300003577 Bacteria 1207
57 Ga0006562J51391_1020559 3300003578 Bacteria 4830
58 Ga0032354_1047181 3300003693 Bacteria 3724
59 Ga0055538_1000021 3300003751 Bacteria 262057
60 Ga0055538_1000089 3300003751 Bacteria 78439
61 Ga0055539_1000026 3300003752 Bacteria 262057
62 Ga0055539_1000133 3300003752 Bacteria 78439
63 Ga0055533_1000035 3300003756 Bacteria 262057
64 Ga0055533_1000136 3300003756 Bacteria 78439
65 Ga0055532_1008571 3300003758 Bacteria 1272
66 Ga0055525_1000045 3300003759 Bacteria 262057
67 Ga0055525_1000181 3300003759 Bacteria 78439
68 Ga0055527_1015720 3300003760 Bacteria 823
69 Ga0055535_1000128 3300003761 Bacteria 80324
70 Ga0055542_1000062 3300003762 Bacteria 161494
71 Ga0055526_1003281 3300003771 Bacteria 10374
72 Ga0055526_1004616 3300003771 Bacteria 8207
73 Ga0055526_1025264 3300003771 Bacteria 1910
74 Ga0055537_1001084 3300003773 Bacteria 11962
75 Ga0055537_1001152 3300003773 Bacteria 11308
76 Ga0055537_1005883 3300003773 Bacteria 3208
77 Ga0055537_1030973 3300003773 Bacteria 688
78 Ga0055524_1002106 3300003775 Bacteria 10514
79 Ga0055524_1002148 3300003775 Bacteria 10374
80 Ga0055524_1003128 3300003775 Bacteria 8167
81 Ga0055524_1009474 3300003775 Bacteria 3956
82 Ga0055524_1064653 3300003775 Bacteria 737
83 Ga0055536_1000045 3300003781 Bacteria 120495
84 Ga0055536_1001927 3300003781 Bacteria 12006
85 Ga0055536_1008144 3300003781 Bacteria 4563
86 Ga0055536_1029855 3300003781 Bacteria 1455
87 Ga0055534_1000607 3300003784 Bacteria 18537
88 Ga0055534_1000680 3300003784 Bacteria 16840
89 Ga0055534_1000948 3300003784 Bacteria 12920
90 Ga0055534_1001053 3300003784 Bacteria 11964
91 Ga0055534_1026656 3300003784 Bacteria 917
92 Ga0055534_1030244 3300003784 Bacteria 838
93 Ga0055528_1001880 3300003790 Bacteria 11962
94 Ga0055528_1012891 3300003790 Bacteria 3208
95 Ga0055530_10001484 3300003791 Bacteria 17030
96 Ga0055530_10036030 3300003791 Bacteria 1248
97 Ga0055540_1002723 3300003792 Bacteria 9092
98 Ga0055540_1003970 3300003792 Bacteria 6892
99 Ga0055540_1004043 3300003792 Bacteria 6819
100 Ga0055540_1010254 3300003792 Bacteria 3131
101 Ga0055531_10002613 3300003794 Bacteria 11930
102 Ga0055531_10042539 3300003794 Bacteria 1297
103 Ga0055541_1000020 3300003841 Bacteria 262057
104 Ga0055541_1000088 3300003841 Bacteria 78439
105 Ga0058692_1000058 3300003856 Bacteria 99195
106 Ga0058692_1000127 3300003856 Bacteria 48125
107 Ga0058692_1000356 3300003856 Bacteria 22204
108 Ga0058692_1000889 3300003856 Bacteria 11763
109 Ga0058692_1001028 3300003856 Bacteria 10963
110 Ga0058692_1003139 3300003856 Bacteria 5239
111 Ga0058692_1005468 3300003856 Bacteria 3620
112 Ga0058692_1006611 3300003856 Bacteria 3158
113 Ga0058692_1008376 3300003856 Bacteria 2669
114 Ga0058692_1008738 3300003856 Bacteria 2599
115 Ga0058692_1009721 3300003856 Bacteria 2410
116 Ga0058692_1016142 3300003856 Bacteria 1667
117 Ga0058692_1036964 3300003856 Bacteria 880
118 Ga0055543_1001728 3300004625 Bacteria 8190
119 Ga0055543_1002173 3300004625 Bacteria 6747
120 Ga0058861_10505237 3300004800 Bacteria 2053
121 Ga0065165_1003326 3300005262 Bacteria 11487
122 Ga0065165_1005438 3300005262 Bacteria 7159
123 Ga0065165_1010696 3300005262 Bacteria 3926
124 Ga0065165_1116696 3300005262 Bacteria 651
125 Ga0065165_1131492 3300005262 Bacteria 598
126 Ga0065703_1020318 3300005272 Bacteria 1878
127 Ga0065714_10166784 3300005288 Bacteria 1024
128 Ga0065704_10000333 3300005289 Bacteria 49423
129 Ga0065704_10000631 3300005289 Bacteria 14774
130 Ga0065704_10001218 3300005289 Bacteria 18433
131 Ga0065704_10003968 3300005289 Bacteria 10032
132 Ga0065704_10071586 3300005289 Bacteria 10614
133 Ga0065704_10086036 3300005289 Bacteria 3162
134 Ga0065704_10086235 3300005289 Bacteria 3141
135 Ga0065704_10129206 3300005289 Bacteria 1651
136 Ga0065704_10141574 3300005289 Bacteria 1512
137 Ga0070658_10070073 3300005327 Bacteria 2870
138 Ga0070658_10148408 3300005327 Bacteria 1962
139 Ga0070658_10243894 3300005327 Bacteria 1523
140 Ga0070658_10557291 3300005327 Bacteria 992
141 Ga0070676_10065117 3300005328 Bacteria 2175
142 Ga0070670_100679234 3300005331 Bacteria 925
143 Ga0070677_10324179 3300005333 Bacteria 790
144 Ga0070680_100022363 3300005336 Bacteria 5037
145 Ga0070680_100495764 3300005336 Bacteria 1045
146 Ga0070682_100010205 3300005337 Bacteria 5325
147 Ga0070682_101235099 3300005337 Bacteria 632
148 Ga0068868_102001739 3300005338 Bacteria 550
149 Ga0070660_100907056 3300005339 Bacteria 743
150 Ga0070691_10006226 3300005341 Bacteria 5445
151 Ga0070691_10036380 3300005341 Bacteria 2320
152 Ga0070691_10198210 3300005341 Bacteria 1053
153 Ga0070687_100056664 3300005343 Bacteria 2051
154 Ga0070661_100015748 3300005344 Bacteria 5337
155 Ga0070661_100398030 3300005344 Bacteria 1088
156 Ga0070661_100546966 3300005344 Bacteria 931
157 Ga0070692_10041561 3300005345 Bacteria 2356
158 Ga0070692_10064627 3300005345 Bacteria 1935
159 Ga0070668_100017378 3300005347 Bacteria 5387
160 Ga0070668_100239409 3300005347 Bacteria 1503
161 Ga0070668_101124166 3300005347 Bacteria 710
162 Ga0070669_100006871 3300005353 Bacteria 8179
163 Ga0070674_100027809 3300005356 Bacteria 3709
164 Ga0070673_100319045 3300005364 Bacteria 1372
165 Ga0070659_100282356 3300005366 Bacteria 1381
166 Ga0070659_100518883 3300005366 Bacteria 1017
167 Ga0070667_100013220 3300005367 Bacteria 6821
168 Ga0070667_100051123 3300005367 Bacteria 3484
169 Ga0070667_100133305 3300005367 Bacteria 2170
170 Ga0070663_100005681 3300005455 Bacteria 7432
171 Ga0070663_100023732 3300005455 Bacteria 4116
172 Ga0070678_100417589 3300005456 Bacteria 1169
173 Ga0070678_101657403 3300005456 Bacteria 601
174 Ga0070662_100017220 3300005457 Bacteria 4866
175 Ga0070662_100235146 3300005457 Bacteria 1467
176 Ga0070681_10000088 3300005458 Bacteria 69295
177 Ga0070681_10002015 3300005458 Bacteria 18385
178 Ga0070681_10984032 3300005458 Bacteria 763
179 Ga0070679_100000061 3300005530 Bacteria 80570
180 Ga0070679_100287609 3300005530 Bacteria 1595
181 Ga0068853_100001354 3300005539 Bacteria 17657
182 Ga0068853_100047998 3300005539 Bacteria 3665
183 Ga0068853_100302849 3300005539 Bacteria 1478
184 Ga0068853_100355525 3300005539 Bacteria 1363
185 Ga0070696_100015635 3300005546 Bacteria 5099
186 Ga0070696_100024095 3300005546 Bacteria 4136
187 Ga0070693_100008374 3300005547 Bacteria 5095
188 Ga0070665_100000262 3300005548 Bacteria 86632
189 Ga0070665_100010362 3300005548 Bacteria 9432
190 Ga0070665_100070998 3300005548 Bacteria 3489
191 Ga0070665_100775281 3300005548 Bacteria 972
192 Ga0070665_100833059 3300005548 Bacteria 936
193 Ga0070665_101682702 3300005548 Bacteria 642
194 Ga0068855_100010497 3300005563 Bacteria 11173
195 Ga0068855_100224695 3300005563 Bacteria 2104
196 Ga0070664_100099825 3300005564 Bacteria 2523
197 Ga0068857_100000082 3300005577 Bacteria 55308
198 Ga0068857_100036973 3300005577 Bacteria 4324
199 Ga0068857_100650963 3300005577 Bacteria 999
200 Ga0068857_101000606 3300005577 Bacteria 805
201 Ga0068854_100061734 3300005578 Bacteria 2715
202 Ga0068852_100320257 3300005616 Bacteria 1506
203 Ga0068852_100805233 3300005616 Bacteria 954
204 Ga0068859_100135523 3300005617 Bacteria 2535
205 Ga0068851_10001818 3300005834 Bacteria 9333
206 Ga0068851_10012101 3300005834 Bacteria 4062
207 Ga0068870_11119288 3300005840 Bacteria 567
208 Ga0068863_100031760 3300005841 Bacteria 5038
209 Ga0068860_100301337 3300005843 Bacteria 1570
210 Ga0081539_10075937 3300005985 Bacteria 1782
211 Ga0075365_10093978 3300006038 Bacteria 2046
212 Ga0075363_100698181 3300006048 Bacteria 613
213 Ga0075364_10004261 3300006051 Bacteria 8212
214 Ga0075364_10019925 3300006051 Bacteria 4214
215 Ga0075364_10039524 3300006051 Bacteria 3058
216 Ga0075364_10090303 3300006051 Bacteria 2032
217 Ga0075364_10122334 3300006051 Bacteria 1743
218 Ga0075364_10139974 3300006051 Bacteria 1627
219 Ga0075364_10141236 3300006051 Bacteria 1620
220 Ga0075364_10229103 3300006051 Bacteria 1262
221 Ga0075364_10252742 3300006051 Bacteria 1198
222 Ga0075364_10669159 3300006051 Bacteria 709
223 Ga0075432_10045356 3300006058 Bacteria 1542
224 Ga0075362_10000528 3300006177 Bacteria 11099
225 Ga0075362_10002538 3300006177 Bacteria 6156
226 Ga0075362_10017911 3300006177 Bacteria 2924
227 Ga0075369_10155822 3300006186 Bacteria 1045
228 Ga0075369_10203553 3300006186 Bacteria 914
229 Ga0075366_10036012 3300006195 Bacteria 2917
230 Ga0075366_10255351 3300006195 Bacteria 1069
231 Ga0075370_10004045 3300006353 Bacteria 7049
232 Ga0075370_10016704 3300006353 Bacteria 3951
233 Ga0075370_10019421 3300006353 Bacteria 3701
234 Ga0075370_10367422 3300006353 Bacteria 861
235 Ga0075430_100079155 3300006846 Bacteria 2755
236 Ga0075433_10254037 3300006852 Bacteria 1559
237 Ga0097620_100135524 3300006931 Bacteria 2535
238 Ga0079104_1000035 3300006946 Bacteria 198709
239 Ga0079104_1000274 3300006946 Bacteria 67264
240 Ga0079104_1000343 3300006946 Bacteria 56060
241 Ga0079104_1000464 3300006946 Bacteria 45595
242 Ga0079104_1000819 3300006946 Bacteria 25996
243 Ga0079104_1001653 3300006946 Bacteria 14405
244 Ga0079104_1001797 3300006946 Bacteria 13307
245 Ga0079104_1003555 3300006946 Bacteria 7168
246 Ga0079104_1015838 3300006946 Bacteria 2221
247 Ga0079104_1022141 3300006946 Bacteria 1716
248 Ga0079104_1022902 3300006946 Bacteria 1671
249 Ga0079104_1024210 3300006946 Bacteria 1602
250 Ga0079104_1051905 3300006946 Bacteria 911
251 Ga0079104_1066673 3300006946 Bacteria 763
252 Ga0099826_10000013 3300006948 Bacteria 265459
253 Ga0099826_10139907 3300006948 Bacteria 1400
254 Ga0099826_10481446 3300006948 Bacteria 584
255 Ga0105251_10002660 3300009011 Bacteria 13773
256 Ga0105251_10002718 3300009011 Bacteria 13563
257 Ga0105251_10002876 3300009011 Bacteria 12987
258 Ga0105251_10007342 3300009011 Bacteria 6810
259 Ga0105251_10008589 3300009011 Bacteria 6129
260 Ga0105251_10011774 3300009011 Bacteria 4980
261 Ga0105251_10025606 3300009011 Bacteria 3015
262 Ga0105251_10027110 3300009011 Bacteria 2909
263 Ga0105251_10035985 3300009011 Bacteria 2439
264 Ga0105251_10079343 3300009011 Bacteria 1519
265 Ga0105251_10098773 3300009011 Bacteria 1335
266 Ga0105251_10110569 3300009011 Bacteria 1252
267 Ga0105251_10213105 3300009011 Bacteria 869
268 Ga0105244_10000117 3300009036 Bacteria 83982
269 Ga0105244_10000123 3300009036 Bacteria 79547
270 Ga0105244_10000491 3300009036 Bacteria 35705
271 Ga0105244_10001091 3300009036 Bacteria 22607
272 Ga0105244_10001372 3300009036 Bacteria 19788
273 Ga0105244_10002148 3300009036 Bacteria 15132
274 Ga0105244_10002204 3300009036 Bacteria 14884
275 Ga0105244_10003085 3300009036 Bacteria 12193
276 Ga0105244_10014092 3300009036 Bacteria 4639
277 Ga0105244_10025906 3300009036 Bacteria 3180
278 Ga0105244_10038004 3300009036 Bacteria 2513
279 Ga0105244_10065064 3300009036 Bacteria 1827
280 Ga0105244_10124884 3300009036 Bacteria 1244
281 Ga0105244_10144566 3300009036 Bacteria 1142
282 Ga0105244_10206087 3300009036 Bacteria 926
283 Ga0105250_10000037 3300009092 Bacteria 143923
284 Ga0105250_10000414 3300009092 Bacteria 31316
285 Ga0105250_10000650 3300009092 Bacteria 22037
286 Ga0105250_10000917 3300009092 Bacteria 17339
287 Ga0105250_10001186 3300009092 Bacteria 14627
288 Ga0105250_10002778 3300009092 Bacteria 8595
289 Ga0105250_10002792 3300009092 Bacteria 8567
290 Ga0105250_10004534 3300009092 Bacteria 6375
291 Ga0105250_10065924 3300009092 Bacteria 1460
292 Ga0105250_10067681 3300009092 Bacteria 1441
293 Ga0105250_10077887 3300009092 Bacteria 1342
294 Ga0105250_10272096 3300009092 Bacteria 727
295 Ga0105240_10062558 3300009093 Bacteria 4633
296 Ga0105240_10273746 3300009093 Bacteria 1943
297 Ga0105240_10335586 3300009093 Bacteria 1718
298 Ga0105240_10498509 3300009093 Bacteria 1354
299 Ga0105240_11260892 3300009093 Bacteria 781
300 Ga0105240_11310510 3300009093 Bacteria 764
301 Ga0105247_10000086 3300009101 Bacteria 99603
302 Ga0105243_10003849 3300009148 Bacteria 11994
303 Ga0105243_10092126 3300009148 Bacteria 2498
304 Ga0105243_12744318 3300009148 Bacteria 533
305 Ga0105241_10000001 3300009174 Bacteria 879793
306 Ga0105241_10130865 3300009174 Bacteria 2031
307 Ga0105241_12690589 3300009174 Bacteria 501
308 Ga0105242_10002597 3300009176 Bacteria 14150
309 Ga0105242_10068733 3300009176 Bacteria 2931
310 Ga0105242_11474481 3300009176 Bacteria 710
311 Ga0105242_11525997 3300009176 Bacteria 700
312 Ga0105248_10253265 3300009177 Bacteria 1981
313 Ga0105237_10011495 3300009545 Bacteria 9366
314 Ga0105237_10150560 3300009545 Bacteria 2323
315 Ga0105237_10395502 3300009545 Bacteria 1387
316 Ga0105238_10001283 3300009551 Bacteria 25225
317 Ga0105238_10634030 3300009551 Bacteria 1078
318 Ga0105249_10340702 3300009553 Bacteria 1516
319 Ga0105239_10013831 3300010375 Bacteria 8956
320 Ga0105246_10073988 3300011119 Bacteria 2407
321 Ga0105246_10155285 3300011119 Bacteria 1737
322 Ga0105246_10493964 3300011119 Bacteria 1038
323 Ga0105246_11291391 3300011119 Bacteria 676
324 Ga0157347_1033606 3300012502 Bacteria 652
325 Ga0157373_10000200 3300013100 Bacteria 49401
326 Ga0157373_10005859 3300013100 Bacteria 9193
327 Ga0157373_10018164 3300013100 Bacteria 5122
328 Ga0157373_10029150 3300013100 Bacteria 3979
329 Ga0157373_10031860 3300013100 Bacteria 3796
330 Ga0157373_10040095 3300013100 Bacteria 3352
331 Ga0157373_10046256 3300013100 Bacteria 3105
332 Ga0157373_10137322 3300013100 Bacteria 1719
333 Ga0157373_10174876 3300013100 Bacteria 1511
334 Ga0157373_10258326 3300013100 Bacteria 1232
335 Ga0157371_10000067 3300013102 Bacteria 168242
336 Ga0157371_10000156 3300013102 Bacteria 100191
337 Ga0157371_10003023 3300013102 Bacteria 15617
338 Ga0157371_10006525 3300013102 Bacteria 9599
339 Ga0157371_10016466 3300013102 Bacteria 5517
340 Ga0157371_10028186 3300013102 Bacteria 4069
341 Ga0157371_10049077 3300013102 Bacteria 2999
342 Ga0157371_10146989 3300013102 Bacteria 1680
343 Ga0157371_10149671 3300013102 Bacteria 1664
344 Ga0157371_10381989 3300013102 Bacteria 1028
345 Ga0157371_10474916 3300013102 Bacteria 921
346 Ga0157371_10503224 3300013102 Bacteria 895
347 Ga0157371_11187912 3300013102 Bacteria 587
348 Ga0157370_10000814 3300013104 Bacteria 39443
349 Ga0157370_10003193 3300013104 Bacteria 19382
350 Ga0157370_10003562 3300013104 Bacteria 18230
351 Ga0157370_10005747 3300013104 Bacteria 13872
352 Ga0157370_10028456 3300013104 Bacteria 5497
353 Ga0157370_10063234 3300013104 Bacteria 3507
354 Ga0157370_10067492 3300013104 Bacteria 3381
355 Ga0157370_10123676 3300013104 Bacteria 2415
356 Ga0157370_10181136 3300013104 Bacteria 1958
357 Ga0157370_10396757 3300013104 Bacteria 1270
358 Ga0157370_10544307 3300013104 Bacteria 1064
359 Ga0157370_11460098 3300013104 Bacteria 615
360 Ga0157369_10002007 3300013105 Bacteria 24526
361 Ga0157369_10010610 3300013105 Bacteria 10485
362 Ga0157369_10016298 3300013105 Bacteria 8365
363 Ga0157369_10024085 3300013105 Bacteria 6774
364 Ga0157369_10650919 3300013105 Bacteria 1087
365 Ga0157374_10002106 3300013296 Bacteria 16738
366 Ga0157374_11778966 3300013296 Bacteria 641
367 Ga0163162_10071042 3300013306 Bacteria 3533
368 Ga0163162_10071964 3300013306 Bacteria 3512
369 Ga0163162_10140414 3300013306 Bacteria 2529
370 Ga0163162_10259980 3300013306 Bacteria 1868
371 Ga0157372_10001630 3300013307 Bacteria 24355
372 Ga0157372_10001655 3300013307 Bacteria 24172
373 Ga0157372_10001723 3300013307 Bacteria 23725
374 Ga0157372_10003992 3300013307 Bacteria 15837
375 Ga0157372_10025560 3300013307 Bacteria 6423
376 Ga0157372_10056434 3300013307 Bacteria 4388
377 Ga0157372_10057183 3300013307 Bacteria 4359
378 Ga0157372_10117318 3300013307 Bacteria 3053
379 Ga0157372_10157175 3300013307 Bacteria 2626
380 Ga0157372_10457502 3300013307 Bacteria 1487
381 Ga0157372_10496574 3300013307 Bacteria 1423
382 Ga0157375_11572794 3300013308 Bacteria 777
383 Ga0182008_10000877 3300014497 Bacteria 20906
384 Ga0182008_10001330 3300014497 Bacteria 16858
385 Ga0182008_10005352 3300014497 Bacteria 7328
386 Ga0182008_10009021 3300014497 Bacteria 5403
387 Ga0182008_10012011 3300014497 Bacteria 4585
388 Ga0182008_10081751 3300014497 Bacteria 1590
389 Ga0182008_10310770 3300014497 Bacteria 827
390 Ga0157379_10003242 3300014968 Bacteria 13800
391 Ga0157376_11058796 3300014969 Bacteria 836
392 Ga0182006_1000022 3300015261 Bacteria 275350
393 Ga0182006_1039514 3300015261 Bacteria 1861
394 Ga0182006_1045596 3300015261 Bacteria 1705
395 Ga0182006_1049881 3300015261 Bacteria 1614
396 Ga0182006_1050636 3300015261 Bacteria 1600
397 Ga0182006_1109871 3300015261 Bacteria 969
398 Ga0182007_10003487 3300015262 Bacteria 7404
399 Ga0182007_10006154 3300015262 Bacteria 5180
400 Ga0182007_10016771 3300015262 Bacteria 2692
401 Ga0182005_1000075 3300015265 Bacteria 79711
402 Ga0183366_1001 3300015679 Bacteria 2743932
403 Ga0183370_1001 3300015680 Bacteria 2743932
404 Ga0183362_10001 3300015683 Bacteria 2046624
405 Ga0183369_1001 3300015685 Bacteria 2743932
406 Ga0183368_1001 3300015687 Bacteria 2743932
407 Ga0163161_10000001 3300017792 Bacteria 2041488
408 Ga0163161_10019762 3300017792 Bacteria 4725
409 Ga0163161_10040757 3300017792 Bacteria 3336
410 Ga0163161_10055207 3300017792 Bacteria 2883
411 Ga0206356_10036066 3300020070 Bacteria 6683
412 Ga0206354_11653555 3300020081 Bacteria 2241
413 Ga0206353_11505629 3300020082 Bacteria 1523
414 Ga0154015_1259153 3300020610 Bacteria 1238
415 Ga0213874_10372997 3300021377 Bacteria 551
416 Ga0213876_10000086 3300021384 Bacteria 106079
417 Ga0209760_100004 3300025207 Bacteria 254650
418 Ga0209760_101358 3300025207 Bacteria 2628
419 Ga0209436_101095 3300025208 Bacteria 10137
420 Ga0209436_103393 3300025208 Bacteria 4259
421 Ga0209784_100001 3300025224 Bacteria 3600592
422 Ga0209784_100071 3300025224 Bacteria 151400
423 Ga0209566_100001 3300025225 Bacteria 3600765
424 Ga0209566_100004 3300025225 Bacteria 1531866
425 Ga0209674_100002 3300025226 Bacteria 3600592
426 Ga0209674_100006 3300025226 Bacteria 1531866
427 Ga0209672_100319 3300025228 Bacteria 31820
428 Ga0209147_101404 3300025229 Bacteria 8838
429 Ga0209563_100002 3300025230 Bacteria 2045675
430 Ga0209563_100104 3300025230 Bacteria 151400
431 Ga0207427_100012 3300025231 Bacteria 585657
432 Ga0207427_100308 3300025231 Bacteria 33981
433 Ga0209437_100001 3300025233 Bacteria 2045675
434 Ga0209437_100035 3300025233 Bacteria 481110
435 Ga0209437_100158 3300025233 Bacteria 151400
436 Ga0209258_100154 3300025242 Bacteria 158235
437 Ga0207425_1000215 3300025245 Bacteria 45771
438 Ga0207425_1002841 3300025245 Bacteria 5827
439 Ga0207425_1004676 3300025245 Bacteria 4046
440 Ga0207425_1013759 3300025245 Bacteria 1858
441 Ga0207425_1024413 3300025245 Bacteria 1256
442 Ga0207425_1026374 3300025245 Bacteria 1192
443 Ga0209677_100002 3300025253 Bacteria 2045675
444 Ga0209677_100064 3300025253 Bacteria 151400
445 Ga0209677_112773 3300025253 Bacteria 1227
446 Ga0209148_1000145 3300025254 Bacteria 161352
447 Ga0209129_1000018 3300025258 Bacteria 469298
448 Ga0209129_1000054 3300025258 Bacteria 261997
449 Ga0209129_1000103 3300025258 Bacteria 161305
450 Ga0209129_1009530 3300025258 Bacteria 2543
451 Ga0209233_1000005 3300025261 Bacteria 1531866
452 Ga0209233_1001009 3300025261 Bacteria 12019
453 Ga0209565_1000086 3300025263 Bacteria 152204
454 Ga0209565_1000317 3300025263 Bacteria 44071
455 Ga0209565_1001154 3300025263 Bacteria 12731
456 Ga0209565_1003106 3300025263 Bacteria 5572
457 Ga0209565_1005158 3300025263 Bacteria 3840
458 Ga0209455_1000399 3300025272 Bacteria 36942
459 Ga0209673_1000168 3300025273 Bacteria 135126
460 Ga0209673_1001793 3300025273 Bacteria 17739
461 Ga0209673_1009768 3300025273 Bacteria 4116
462 Ga0209130_1000206 3300025284 Bacteria 79198
463 Ga0209130_1001133 3300025284 Bacteria 19524
464 Ga0209130_1001531 3300025284 Bacteria 14805
465 Ga0209130_1001936 3300025284 Bacteria 11521
466 Ga0209130_1013485 3300025284 Bacteria 2090
467 Ga0209675_1000193 3300025291 Bacteria 66563
468 Ga0209675_1000548 3300025291 Bacteria 27388
469 Ga0209675_1002487 3300025291 Bacteria 9442
470 Ga0209675_1002730 3300025291 Bacteria 8841
471 Ga0209675_1005202 3300025291 Bacteria 5514
472 Ga0209675_1005551 3300025291 Bacteria 5256
473 Ga0209675_1019667 3300025291 Bacteria 1850
474 Ga0209676_1000053 3300025292 Bacteria 370111
475 Ga0209676_1000103 3300025292 Bacteria 226908
476 Ga0209676_1000290 3300025292 Bacteria 103000
477 Ga0209676_1004587 3300025292 Bacteria 7631
478 Ga0209676_1004993 3300025292 Bacteria 7110
479 Ga0209025_1000018 3300025294 Bacteria 686898
480 Ga0209025_1000034 3300025294 Bacteria 413205
481 Ga0209025_1000059 3300025294 Bacteria 305480
482 Ga0209025_1000073 3300025294 Bacteria 282133
483 Ga0209025_1000093 3300025294 Bacteria 241788
484 Ga0209025_1000201 3300025294 Bacteria 145890
485 Ga0209025_1003493 3300025294 Bacteria 14805
486 Ga0209025_1023935 3300025294 Bacteria 3173
487 Ga0209025_1035232 3300025294 Bacteria 2265
488 Ga0209025_1038171 3300025294 Bacteria 2117
489 Ga0209025_1062942 3300025294 Bacteria 1372
490 Ga0209564_1000301 3300025295 Bacteria 97869
491 Ga0209564_1000408 3300025295 Bacteria 76528
492 Ga0209564_1001285 3300025295 Bacteria 27486
493 Ga0209564_1003017 3300025295 Bacteria 12029
494 Ga0209564_1004316 3300025295 Bacteria 8786
495 Ga0209758_1000034 3300025297 Bacteria 467637
496 Ga0209758_1011927 3300025297 Bacteria 4947
497 Ga0209758_1034934 3300025297 Bacteria 1989
498 Ga0209758_1052022 3300025297 Bacteria 1420
499 Ga0209758_1114102 3300025297 Bacteria 742
500 Ga0209050_1000012 3300025298 Bacteria 813717
501 Ga0209050_1001244 3300025298 Bacteria 29472
502 Ga0209050_1007544 3300025298 Bacteria 6063
503 Ga0209050_1009167 3300025298 Bacteria 5116
504 Ga0209256_1000066 3300025299 Bacteria 247534
505 Ga0209256_1000086 3300025299 Bacteria 218837
506 Ga0209256_1001063 3300025299 Bacteria 31840
507 Ga0209256_1003254 3300025299 Bacteria 11683
508 Ga0209256_1085940 3300025299 Bacteria 678
509 Ga0207426_1000058 3300025302 Bacteria 363857
510 Ga0207426_1000067 3300025302 Bacteria 342108
511 Ga0207426_1000156 3300025302 Bacteria 178646
512 Ga0209051_1000019 3300025303 Bacteria 511268
513 Ga0209051_1000141 3300025303 Bacteria 135837
514 Ga0209051_1001450 3300025303 Bacteria 20110
515 Ga0209051_1001589 3300025303 Bacteria 18632
516 Ga0209051_1002728 3300025303 Bacteria 12254
517 Ga0209051_1053241 3300025303 Bacteria 1331
518 Ga0209051_1067377 3300025303 Bacteria 1095
519 Ga0209051_1075533 3300025303 Bacteria 994
520 Ga0209257_1000024 3300025304 Bacteria 726068
521 Ga0209257_1003493 3300025304 Bacteria 13388
522 Ga0209257_1015612 3300025304 Bacteria 3146
523 Ga0207656_10004218 3300025321 Bacteria 5000
524 Ga0207656_10017790 3300025321 Bacteria 2789
525 Ga0207696_1000001 3300025711 Bacteria 2579611
526 Ga0207696_1000070 3300025711 Bacteria 227242
527 Ga0207696_1000099 3300025711 Bacteria 173329
528 Ga0207696_1000170 3300025711 Bacteria 102852
529 Ga0207696_1000537 3300025711 Bacteria 30749
530 Ga0207696_1001040 3300025711 Bacteria 16508
531 Ga0207696_1002538 3300025711 Bacteria 8897
532 Ga0207696_1004683 3300025711 Bacteria 5844
533 Ga0207696_1007450 3300025711 Bacteria 4283
534 Ga0207696_1010764 3300025711 Bacteria 3336
535 Ga0207696_1012417 3300025711 Bacteria 3011
536 Ga0207696_1039647 3300025711 Bacteria 1384
537 Ga0207655_1000001 3300025728 Bacteria 1866413
538 Ga0207655_1000009 3300025728 Bacteria 664676
539 Ga0207655_1000046 3300025728 Bacteria 309474
540 Ga0207655_1000071 3300025728 Bacteria 237394
541 Ga0207655_1000089 3300025728 Bacteria 204720
542 Ga0207655_1000215 3300025728 Bacteria 100334
543 Ga0207655_1000363 3300025728 Bacteria 64519
544 Ga0207655_1000506 3300025728 Bacteria 49895
545 Ga0207655_1000763 3300025728 Bacteria 36016
546 Ga0207655_1006208 3300025728 Bacteria 7957
547 Ga0207655_1015575 3300025728 Bacteria 4215
548 Ga0207655_1043112 3300025728 Bacteria 1913
549 Ga0207655_1060447 3300025728 Bacteria 1469
550 Ga0207713_1000001 3300025735 Bacteria 2295391
551 Ga0207713_1000004 3300025735 Bacteria 702781
552 Ga0207713_1000018 3300025735 Bacteria 362635
553 Ga0207713_1000120 3300025735 Bacteria 123766
554 Ga0207713_1002665 3300025735 Bacteria 12798
555 Ga0207713_1004886 3300025735 Bacteria 8583
556 Ga0207713_1018235 3300025735 Bacteria 3481
557 Ga0207713_1018975 3300025735 Bacteria 3385
558 Ga0207713_1030329 3300025735 Bacteria 2409
559 Ga0207713_1035127 3300025735 Bacteria 2167
560 Ga0207713_1035833 3300025735 Bacteria 2136
561 Ga0207713_1071665 3300025735 Bacteria 1278
562 Ga0207713_1089201 3300025735 Bacteria 1088
563 Ga0207710_10000233 3300025900 Bacteria 48055
564 Ga0207710_10081304 3300025900 Bacteria 1503
565 Ga0207680_10011667 3300025903 Bacteria 4448
566 Ga0207647_10003226 3300025904 Bacteria 12238
567 Ga0207705_10000029 3300025909 Bacteria 239897
568 Ga0207705_10000755 3300025909 Bacteria 26682
569 Ga0207705_10056150 3300025909 Bacteria 2839
570 Ga0207705_10958300 3300025909 Bacteria 662
571 Ga0207654_10000004 3300025911 Bacteria 902334
572 Ga0207654_10115476 3300025911 Bacteria 1677
573 Ga0207707_10000042 3300025912 Bacteria 126050
574 Ga0207707_10000144 3300025912 Bacteria 73715
575 Ga0207707_10001056 3300025912 Bacteria 26434
576 Ga0207707_10008129 3300025912 Bacteria 9110
577 Ga0207707_10206830 3300025912 Bacteria 1710
578 Ga0207695_10002071 3300025913 Bacteria 30574
579 Ga0207695_10010137 3300025913 Bacteria 11561
580 Ga0207695_10084151 3300025913 Bacteria 3212
581 Ga0207695_10367416 3300025913 Bacteria 1325
582 Ga0207671_10026936 3300025914 Bacteria 4301
583 Ga0207660_10000413 3300025917 Bacteria 28242
584 Ga0207662_10099146 3300025918 Bacteria 1803
585 Ga0207657_10592936 3300025919 Bacteria 865
586 Ga0207649_10007256 3300025920 Bacteria 6025
587 Ga0207649_10015548 3300025920 Bacteria 4275
588 Ga0207649_10519784 3300025920 Bacteria 907
589 Ga0207649_10566197 3300025920 Bacteria 871
590 Ga0207652_10000082 3300025921 Bacteria 103057
591 Ga0207652_10000808 3300025921 Bacteria 29892
592 Ga0207652_10001430 3300025921 Bacteria 21150
593 Ga0207652_10345918 3300025921 Bacteria 1342
594 Ga0207681_10011213 3300025923 Bacteria 5505
595 Ga0207694_10021179 3300025924 Bacteria 4924
596 Ga0207694_10974166 3300025924 Bacteria 717
597 Ga0207650_10811942 3300025925 Bacteria 793
598 Ga0207644_10298919 3300025931 Bacteria 1297
599 Ga0207690_10004125 3300025932 Bacteria 8581
600 Ga0207690_10008721 3300025932 Bacteria 6016
601 Ga0207690_10298468 3300025932 Bacteria 1260
602 Ga0207706_10011328 3300025933 Bacteria 8125
603 Ga0207706_10174918 3300025933 Bacteria 1886
604 Ga0207686_10001018 3300025934 Bacteria 16599
605 Ga0207686_10240383 3300025934 Bacteria 1318
606 Ga0207686_10534495 3300025934 Bacteria 914
607 Ga0207709_10001503 3300025935 Bacteria 16107
608 Ga0207669_10027614 3300025937 Bacteria 3111
609 Ga0207691_10545460 3300025940 Bacteria 983
610 Ga0207711_10633536 3300025941 Bacteria 997
611 Ga0207661_10015030 3300025944 Bacteria 5685
612 Ga0207661_11268292 3300025944 Bacteria 677
613 Ga0207679_10077418 3300025945 Bacteria 2530
614 Ga0207679_10080577 3300025945 Bacteria 2486
615 Ga0207667_10000075 3300025949 Bacteria 169836
616 Ga0207667_10005022 3300025949 Bacteria 16175
617 Ga0207667_10007273 3300025949 Bacteria 13352
618 Ga0207667_10161254 3300025949 Bacteria 2306
619 Ga0207667_10385112 3300025949 Bacteria 1428
620 Ga0207651_10180586 3300025960 Bacteria 1674
621 Ga0207712_10961464 3300025961 Bacteria 757
622 Ga0207712_11548013 3300025961 Bacteria 594
623 Ga0207668_10007961 3300025972 Bacteria 6305
624 Ga0207668_10470819 3300025972 Bacteria 1076
625 Ga0207640_10010766 3300025981 Bacteria 5161
626 Ga0207640_10016893 3300025981 Bacteria 4256
627 Ga0207640_10022260 3300025981 Bacteria 3790
628 Ga0207640_10390751 3300025981 Bacteria 1130
629 Ga0207658_10205254 3300025986 Bacteria 1648
630 Ga0207658_10329316 3300025986 Bacteria 1324
631 Ga0207658_10566998 3300025986 Bacteria 1017
632 Ga0207658_11591886 3300025986 Bacteria 597
633 Ga0207639_10001297 3300026041 Bacteria 16886
634 Ga0207639_10007637 3300026041 Bacteria 7377
635 Ga0207639_10047674 3300026041 Bacteria 3239
636 Ga0207639_10155920 3300026041 Bacteria 1918
637 Ga0207678_10001891 3300026067 Bacteria 19106
638 Ga0207678_10005658 3300026067 Bacteria 11170
639 Ga0207678_10052250 3300026067 Bacteria 3526
640 Ga0207702_10031604 3300026078 Bacteria 4412
641 Ga0207641_10161201 3300026088 Bacteria 2039
642 Ga0207674_10000712 3300026116 Bacteria 43462
643 Ga0207674_10003998 3300026116 Bacteria 17911
644 Ga0207674_10059041 3300026116 Bacteria 3884
645 Ga0207674_10353568 3300026116 Bacteria 1420
646 Ga0207675_100198346 3300026118 Bacteria 1927
647 Ga0207683_10014368 3300026121 Bacteria 6744
648 Ga0207683_10049183 3300026121 Bacteria 3690
649 Ga0207683_10484361 3300026121 Bacteria 1142
650 Ga0207683_11617527 3300026121 Bacteria 597
651 Ga0207698_10000358 3300026142 Bacteria 26861
652 Ga0207698_10313763 3300026142 Bacteria 1465
653 Ga0209281_1000001 3300027111 Bacteria 1933496
654 Ga0209281_1000003 3300027111 Bacteria 1260089
655 Ga0209281_1000114 3300027111 Bacteria 210536
656 Ga0209281_1000180 3300027111 Bacteria 147099
657 Ga0209281_1000229 3300027111 Bacteria 118957
658 Ga0209281_1000267 3300027111 Bacteria 100564
659 Ga0209281_1000288 3300027111 Bacteria 93347
660 Ga0209281_1000383 3300027111 Bacteria 70062
661 Ga0209281_1000722 3300027111 Bacteria 32788
662 Ga0209281_1001917 3300027111 Bacteria 9885
663 Ga0209281_1002477 3300027111 Bacteria 7347
664 Ga0209973_1037991 3300027252 Bacteria 698
665 Ga0209371_1000001 3300027312 Bacteria 2771503
666 Ga0209371_1000010 3300027312 Bacteria 922021
667 Ga0209371_1000020 3300027312 Bacteria 556282
668 Ga0209371_1000081 3300027312 Bacteria 185440
669 Ga0209371_1000085 3300027312 Bacteria 179586
670 Ga0209371_1000086 3300027312 Bacteria 175099
671 Ga0209371_1000167 3300027312 Bacteria 98922
672 Ga0209371_1000321 3300027312 Bacteria 52619
673 Ga0209371_1000349 3300027312 Bacteria 50349
674 Ga0209371_1000616 3300027312 Bacteria 31750
675 Ga0209371_1000809 3300027312 Bacteria 25834
676 Ga0209371_1001073 3300027312 Bacteria 20478
677 Ga0209371_1002095 3300027312 Bacteria 11843
678 Ga0209371_1002126 3300027312 Bacteria 11691
679 Ga0209371_1002299 3300027312 Bacteria 10904
680 Ga0209371_1002407 3300027312 Bacteria 10512
681 Ga0209371_1002837 3300027312 Bacteria 9192
682 Ga0209371_1003155 3300027312 Bacteria 8368
683 Ga0209371_1003489 3300027312 Bacteria 7600
684 Ga0209371_1003616 3300027312 Bacteria 7380
685 Ga0209371_1021256 3300027312 Bacteria 1578
686 Ga0209371_1046577 3300027312 Bacteria 851
687 Ga0209371_1047234 3300027312 Bacteria 843
688 Ga0209371_1062786 3300027312 Bacteria 678
689 Ga0209999_1043668 3300027543 Bacteria 842
690 Ga0210002_1020944 3300027617 Bacteria 1055
691 Ga0209282_1000043 3300027666 Bacteria 119260
692 Ga0209971_1001163 3300027682 Bacteria 6629
693 Ga0209971_1169283 3300027682 Bacteria 539
694 Ga0209974_10010341 3300027876 Bacteria 3148
695 Ga0268266_10000282 3300028379 Bacteria 83781
696 Ga0268266_10025201 3300028379 Bacteria 5062
697 Ga0268266_10180251 3300028379 Bacteria 1923
698 Ga0268266_11456353 3300028379 Bacteria 660
699 Ga0268265_10139443 3300028380 Bacteria 2028
700 Ga0268264_10304937 3300028381 Bacteria 1500
701 Ga0265323_10010795 3300028653 Bacteria 3698
702 Ga0307515_10000626 3300028794 Bacteria 82165
703 Ga0307515_10001303 3300028794 Bacteria 56637
704 Ga0307515_10032622 3300028794 Bacteria 8617
705 Ga0265324_10056153 3300029957 Bacteria 1349
706 Ga0268256_1000001 3300030500 Bacteria 2771065
707 Ga0268256_1000003 3300030500 Bacteria 1289401
708 Ga0268256_1000048 3300030500 Bacteria 312298
709 Ga0268256_1000092 3300030500 Bacteria 144061
710 Ga0268256_1000114 3300030500 Bacteria 117092
711 Ga0268256_1000124 3300030500 Bacteria 111181
712 Ga0268256_1000175 3300030500 Bacteria 76497
713 Ga0268256_1000532 3300030500 Bacteria 31413
714 Ga0268256_1000920 3300030500 Bacteria 20333
715 Ga0268256_1001027 3300030500 Bacteria 18776
716 Ga0268256_1001435 3300030500 Bacteria 14374
717 Ga0268256_1001749 3300030500 Bacteria 12267
718 Ga0268256_1002069 3300030500 Bacteria 10802
719 Ga0268256_1002830 3300030500 Bacteria 8368
720 Ga0268256_1003160 3300030500 Bacteria 7667
721 Ga0268256_1004676 3300030500 Bacteria 5591
722 Ga0268256_1007695 3300030500 Bacteria 3800
723 Ga0268256_1017912 3300030500 Bacteria 1983
724 Ga0268256_1018423 3300030500 Bacteria 1937
725 Ga0268256_1023884 3300030500 Bacteria 1578
726 Ga0268256_1052542 3300030500 Bacteria 851
727 Ga0316177_1037186 3300030731 Bacteria 9370
728 Ga0316176_1061113 3300030732 Bacteria 4189
729 Ga0314311_1031728 3300030733 Bacteria 7577
730 Ga0316179_1098736 3300030734 Bacteria 3497
731 Ga0316178_1015612 3300030735 Bacteria 4295
732 Ga0316180_1126976 3300030736 Bacteria 746
733 Ga0316183_1122932 3300030742 Bacteria 7560
734 Ga0316181_1114225 3300030744 Bacteria 2386
735 Ga0316182_1103194 3300030745 Bacteria 5077
736 Ga0265330_10004252 3300031235 Bacteria 7298
737 Ga0265332_10019389 3300031238 Bacteria 3002
738 Ga0265328_10327217 3300031239 Bacteria 594
739 Ga0265331_10003913 3300031250 Bacteria 9413
740 Ga0265331_10105558 3300031250 Bacteria 1294
741 Ga0265327_10000133 3300031251 Bacteria 163887
742 Ga0265327_10002852 3300031251 Bacteria 17418
743 Ga0265327_10015025 3300031251 Bacteria 5031
744 Ga0265327_10024914 3300031251 Bacteria 3500
745 Ga0265327_10025409 3300031251 Bacteria 3453
746 Ga0265327_10393824 3300031251 Bacteria 602
747 Ga0265316_10147424 3300031344 Bacteria 1764
748 Ga0307408_100009699 3300031548 Bacteria 6346
749 Ga0307408_100014538 3300031548 Bacteria 5230
750 Ga0307408_100033660 3300031548 Bacteria 3582
751 Ga0307408_100161444 3300031548 Bacteria 1780
752 Ga0307408_100323091 3300031548 Bacteria 1300
753 Ga0307514_10000711 3300031649 Bacteria 57628
754 Ga0307514_10173650 3300031649 Bacteria 1402
755 Ga0316575_10024298 3300031665 Bacteria 2346
756 Ga0316579_10046342 3300031691 Bacteria 2028
757 Ga0265314_10008686 3300031711 Bacteria 8689
758 Ga0316576_10557731 3300031727 Bacteria 839
759 Ga0316578_10079152 3300031728 Bacteria 1954
760 Ga0316578_10118438 3300031728 Bacteria 1591
761 Ga0307405_10058452 3300031731 Bacteria 2426
762 Ga0307405_10144393 3300031731 Bacteria 1664
763 Ga0307405_10180638 3300031731 Bacteria 1514
764 Ga0307405_10310911 3300031731 Bacteria 1199
765 Ga0307405_10321329 3300031731 Bacteria 1182
766 Ga0307405_10362857 3300031731 Bacteria 1121
767 Ga0307405_10427102 3300031731 Bacteria 1044
768 Ga0307405_10874541 3300031731 Bacteria 758
769 Ga0307405_10897101 3300031731 Bacteria 749
770 Ga0316577_10041516 3300031733 Bacteria 2574
771 Ga0316577_10057099 3300031733 Bacteria 2179
772 Ga0316577_10062977 3300031733 Bacteria 2071
773 Ga0307413_10082572 3300031824 Bacteria 2065
774 Ga0307413_10347186 3300031824 Bacteria 1144
775 Ga0307406_10003334 3300031901 Bacteria 8755
776 Ga0307406_10007375 3300031901 Bacteria 6097
777 Ga0307406_10029379 3300031901 Bacteria 3329
778 Ga0307406_10109880 3300031901 Bacteria 1896
779 Ga0307406_10319528 3300031901 Bacteria 1200
780 Ga0307406_11635513 3300031901 Bacteria 569
781 Ga0307412_10019109 3300031911 Bacteria 4140
782 Ga0307412_10128246 3300031911 Bacteria 1838
783 Ga0307412_10242227 3300031911 Bacteria 1395
784 Ga0307412_10423382 3300031911 Bacteria 1090
785 Ga0307412_12210232 3300031911 Bacteria 512
786 Ga0307409_100887652 3300031995 Bacteria 904
787 Ga0307416_100408334 3300032002 Bacteria 1398
788 Ga0307416_100431182 3300032002 Bacteria 1365
789 Ga0307416_101951500 3300032002 Bacteria 690
790 Ga0307416_102284103 3300032002 Bacteria 641
791 Ga0307416_102326572 3300032002 Bacteria 636
792 Ga0307414_10177984 3300032004 Bacteria 1707
793 Ga0307414_10339772 3300032004 Bacteria 1285
794 Ga0307414_10553731 3300032004 Bacteria 1025
795 Ga0307414_11822512 3300032004 Bacteria 568
796 Ga0307411_10019468 3300032005 Bacteria 3922
797 Ga0307411_10201421 3300032005 Bacteria 1529
798 Ga0307411_10261224 3300032005 Bacteria 1367
799 Ga0316580_10045072 3300032139 Bacteria 1360
800 Ga0316580_10237488 3300032139 Bacteria 563
801 Ga0307510_10232500 3300033180 Bacteria 1345
802 Ga0316587_1000878 3300033529 Bacteria 3407
803 Ga0316574_0019624 3300035398 Bacteria 3990
804 Ga0316574_0212159 3300035398 Bacteria 1242
805 Ga0316582_0012653 3300036647 Bacteria 4718
806 Ga0316582_0139520 3300036647 Bacteria 1633
807 Ga0316582_0207199 3300036647 Bacteria 1339
808 Ga0316582_0254001 3300036647 Bacteria 1205
809 Ga0316584_0003227 3300036712 Bacteria 10555
810 Ga0316584_0007399 3300036712 Bacteria 7505
811 Ga0316584_0058252 3300036712 Bacteria 2892
812 Ga0316584_0137779 3300036712 Bacteria 1821
813 Ga0395900_0067131 3300037418 Bacteria 3684
814 Ga0395900_0359565 3300037418 Bacteria 1427
815 Ga0395898_0167266 3300037466 Bacteria 2102
816 Ga0395898_0368686 3300037466 Bacteria 1369
817 Ga0395905_0229337 3300037471 Bacteria 1737
818 Ga0316581_0035288 3300037588 Bacteria 1515
819 Ga0395901_0642429 3300038443 Bacteria 1065
820 Ga0395901_1003615 3300038443 Bacteria 810
821 Ga0395901_1886488 3300038443 Bacteria 545
822 Ga0436365_1037676 3300039437 Bacteria 170132
823 Ga0436361_0079908 3300039447 Bacteria 734
824 Ga0436361_1010587 3300039447 Bacteria 1135
825 Ga0436363_0982124 3300039450 Bacteria 763
826 Ga0439436_0000336 3300041404 Bacteria 11576
827 Ga0439436_0002994 3300041404 Bacteria 5123
828 Ga0439438_000001 3300041405 Bacteria 1263568
829 Ga0439438_001188 3300041405 Bacteria 11568
830 Ga0439438_001930 3300041405 Bacteria 9046
831 Ga0439438_008658 3300041405 Bacteria 3351
832 Ga0439438_034767 3300041405 Bacteria 1326
833 Ga0439439_0003042 3300041406 Bacteria 3653
834 Ga0439439_0014282 3300041406 Bacteria 1933
835 Ga0439447_004155 3300041407 Bacteria 5030
836 Ga0439447_005376 3300041407 Bacteria 4267
837 Ga0439447_028060 3300041407 Bacteria 1432
838 Ga0439461_0065771 3300041410 Bacteria 831
839 Ga0439466_0000003 3300041411 Bacteria 486229
840 Ga0439466_0058052 3300041411 Bacteria 1252
841 Ga0439466_0218156 3300041411 Bacteria 579
842 Ga0439465_0000517 3300041413 Bacteria 11531
843 Ga0451791_0103488 3300041451 Bacteria 558
844 Ga0451791_0972312 3300041451 Bacteria 1330
845 Ga0451793_1583412 3300041452 Bacteria 765
846 Ga0451795_0579443 3300041456 Bacteria 879
847 Ga0451802_0881816 3300041460 Bacteria 593
848 Ga0451805_033409 3300041461 Bacteria 697
849 Ga0451847_0790351 3300041503 Bacteria 938
850 Ga0451853_2599509 3300041512 Bacteria 1805
851 Ga0451853_3098869 3300041512 Bacteria 957
852 Ga0439431_0002606 3300041997 Bacteria 3980
853 Ga0439431_0276272 3300041997 Bacteria 502
854 Ga0439433_0024432 3300041999 Bacteria 1361
855 Ga0439433_0038479 3300041999 Bacteria 1109
856 Ga0439442_002961 3300042002 Bacteria 3345
857 Ga0439445_0000347 3300042004 Bacteria 9147
858 Ga0439445_0003104 3300042004 Bacteria 3723
859 Ga0439445_0200499 3300042004 Bacteria 589
860 Ga0439448_0244134 3300042005 Bacteria 633
861 Ga0439432_000662 3300042006 Bacteria 12859
862 Ga0439432_008144 3300042006 Bacteria 3689
863 Ga0439432_010037 3300042006 Bacteria 3292
864 Ga0439432_010592 3300042006 Bacteria 3187
865 Ga0439432_014689 3300042006 Bacteria 2649
866 Ga0439432_125770 3300042006 Bacteria 758
867 Ga0439432_201852 3300042006 Bacteria 576
868 Ga0439449_0000838 3300042007 Bacteria 11916
869 Ga0439449_0009132 3300042007 Bacteria 3758
870 Ga0439449_0184117 3300042007 Bacteria 781
871 Ga0439451_047755 3300042009 Bacteria 857
872 Ga0439452_000001 3300042010 Bacteria 1725439
873 Ga0439452_000003 3300042010 Bacteria 942815
874 Ga0439452_000006 3300042010 Bacteria 645083
875 Ga0439452_000008 3300042010 Bacteria 569877
876 Ga0439452_000161 3300042010 Bacteria 49828
877 Ga0439452_000216 3300042010 Bacteria 40719
878 Ga0439452_000949 3300042010 Bacteria 13024
879 Ga0439452_002479 3300042010 Bacteria 6788
880 Ga0439457_011278 3300042014 Bacteria 2036
881 Ga0439462_0000328 3300042015 Bacteria 8874
882 Ga0439462_0002574 3300042015 Bacteria 4232
883 Ga0439463_006410 3300042016 Bacteria 2920
884 Ga0450911_000124 3300042115 Bacteria 30673
885 Ga0450922_001261 3300042124 Bacteria 2509
886 Ga0450922_004419 3300042124 Bacteria 1291
887 Ga0450923_000221 3300042125 Bacteria 5506
888 Ga0450923_013904 3300042125 Bacteria 1485
889 Ga0450890_007058 3300042127 Bacteria 1432
890 Ga0450894_010619 3300042131 Bacteria 1195
891 Ga0450898_012816 3300042134 Bacteria 1390
892 Ga0450900_017373 3300042136 Bacteria 981
893 Ga0450902_019005 3300042137 Bacteria 1129
894 Ga0450907_000329 3300042146 Bacteria 15006
895 Ga0439446_0014658 3300042156 Bacteria 2166
896 Ga0439446_0176825 3300042156 Bacteria 712
897 Ga0450909_012251 3300042185 Bacteria 1257
898 Ga0450909_015394 3300042185 Bacteria 1129
899 Ga0439434_0002221 3300042435 Bacteria 5634
900 Ga0439434_0086096 3300042435 Bacteria 1001
901 Ga0439464_0000625 3300042439 Bacteria 7504
902 Ga0439464_0003541 3300042439 Bacteria 3949
903 Ga0439464_0019306 3300042439 Bacteria 1860
904 Ga0439464_0044551 3300042439 Bacteria 1271
905 Ga0450893_0003283 3300042532 Bacteria 2545
906 Ga0450893_0004785 3300042532 Bacteria 2161
907 Ga0450893_0039760 3300042532 Bacteria 859
908 Ga0451577_0014209 3300042876 Bacteria 7423
909 Ga0451577_0025812 3300042876 Bacteria 5327
910 Ga0451577_0118887 3300042876 Bacteria 2367
911 Ga0451577_1176457 3300042876 Unclassified 684
912 Ga0466977_0000007 3300044666 Bacteria 32886
913 Ga0466981_0000016 3300044669 Bacteria 100013
914 Ga0453683_0504451 3300044673 Bacteria 785
915 Ga0466961_0023977 3300044693 Bacteria 3925
916 Ga0453684_0000917 3300044712 Bacteria 97990
917 Ga0453684_0014200 3300044712 Bacteria 12785
918 Ga0453684_0693932 3300044712 Bacteria 1107
919 Ga0453684_1211732 3300044712 Bacteria 792
920 Ga0466970_0209074 3300044765 Bacteria 1087
921 Ga0466960_0037103 3300044901 Bacteria 2285
922 Ga0451576_0252121 3300045051 Bacteria 1845
923 Ga0495617_012114 3300046452 Bacteria 2940
924 Ga0495617_031455 3300046452 Bacteria 1782
925 Ga0495627_000027 3300046453 Bacteria 236960
926 Ga0495627_073184 3300046453 Bacteria 999
927 Ga0495627_162336 3300046453 Bacteria 621
928 Ga0495592_0016839 3300046454 Bacteria 5551
929 Ga0495592_0206827 3300046454 Bacteria 1321
930 Ga0495591_000014 3300046458 Bacteria 254281
931 Ga0495591_000238 3300046458 Bacteria 52890
932 Ga0495591_002770 3300046458 Bacteria 9466
933 Ga0495591_005174 3300046458 Bacteria 6112
934 Ga0495591_084621 3300046458 Bacteria 804
935 Ga0495638_0002381 3300046460 Bacteria 15407
936 Ga0495638_0013990 3300046460 Bacteria 5441
937 Ga0495651_0005777 3300046462 Bacteria 9440
938 Ga0495651_0414476 3300046462 Bacteria 877
939 Ga0495653_0198914 3300046463 Bacteria 1361
940 Ga0495650_0000002 3300046471 Bacteria 1057165
941 Ga0495650_0000021 3300046471 Bacteria 531242
942 Ga0495650_0000032 3300046471 Bacteria 425389
943 Ga0495650_0000396 3300046471 Bacteria 73012
944 Ga0495650_0000478 3300046471 Bacteria 61296
945 Ga0495605_0004250 3300046474 Bacteria 8440
946 Ga0495605_0004747 3300046474 Bacteria 7945
947 Ga0495605_0033547 3300046474 Bacteria 2604
948 Ga0495605_0073615 3300046474 Bacteria 1609
949 Ga0495605_0127430 3300046474 Bacteria 1150
950 Ga0495639_0006891 3300046475 Bacteria 4880
951 Ga0495584_0006445 3300046491 Bacteria 6141
952 Ga0495584_0034114 3300046491 Bacteria 2575
953 Ga0495585_0004620 3300046492 Bacteria 8890
954 Ga0495594_0007426 3300046499 Bacteria 5639
955 Ga0495596_0000001 3300046500 Bacteria 501331
956 Ga0495596_0000366 3300046500 Bacteria 29053
957 Ga0495596_0045021 3300046500 Bacteria 1735
958 Ga0495607_0000175 3300046501 Bacteria 68131
959 Ga0495607_0007488 3300046501 Bacteria 7547
960 Ga0495607_0009243 3300046501 Bacteria 6695
961 Ga0495607_0178868 3300046501 Bacteria 1065
962 Ga0495606_0001314 3300046507 Bacteria 34190
963 Ga0495606_0231995 3300046507 Bacteria 1034
964 Ga0495608_0006970 3300046511 Bacteria 7999
965 Ga0495610_0000002 3300046512 Bacteria 1282131
966 Ga0495610_0001226 3300046512 Bacteria 23065
967 Ga0495610_0029233 3300046512 Bacteria 2905
968 Ga0495616_0001943 3300046513 Bacteria 13903
969 Ga0495616_0002001 3300046513 Bacteria 13713
970 Ga0495616_0086880 3300046513 Bacteria 1487
971 Ga0495618_0012760 3300046514 Bacteria 5107
972 Ga0495618_0028883 3300046514 Bacteria 3458
973 Ga0495618_0106009 3300046514 Bacteria 1799
974 Ga0495620_0003066 3300046515 Bacteria 9591
975 Ga0495620_0141600 3300046515 Bacteria 940
976 Ga0495620_0145922 3300046515 Bacteria 924
977 Ga0495620_0147396 3300046515 Bacteria 918
978 Ga0495628_0000059 3300046516 Bacteria 87291
979 Ga0495628_0006630 3300046516 Bacteria 10098
980 Ga0495628_0295816 3300046516 Bacteria 1199
981 Ga0495628_0548866 3300046516 Bacteria 830
982 Ga0495630_0123685 3300046517 Bacteria 1963
983 Ga0495631_0000414 3300046518 Bacteria 29474
984 Ga0495632_0007880 3300046519 Bacteria 6619
985 Ga0495632_0011349 3300046519 Bacteria 5201
986 Ga0495632_0131606 3300046519 Bacteria 1164
987 Ga0495632_0354786 3300046519 Bacteria 644
988 Ga0495637_0000005 3300046520 Bacteria 447799
989 Ga0495637_0031616 3300046520 Bacteria 2339
990 Ga0495643_0000002 3300046522 Bacteria 1131278
991 Ga0495643_0019114 3300046522 Bacteria 3967
992 Ga0495643_0022631 3300046522 Bacteria 3584
993 Ga0495643_0025319 3300046522 Bacteria 3358
994 Ga0495643_0028334 3300046522 Bacteria 3141
995 Ga0495643_0081546 3300046522 Bacteria 1682
996 Ga0495644_0002242 3300046523 Bacteria 7732
997 Ga0495648_0000299 3300046524 Bacteria 55022
998 Ga0495648_0006462 3300046524 Bacteria 9563
999 Ga0495648_0021944 3300046524 Bacteria 4410
1000 Ga0495663_0142351 3300046525 Bacteria 814
1001 Ga0495666_0001981 3300046526 Bacteria 10110
1002 Ga0495666_0035617 3300046526 Bacteria 2426
1003 Ga0495666_0499409 3300046526 Bacteria 544
1004 Ga0495652_0004625 3300046529 Bacteria 13120
1005 Ga0495652_0035985 3300046529 Bacteria 4306
1006 Ga0495654_0000019 3300046530 Bacteria 289483
1007 Ga0495654_0001152 3300046530 Bacteria 18924
1008 Ga0495654_0002661 3300046530 Bacteria 11346
1009 Ga0495654_0008751 3300046530 Bacteria 5572
1010 Ga0495654_0011360 3300046530 Bacteria 4821
1011 Ga0495654_0053428 3300046530 Bacteria 1963
1012 Ga0495654_0054888 3300046530 Bacteria 1930
1013 Ga0495654_0082084 3300046530 Bacteria 1509
1014 Ga0495654_0183630 3300046530 Bacteria 904
1015 Ga0495586_0097772 3300046535 Bacteria 1627
1016 Ga0495587_0823400 3300046536 Bacteria 506
1017 Ga0495609_0010849 3300046538 Bacteria 4352
1018 Ga0495621_0004439 3300046539 Bacteria 3945
1019 Ga0495597_0000015 3300046542 Bacteria 172952
1020 Ga0495597_0000720 3300046542 Bacteria 26410
1021 Ga0495597_0001359 3300046542 Bacteria 17738
1022 Ga0495597_0020433 3300046542 Bacteria 3085
1023 Ga0495645_0054792 3300046543 Bacteria 2896
1024 Ga0495645_0181366 3300046543 Bacteria 1442
1025 Ga0495622_0013458 3300046557 Bacteria 3795
1026 Ga0495656_0005434 3300046615 Bacteria 4401
1027 Ga0495656_0007291 3300046615 Bacteria 3903
1028 Ga0495668_0053240 3300046616 Bacteria 2238
1029 Ga0495634_0069678 3300046642 Bacteria 2320
1030 Ga0495611_0035919 3300046648 Bacteria 2197
1031 Ga0495611_0401145 3300046648 Bacteria 627
1032 Ga0495625_0004458 3300046660 Bacteria 13233
1033 Ga0495625_0005285 3300046660 Bacteria 11849
1034 Ga0495625_0014435 3300046660 Bacteria 6304
1035 Ga0495635_0083588 3300046663 Bacteria 2185
1036 Ga0495635_0172144 3300046663 Bacteria 1472
1037 Ga0495661_0009993 3300046665 Bacteria 6487
1038 Ga0495588_0000437 3300046674 Bacteria 21337
1039 Ga0495657_0043991 3300046675 Bacteria 3041
1040 Ga0495599_0003585 3300046678 Bacteria 9102
1041 Ga0495623_0003538 3300046679 Bacteria 10338
1042 Ga0495646_0002246 3300046680 Bacteria 11800
1043 Ga0495646_0014471 3300046680 Bacteria 5017
1044 Ga0495646_0441126 3300046680 Bacteria 673
1045 Ga0495647_0067036 3300046681 Bacteria 1429
1046 Ga0495658_0042769 3300046683 Bacteria 2531
1047 Ga0495669_0147709 3300046684 Bacteria 1112
1048 Ga0495613_0714846 3300046689 Bacteria 659
1049 Ga0495624_0008986 3300046690 Bacteria 6944
1050 Ga0495624_0020855 3300046690 Bacteria 4354
1051 Ga0495624_0255279 3300046690 Bacteria 1060
1052 Ga0495670_0016534 3300046691 Bacteria 3627
1053 Ga0495670_0016868 3300046691 Bacteria 3590
1054 Ga0495671_0001044 3300046692 Bacteria 19266
1055 Ga0495671_0001269 3300046692 Bacteria 17216
1056 Ga0495671_0008856 3300046692 Bacteria 5651
1057 Ga0495671_0258152 3300046692 Bacteria 841
1058 Ga0495649_0013339 3300046694 Bacteria 4742
1059 Ga0495649_0014855 3300046694 Bacteria 4449
1060 Ga0495649_0042287 3300046694 Bacteria 2490
1061 Ga0495649_0107137 3300046694 Bacteria 1483
1062 Ga0495589_0000001 3300046794 Bacteria 888100
1063 Ga0495589_0039635 3300046794 Bacteria 2354
1064 Ga0495589_0052967 3300046794 Bacteria 2003
1065 Ga0495600_0003774 3300046809 Bacteria 8965
1066 Ga0495600_0511904 3300046809 Bacteria 736
1067 Ga0495600_0682364 3300046809 Bacteria 619
1068 Ga0495660_0000004 3300046810 Bacteria 1003183
1069 Ga0495660_0000021 3300046810 Bacteria 293250
1070 Ga0495660_0006528 3300046810 Bacteria 6890
1071 Ga0495660_0037106 3300046810 Bacteria 2716
1072 Ga0495604_0001830 3300047317 Bacteria 17320
1073 Ga0495604_0014340 3300047317 Bacteria 6321
1074 Ga0495604_0391285 3300047317 Bacteria 917
1075 Ga0495636_0010570 3300047318 Bacteria 3647
1076 Ga0495672_0000002 3300047320 Bacteria 740116
1077 Ga0495672_0000012 3300047320 Bacteria 519975
1078 Ga0495672_0000020 3300047320 Bacteria 432845
1079 Ga0495672_0024648 3300047320 Bacteria 3871
1080 Ga0495672_0215417 3300047320 Bacteria 951
1081 Ga0495676_0008592 3300047321 Bacteria 9354
1082 Ga0495683_0020678 3300047323 Bacteria 3393
1083 Ga0495677_0413493 3300047445 Bacteria 534
1084 Ga0495679_000020 3300047446 Bacteria 228413
1085 Ga0495679_002132 3300047446 Bacteria 10405
1086 Ga0495679_002328 3300047446 Bacteria 9757
1087 Ga0495679_047995 3300047446 Bacteria 1293
1088 Ga0495685_004966 3300047447 Bacteria 4325
1089 Ga0495673_0000065 3300047469 Bacteria 222481
1090 Ga0495673_0000081 3300047469 Bacteria 199943
1091 Ga0495681_0000088 3300047470 Bacteria 79878
1092 Ga0495681_0000426 3300047470 Bacteria 32387
1093 Ga0495686_0060309 3300047472 Bacteria 2358
1094 Ga0495593_0034149 3300047673 Bacteria 2767
1095 Ga0495593_0487597 3300047673 Bacteria 618
1096 Ga0495602_0012279 3300048088 Bacteria 8815
1097 Ga0495602_0147112 3300048088 Bacteria 1857
1098 Ga0495602_0375023 3300048088 Bacteria 1020
1099 Ga0495614_0004433 3300048089 Bacteria 6329
1100 Ga0495626_0000001 3300048091 Bacteria 1077129
1101 Ga0496100_0006740 3300048903 Bacteria 6288
1102 Ga0496100_0013256 3300048903 Bacteria 4747
1103 Ga0496100_0028570 3300048903 Bacteria 3441
1104 Ga0496100_0125278 3300048903 Bacteria 1802
1105 Ga0496100_1483057 3300048903 Bacteria 536
1106 Ga0496101_0000314 3300048904 Bacteria 33586
1107 Ga0496101_0025960 3300048904 Bacteria 4069
1108 Ga0496101_0203711 3300048904 Bacteria 1530
1109 Ga0496101_0383973 3300048904 Bacteria 1105
1110 Ga0496101_0592517 3300048904 Bacteria 876
1111 Ga0496101_0927755 3300048904 Bacteria 685
1112 Ga0496101_1288540 3300048904 Bacteria 571
1113 Ga0496102_0005511 3300048905 Bacteria 10747
1114 Ga0496102_0108549 3300048905 Bacteria 2585
1115 Ga0496102_0266586 3300048905 Bacteria 1615
1116 Ga0496102_0493239 3300048905 Bacteria 1146
1117 Ga0496103_0092134 3300048906 Bacteria 1913
1118 Ga0496103_0172794 3300048906 Bacteria 1388
1119 Ga0496103_0646170 3300048906 Bacteria 672
1120 Ga0496104_0000893 3300048907 Bacteria 25662
1121 Ga0496104_0001151 3300048907 Bacteria 22641
1122 Ga0496104_0452682 3300048907 Bacteria 1195
1123 Ga0496104_1047988 3300048907 Bacteria 719
1124 Ga0496104_1632241 3300048907 Bacteria 547
1125 Ga0496105_0001685 3300048908 Bacteria 15768
1126 Ga0496105_0019956 3300048908 Bacteria 5409
1127 Ga0496105_0118704 3300048908 Bacteria 2182
1128 Ga0496105_0157490 3300048908 Bacteria 1865
1129 Ga0496106_0048665 3300048909 Bacteria 3193
1130 Ga0496106_1184926 3300048909 Bacteria 596
1131 Ga0496107_0257645 3300048910 Bacteria 1298
1132 Ga0496107_0700337 3300048910 Bacteria 745
1133 Ga0496108_0059934 3300048911 Bacteria 3201
1134 Ga0496109_0078498 3300048912 Bacteria 3040
1135 Ga0496110_0306314 3300048913 Bacteria 1447
1136 Ga0496110_1212553 3300048913 Bacteria 663
1137 Ga0496110_1303227 3300048913 Bacteria 635
1138 Ga0496113_0110179 3300048916 Bacteria 2142
1139 Ga0496113_0182493 3300048916 Bacteria 1664
1140 Ga0496113_0747444 3300048916 Bacteria 779
1141 Ga0496114_0634583 3300048917 Bacteria 940
1142 Ga0496116_0000001 3300048919 Bacteria 1501681
1143 Ga0496116_0000094 3300048919 Bacteria 205588
1144 Ga0496116_0000261 3300048919 Bacteria 92108
1145 Ga0496116_0000431 3300048919 Bacteria 58709
1146 Ga0496116_0000679 3300048919 Bacteria 44214
1147 Ga0496116_0000738 3300048919 Bacteria 41713
1148 Ga0496116_0000930 3300048919 Bacteria 36114
1149 Ga0496116_0002175 3300048919 Bacteria 20873
1150 Ga0496116_0005086 3300048919 Bacteria 12360
1151 Ga0496116_0007904 3300048919 Bacteria 9324
1152 Ga0496116_0011708 3300048919 Bacteria 7228
1153 Ga0496116_0015751 3300048919 Bacteria 5958
1154 Ga0496116_0017298 3300048919 Bacteria 5603
1155 Ga0496116_0018592 3300048919 Bacteria 5349
1156 Ga0496116_0023072 3300048919 Bacteria 4643
1157 Ga0496116_0035310 3300048919 Bacteria 3512
1158 Ga0496116_0084036 3300048919 Bacteria 1962
1159 Ga0496116_0088658 3300048919 Bacteria 1889
1160 Ga0496116_0125206 3300048919 Bacteria 1477
1161 Ga0496116_0166367 3300048919 Bacteria 1202
1162 Ga0496116_0270833 3300048919 Bacteria 830
1163 Ga0496117_0000004 3300048920 Bacteria 877131
1164 Ga0496117_0000213 3300048920 Bacteria 111751
1165 Ga0496117_0001414 3300048920 Bacteria 34795
1166 Ga0496117_0002234 3300048920 Bacteria 24995
1167 Ga0496117_0002320 3300048920 Bacteria 24384
1168 Ga0496117_0003205 3300048920 Bacteria 19351
1169 Ga0496117_0007415 3300048920 Bacteria 10724
1170 Ga0496117_0008133 3300048920 Bacteria 10024
1171 Ga0496117_0009227 3300048920 Bacteria 9224
1172 Ga0496117_0010043 3300048920 Bacteria 8696
1173 Ga0496117_0012413 3300048920 Bacteria 7511
1174 Ga0496117_0015407 3300048920 Bacteria 6520
1175 Ga0496117_0035442 3300048920 Bacteria 3745
1176 Ga0496117_0035885 3300048920 Bacteria 3716
1177 Ga0496117_0039172 3300048920 Bacteria 3501
1178 Ga0496117_0044550 3300048920 Bacteria 3213
1179 Ga0496117_0046718 3300048920 Bacteria 3112
1180 Ga0496117_0063088 3300048920 Bacteria 2534
1181 Ga0496117_0086922 3300048920 Bacteria 2029
1182 Ga0496117_0124537 3300048920 Bacteria 1576
1183 Ga0496117_0147540 3300048920 Bacteria 1397
1184 Ga0496118_0000072 3300048921 Bacteria 201387
1185 Ga0496118_0000137 3300048921 Bacteria 129477
1186 Ga0496118_0001157 3300048921 Bacteria 40657
1187 Ga0496118_0002508 3300048921 Bacteria 24634
1188 Ga0496118_0003626 3300048921 Bacteria 19165
1189 Ga0496118_0003664 3300048921 Bacteria 19077
1190 Ga0496118_0008346 3300048921 Bacteria 10724
1191 Ga0496118_0008657 3300048921 Bacteria 10466
1192 Ga0496118_0022858 3300048921 Bacteria 5452
1193 Ga0496118_0023065 3300048921 Bacteria 5418
1194 Ga0496118_0031286 3300048921 Bacteria 4414
1195 Ga0496118_0031499 3300048921 Bacteria 4394
1196 Ga0496118_0045544 3300048921 Bacteria 3422
1197 Ga0496118_0117588 3300048921 Bacteria 1743
1198 Ga0496118_0236351 3300048921 Bacteria 1050
1199 Ga0496118_0330465 3300048921 Bacteria 822
1200 Ga0496119_0000008 3300048922 Bacteria 446822
1201 Ga0496119_0000080 3300048922 Bacteria 139962
1202 Ga0496119_0000156 3300048922 Bacteria 94640
1203 Ga0496119_0000677 3300048922 Bacteria 45578
1204 Ga0496119_0002331 3300048922 Bacteria 20914
1205 Ga0496119_0002686 3300048922 Bacteria 19209
1206 Ga0496119_0004122 3300048922 Bacteria 14639
1207 Ga0496119_0004498 3300048922 Bacteria 13851
1208 Ga0496119_0005466 3300048922 Bacteria 12159
1209 Ga0496119_0007741 3300048922 Bacteria 9594
1210 Ga0496119_0019148 3300048922 Bacteria 5057
1211 Ga0496119_0019675 3300048922 Bacteria 4958
1212 Ga0496119_0034475 3300048922 Bacteria 3332
1213 Ga0496119_0242819 3300048922 Bacteria 911
1214 Ga0496119_0246500 3300048922 Bacteria 903
1215 Ga0496120_0000035 3300048923 Bacteria 213992
1216 Ga0496120_0000040 3300048923 Bacteria 201554
1217 Ga0496120_0000075 3300048923 Bacteria 163540
1218 Ga0496120_0000128 3300048923 Bacteria 127855
1219 Ga0496120_0000302 3300048923 Bacteria 82387
1220 Ga0496120_0000477 3300048923 Bacteria 62911
1221 Ga0496120_0002786 3300048923 Bacteria 16967
1222 Ga0496120_0003693 3300048923 Bacteria 13654
1223 Ga0496120_0003747 3300048923 Bacteria 13471
1224 Ga0496120_0003837 3300048923 Bacteria 13206
1225 Ga0496120_0005107 3300048923 Bacteria 10610
1226 Ga0496120_0006986 3300048923 Bacteria 8500
1227 Ga0496120_0035747 3300048923 Bacteria 2963
1228 Ga0496120_0043456 3300048923 Bacteria 2617
1229 Ga0496120_0073631 3300048923 Bacteria 1868
1230 Ga0496121_0000047 3300048924 Bacteria 335768
1231 Ga0496121_0000124 3300048924 Bacteria 170427
1232 Ga0496121_0001134 3300048924 Bacteria 46801
1233 Ga0496121_0002661 3300048924 Bacteria 26786
1234 Ga0496121_0002930 3300048924 Bacteria 24980
1235 Ga0496121_0003880 3300048924 Bacteria 20785
1236 Ga0496121_0007669 3300048924 Bacteria 12962
1237 Ga0496121_0010355 3300048924 Bacteria 10532
1238 Ga0496121_0015160 3300048924 Bacteria 8106
1239 Ga0496121_0015971 3300048924 Bacteria 7790
1240 Ga0496121_0035885 3300048924 Bacteria 4430
1241 Ga0496121_0038890 3300048924 Bacteria 4202
1242 Ga0496121_0041514 3300048924 Bacteria 4019
1243 Ga0496121_0052914 3300048924 Bacteria 3404
1244 Ga0496121_0056690 3300048924 Bacteria 3252
1245 Ga0496122_0000007 3300048925 Bacteria 606493
1246 Ga0496122_0000033 3300048925 Bacteria 324104
1247 Ga0496122_0000130 3300048925 Bacteria 173330
1248 Ga0496122_0000356 3300048925 Bacteria 98548
1249 Ga0496122_0001024 3300048925 Bacteria 49397
1250 Ga0496122_0001367 3300048925 Bacteria 39674
1251 Ga0496122_0001535 3300048925 Bacteria 36726
1252 Ga0496122_0004005 3300048925 Bacteria 18773
1253 Ga0496122_0004980 3300048925 Bacteria 16068
1254 Ga0496122_0006622 3300048925 Bacteria 13213
1255 Ga0496122_0007333 3300048925 Bacteria 12306
1256 Ga0496122_0012310 3300048925 Bacteria 8538
1257 Ga0496122_0018241 3300048925 Bacteria 6498
1258 Ga0496122_0035075 3300048925 Bacteria 4092
1259 Ga0496122_0052511 3300048925 Bacteria 3084
1260 Ga0496122_0053063 3300048925 Bacteria 3060
1261 Ga0496122_0063042 3300048925 Bacteria 2709
1262 Ga0496122_0067614 3300048925 Bacteria 2572
1263 Ga0496122_0067953 3300048925 Bacteria 2562
1264 Ga0496122_0085176 3300048925 Bacteria 2182
1265 Ga0496122_0089083 3300048925 Bacteria 2111
1266 Ga0496122_0126517 3300048925 Bacteria 1634
1267 Ga0496122_0137705 3300048925 Bacteria 1534
1268 Ga0496122_0142086 3300048925 Bacteria 1499
1269 Ga0496122_0248225 3300048925 Bacteria 997
1270 Ga0496123_0000004 3300048926 Bacteria 777230
1271 Ga0496123_0000064 3300048926 Bacteria 212668
1272 Ga0496123_0000248 3300048926 Bacteria 109122
1273 Ga0496123_0000263 3300048926 Bacteria 105886
1274 Ga0496123_0000309 3300048926 Bacteria 94366
1275 Ga0496123_0000827 3300048926 Bacteria 49725
1276 Ga0496123_0001080 3300048926 Bacteria 41095
1277 Ga0496123_0002455 3300048926 Bacteria 22975
1278 Ga0496123_0003432 3300048926 Bacteria 17794
1279 Ga0496123_0003815 3300048926 Bacteria 16453
1280 Ga0496123_0005121 3300048926 Bacteria 13378
1281 Ga0496123_0006692 3300048926 Bacteria 11104
1282 Ga0496123_0008295 3300048926 Bacteria 9566
1283 Ga0496123_0012224 3300048926 Bacteria 7342
1284 Ga0496123_0031257 3300048926 Bacteria 3876
1285 Ga0496123_0031549 3300048926 Bacteria 3853
1286 Ga0496123_0037990 3300048926 Bacteria 3391
1287 Ga0496123_0048163 3300048926 Bacteria 2870
1288 Ga0496123_0080653 3300048926 Bacteria 1981
1289 Ga0496123_0107980 3300048926 Bacteria 1599
1290 Ga0496123_0135435 3300048926 Bacteria 1356
1291 Ga0496123_0186925 3300048926 Bacteria 1075
1292 Ga0496123_0231341 3300048926 Bacteria 924
1293 Ga0496123_0382431 3300048926 Bacteria 645
1294 Ga0496124_0000004 3300048927 Bacteria 976131
1295 Ga0496124_0000008 3300048927 Bacteria 864372
1296 Ga0496124_0000025 3300048927 Bacteria 405471
1297 Ga0496124_0000097 3300048927 Bacteria 183703
1298 Ga0496124_0000180 3300048927 Bacteria 125291
1299 Ga0496124_0000659 3300048927 Bacteria 56974
1300 Ga0496124_0001108 3300048927 Bacteria 42354
1301 Ga0496124_0001496 3300048927 Bacteria 34238
1302 Ga0496124_0005507 3300048927 Bacteria 14213
1303 Ga0496124_0006593 3300048927 Bacteria 12607
1304 Ga0496124_0011293 3300048927 Bacteria 8941
1305 Ga0496124_0012761 3300048927 Bacteria 8260
1306 Ga0496124_0018225 3300048927 Bacteria 6583
1307 Ga0496124_0025818 3300048927 Bacteria 5310
1308 Ga0496124_0028216 3300048927 Bacteria 5024
1309 Ga0496124_0043725 3300048927 Bacteria 3848
1310 Ga0496124_0050738 3300048927 Bacteria 3533
1311 Ga0496124_0092781 3300048927 Bacteria 2459
1312 Ga0496124_0102126 3300048927 Bacteria 2321
1313 Ga0496124_0110891 3300048927 Bacteria 2208
1314 Ga0496124_0114707 3300048927 Bacteria 2163
1315 Ga0496124_0121468 3300048927 Bacteria 2087
1316 Ga0496124_0126256 3300048927 Bacteria 2037
1317 Ga0496124_0140729 3300048927 Bacteria 1904
1318 Ga0496124_0275538 3300048927 Bacteria 1229
1319 Ga0496124_0289900 3300048927 Bacteria 1188
1320 Ga0496124_0396997 3300048927 Bacteria 958
1321 Ga0496124_0417766 3300048927 Bacteria 925
1322 Ga0496124_0498316 3300048927 Bacteria 817
1323 Ga0496124_0963776 3300048927 Bacteria 511
1324 Ga0496125_0000013 3300048928 Bacteria 628761
1325 Ga0496125_0000055 3300048928 Bacteria 278140
1326 Ga0496125_0003192 3300048928 Bacteria 20252
1327 Ga0496125_0004562 3300048928 Bacteria 15883
1328 Ga0496125_0011417 3300048928 Bacteria 8886
1329 Ga0496125_0012992 3300048928 Bacteria 8221
1330 Ga0496125_0019540 3300048928 Bacteria 6384
1331 Ga0496125_0031099 3300048928 Bacteria 4764
1332 Ga0496125_0031681 3300048928 Bacteria 4708
1333 Ga0496125_0033541 3300048928 Bacteria 4541
1334 Ga0496125_0051081 3300048928 Bacteria 3414
1335 Ga0496125_0056246 3300048928 Bacteria 3196
1336 Ga0496125_0065514 3300048928 Bacteria 2877
1337 Ga0496125_0101308 3300048928 Bacteria 2120
1338 Ga0496125_0102529 3300048928 Bacteria 2102
1339 Ga0496125_0125272 3300048928 Bacteria 1822
1340 Ga0496125_0172485 3300048928 Bacteria 1452
1341 Ga0496126_0000524 3300048929 Bacteria 74800
1342 Ga0496126_0001242 3300048929 Bacteria 41379
1343 Ga0496126_0001275 3300048929 Bacteria 40477
1344 Ga0496126_0002571 3300048929 Bacteria 24231
1345 Ga0496126_0004513 3300048929 Bacteria 16581
1346 Ga0496126_0005838 3300048929 Bacteria 13913
1347 Ga0496126_0012055 3300048929 Bacteria 8883
1348 Ga0496126_0026056 3300048929 Bacteria 5613
1349 Ga0496126_0095925 3300048929 Bacteria 2600
1350 Ga0496126_0102516 3300048929 Bacteria 2502
1351 Ga0496126_0113215 3300048929 Bacteria 2362
1352 Ga0496126_0138297 3300048929 Bacteria 2098
1353 Ga0496126_0140140 3300048929 Bacteria 2082
1354 Ga0496126_0221148 3300048929 Bacteria 1590
1355 Ga0496126_0421096 3300048929 Bacteria 1079
1356 Ga0501306_044815 3300049127 Bacteria 695
1357 Ga0495678_000817 3300049459 Bacteria 27883
1358 Ga0495678_002620 3300049459 Bacteria 11999
1359 Ga0495678_040935 3300049459 Bacteria 1858
1360 Ga0495682_0000015 3300049460 Bacteria 235048
1361 Ga0501290_021491 3300049513 Bacteria 885
1362 Ga0501314_040360 3300049530 Bacteria 543
1363 Ga0501315_101563 3300049531 Bacteria 509
1364 Ga0501031_0009408 3300049568 Bacteria 6349
1365 Ga0501033_0005448 3300049570 Bacteria 10084
1366 Ga0501034_0000194 3300049571 Bacteria 114531
1367 Ga0501034_0067693 3300049571 Bacteria 3583
1368 Ga0501034_0098941 3300049571 Bacteria 2912
1369 Ga0501034_0450921 3300049571 Bacteria 1204
1370 Ga0501037_0442852 3300049573 Bacteria 887
1371 Ga0501043_0906553 3300049579 Bacteria 632
1372 Ga0501043_1195240 3300049579 Bacteria 534
1373 Ga0501047_0022639 3300049581 Bacteria 6033
1374 Ga0501047_0026369 3300049581 Bacteria 5592
1375 Ga0501048_0259736 3300049582 Bacteria 1234
1376 Ga0501069_0003956 3300049585 Bacteria 7644
1377 Ga0501069_0092482 3300049585 Bacteria 1711
1378 Ga0501070_0008196 3300049586 Bacteria 8836
1379 Ga0501073_0004370 3300049589 Bacteria 10615
1380 Ga0501074_0045353 3300049590 Bacteria 3181
1381 Ga0501074_0145039 3300049590 Bacteria 1698
1382 Ga0501076_0358287 3300049592 Bacteria 1198
1383 Ga0501077_0023480 3300049593 Bacteria 3911
1384 Ga0501223_013447 3300049663 Bacteria 1630
1385 Ga0501228_006460 3300049666 Bacteria 1071
1386 Ga0501238_010976 3300049671 Bacteria 1214
1387 Ga0501249_006469 3300049679 Bacteria 2409
1388 Ga0501252_039108 3300049682 Bacteria 682
1389 Ga0501257_049098 3300049686 Bacteria 1050
1390 Ga0501225_0012633 3300049705 Bacteria 2370
1391 Ga0501080_0045132 3300049742 Bacteria 4102
1392 Ga0501080_0176550 3300049742 Bacteria 1967
1393 Ga0501083_0083127 3300049744 Bacteria 2121
1394 Ga0501241_019985 3300049758 Bacteria 1231
1395 Ga0501262_000217 3300049759 Bacteria 7100
1396 Ga0501266_018967 3300049763 Bacteria 928
1397 Ga0501279_026092 3300049775 Bacteria 851
1398 Ga0501035_0008452 3300049822 Bacteria 9589
1399 Ga0501035_0022942 3300049822 Bacteria 5729
1400 Ga0501035_0030616 3300049822 Bacteria 4905
1401 Ga0501035_0383862 3300049822 Bacteria 1171
1402 Ga0501044_0000126 3300049823 Bacteria 92879
1403 Ga0501044_0030902 3300049823 Bacteria 5640
1404 nmdc:mga03683_15867_c1 3300050489 Bacteria 2820
1405 nmdc:mga03683_539_c1 3300050489 Bacteria 10090
1406 nmdc:mga03n38_13224_c1 3300050490 Bacteria 3128
1407 nmdc:mga03n38_14629_c1 3300050490 Bacteria 3012
1408 nmdc:mga00v17_146343_c1 3300050491 Bacteria 1516
1409 nmdc:mga00v17_151655_c1 3300050491 Bacteria 938
1410 nmdc:mga00v17_18093_c1 3300050491 Bacteria 3999
1411 nmdc:mga00v17_210738_c1 3300050491 Bacteria 1257
1412 nmdc:mga00v17_223241_c1 3300050491 Bacteria 1220
1413 nmdc:mga00v17_223343_c1 3300050491 Bacteria 1220
1414 nmdc:mga00v17_320026_c1 3300050491 Bacteria 1008
1415 nmdc:mga00v17_50007_c1 3300050491 Bacteria 2538
1416 nmdc:mga00v17_629_c1 3300050491 Bacteria 19512
1417 nmdc:mga0k408_441955_c1 3300050493 Bacteria 773
1418 nmdc:mga0k408_546176_c1 3300050493 Bacteria 685
1419 nmdc:mga0k408_648838_c1 3300050493 Bacteria 621
1420 nmdc:mga07m45_122425_c1 3300050496 Bacteria 1503
1421 nmdc:mga07m45_1446_c1 3300050496 Bacteria 10887
1422 nmdc:mga07m45_297849_c1 3300050496 Bacteria 938
1423 nmdc:mga07m45_42155_c1 3300050496 Bacteria 2558
1424 nmdc:mga0qj67_683617_c1 3300050509 Bacteria 817
1425 nmdc:mga0a205_524229_c1 3300050515 Bacteria 1041
1426 nmdc:mga0sz30_116214_c1 3300050516 Bacteria 1174
1427 Ga0495601_0056834 3300053077 Bacteria 2478
1428 Ga0495655_0116484 3300053083 Bacteria 809
1429 Ga0495619_0318180 3300053085 Bacteria 1077
1430 Ga0500643_015944 3300053087 Bacteria 2562
1431 Ga0500644_0006005 3300053088 Bacteria 3092
1432 Ga0500644_0051178 3300053088 Bacteria 1417
1433 Ga0500646_0019586 3300053090 Bacteria 1791
1434 Ga0500647_0257671 3300053091 Bacteria 764
1435 Ga0500647_0353846 3300053091 Bacteria 610
1436 Ga0500651_0000054 3300053093 Bacteria 74519
1437 Ga0500566_0042353 3300053094 Bacteria 2627
1438 Ga0500641_0120823 3300053096 Bacteria 1129
1439 Ga0500562_007562 3300053108 Bacteria 2741
1440 Ga0500562_120711 3300053108 Bacteria 714
1441 Ga0500571_000005 3300053110 Bacteria 109625
1442 Ga0500572_116828 3300053111 Bacteria 862
1443 Ga0500592_003168 3300053116 Bacteria 2630
1444 Ga0500593_002899 3300053117 Bacteria 6373
1445 Ga0500594_0000763 3300053118 Bacteria 6854
1446 Ga0500595_001889 3300053119 Bacteria 10795
1447 Ga0500595_118460 3300053119 Bacteria 749
1448 Ga0500597_253803 3300053120 Bacteria 718
1449 Ga0500607_036794 3300053121 Bacteria 2671
1450 Ga0500607_038837 3300053121 Bacteria 2589
1451 Ga0500608_024725 3300053122 Bacteria 2807
1452 Ga0500614_118936 3300053123 Bacteria 776
1453 Ga0500618_014532 3300053125 Bacteria 2008
1454 Ga0500621_000001 3300053126 Bacteria 1049698
1455 Ga0500655_000895 3300053133 Bacteria 5782
1456 Ga0500559_0001788 3300053136 Bacteria 11804
1457 Ga0500559_0084954 3300053136 Bacteria 1443
1458 Ga0500559_0258511 3300053136 Bacteria 820
1459 Ga0500561_0016276 3300053137 Bacteria 1666
1460 Ga0500564_005575 3300053138 Bacteria 5158
1461 Ga0500568_0002238 3300053139 Bacteria 11589
1462 Ga0500573_0029700 3300053140 Bacteria 3151
1463 Ga0500574_000299 3300053141 Bacteria 6083
1464 Ga0500574_001599 3300053141 Bacteria 3438
1465 Ga0500604_0054108 3300053151 Bacteria 1246
1466 Ga0500616_0047830 3300053153 Bacteria 2269
1467 Ga0500619_000249 3300053154 Bacteria 11573
1468 Ga0500622_0125928 3300053156 Bacteria 1237
1469 Ga0500624_004622 3300053157 Bacteria 1817
1470 Ga0500624_070879 3300053157 Bacteria 681
1471 Ga0500634_0025168 3300053161 Bacteria 3239
1472 Ga0500634_0036031 3300053161 Bacteria 2694
1473 Ga0500634_0107998 3300053161 Bacteria 1379
1474 Ga0500638_004055 3300053162 Bacteria 5560
1475 Ga0500636_0000053 3300053177 Bacteria 55579
1476 Ga0500625_026945 3300053729 Bacteria 2724
1477 Ga0500645_011458 3300053730 Bacteria 2895
1478 Ga0500645_049388 3300053730 Bacteria 1230
1479 Ga0500661_002371 3300055283 Bacteria 3552
1480 Ga0501082_0077867 3300060353 Bacteria 2859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049666 Ga0501228_006460 Ga0501228_006460_633_968 107
2 iso_pu_bacteria 2939617950 2939621866 108
3 iso_pu_bacteria 8019504834 8019509242 108
4 3300009036 Ga0105244_10000491 Ga0105244_1000049120 110
5 3300025728 Ga0207655_1000763 Ga0207655_100076320 110
6 3300048927 Ga0496124_0001496 Ga0496124_0001496_9081_9485 110
7 3300033529 Ga0316587_1000878 Ga0316587_10008784 111
8 3300042006 Ga0439432_125770 Ga0439432_125770_22_360 112
9 3300046536 Ga0495587_0823400 Ga0495587_0823400_16_357 112
10 3300046507 Ga0495606_0231995 Ga0495606_0231995_679_1023 113
11 3300046512 Ga0495610_0029233 Ga0495610_0029233_2538_2888 114
12 3300050491 nmdc:mga00v17_146343_c1 nmdc:mga00v17_146343_c1_11_370 114
13 3300053730 Ga0500645_049388 Ga0500645_049388_866_1210 114
14 iso_pu_bacteria 2547132181 2547698141 117
15 iso_pu_bacteria 2881609920 2881612390 117
16 iso_pu_bacteria 644736347 644750334 117
17 3300025711 Ga0207696_1000099 Ga0207696_100009963 120
18 3300027312 Ga0209371_1000809 Ga0209371_100080919 121
19 3300030500 Ga0268256_1002069 Ga0268256_100206911 121
20 3300046648 Ga0495611_0401145 Ga0495611_0401145_14_385 121
21 3300046692 Ga0495671_0008856 Ga0495671_0008856_5268_5633 121
22 3300047673 Ga0495593_0487597 Ga0495593_0487597_13_390 121
23 3300048913 Ga0496110_1212553 Ga0496110_1212553_11_376 121
24 3300048919 Ga0496116_0270833 Ga0496116_0270833_452_817 121
25 3300031251 Ga0265327_10393824 Ga0265327_103938241 125
26 3300042876 Ga0451577_0025812 Ga0451577_0025812_4144_4557 125
27 iso_pu_bacteria 2738541277 2738721246 125
28 iso_pu_bacteria 2738543019 2739280445 125
29 3300029957 Ga0265324_10056153 Ga0265324_100561532 126
30 iso_pu_bacteria 2643221683 2644467160 127
31 iso_pu_bacteria 2885192300 2885198062 127
32 iso_pu_bacteria 2885198086 2885198672 127
33 iso_pu_bacteria 2928070936 2928077402 127
34 3300003163 Ga0006759J45824_1061774 Ga0006759J45824_10617742 128
35 3300003574 Ga0007410J51695_1038845 Ga0007410J51695_10388452 128
36 3300003575 Ga0007409J51694_1018424 Ga0007409J51694_10184242 128
37 3300003577 Ga0007416J51690_1050216 Ga0007416J51690_10502162 128
38 3300003693 Ga0032354_1047181 Ga0032354_10471812 128
39 3300005985 Ga0081539_10075937 Ga0081539_100759372 128
40 3300042131 Ga0450894_010619 Ga0450894_010619_601_1005 128
41 3300001979 JGI24740J21852_10108564 JGI24740J21852_101085641 129
42 3300005327 Ga0070658_10557291 Ga0070658_105572912 129
43 3300005336 Ga0070680_100495764 Ga0070680_1004957642 129
44 3300005337 Ga0070682_101235099 Ga0070682_1012350991 129
45 3300005339 Ga0070660_100907056 Ga0070660_1009070562 129
46 3300005344 Ga0070661_100015748 Ga0070661_1000157483 129
47 3300005458 Ga0070681_10002015 Ga0070681_1000201514 129
48 3300005458 Ga0070681_10984032 Ga0070681_109840322 129
49 3300005530 Ga0070679_100287609 Ga0070679_1002876093 129
50 3300005539 Ga0068853_100001354 Ga0068853_10000135418 129
51 3300005564 Ga0070664_100099825 Ga0070664_1000998252 129
52 3300005577 Ga0068857_100650963 Ga0068857_1006509631 129
53 3300009093 Ga0105240_10498509 Ga0105240_104985092 129
54 3300009545 Ga0105237_10011495 Ga0105237_100114956 129
55 3300009551 Ga0105238_10634030 Ga0105238_106340302 129
56 3300010375 Ga0105239_10013831 Ga0105239_100138315 129
57 3300013100 Ga0157373_10018164 Ga0157373_100181641 129
58 3300013100 Ga0157373_10137322 Ga0157373_101373222 129
59 3300013104 Ga0157370_10028456 Ga0157370_100284568 129
60 3300013104 Ga0157370_10063234 Ga0157370_100632342 129
61 3300013104 Ga0157370_10067492 Ga0157370_100674923 129
62 3300013105 Ga0157369_10010610 Ga0157369_100106107 129
63 3300013307 Ga0157372_10025560 Ga0157372_1002556010 129
64 3300025253 Ga0209677_112773 Ga0209677_1127732 129
65 3300025909 Ga0207705_10958300 Ga0207705_109583002 129
66 3300025912 Ga0207707_10008129 Ga0207707_100081298 129
67 3300025912 Ga0207707_10206830 Ga0207707_102068303 129
68 3300025913 Ga0207695_10367416 Ga0207695_103674162 129
69 3300025914 Ga0207671_10026936 Ga0207671_100269365 129
70 3300025919 Ga0207657_10592936 Ga0207657_105929361 129
71 3300025920 Ga0207649_10015548 Ga0207649_100155485 129
72 3300025921 Ga0207652_10345918 Ga0207652_103459182 129
73 3300025945 Ga0207679_10080577 Ga0207679_100805775 129
74 3300025949 Ga0207667_10161254 Ga0207667_101612543 129
75 3300026041 Ga0207639_10007637 Ga0207639_100076374 129
76 3300048921 Ga0496118_0330465 Ga0496118_0330465_389_784 129
77 3300048925 Ga0496122_0063042 Ga0496122_0063042_956_1351 129
78 3300049571 Ga0501034_0098941 Ga0501034_0098941_844_1251 129
79 3300049581 Ga0501047_0026369 Ga0501047_0026369_1955_2362 129
80 3300049585 Ga0501069_0092482 Ga0501069_0092482_410_817 129
81 3300049589 Ga0501073_0004370 Ga0501073_0004370_1320_1727 129
82 3300049590 Ga0501074_0045353 Ga0501074_0045353_1646_2053 129
83 3300049742 Ga0501080_0045132 Ga0501080_0045132_2108_2515 129
84 3300049742 Ga0501080_0176550 Ga0501080_0176550_1214_1621 129
85 3300049744 Ga0501083_0083127 Ga0501083_0083127_1419_1826 129
86 3300049822 Ga0501035_0383862 Ga0501035_0383862_544_951 129
87 3300053091 Ga0500647_0257671 Ga0500647_0257671_301_693 129
88 3300053121 Ga0500607_038837 Ga0500607_038837_1262_1654 129
89 3300053136 Ga0500559_0258511 Ga0500559_0258511_202_594 129
90 3300053161 Ga0500634_0025168 Ga0500634_0025168_727_1137 129
91 3300053177 Ga0500636_0000053 Ga0500636_0000053_55086_55478 129
92 3300053729 Ga0500625_026945 Ga0500625_026945_1702_2094 129
93 3300060353 Ga0501082_0077867 Ga0501082_0077867_394_801 129
94 iso_pu_bacteria 2721755763 2723879825 129
95 iso_pu_bacteria 2738543013 2739250546 129
96 3300001915 JGI24741J21665_1002439 JGI24741J21665_10024393 130
97 3300001979 JGI24740J21852_10001465 JGI24740J21852_1000146511 130
98 3300003784 Ga0055534_1030244 Ga0055534_10302441 130
99 3300003791 Ga0055530_10036030 Ga0055530_100360302 130
100 3300005327 Ga0070658_10070073 Ga0070658_100700733 130
101 3300005327 Ga0070658_10243894 Ga0070658_102438942 130
102 3300005331 Ga0070670_100679234 Ga0070670_1006792342 130
103 3300005336 Ga0070680_100022363 Ga0070680_1000223633 130
104 3300005337 Ga0070682_100010205 Ga0070682_1000102056 130
105 3300005341 Ga0070691_10006226 Ga0070691_100062268 130
106 3300005341 Ga0070691_10036380 Ga0070691_100363802 130
107 3300005341 Ga0070691_10198210 Ga0070691_101982101 130
108 3300005344 Ga0070661_100398030 Ga0070661_1003980302 130
109 3300005345 Ga0070692_10041561 Ga0070692_100415614 130
110 3300005345 Ga0070692_10064627 Ga0070692_100646273 130
111 3300005367 Ga0070667_100051123 Ga0070667_1000511232 130
112 3300005455 Ga0070663_100005681 Ga0070663_1000056816 130
113 3300005455 Ga0070663_100023732 Ga0070663_1000237326 130
114 3300005456 Ga0070678_101657403 Ga0070678_1016574031 130
115 3300005457 Ga0070662_100017220 Ga0070662_1000172203 130
116 3300005458 Ga0070681_10000088 Ga0070681_1000008853 130
117 3300005530 Ga0070679_100000061 Ga0070679_10000006165 130
118 3300005539 Ga0068853_100047998 Ga0068853_1000479982 130
119 3300005539 Ga0068853_100302849 Ga0068853_1003028492 130
120 3300005539 Ga0068853_100355525 Ga0068853_1003555251 130
121 3300005546 Ga0070696_100015635 Ga0070696_1000156352 130
122 3300005546 Ga0070696_100024095 Ga0070696_1000240954 130
123 3300005547 Ga0070693_100008374 Ga0070693_1000083743 130
124 3300005548 Ga0070665_100833059 Ga0070665_1008330591 130
125 3300005548 Ga0070665_101682702 Ga0070665_1016827022 130
126 3300005563 Ga0068855_100010497 Ga0068855_10001049715 130
127 3300005563 Ga0068855_100224695 Ga0068855_1002246952 130
128 3300005578 Ga0068854_100061734 Ga0068854_1000617343 130
129 3300005617 Ga0068859_100135523 Ga0068859_1001355233 130
130 3300005834 Ga0068851_10012101 Ga0068851_100121014 130
131 3300005841 Ga0068863_100031760 Ga0068863_1000317604 130
132 3300005843 Ga0068860_100301337 Ga0068860_1003013373 130
133 3300006846 Ga0075430_100079155 Ga0075430_1000791552 130
134 3300006852 Ga0075433_10254037 Ga0075433_102540373 130
135 3300006931 Ga0097620_100135524 Ga0097620_1001355243 130
136 3300009093 Ga0105240_10062558 Ga0105240_100625586 130
137 3300009093 Ga0105240_10273746 Ga0105240_102737462 130
138 3300009093 Ga0105240_11310510 Ga0105240_113105102 130
139 3300009174 Ga0105241_10130865 Ga0105241_101308652 130
140 3300009176 Ga0105242_11474481 Ga0105242_114744812 130
141 3300009177 Ga0105248_10253265 Ga0105248_102532652 130
142 3300009545 Ga0105237_10150560 Ga0105237_101505602 130
143 3300009551 Ga0105238_10001283 Ga0105238_1000128321 130
144 3300009553 Ga0105249_10340702 Ga0105249_103407023 130
145 3300013100 Ga0157373_10040095 Ga0157373_100400955 130
146 3300013102 Ga0157371_10474916 Ga0157371_104749162 130
147 3300013102 Ga0157371_11187912 Ga0157371_111879122 130
148 3300013104 Ga0157370_10005747 Ga0157370_100057477 130
149 3300013104 Ga0157370_10396757 Ga0157370_103967572 130
150 3300013104 Ga0157370_10544307 Ga0157370_105443072 130
151 3300013105 Ga0157369_10016298 Ga0157369_100162982 130
152 3300013105 Ga0157369_10650919 Ga0157369_106509192 130
153 3300013307 Ga0157372_10001723 Ga0157372_1000172326 130
154 3300013307 Ga0157372_10057183 Ga0157372_100571832 130
155 3300013307 Ga0157372_10496574 Ga0157372_104965742 130
156 3300014968 Ga0157379_10003242 Ga0157379_1000324211 130
157 3300014969 Ga0157376_11058796 Ga0157376_110587962 130
158 3300020070 Ga0206356_10036066 Ga0206356_100360664 130
159 3300020081 Ga0206354_11653555 Ga0206354_116535552 130
160 3300020082 Ga0206353_11505629 Ga0206353_115056293 130
161 3300020610 Ga0154015_1259153 Ga0154015_12591532 130
162 3300021377 Ga0213874_10372997 Ga0213874_103729971 130
163 3300025291 Ga0209675_1005551 Ga0209675_10055518 130
164 3300025294 Ga0209025_1035232 Ga0209025_10352323 130
165 3300025298 Ga0209050_1009167 Ga0209050_10091673 130
166 3300025321 Ga0207656_10004218 Ga0207656_100042185 130
167 3300025900 Ga0207710_10081304 Ga0207710_100813042 130
168 3300025904 Ga0207647_10003226 Ga0207647_1000322614 130
169 3300025909 Ga0207705_10000029 Ga0207705_10000029201 130
170 3300025909 Ga0207705_10000755 Ga0207705_100007557 130
171 3300025909 Ga0207705_10056150 Ga0207705_100561502 130
172 3300025911 Ga0207654_10115476 Ga0207654_101154763 130
173 3300025912 Ga0207707_10000042 Ga0207707_1000004216 130
174 3300025912 Ga0207707_10000144 Ga0207707_1000014479 130
175 3300025912 Ga0207707_10001056 Ga0207707_1000105618 130
176 3300025913 Ga0207695_10002071 Ga0207695_1000207129 130
177 3300025913 Ga0207695_10010137 Ga0207695_100101373 130
178 3300025917 Ga0207660_10000413 Ga0207660_1000041329 130
179 3300025920 Ga0207649_10007256 Ga0207649_100072567 130
180 3300025920 Ga0207649_10519784 Ga0207649_105197842 130
181 3300025921 Ga0207652_10000082 Ga0207652_1000008280 130
182 3300025921 Ga0207652_10000808 Ga0207652_1000080815 130
183 3300025921 Ga0207652_10001430 Ga0207652_100014305 130
184 3300025924 Ga0207694_10021179 Ga0207694_100211795 130
185 3300025925 Ga0207650_10811942 Ga0207650_108119422 130
186 3300025932 Ga0207690_10004125 Ga0207690_100041257 130
187 3300025932 Ga0207690_10008721 Ga0207690_100087213 130
188 3300025933 Ga0207706_10011328 Ga0207706_100113289 130
189 3300025934 Ga0207686_10534495 Ga0207686_105344952 130
190 3300025941 Ga0207711_10633536 Ga0207711_106335362 130
191 3300025944 Ga0207661_10015030 Ga0207661_100150304 130
192 3300025944 Ga0207661_11268292 Ga0207661_112682921 130
193 3300025945 Ga0207679_10077418 Ga0207679_100774182 130
194 3300025949 Ga0207667_10000075 Ga0207667_10000075136 130
195 3300025949 Ga0207667_10005022 Ga0207667_100050223 130
196 3300025949 Ga0207667_10007273 Ga0207667_100072736 130
197 3300025949 Ga0207667_10385112 Ga0207667_103851122 130
198 3300025961 Ga0207712_10961464 Ga0207712_109614642 130
199 3300025961 Ga0207712_11548013 Ga0207712_115480132 130
200 3300025981 Ga0207640_10010766 Ga0207640_100107664 130
201 3300025981 Ga0207640_10016893 Ga0207640_100168936 130
202 3300025981 Ga0207640_10022260 Ga0207640_100222602 130
203 3300025986 Ga0207658_10205254 Ga0207658_102052542 130
204 3300025986 Ga0207658_11591886 Ga0207658_115918861 130
205 3300026041 Ga0207639_10001297 Ga0207639_100012973 130
206 3300026041 Ga0207639_10047674 Ga0207639_100476744 130
207 3300026041 Ga0207639_10155920 Ga0207639_101559202 130
208 3300026067 Ga0207678_10001891 Ga0207678_100018912 130
209 3300026067 Ga0207678_10005658 Ga0207678_1000565813 130
210 3300026067 Ga0207678_10052250 Ga0207678_100522505 130
211 3300026078 Ga0207702_10031604 Ga0207702_100316042 130
212 3300026088 Ga0207641_10161201 Ga0207641_101612012 130
213 3300026116 Ga0207674_10003998 Ga0207674_1000399811 130
214 3300026121 Ga0207683_11617527 Ga0207683_116175271 130
215 3300026142 Ga0207698_10000358 Ga0207698_100003582 130
216 3300028379 Ga0268266_10180251 Ga0268266_101802512 130
217 3300028380 Ga0268265_10139443 Ga0268265_101394431 130
218 3300028381 Ga0268264_10304937 Ga0268264_103049372 130
219 3300037418 Ga0395900_0067131 Ga0395900_0067131_393_788 130
220 3300037418 Ga0395900_0359565 Ga0395900_0359565_629_1030 130
221 3300037466 Ga0395898_0167266 Ga0395898_0167266_243_644 130
222 3300037466 Ga0395898_0368686 Ga0395898_0368686_48_449 130
223 3300038443 Ga0395901_0642429 Ga0395901_0642429_183_584 130
224 3300038443 Ga0395901_1003615 Ga0395901_1003615_398_799 130
225 3300038443 Ga0395901_1886488 Ga0395901_1886488_12_413 130
226 3300039450 Ga0436363_0982124 Ga0436363_0982124_35_436 130
227 3300041404 Ga0439436_0000336 Ga0439436_0000336_3072_3464 130
228 3300041411 Ga0439466_0058052 Ga0439466_0058052_299_691 130
229 3300041413 Ga0439465_0000517 Ga0439465_0000517_5356_5748 130
230 3300041451 Ga0451791_0972312 Ga0451791_0972312_685_1101 130
231 3300041512 Ga0451853_3098869 Ga0451853_3098869_82_498 130
232 3300041997 Ga0439431_0002606 Ga0439431_0002606_2411_2803 130
233 3300042127 Ga0450890_007058 Ga0450890_007058_516_911 130
234 3300042435 Ga0439434_0086096 Ga0439434_0086096_582_974 130
235 3300042876 Ga0451577_1176457 Ga0451577_1176457_100_498 130
236 3300044712 Ga0453684_0693932 Ga0453684_0693932_31_435 130
237 3300045051 Ga0451576_0252121 Ga0451576_0252121_970_1368 130
238 3300046499 Ga0495594_0007426 Ga0495594_0007426_1275_1688 130
239 3300046526 Ga0495666_0035617 Ga0495666_0035617_651_1064 130
240 3300048904 Ga0496101_0025960 Ga0496101_0025960_1301_1717 130
241 3300048919 Ga0496116_0015751 Ga0496116_0015751_4759_5175 130
242 3300048920 Ga0496117_0035885 Ga0496117_0035885_1890_2306 130
243 3300048924 Ga0496121_0035885 Ga0496121_0035885_1193_1609 130
244 3300048925 Ga0496122_0035075 Ga0496122_0035075_1970_2386 130
245 3300048925 Ga0496122_0053063 Ga0496122_0053063_575_991 130
246 3300048926 Ga0496123_0012224 Ga0496123_0012224_4927_5343 130
247 3300048926 Ga0496123_0037990 Ga0496123_0037990_1012_1428 130
248 3300048927 Ga0496124_0417766 Ga0496124_0417766_160_576 130
249 3300049573 Ga0501037_0442852 Ga0501037_0442852_260_661 130
250 3300049585 Ga0501069_0003956 Ga0501069_0003956_3659_4060 130
251 3300049586 Ga0501070_0008196 Ga0501070_0008196_5837_6238 130
252 3300049590 Ga0501074_0145039 Ga0501074_0145039_337_738 130
253 3300049593 Ga0501077_0023480 Ga0501077_0023480_401_802 130
254 3300050509 nmdc:mga0qj67_683617_c1 nmdc:mga0qj67_683617_c1_38_439 130
255 3300050515 nmdc:mga0a205_524229_c1 nmdc:mga0a205_524229_c1_505_912 130
256 iso_pu_bacteria 2506520007 2506579128 130
257 iso_pu_bacteria 2506520008 2506584267 130
258 iso_pu_bacteria 2508501071 2508853017 130
259 iso_pu_bacteria 2511231025 2511378986 130
260 iso_pu_bacteria 2511231035 2511433251 130
261 iso_pu_bacteria 2513237150 2513953457 130
262 iso_pu_bacteria 2513237165 2514042766 130
263 iso_pu_bacteria 2526164512 2526213809 130
264 iso_pu_bacteria 2537561728 2538425916 130
265 iso_pu_bacteria 2547132181 2547694988 130
266 iso_pu_bacteria 2547132374 2548501264 130
267 iso_pu_bacteria 2547132416 2548648031 130
268 iso_pu_bacteria 2561511199 2562463995 130
269 iso_pu_bacteria 2561511199 2562467013 130
270 iso_pu_bacteria 2585427591 2585829188 130
271 iso_pu_bacteria 2585427592 2585834100 130
272 iso_pu_bacteria 2599185292 2599907762 130
273 iso_pu_bacteria 2599185299 2599927576 130
274 iso_pu_bacteria 2600255256 2601533231 130
275 iso_pu_bacteria 2600255256 2601535065 130
276 iso_pu_bacteria 2600255257 2601538595 130
277 iso_pu_bacteria 2600255257 2601541454 130
278 iso_pu_bacteria 2600255310 2601756944 130
279 iso_pu_bacteria 2600255310 2601758247 130
280 iso_pu_bacteria 2600255311 2601761601 130
281 iso_pu_bacteria 2600255311 2601764356 130
282 iso_pu_bacteria 2602042046 2603638382 130
283 iso_pu_bacteria 2602042046 2603641220 130
284 iso_pu_bacteria 2602042047 2603642877 130
285 iso_pu_bacteria 2602042066 2603698078 130
286 iso_pu_bacteria 2602042067 2603703483 130
287 iso_pu_bacteria 2602042109 2603867553 130
288 iso_pu_bacteria 2608642108 2608669024 130
289 iso_pu_bacteria 2609459761 2609910071 130
290 iso_pu_bacteria 2643221569 2643863186 130
291 iso_pu_bacteria 2643221570 2643868496 130
292 iso_pu_bacteria 2643221594 2643978592 130
293 iso_pu_bacteria 2643221596 2643994603 130
294 iso_pu_bacteria 2643221609 2644061652 130
295 iso_pu_bacteria 2643221611 2644075184 130
296 iso_pu_bacteria 2643221621 2644121712 130
297 iso_pu_bacteria 2643221652 2644295448 130
298 iso_pu_bacteria 2643221717 2644649192 130
299 iso_pu_bacteria 2648501693 2650897820 130
300 iso_pu_bacteria 2654587920 2656280085 130
301 iso_pu_bacteria 2667528172 2671103420 130
302 iso_pu_bacteria 2667528173 2671108783 130
303 iso_pu_bacteria 2671180115 2671587306 130
304 iso_pu_bacteria 2681812866 2681997451 130
305 iso_pu_bacteria 2681812869 2682007045 130
306 iso_pu_bacteria 2684622997 2686352920 130
307 iso_pu_bacteria 2687453601 2689445585 130
308 iso_pu_bacteria 2706794495 2707098652 130
309 iso_pu_bacteria 2738541307 2738882743 130
310 iso_pu_bacteria 2738543012 2739243349 130
311 iso_pu_bacteria 2751185917 2753855531 130
312 iso_pu_bacteria 2765235842 2765588508 130
313 iso_pu_bacteria 2772190666 2772439547 130
314 iso_pu_bacteria 2775506706 2775542322 130
315 iso_pu_bacteria 2791354903 2791925875 130
316 iso_pu_bacteria 2791355010 2792311507 130
317 iso_pu_bacteria 2791355275 2793405912 130
318 iso_pu_bacteria 2806310673 2807180778 130
319 iso_pu_bacteria 2808606395 2809036651 130
320 iso_pu_bacteria 2808606414 2809126989 130
321 iso_pu_bacteria 2811995292 2813727434 130
322 iso_pu_bacteria 2811995292 2813729433 130
323 iso_pu_bacteria 2814123068 2814694966 130
324 iso_pu_bacteria 2814123068 2814696928 130
325 iso_pu_bacteria 2816332133 2816473927 130
326 iso_pu_bacteria 2821118458 2821119337 130
327 iso_pu_bacteria 2823373977 2823374294 130
328 iso_pu_bacteria 2834641062 2834645087 130
329 iso_pu_bacteria 2842718218 2842721934 130
330 iso_pu_bacteria 2844425489 2844427075 130
331 iso_pu_bacteria 2844528606 2844530485 130
332 iso_pu_bacteria 2846540461 2846541790 130
333 iso_pu_bacteria 2847085930 2847088103 130
334 iso_pu_bacteria 2847797336 2847800402 130
335 iso_pu_bacteria 2852103415 2852107623 130
336 iso_pu_bacteria 2854601825 2854601991 130
337 iso_pu_bacteria 2855195626 2855197066 130
338 iso_pu_bacteria 2855730933 2855731415 130
339 iso_pu_bacteria 2855767633 2855768121 130
340 iso_pu_bacteria 2857537821 2857542680 130
341 iso_pu_bacteria 2857542790 2857545856 130
342 iso_pu_bacteria 2858466076 2858469096 130
343 iso_pu_bacteria 2858688981 2858691088 130
344 iso_pu_bacteria 2858950400 2858954805 130
345 iso_pu_bacteria 2865014394 2865015573 130
346 iso_pu_bacteria 2869551831 2869555030 130
347 iso_pu_bacteria 2871272651 2871275628 130
348 iso_pu_bacteria 2871282230 2871285420 130
349 iso_pu_bacteria 2876601092 2876601983 130
350 iso_pu_bacteria 2881412998 2881413712 130
351 iso_pu_bacteria 2884086401 2884089421 130
352 iso_pu_bacteria 2888366609 2888369610 130
353 iso_pu_bacteria 2891670763 2891672676 130
354 iso_pu_bacteria 2900051742 2900052857 130
355 iso_pu_bacteria 2901300506 2901304334 130
356 iso_pu_bacteria 2904474040 2904475471 130
357 iso_pu_bacteria 2904541872 2904548220 130
358 iso_pu_bacteria 2919150387 2919154316 130
359 iso_pu_bacteria 2923634449 2923638964 130
360 iso_pu_bacteria 2927143783 2927144309 130
361 iso_pu_bacteria 2927833300 2927834546 130
362 iso_pu_bacteria 2929160207 2929163210 130
363 iso_pu_bacteria 2932406140 2932408756 130
364 iso_pu_bacteria 2935625433 2935627103 130
365 iso_pu_bacteria 2935625433 2935629095 130
366 iso_pu_bacteria 2937539931 2937543247 130
367 iso_pu_bacteria 2937967321 2937968184 130
368 iso_pu_bacteria 2939568625 2939568727 130
369 iso_pu_bacteria 2939573065 2939574239 130
370 iso_pu_bacteria 2939577877 2939580452 130
371 iso_pu_bacteria 2939602548 2939603654 130
372 iso_pu_bacteria 2939607340 2939607919 130
373 iso_pu_bacteria 2939617950 2939619108 130
374 iso_pu_bacteria 2939642701 2939644228 130
375 iso_pu_bacteria 2941479691 2941481035 130
376 iso_pu_bacteria 2945874760 2945877271 130
377 iso_pu_bacteria 2945951305 2945953465 130
378 iso_pu_bacteria 2974310843 2974312571 130
379 iso_pu_bacteria 2974320154 2974321964 130
380 iso_pu_bacteria 2974435778 2974437978 130
381 iso_pu_bacteria 2974435778 2974439772 130
382 iso_pu_bacteria 2978975091 2978975957 130
383 iso_pu_bacteria 2978975091 2978978014 130
384 iso_pu_bacteria 2984494565 2984496150 130
385 iso_pu_bacteria 2990261002 2990262827 130
386 iso_pu_bacteria 2990710928 2990715533 130
387 iso_pu_bacteria 3000376612 3000376946 130
388 iso_pu_bacteria 640753048 640938510 130
389 iso_pu_bacteria 8003400568 8003405317 130
390 iso_pu_bacteria 8004592986 8004596810 130
391 iso_pu_bacteria 8015394850 8015398332 130
392 iso_pu_bacteria 8016733728 8016736360 130
393 iso_pu_bacteria 8018221730 8018224609 130
394 iso_pu_bacteria 8018405270 8018408625 130
395 iso_pu_bacteria 8019499862 8019503032 130
396 iso_pu_bacteria 8019504834 8019505992 130
397 iso_pu_bacteria 8054844752 8054846254 130
398 iso_pu_bacteria 8054849141 8054850454 130
399 iso_pu_bacteria 8055087960 8055088534 130
400 iso_pu_bacteria 8055092621 8055094229 130
401 iso_pu_bacteria 8055097453 8055099647 130
402 iso_pu_bacteria 8055693939 8055696620 130
403 iso_pu_bacteria 8057160832 8057161335 130
404 iso_pu_bacteria 8057304971 8057309059 130
405 3300003322 rootL2_10010810 rootL2_1001081012 131
406 3300003781 Ga0055536_1008144 Ga0055536_10081443 131
407 3300003792 Ga0055540_1002723 Ga0055540_10027239 131
408 3300003794 Ga0055531_10042539 Ga0055531_100425392 131
409 3300005338 Ga0068868_102001739 Ga0068868_1020017391 131
410 3300005347 Ga0070668_100239409 Ga0070668_1002394092 131
411 3300005367 Ga0070667_100013220 Ga0070667_1000132205 131
412 3300005577 Ga0068857_100036973 Ga0068857_1000369735 131
413 3300006186 Ga0075369_10203553 Ga0075369_102035532 131
414 3300006948 Ga0099826_10139907 Ga0099826_101399072 131
415 3300009092 Ga0105250_10000037 Ga0105250_10000037109 131
416 3300009148 Ga0105243_10003849 Ga0105243_1000384911 131
417 3300009176 Ga0105242_10068733 Ga0105242_100687333 131
418 3300009176 Ga0105242_11525997 Ga0105242_115259972 131
419 3300013102 Ga0157371_10000067 Ga0157371_1000006787 131
420 3300014497 Ga0182008_10005352 Ga0182008_100053529 131
421 3300015262 Ga0182007_10003487 Ga0182007_100034873 131
422 3300015265 Ga0182005_1000075 Ga0182005_100007547 131
423 3300025292 Ga0209676_1000290 Ga0209676_100029090 131
424 3300025303 Ga0209051_1000141 Ga0209051_100014112 131
425 3300025304 Ga0209257_1015612 Ga0209257_10156123 131
426 3300025903 Ga0207680_10011667 Ga0207680_100116675 131
427 3300025931 Ga0207644_10298919 Ga0207644_102989192 131
428 3300025934 Ga0207686_10240383 Ga0207686_102403832 131
429 3300025935 Ga0207709_10001503 Ga0207709_1000150314 131
430 3300025940 Ga0207691_10545460 Ga0207691_105454602 131
431 3300025986 Ga0207658_10329316 Ga0207658_103293162 131
432 3300026121 Ga0207683_10014368 Ga0207683_100143686 131
433 3300030731 Ga0316177_1037186 Ga0316177_10371867 131
434 3300030732 Ga0316176_1061113 Ga0316176_10611133 131
435 3300030733 Ga0314311_1031728 Ga0314311_10317283 131
436 3300030734 Ga0316179_1098736 Ga0316179_10987363 131
437 3300030735 Ga0316178_1015612 Ga0316178_10156127 131
438 3300030736 Ga0316180_1126976 Ga0316180_11269762 131
439 3300030742 Ga0316183_1122932 Ga0316183_11229328 131
440 3300030744 Ga0316181_1114225 Ga0316181_11142253 131
441 3300031251 Ga0265327_10002852 Ga0265327_1000285212 131
442 3300031251 Ga0265327_10024914 Ga0265327_100249142 131
443 3300031731 Ga0307405_10058452 Ga0307405_100584525 131
444 3300031731 Ga0307405_10310911 Ga0307405_103109112 131
445 3300031731 Ga0307405_10321329 Ga0307405_103213292 131
446 3300031824 Ga0307413_10082572 Ga0307413_100825723 131
447 3300031901 Ga0307406_11635513 Ga0307406_116355131 131
448 3300031911 Ga0307412_10019109 Ga0307412_100191094 131
449 3300032002 Ga0307416_102284103 Ga0307416_1022841032 131
450 3300032004 Ga0307414_10339772 Ga0307414_103397722 131
451 3300032005 Ga0307411_10019468 Ga0307411_100194684 131
452 3300032005 Ga0307411_10261224 Ga0307411_102612243 131
453 3300035398 Ga0316574_0212159 Ga0316574_0212159_406_819 131
454 3300036647 Ga0316582_0207199 Ga0316582_0207199_396_809 131
455 3300039447 Ga0436361_0079908 Ga0436361_0079908_116_520 131
456 3300041410 Ga0439461_0065771 Ga0439461_0065771_211_606 131
457 3300042009 Ga0439451_047755 Ga0439451_047755_260_655 131
458 3300042015 Ga0439462_0000328 Ga0439462_0000328_1196_1591 131
459 3300042156 Ga0439446_0176825 Ga0439446_0176825_297_692 131
460 3300042532 Ga0450893_0003283 Ga0450893_0003283_1887_2282 131
461 3300044693 Ga0466961_0023977 Ga0466961_0023977_842_1237 131
462 3300044712 Ga0453684_0000917 Ga0453684_0000917_55695_56105 131
463 3300046452 Ga0495617_031455 Ga0495617_031455_803_1201 131
464 3300046453 Ga0495627_073184 Ga0495627_073184_201_596 131
465 3300046454 Ga0495592_0016839 Ga0495592_0016839_494_901 131
466 3300046463 Ga0495653_0198914 Ga0495653_0198914_450_857 131
467 3300046471 Ga0495650_0000002 Ga0495650_0000002_561033_561437 131
468 3300046471 Ga0495650_0000478 Ga0495650_0000478_44775_45191 131
469 3300046474 Ga0495605_0004250 Ga0495605_0004250_7327_7743 131
470 3300046500 Ga0495596_0000001 Ga0495596_0000001_6995_7393 131
471 3300046501 Ga0495607_0000175 Ga0495607_0000175_51736_52134 131
472 3300046511 Ga0495608_0006970 Ga0495608_0006970_3372_3779 131
473 3300046512 Ga0495610_0000002 Ga0495610_0000002_209834_210238 131
474 3300046514 Ga0495618_0012760 Ga0495618_0012760_749_1156 131
475 3300046514 Ga0495618_0106009 Ga0495618_0106009_498_893 131
476 3300046515 Ga0495620_0141600 Ga0495620_0141600_113_511 131
477 3300046516 Ga0495628_0006630 Ga0495628_0006630_226_633 131
478 3300046519 Ga0495632_0007880 Ga0495632_0007880_3824_4228 131
479 3300046519 Ga0495632_0011349 Ga0495632_0011349_354_752 131
480 3300046520 Ga0495637_0000005 Ga0495637_0000005_205618_206022 131
481 3300046522 Ga0495643_0000002 Ga0495643_0000002_223143_223547 131
482 3300046525 Ga0495663_0142351 Ga0495663_0142351_250_645 131
483 3300046526 Ga0495666_0001981 Ga0495666_0001981_3220_3618 131
484 3300046526 Ga0495666_0499409 Ga0495666_0499409_19_414 131
485 3300046529 Ga0495652_0035985 Ga0495652_0035985_653_1060 131
486 3300046530 Ga0495654_0082084 Ga0495654_0082084_475_891 131
487 3300046542 Ga0495597_0000015 Ga0495597_0000015_70699_71103 131
488 3300046542 Ga0495597_0001359 Ga0495597_0001359_8046_8462 131
489 3300046542 Ga0495597_0020433 Ga0495597_0020433_170_568 131
490 3300046543 Ga0495645_0181366 Ga0495645_0181366_621_1028 131
491 3300046557 Ga0495622_0013458 Ga0495622_0013458_1858_2265 131
492 3300046615 Ga0495656_0007291 Ga0495656_0007291_92_487 131
493 3300046642 Ga0495634_0069678 Ga0495634_0069678_890_1297 131
494 3300046660 Ga0495625_0004458 Ga0495625_0004458_1003_1407 131
495 3300046663 Ga0495635_0172144 Ga0495635_0172144_635_1042 131
496 3300046675 Ga0495657_0043991 Ga0495657_0043991_2419_2826 131
497 3300046678 Ga0495599_0003585 Ga0495599_0003585_8398_8805 131
498 3300046680 Ga0495646_0014471 Ga0495646_0014471_2824_3231 131
499 3300046681 Ga0495647_0067036 Ga0495647_0067036_1022_1417 131
500 3300046683 Ga0495658_0042769 Ga0495658_0042769_121_528 131
501 3300046690 Ga0495624_0008986 Ga0495624_0008986_3998_4405 131
502 3300046691 Ga0495670_0016534 Ga0495670_0016534_220_636 131
503 3300046692 Ga0495671_0001269 Ga0495671_0001269_15213_15617 131
504 3300046809 Ga0495600_0003774 Ga0495600_0003774_8546_8953 131
505 3300047317 Ga0495604_0001830 Ga0495604_0001830_11839_12237 131
506 3300047317 Ga0495604_0014340 Ga0495604_0014340_4569_4976 131
507 3300047320 Ga0495672_0215417 Ga0495672_0215417_148_564 131
508 3300047445 Ga0495677_0413493 Ga0495677_0413493_13_408 131
509 3300047470 Ga0495681_0000088 Ga0495681_0000088_26660_27064 131
510 3300047470 Ga0495681_0000426 Ga0495681_0000426_22556_22954 131
511 3300047472 Ga0495686_0060309 Ga0495686_0060309_1011_1415 131
512 3300048088 Ga0495602_0375023 Ga0495602_0375023_242_649 131
513 3300048091 Ga0495626_0000001 Ga0495626_0000001_377122_377538 131
514 3300048906 Ga0496103_0646170 Ga0496103_0646170_156_551 131
515 3300048919 Ga0496116_0000261 Ga0496116_0000261_34814_35215 131
516 3300048919 Ga0496116_0002175 Ga0496116_0002175_9859_10257 131
517 3300048920 Ga0496117_0000213 Ga0496117_0000213_48945_49346 131
518 3300048920 Ga0496117_0044550 Ga0496117_0044550_104_499 131
519 3300048921 Ga0496118_0000137 Ga0496118_0000137_95465_95866 131
520 3300048921 Ga0496118_0001157 Ga0496118_0001157_27701_28096 131
521 3300048924 Ga0496121_0015160 Ga0496121_0015160_2258_2659 131
522 3300048924 Ga0496121_0038890 Ga0496121_0038890_3684_4085 131
523 3300048925 Ga0496122_0000130 Ga0496122_0000130_109257_109658 131
524 3300048926 Ga0496123_0000064 Ga0496123_0000064_177991_178392 131
525 3300048929 Ga0496126_0005838 Ga0496126_0005838_9348_9749 131
526 3300049459 Ga0495678_002620 Ga0495678_002620_3219_3623 131
527 3300049592 Ga0501076_0358287 Ga0501076_0358287_26_439 131
528 3300049679 Ga0501249_006469 Ga0501249_006469_519_935 131
529 3300049705 Ga0501225_0012633 Ga0501225_0012633_636_1052 131
530 3300050489 nmdc:mga03683_15867_c1 nmdc:mga03683_15867_c1_1234_1629 131
531 3300050490 nmdc:mga03n38_14629_c1 nmdc:mga03n38_14629_c1_2457_2852 131
532 3300050493 nmdc:mga0k408_441955_c1 nmdc:mga0k408_441955_c1_328_723 131
533 3300050493 nmdc:mga0k408_648838_c1 nmdc:mga0k408_648838_c1_201_596 131
534 3300050496 nmdc:mga07m45_1446_c1 nmdc:mga07m45_1446_c1_2148_2543 131
535 3300053077 Ga0495601_0056834 Ga0495601_0056834_450_857 131
536 3300053085 Ga0495619_0318180 Ga0495619_0318180_641_1048 131
537 3300053094 Ga0500566_0042353 Ga0500566_0042353_11_412 131
538 3300053111 Ga0500572_116828 Ga0500572_116828_140_547 131
539 3300053119 Ga0500595_001889 Ga0500595_001889_1331_1738 131
540 3300053120 Ga0500597_253803 Ga0500597_253803_201_602 131
541 3300053123 Ga0500614_118936 Ga0500614_118936_116_517 131
542 3300053136 Ga0500559_0084954 Ga0500559_0084954_116_517 131
543 3300053141 Ga0500574_001599 Ga0500574_001599_13_420 131
544 3300053154 Ga0500619_000249 Ga0500619_000249_7932_8339 131
545 iso_pu_bacteria 2711768156 2712470160 131
546 iso_pu_bacteria 2842677519 2842679834 131
547 2162886007 SwRhRL2b_contig_1532308 SwRhRL2b_0931.00007210 132
548 2162886007 SwRhRL2b_contig_1817389 SwRhRL2b_0817.00005470 132
549 2162886007 SwRhRL2b_contig_211812 SwRhRL2b_0890.00000320 132
550 2162886007 SwRhRL2b_contig_3815225 SwRhRL2b_0741.00006880 132
551 2162886007 SwRhRL2b_contig_648880 SwRhRL2b_0669.00003490 132
552 2162886007 SwRhRL2b_contig_811231 SwRhRL2b_0269.00008290 132
553 3300001979 JGI24740J21852_10005400 JGI24740J21852_100054005 132
554 3300001989 JGI24739J22299_10000528 JGI24739J22299_100005287 132
555 3300001989 JGI24739J22299_10019327 JGI24739J22299_100193273 132
556 3300002737 JGI25162J39368_1000019 JGI25162J39368_100001969 132
557 3300002737 JGI25162J39368_1000139 JGI25162J39368_100013940 132
558 3300002737 JGI25162J39368_1004044 JGI25162J39368_10040444 132
559 3300002739 JGI25158J39367_1004522 JGI25158J39367_10045222 132
560 3300002739 JGI25158J39367_1014677 JGI25158J39367_10146772 132
561 3300002771 JGI25163J39215_1000008 JGI25163J39215_100000887 132
562 3300002771 JGI25163J39215_1000036 JGI25163J39215_10000369 132
563 3300002771 JGI25163J39215_1001578 JGI25163J39215_10015782 132
564 3300002772 JGI25164J39214_1000011 JGI25164J39214_1000011205 132
565 3300002773 JGI25152J39213_1000725 JGI25152J39213_100072511 132
566 3300002773 JGI25152J39213_1001419 JGI25152J39213_10014192 132
567 3300002773 JGI25152J39213_1001623 JGI25152J39213_10016235 132
568 3300002773 JGI25152J39213_1008926 JGI25152J39213_10089262 132
569 3300002774 JGI25150J39212_1001793 JGI25150J39212_10017933 132
570 3300002774 JGI25150J39212_1009982 JGI25150J39212_10099822 132
571 3300002987 JGI25159J45721_1000435 JGI25159J45721_100043519 132
572 3300002987 JGI25159J45721_1001336 JGI25159J45721_10013362 132
573 3300003187 JGI25151J46595_10000198 JGI25151J46595_1000019867 132
574 3300003187 JGI25151J46595_10000666 JGI25151J46595_1000066632 132
575 3300003187 JGI25151J46595_10000713 JGI25151J46595_1000071324 132
576 3300003187 JGI25151J46595_10000957 JGI25151J46595_1000095713 132
577 3300003187 JGI25151J46595_10002229 JGI25151J46595_100022293 132
578 3300003187 JGI25151J46595_10011933 JGI25151J46595_100119336 132
579 3300003187 JGI25151J46595_10015566 JGI25151J46595_100155665 132
580 3300003187 JGI25151J46595_10018492 JGI25151J46595_100184924 132
581 3300003187 JGI25151J46595_10064364 JGI25151J46595_100643641 132
582 3300003214 JGI25165J46597_1000227 JGI25165J46597_100022748 132
583 3300003215 JGI25153J46596_10002586 JGI25153J46596_100025862 132
584 3300003215 JGI25153J46596_10027801 JGI25153J46596_100278012 132
585 3300003320 rootH2_10001915 rootH2_1000191527 132
586 3300003320 rootH2_10011746 rootH2_100117463 132
587 3300003322 rootL2_10038684 rootL2_100386848 132
588 3300003323 rootH1_10022702 rootH1_100227024 132
589 3300003354 JGI25160J50197_1000093 JGI25160J50197_100009375 132
590 3300003354 JGI25160J50197_1001793 JGI25160J50197_10017932 132
591 3300003354 JGI25160J50197_1002516 JGI25160J50197_10025169 132
592 3300003374 JGI25161J50226_1000443 JGI25161J50226_100044319 132
593 3300003374 JGI25161J50226_1001737 JGI25161J50226_10017372 132
594 3300003374 JGI25161J50226_1006112 JGI25161J50226_10061123 132
595 3300003578 Ga0006562J51391_1020559 Ga0006562J51391_10205596 132
596 3300003751 Ga0055538_1000021 Ga0055538_1000021205 132
597 3300003751 Ga0055538_1000089 Ga0055538_100008948 132
598 3300003752 Ga0055539_1000026 Ga0055539_100002669 132
599 3300003752 Ga0055539_1000133 Ga0055539_100013340 132
600 3300003756 Ga0055533_1000035 Ga0055533_1000035205 132
601 3300003756 Ga0055533_1000136 Ga0055533_100013648 132
602 3300003758 Ga0055532_1008571 Ga0055532_10085712 132
603 3300003759 Ga0055525_1000045 Ga0055525_1000045205 132
604 3300003759 Ga0055525_1000181 Ga0055525_100018148 132
605 3300003760 Ga0055527_1015720 Ga0055527_10157201 132
606 3300003761 Ga0055535_1000128 Ga0055535_100012875 132
607 3300003762 Ga0055542_1000062 Ga0055542_100006212 132
608 3300003771 Ga0055526_1003281 Ga0055526_10032812 132
609 3300003771 Ga0055526_1004616 Ga0055526_10046162 132
610 3300003771 Ga0055526_1025264 Ga0055526_10252642 132
611 3300003773 Ga0055537_1001084 Ga0055537_10010843 132
612 3300003773 Ga0055537_1001152 Ga0055537_100115210 132
613 3300003773 Ga0055537_1005883 Ga0055537_10058833 132
614 3300003773 Ga0055537_1030973 Ga0055537_10309731 132
615 3300003775 Ga0055524_1002106 Ga0055524_100210610 132
616 3300003775 Ga0055524_1002148 Ga0055524_10021482 132
617 3300003775 Ga0055524_1003128 Ga0055524_10031289 132
618 3300003775 Ga0055524_1009474 Ga0055524_10094744 132
619 3300003775 Ga0055524_1064653 Ga0055524_10646531 132
620 3300003781 Ga0055536_1000045 Ga0055536_100004583 132
621 3300003781 Ga0055536_1001927 Ga0055536_100192712 132
622 3300003781 Ga0055536_1029855 Ga0055536_10298552 132
623 3300003784 Ga0055534_1000607 Ga0055534_100060713 132
624 3300003784 Ga0055534_1000680 Ga0055534_100068010 132
625 3300003784 Ga0055534_1000948 Ga0055534_10009489 132
626 3300003784 Ga0055534_1001053 Ga0055534_10010533 132
627 3300003784 Ga0055534_1026656 Ga0055534_10266562 132
628 3300003790 Ga0055528_1001880 Ga0055528_10018803 132
629 3300003790 Ga0055528_1012891 Ga0055528_10128913 132
630 3300003791 Ga0055530_10001484 Ga0055530_100014849 132
631 3300003792 Ga0055540_1003970 Ga0055540_10039707 132
632 3300003792 Ga0055540_1004043 Ga0055540_10040433 132
633 3300003792 Ga0055540_1010254 Ga0055540_10102542 132
634 3300003794 Ga0055531_10002613 Ga0055531_100026133 132
635 3300003841 Ga0055541_1000020 Ga0055541_1000020205 132
636 3300003841 Ga0055541_1000088 Ga0055541_100008848 132
637 3300003856 Ga0058692_1000058 Ga0058692_1000058101 132
638 3300003856 Ga0058692_1000127 Ga0058692_100012743 132
639 3300003856 Ga0058692_1000356 Ga0058692_10003566 132
640 3300003856 Ga0058692_1000889 Ga0058692_10008893 132
641 3300003856 Ga0058692_1001028 Ga0058692_10010286 132
642 3300003856 Ga0058692_1003139 Ga0058692_10031392 132
643 3300003856 Ga0058692_1005468 Ga0058692_10054686 132
644 3300003856 Ga0058692_1006611 Ga0058692_10066111 132
645 3300003856 Ga0058692_1008376 Ga0058692_10083765 132
646 3300003856 Ga0058692_1008738 Ga0058692_10087382 132
647 3300003856 Ga0058692_1009721 Ga0058692_10097211 132
648 3300003856 Ga0058692_1016142 Ga0058692_10161422 132
649 3300003856 Ga0058692_1036964 Ga0058692_10369642 132
650 3300004625 Ga0055543_1001728 Ga0055543_10017289 132
651 3300004625 Ga0055543_1002173 Ga0055543_10021735 132
652 3300004800 Ga0058861_10505237 Ga0058861_105052372 132
653 3300005262 Ga0065165_1003326 Ga0065165_10033263 132
654 3300005262 Ga0065165_1005438 Ga0065165_10054389 132
655 3300005262 Ga0065165_1010696 Ga0065165_10106962 132
656 3300005262 Ga0065165_1116696 Ga0065165_11166961 132
657 3300005262 Ga0065165_1131492 Ga0065165_11314922 132
658 3300005272 Ga0065703_1020318 Ga0065703_10203183 132
659 3300005288 Ga0065714_10166784 Ga0065714_101667842 132
660 3300005289 Ga0065704_10000333 Ga0065704_1000033346 132
661 3300005289 Ga0065704_10000631 Ga0065704_100006316 132
662 3300005289 Ga0065704_10001218 Ga0065704_1000121818 132
663 3300005289 Ga0065704_10003968 Ga0065704_1000396810 132
664 3300005289 Ga0065704_10071586 Ga0065704_100715869 132
665 3300005289 Ga0065704_10086036 Ga0065704_100860364 132
666 3300005289 Ga0065704_10086235 Ga0065704_100862351 132
667 3300005289 Ga0065704_10129206 Ga0065704_101292063 132
668 3300005289 Ga0065704_10141574 Ga0065704_101415742 132
669 3300005327 Ga0070658_10148408 Ga0070658_101484082 132
670 3300005328 Ga0070676_10065117 Ga0070676_100651173 132
671 3300005333 Ga0070677_10324179 Ga0070677_103241791 132
672 3300005343 Ga0070687_100056664 Ga0070687_1000566642 132
673 3300005344 Ga0070661_100546966 Ga0070661_1005469662 132
674 3300005347 Ga0070668_100017378 Ga0070668_1000173786 132
675 3300005347 Ga0070668_101124166 Ga0070668_1011241662 132
676 3300005353 Ga0070669_100006871 Ga0070669_1000068714 132
677 3300005356 Ga0070674_100027809 Ga0070674_1000278092 132
678 3300005364 Ga0070673_100319045 Ga0070673_1003190452 132
679 3300005366 Ga0070659_100282356 Ga0070659_1002823562 132
680 3300005366 Ga0070659_100518883 Ga0070659_1005188831 132
681 3300005367 Ga0070667_100133305 Ga0070667_1001333053 132
682 3300005456 Ga0070678_100417589 Ga0070678_1004175892 132
683 3300005457 Ga0070662_100235146 Ga0070662_1002351462 132
684 3300005548 Ga0070665_100000262 Ga0070665_10000026257 132
685 3300005548 Ga0070665_100010362 Ga0070665_1000103629 132
686 3300005548 Ga0070665_100070998 Ga0070665_1000709986 132
687 3300005548 Ga0070665_100775281 Ga0070665_1007752812 132
688 3300005577 Ga0068857_100000082 Ga0068857_10000008236 132
689 3300005577 Ga0068857_101000606 Ga0068857_1010006062 132
690 3300005616 Ga0068852_100320257 Ga0068852_1003202572 132
691 3300005616 Ga0068852_100805233 Ga0068852_1008052332 132
692 3300005834 Ga0068851_10001818 Ga0068851_100018189 132
693 3300005840 Ga0068870_11119288 Ga0068870_111192881 132
694 3300006038 Ga0075365_10093978 Ga0075365_100939783 132
695 3300006048 Ga0075363_100698181 Ga0075363_1006981811 132
696 3300006051 Ga0075364_10004261 Ga0075364_100042614 132
697 3300006051 Ga0075364_10019925 Ga0075364_100199252 132
698 3300006051 Ga0075364_10039524 Ga0075364_100395244 132
699 3300006051 Ga0075364_10090303 Ga0075364_100903033 132
700 3300006051 Ga0075364_10122334 Ga0075364_101223342 132
701 3300006051 Ga0075364_10139974 Ga0075364_101399742 132
702 3300006051 Ga0075364_10141236 Ga0075364_101412362 132
703 3300006051 Ga0075364_10229103 Ga0075364_102291032 132
704 3300006051 Ga0075364_10252742 Ga0075364_102527422 132
705 3300006051 Ga0075364_10669159 Ga0075364_106691591 132
706 3300006058 Ga0075432_10045356 Ga0075432_100453563 132
707 3300006177 Ga0075362_10000528 Ga0075362_100005288 132
708 3300006177 Ga0075362_10002538 Ga0075362_100025387 132
709 3300006177 Ga0075362_10017911 Ga0075362_100179114 132
710 3300006186 Ga0075369_10155822 Ga0075369_101558222 132
711 3300006195 Ga0075366_10036012 Ga0075366_100360124 132
712 3300006195 Ga0075366_10255351 Ga0075366_102553512 132
713 3300006353 Ga0075370_10004045 Ga0075370_100040455 132
714 3300006353 Ga0075370_10016704 Ga0075370_100167047 132
715 3300006353 Ga0075370_10019421 Ga0075370_100194215 132
716 3300006353 Ga0075370_10367422 Ga0075370_103674222 132
717 3300006946 Ga0079104_1000035 Ga0079104_1000035180 132
718 3300006946 Ga0079104_1000274 Ga0079104_100027474 132
719 3300006946 Ga0079104_1000343 Ga0079104_100034322 132
720 3300006946 Ga0079104_1000464 Ga0079104_100046425 132
721 3300006946 Ga0079104_1000819 Ga0079104_100081915 132
722 3300006946 Ga0079104_1001653 Ga0079104_100165311 132
723 3300006946 Ga0079104_1001797 Ga0079104_100179716 132
724 3300006946 Ga0079104_1003555 Ga0079104_10035559 132
725 3300006946 Ga0079104_1015838 Ga0079104_10158383 132
726 3300006946 Ga0079104_1022141 Ga0079104_10221413 132
727 3300006946 Ga0079104_1022902 Ga0079104_10229022 132
728 3300006946 Ga0079104_1024210 Ga0079104_10242102 132
729 3300006946 Ga0079104_1051905 Ga0079104_10519052 132
730 3300006946 Ga0079104_1066673 Ga0079104_10666731 132
731 3300006948 Ga0099826_10000013 Ga0099826_10000013108 132
732 3300006948 Ga0099826_10481446 Ga0099826_104814462 132
733 3300009011 Ga0105251_10002660 Ga0105251_100026602 132
734 3300009011 Ga0105251_10002718 Ga0105251_1000271814 132
735 3300009011 Ga0105251_10002876 Ga0105251_1000287613 132
736 3300009011 Ga0105251_10007342 Ga0105251_100073426 132
737 3300009011 Ga0105251_10008589 Ga0105251_100085895 132
738 3300009011 Ga0105251_10011774 Ga0105251_100117746 132
739 3300009011 Ga0105251_10025606 Ga0105251_100256063 132
740 3300009011 Ga0105251_10027110 Ga0105251_100271104 132
741 3300009011 Ga0105251_10035985 Ga0105251_100359852 132
742 3300009011 Ga0105251_10079343 Ga0105251_100793431 132
743 3300009011 Ga0105251_10098773 Ga0105251_100987732 132
744 3300009011 Ga0105251_10110569 Ga0105251_101105692 132
745 3300009011 Ga0105251_10213105 Ga0105251_102131052 132
746 3300009036 Ga0105244_10000117 Ga0105244_1000011778 132
747 3300009036 Ga0105244_10000123 Ga0105244_1000012336 132
748 3300009036 Ga0105244_10001091 Ga0105244_100010912 132
749 3300009036 Ga0105244_10001372 Ga0105244_1000137216 132
750 3300009036 Ga0105244_10002148 Ga0105244_1000214813 132
751 3300009036 Ga0105244_10002204 Ga0105244_100022049 132
752 3300009036 Ga0105244_10003085 Ga0105244_100030856 132
753 3300009036 Ga0105244_10014092 Ga0105244_100140923 132
754 3300009036 Ga0105244_10025906 Ga0105244_100259062 132
755 3300009036 Ga0105244_10038004 Ga0105244_100380043 132
756 3300009036 Ga0105244_10065064 Ga0105244_100650641 132
757 3300009036 Ga0105244_10124884 Ga0105244_101248842 132
758 3300009036 Ga0105244_10144566 Ga0105244_101445662 132
759 3300009036 Ga0105244_10206087 Ga0105244_102060872 132
760 3300009092 Ga0105250_10000414 Ga0105250_1000041430 132
761 3300009092 Ga0105250_10000650 Ga0105250_1000065020 132
762 3300009092 Ga0105250_10000917 Ga0105250_100009173 132
763 3300009092 Ga0105250_10001186 Ga0105250_1000118611 132
764 3300009092 Ga0105250_10002778 Ga0105250_100027783 132
765 3300009092 Ga0105250_10002792 Ga0105250_1000279210 132
766 3300009092 Ga0105250_10004534 Ga0105250_100045345 132
767 3300009092 Ga0105250_10065924 Ga0105250_100659243 132
768 3300009092 Ga0105250_10067681 Ga0105250_100676812 132
769 3300009092 Ga0105250_10077887 Ga0105250_100778872 132
770 3300009092 Ga0105250_10272096 Ga0105250_102720962 132
771 3300009093 Ga0105240_10335586 Ga0105240_103355862 132
772 3300009093 Ga0105240_11260892 Ga0105240_112608922 132
773 3300009101 Ga0105247_10000086 Ga0105247_1000008654 132
774 3300009148 Ga0105243_10092126 Ga0105243_100921263 132
775 3300009148 Ga0105243_12744318 Ga0105243_127443181 132
776 3300009174 Ga0105241_10000001 Ga0105241_10000001348 132
777 3300009174 Ga0105241_12690589 Ga0105241_126905891 132
778 3300009176 Ga0105242_10002597 Ga0105242_1000259711 132
779 3300009545 Ga0105237_10395502 Ga0105237_103955022 132
780 3300011119 Ga0105246_10073988 Ga0105246_100739883 132
781 3300011119 Ga0105246_10155285 Ga0105246_101552852 132
782 3300011119 Ga0105246_10493964 Ga0105246_104939642 132
783 3300011119 Ga0105246_11291391 Ga0105246_112913912 132
784 3300012502 Ga0157347_1033606 Ga0157347_10336062 132
785 3300013100 Ga0157373_10000200 Ga0157373_1000020032 132
786 3300013100 Ga0157373_10005859 Ga0157373_100058598 132
787 3300013100 Ga0157373_10029150 Ga0157373_100291502 132
788 3300013100 Ga0157373_10031860 Ga0157373_100318606 132
789 3300013100 Ga0157373_10046256 Ga0157373_100462562 132
790 3300013100 Ga0157373_10174876 Ga0157373_101748763 132
791 3300013100 Ga0157373_10258326 Ga0157373_102583262 132
792 3300013102 Ga0157371_10000156 Ga0157371_1000015657 132
793 3300013102 Ga0157371_10003023 Ga0157371_1000302313 132
794 3300013102 Ga0157371_10006525 Ga0157371_1000652511 132
795 3300013102 Ga0157371_10016466 Ga0157371_100164665 132
796 3300013102 Ga0157371_10028186 Ga0157371_100281866 132
797 3300013102 Ga0157371_10049077 Ga0157371_100490773 132
798 3300013102 Ga0157371_10146989 Ga0157371_101469892 132
799 3300013102 Ga0157371_10149671 Ga0157371_101496711 132
800 3300013102 Ga0157371_10381989 Ga0157371_103819892 132
801 3300013102 Ga0157371_10503224 Ga0157371_105032241 132
802 3300013104 Ga0157370_10000814 Ga0157370_1000081435 132
803 3300013104 Ga0157370_10003193 Ga0157370_100031938 132
804 3300013104 Ga0157370_10003562 Ga0157370_1000356214 132
805 3300013104 Ga0157370_10123676 Ga0157370_101236763 132
806 3300013104 Ga0157370_10181136 Ga0157370_101811362 132
807 3300013104 Ga0157370_11460098 Ga0157370_114600982 132
808 3300013105 Ga0157369_10002007 Ga0157369_1000200716 132
809 3300013105 Ga0157369_10024085 Ga0157369_100240857 132
810 3300013296 Ga0157374_10002106 Ga0157374_100021067 132
811 3300013296 Ga0157374_11778966 Ga0157374_117789662 132
812 3300013306 Ga0163162_10071042 Ga0163162_100710426 132
813 3300013306 Ga0163162_10071964 Ga0163162_100719642 132
814 3300013306 Ga0163162_10140414 Ga0163162_101404142 132
815 3300013306 Ga0163162_10259980 Ga0163162_102599803 132
816 3300013307 Ga0157372_10001630 Ga0157372_100016308 132
817 3300013307 Ga0157372_10001655 Ga0157372_1000165512 132
818 3300013307 Ga0157372_10003992 Ga0157372_100039929 132
819 3300013307 Ga0157372_10056434 Ga0157372_100564346 132
820 3300013307 Ga0157372_10117318 Ga0157372_101173182 132
821 3300013307 Ga0157372_10157175 Ga0157372_101571753 132
822 3300013307 Ga0157372_10457502 Ga0157372_104575022 132
823 3300013308 Ga0157375_11572794 Ga0157375_115727942 132
824 3300014497 Ga0182008_10000877 Ga0182008_1000087713 132
825 3300014497 Ga0182008_10001330 Ga0182008_100013308 132
826 3300014497 Ga0182008_10009021 Ga0182008_100090215 132
827 3300014497 Ga0182008_10012011 Ga0182008_100120115 132
828 3300014497 Ga0182008_10081751 Ga0182008_100817513 132
829 3300014497 Ga0182008_10310770 Ga0182008_103107702 132
830 3300015261 Ga0182006_1000022 Ga0182006_1000022140 132
831 3300015261 Ga0182006_1039514 Ga0182006_10395143 132
832 3300015261 Ga0182006_1045596 Ga0182006_10455961 132
833 3300015261 Ga0182006_1049881 Ga0182006_10498812 132
834 3300015261 Ga0182006_1050636 Ga0182006_10506362 132
835 3300015261 Ga0182006_1109871 Ga0182006_11098712 132
836 3300015262 Ga0182007_10006154 Ga0182007_100061548 132
837 3300015262 Ga0182007_10016771 Ga0182007_100167712 132
838 3300015679 Ga0183366_1001 Ga0183366_1001904 132
839 3300015680 Ga0183370_1001 Ga0183370_1001904 132
840 3300015683 Ga0183362_10001 Ga0183362_10001313 132
841 3300015685 Ga0183369_1001 Ga0183369_1001904 132
842 3300015687 Ga0183368_1001 Ga0183368_1001904 132
843 3300017792 Ga0163161_10000001 Ga0163161_100000011799 132
844 3300017792 Ga0163161_10019762 Ga0163161_100197625 132
845 3300017792 Ga0163161_10040757 Ga0163161_100407576 132
846 3300017792 Ga0163161_10055207 Ga0163161_100552073 132
847 3300021384 Ga0213876_10000086 Ga0213876_1000008667 132
848 3300025207 Ga0209760_100004 Ga0209760_100004201 132
849 3300025207 Ga0209760_101358 Ga0209760_1013583 132
850 3300025208 Ga0209436_101095 Ga0209436_1010953 132
851 3300025208 Ga0209436_103393 Ga0209436_1033932 132
852 3300025224 Ga0209784_100001 Ga0209784_1000012388 132
853 3300025224 Ga0209784_100071 Ga0209784_100071113 132
854 3300025225 Ga0209566_100001 Ga0209566_1000012388 132
855 3300025225 Ga0209566_100004 Ga0209566_100004111 132
856 3300025226 Ga0209674_100002 Ga0209674_1000022388 132
857 3300025226 Ga0209674_100006 Ga0209674_100006111 132
858 3300025228 Ga0209672_100319 Ga0209672_10031935 132
859 3300025229 Ga0209147_101404 Ga0209147_1014049 132
860 3300025230 Ga0209563_100002 Ga0209563_100002923 132
861 3300025230 Ga0209563_100104 Ga0209563_100104113 132
862 3300025231 Ga0207427_100012 Ga0207427_100012428 132
863 3300025231 Ga0207427_100308 Ga0207427_10030823 132
864 3300025233 Ga0209437_100001 Ga0209437_100001923 132
865 3300025233 Ga0209437_100035 Ga0209437_100035357 132
866 3300025233 Ga0209437_100158 Ga0209437_100158113 132
867 3300025242 Ga0209258_100154 Ga0209258_100154165 132
868 3300025245 Ga0207425_1000215 Ga0207425_100021538 132
869 3300025245 Ga0207425_1002841 Ga0207425_10028413 132
870 3300025245 Ga0207425_1004676 Ga0207425_10046763 132
871 3300025245 Ga0207425_1013759 Ga0207425_10137592 132
872 3300025245 Ga0207425_1024413 Ga0207425_10244131 132
873 3300025245 Ga0207425_1026374 Ga0207425_10263743 132
874 3300025253 Ga0209677_100002 Ga0209677_100002923 132
875 3300025253 Ga0209677_100064 Ga0209677_100064113 132
876 3300025254 Ga0209148_1000145 Ga0209148_1000145164 132
877 3300025258 Ga0209129_1000018 Ga0209129_1000018271 132
878 3300025258 Ga0209129_1000054 Ga0209129_1000054200 132
879 3300025258 Ga0209129_1000103 Ga0209129_100010354 132
880 3300025258 Ga0209129_1009530 Ga0209129_10095303 132
881 3300025261 Ga0209233_1000005 Ga0209233_1000005111 132
882 3300025261 Ga0209233_1001009 Ga0209233_10010099 132
883 3300025263 Ga0209565_1000086 Ga0209565_1000086137 132
884 3300025263 Ga0209565_1000317 Ga0209565_100031715 132
885 3300025263 Ga0209565_1001154 Ga0209565_10011547 132
886 3300025263 Ga0209565_1003106 Ga0209565_10031065 132
887 3300025263 Ga0209565_1005158 Ga0209565_10051583 132
888 3300025272 Ga0209455_1000399 Ga0209455_100039911 132
889 3300025273 Ga0209673_1000168 Ga0209673_100016897 132
890 3300025273 Ga0209673_1001793 Ga0209673_100179312 132
891 3300025273 Ga0209673_1009768 Ga0209673_10097681 132
892 3300025284 Ga0209130_1000206 Ga0209130_100020622 132
893 3300025284 Ga0209130_1001133 Ga0209130_10011335 132
894 3300025284 Ga0209130_1001531 Ga0209130_10015319 132
895 3300025284 Ga0209130_1001936 Ga0209130_10019363 132
896 3300025284 Ga0209130_1013485 Ga0209130_10134853 132
897 3300025291 Ga0209675_1000193 Ga0209675_100019356 132
898 3300025291 Ga0209675_1000548 Ga0209675_100054833 132
899 3300025291 Ga0209675_1002487 Ga0209675_10024876 132
900 3300025291 Ga0209675_1002730 Ga0209675_10027303 132
901 3300025291 Ga0209675_1005202 Ga0209675_10052024 132
902 3300025291 Ga0209675_1019667 Ga0209675_10196672 132
903 3300025292 Ga0209676_1000053 Ga0209676_1000053224 132
904 3300025292 Ga0209676_1000103 Ga0209676_1000103135 132
905 3300025292 Ga0209676_1004587 Ga0209676_10045874 132
906 3300025292 Ga0209676_1004993 Ga0209676_100499310 132
907 3300025294 Ga0209025_1000018 Ga0209025_1000018536 132
908 3300025294 Ga0209025_1000034 Ga0209025_100003427 132
909 3300025294 Ga0209025_1000059 Ga0209025_1000059150 132
910 3300025294 Ga0209025_1000073 Ga0209025_100007370 132
911 3300025294 Ga0209025_1000093 Ga0209025_100009351 132
912 3300025294 Ga0209025_1000201 Ga0209025_100020138 132
913 3300025294 Ga0209025_1003493 Ga0209025_10034939 132
914 3300025294 Ga0209025_1023935 Ga0209025_10239352 132
915 3300025294 Ga0209025_1038171 Ga0209025_10381713 132
916 3300025294 Ga0209025_1062942 Ga0209025_10629423 132
917 3300025295 Ga0209564_1000301 Ga0209564_1000301113 132
918 3300025295 Ga0209564_1000408 Ga0209564_100040831 132
919 3300025295 Ga0209564_1001285 Ga0209564_100128524 132
920 3300025295 Ga0209564_1003017 Ga0209564_100301710 132
921 3300025295 Ga0209564_1004316 Ga0209564_10043169 132
922 3300025297 Ga0209758_1000034 Ga0209758_1000034238 132
923 3300025297 Ga0209758_1011927 Ga0209758_10119273 132
924 3300025297 Ga0209758_1034934 Ga0209758_10349343 132
925 3300025297 Ga0209758_1052022 Ga0209758_10520222 132
926 3300025297 Ga0209758_1114102 Ga0209758_11141022 132
927 3300025298 Ga0209050_1000012 Ga0209050_1000012519 132
928 3300025298 Ga0209050_1001244 Ga0209050_100124415 132
929 3300025298 Ga0209050_1007544 Ga0209050_10075443 132
930 3300025299 Ga0209256_1000066 Ga0209256_1000066202 132
931 3300025299 Ga0209256_1000086 Ga0209256_100008671 132
932 3300025299 Ga0209256_1001063 Ga0209256_100106325 132
933 3300025299 Ga0209256_1003254 Ga0209256_100325410 132
934 3300025299 Ga0209256_1085940 Ga0209256_10859402 132
935 3300025302 Ga0207426_1000058 Ga0207426_1000058378 132
936 3300025302 Ga0207426_1000067 Ga0207426_1000067140 132
937 3300025302 Ga0207426_1000156 Ga0207426_1000156134 132
938 3300025303 Ga0209051_1000019 Ga0209051_1000019439 132
939 3300025303 Ga0209051_1001450 Ga0209051_100145010 132
940 3300025303 Ga0209051_1001589 Ga0209051_100158911 132
941 3300025303 Ga0209051_1002728 Ga0209051_100272816 132
942 3300025303 Ga0209051_1053241 Ga0209051_10532412 132
943 3300025303 Ga0209051_1067377 Ga0209051_10673772 132
944 3300025303 Ga0209051_1075533 Ga0209051_10755332 132
945 3300025304 Ga0209257_1000024 Ga0209257_1000024465 132
946 3300025304 Ga0209257_1003493 Ga0209257_100349316 132
947 3300025321 Ga0207656_10017790 Ga0207656_100177902 132
948 3300025711 Ga0207696_1000001 Ga0207696_10000011890 132
949 3300025711 Ga0207696_1000070 Ga0207696_100007084 132
950 3300025711 Ga0207696_1000170 Ga0207696_100017015 132
951 3300025711 Ga0207696_1000537 Ga0207696_10005375 132
952 3300025711 Ga0207696_1001040 Ga0207696_10010404 132
953 3300025711 Ga0207696_1002538 Ga0207696_10025386 132
954 3300025711 Ga0207696_1004683 Ga0207696_10046833 132
955 3300025711 Ga0207696_1007450 Ga0207696_10074504 132
956 3300025711 Ga0207696_1010764 Ga0207696_10107643 132
957 3300025711 Ga0207696_1012417 Ga0207696_10124171 132
958 3300025711 Ga0207696_1039647 Ga0207696_10396472 132
959 3300025728 Ga0207655_1000001 Ga0207655_1000001898 132
960 3300025728 Ga0207655_1000009 Ga0207655_1000009161 132
961 3300025728 Ga0207655_1000046 Ga0207655_1000046274 132
962 3300025728 Ga0207655_1000071 Ga0207655_1000071187 132
963 3300025728 Ga0207655_1000089 Ga0207655_1000089163 132
964 3300025728 Ga0207655_1000215 Ga0207655_100021552 132
965 3300025728 Ga0207655_1000363 Ga0207655_100036332 132
966 3300025728 Ga0207655_1000506 Ga0207655_100050613 132
967 3300025728 Ga0207655_1006208 Ga0207655_10062083 132
968 3300025728 Ga0207655_1015575 Ga0207655_10155753 132
969 3300025728 Ga0207655_1043112 Ga0207655_10431123 132
970 3300025728 Ga0207655_1060447 Ga0207655_10604473 132
971 3300025735 Ga0207713_1000001 Ga0207713_1000001655 132
972 3300025735 Ga0207713_1000004 Ga0207713_1000004103 132
973 3300025735 Ga0207713_1000018 Ga0207713_1000018299 132
974 3300025735 Ga0207713_1000120 Ga0207713_100012077 132
975 3300025735 Ga0207713_1002665 Ga0207713_10026651 132
976 3300025735 Ga0207713_1004886 Ga0207713_10048866 132
977 3300025735 Ga0207713_1018235 Ga0207713_10182352 132
978 3300025735 Ga0207713_1018975 Ga0207713_10189753 132
979 3300025735 Ga0207713_1030329 Ga0207713_10303293 132
980 3300025735 Ga0207713_1035127 Ga0207713_10351273 132
981 3300025735 Ga0207713_1035833 Ga0207713_10358333 132
982 3300025735 Ga0207713_1071665 Ga0207713_10716652 132
983 3300025735 Ga0207713_1089201 Ga0207713_10892012 132
984 3300025900 Ga0207710_10000233 Ga0207710_1000023317 132
985 3300025911 Ga0207654_10000004 Ga0207654_10000004375 132
986 3300025913 Ga0207695_10084151 Ga0207695_100841513 132
987 3300025918 Ga0207662_10099146 Ga0207662_100991463 132
988 3300025920 Ga0207649_10566197 Ga0207649_105661972 132
989 3300025923 Ga0207681_10011213 Ga0207681_100112136 132
990 3300025924 Ga0207694_10974166 Ga0207694_109741662 132
991 3300025932 Ga0207690_10298468 Ga0207690_102984682 132
992 3300025933 Ga0207706_10174918 Ga0207706_101749183 132
993 3300025934 Ga0207686_10001018 Ga0207686_1000101811 132
994 3300025937 Ga0207669_10027614 Ga0207669_100276142 132
995 3300025960 Ga0207651_10180586 Ga0207651_101805862 132
996 3300025972 Ga0207668_10007961 Ga0207668_100079615 132
997 3300025972 Ga0207668_10470819 Ga0207668_104708192 132
998 3300025981 Ga0207640_10390751 Ga0207640_103907512 132
999 3300025986 Ga0207658_10566998 Ga0207658_105669982 132
1000 3300026116 Ga0207674_10000712 Ga0207674_1000071242 132
1001 3300026116 Ga0207674_10059041 Ga0207674_100590415 132
1002 3300026116 Ga0207674_10353568 Ga0207674_103535682 132
1003 3300026118 Ga0207675_100198346 Ga0207675_1001983462 132
1004 3300026121 Ga0207683_10049183 Ga0207683_100491834 132
1005 3300026121 Ga0207683_10484361 Ga0207683_104843612 132
1006 3300026142 Ga0207698_10313763 Ga0207698_103137633 132
1007 3300027111 Ga0209281_1000001 Ga0209281_10000011037 132
1008 3300027111 Ga0209281_1000003 Ga0209281_1000003982 132
1009 3300027111 Ga0209281_1000114 Ga0209281_100011458 132
1010 3300027111 Ga0209281_1000180 Ga0209281_1000180127 132
1011 3300027111 Ga0209281_1000229 Ga0209281_100022993 132
1012 3300027111 Ga0209281_1000267 Ga0209281_100026721 132
1013 3300027111 Ga0209281_1000288 Ga0209281_100028888 132
1014 3300027111 Ga0209281_1000383 Ga0209281_100038349 132
1015 3300027111 Ga0209281_1000722 Ga0209281_10007222 132
1016 3300027111 Ga0209281_1001917 Ga0209281_100191712 132
1017 3300027111 Ga0209281_1002477 Ga0209281_100247710 132
1018 3300027252 Ga0209973_1037991 Ga0209973_10379911 132
1019 3300027312 Ga0209371_1000001 Ga0209371_1000001824 132
1020 3300027312 Ga0209371_1000010 Ga0209371_1000010225 132
1021 3300027312 Ga0209371_1000020 Ga0209371_100002086 132
1022 3300027312 Ga0209371_1000081 Ga0209371_1000081160 132
1023 3300027312 Ga0209371_1000085 Ga0209371_1000085146 132
1024 3300027312 Ga0209371_1000086 Ga0209371_100008617 132
1025 3300027312 Ga0209371_1000167 Ga0209371_1000167101 132
1026 3300027312 Ga0209371_1000321 Ga0209371_100032156 132
1027 3300027312 Ga0209371_1000349 Ga0209371_100034926 132
1028 3300027312 Ga0209371_1000616 Ga0209371_100061634 132
1029 3300027312 Ga0209371_1001073 Ga0209371_10010739 132
1030 3300027312 Ga0209371_1002095 Ga0209371_10020958 132
1031 3300027312 Ga0209371_1002126 Ga0209371_100212615 132
1032 3300027312 Ga0209371_1002299 Ga0209371_10022993 132
1033 3300027312 Ga0209371_1002407 Ga0209371_100240712 132
1034 3300027312 Ga0209371_1002837 Ga0209371_10028379 132
1035 3300027312 Ga0209371_1003155 Ga0209371_10031553 132
1036 3300027312 Ga0209371_1003489 Ga0209371_10034892 132
1037 3300027312 Ga0209371_1003616 Ga0209371_10036167 132
1038 3300027312 Ga0209371_1021256 Ga0209371_10212562 132
1039 3300027312 Ga0209371_1046577 Ga0209371_10465772 132
1040 3300027312 Ga0209371_1047234 Ga0209371_10472342 132
1041 3300027312 Ga0209371_1062786 Ga0209371_10627862 132
1042 3300027543 Ga0209999_1043668 Ga0209999_10436682 132
1043 3300027617 Ga0210002_1020944 Ga0210002_10209442 132
1044 3300027666 Ga0209282_1000043 Ga0209282_100004317 132
1045 3300027682 Ga0209971_1001163 Ga0209971_10011633 132
1046 3300027682 Ga0209971_1169283 Ga0209971_11692831 132
1047 3300027876 Ga0209974_10010341 Ga0209974_100103412 132
1048 3300028379 Ga0268266_10000282 Ga0268266_1000028230 132
1049 3300028379 Ga0268266_10025201 Ga0268266_100252015 132
1050 3300028379 Ga0268266_11456353 Ga0268266_114563532 132
1051 3300028653 Ga0265323_10010795 Ga0265323_100107955 132
1052 3300028794 Ga0307515_10000626 Ga0307515_1000062656 132
1053 3300028794 Ga0307515_10001303 Ga0307515_1000130310 132
1054 3300028794 Ga0307515_10032622 Ga0307515_100326226 132
1055 3300030500 Ga0268256_1000001 Ga0268256_10000011816 132
1056 3300030500 Ga0268256_1000003 Ga0268256_1000003795 132
1057 3300030500 Ga0268256_1000048 Ga0268256_1000048146 132
1058 3300030500 Ga0268256_1000092 Ga0268256_100009219 132
1059 3300030500 Ga0268256_1000114 Ga0268256_100011461 132
1060 3300030500 Ga0268256_1000124 Ga0268256_100012413 132
1061 3300030500 Ga0268256_1000175 Ga0268256_100017523 132
1062 3300030500 Ga0268256_1000532 Ga0268256_100053215 132
1063 3300030500 Ga0268256_1000920 Ga0268256_10009203 132
1064 3300030500 Ga0268256_1001027 Ga0268256_10010278 132
1065 3300030500 Ga0268256_1001435 Ga0268256_10014357 132
1066 3300030500 Ga0268256_1001749 Ga0268256_100174911 132
1067 3300030500 Ga0268256_1002830 Ga0268256_10028303 132
1068 3300030500 Ga0268256_1003160 Ga0268256_10031603 132
1069 3300030500 Ga0268256_1004676 Ga0268256_10046763 132
1070 3300030500 Ga0268256_1007695 Ga0268256_10076954 132
1071 3300030500 Ga0268256_1017912 Ga0268256_10179123 132
1072 3300030500 Ga0268256_1018423 Ga0268256_10184232 132
1073 3300030500 Ga0268256_1023884 Ga0268256_10238842 132
1074 3300030500 Ga0268256_1052542 Ga0268256_10525422 132
1075 3300030745 Ga0316182_1103194 Ga0316182_11031945 132
1076 3300031235 Ga0265330_10004252 Ga0265330_100042526 132
1077 3300031238 Ga0265332_10019389 Ga0265332_100193892 132
1078 3300031239 Ga0265328_10327217 Ga0265328_103272171 132
1079 3300031250 Ga0265331_10003913 Ga0265331_100039134 132
1080 3300031250 Ga0265331_10105558 Ga0265331_101055582 132
1081 3300031251 Ga0265327_10000133 Ga0265327_1000013351 132
1082 3300031251 Ga0265327_10015025 Ga0265327_100150251 132
1083 3300031251 Ga0265327_10025409 Ga0265327_100254094 132
1084 3300031344 Ga0265316_10147424 Ga0265316_101474243 132
1085 3300031548 Ga0307408_100009699 Ga0307408_1000096996 132
1086 3300031548 Ga0307408_100014538 Ga0307408_1000145387 132
1087 3300031548 Ga0307408_100033660 Ga0307408_1000336602 132
1088 3300031548 Ga0307408_100161444 Ga0307408_1001614443 132
1089 3300031548 Ga0307408_100323091 Ga0307408_1003230912 132
1090 3300031649 Ga0307514_10000711 Ga0307514_100007113 132
1091 3300031649 Ga0307514_10173650 Ga0307514_101736502 132
1092 3300031665 Ga0316575_10024298 Ga0316575_100242982 132
1093 3300031691 Ga0316579_10046342 Ga0316579_100463422 132
1094 3300031711 Ga0265314_10008686 Ga0265314_100086867 132
1095 3300031727 Ga0316576_10557731 Ga0316576_105577312 132
1096 3300031728 Ga0316578_10079152 Ga0316578_100791522 132
1097 3300031728 Ga0316578_10118438 Ga0316578_101184383 132
1098 3300031731 Ga0307405_10144393 Ga0307405_101443931 132
1099 3300031731 Ga0307405_10180638 Ga0307405_101806383 132
1100 3300031731 Ga0307405_10362857 Ga0307405_103628573 132
1101 3300031731 Ga0307405_10427102 Ga0307405_104271022 132
1102 3300031731 Ga0307405_10874541 Ga0307405_108745412 132
1103 3300031731 Ga0307405_10897101 Ga0307405_108971012 132
1104 3300031733 Ga0316577_10041516 Ga0316577_100415162 132
1105 3300031733 Ga0316577_10057099 Ga0316577_100570992 132
1106 3300031733 Ga0316577_10062977 Ga0316577_100629773 132
1107 3300031824 Ga0307413_10347186 Ga0307413_103471862 132
1108 3300031901 Ga0307406_10003334 Ga0307406_1000333410 132
1109 3300031901 Ga0307406_10007375 Ga0307406_100073755 132
1110 3300031901 Ga0307406_10029379 Ga0307406_100293793 132
1111 3300031901 Ga0307406_10109880 Ga0307406_101098803 132
1112 3300031901 Ga0307406_10319528 Ga0307406_103195282 132
1113 3300031911 Ga0307412_10128246 Ga0307412_101282462 132
1114 3300031911 Ga0307412_10242227 Ga0307412_102422273 132
1115 3300031911 Ga0307412_10423382 Ga0307412_104233822 132
1116 3300031911 Ga0307412_12210232 Ga0307412_122102321 132
1117 3300031995 Ga0307409_100887652 Ga0307409_1008876522 132
1118 3300032002 Ga0307416_100408334 Ga0307416_1004083342 132
1119 3300032002 Ga0307416_100431182 Ga0307416_1004311822 132
1120 3300032002 Ga0307416_101951500 Ga0307416_1019515002 132
1121 3300032002 Ga0307416_102326572 Ga0307416_1023265722 132
1122 3300032004 Ga0307414_10177984 Ga0307414_101779843 132
1123 3300032004 Ga0307414_10553731 Ga0307414_105537311 132
1124 3300032004 Ga0307414_11822512 Ga0307414_118225122 132
1125 3300032005 Ga0307411_10201421 Ga0307411_102014212 132
1126 3300032139 Ga0316580_10045072 Ga0316580_100450721 132
1127 3300032139 Ga0316580_10237488 Ga0316580_102374881 132
1128 3300033180 Ga0307510_10232500 Ga0307510_102325002 132
1129 3300035398 Ga0316574_0019624 Ga0316574_0019624_3080_3496 132
1130 3300036647 Ga0316582_0012653 Ga0316582_0012653_2045_2467 132
1131 3300036647 Ga0316582_0139520 Ga0316582_0139520_1015_1431 132
1132 3300036647 Ga0316582_0254001 Ga0316582_0254001_328_744 132
1133 3300036712 Ga0316584_0003227 Ga0316584_0003227_9326_9748 132
1134 3300036712 Ga0316584_0007399 Ga0316584_0007399_5260_5676 132
1135 3300036712 Ga0316584_0058252 Ga0316584_0058252_976_1392 132
1136 3300036712 Ga0316584_0137779 Ga0316584_0137779_706_1122 132
1137 3300037471 Ga0395905_0229337 Ga0395905_0229337_1138_1545 132
1138 3300037588 Ga0316581_0035288 Ga0316581_0035288_867_1283 132
1139 3300039437 Ga0436365_1037676 Ga0436365_1037676_135427_135831 132
1140 3300039447 Ga0436361_1010587 Ga0436361_1010587_12_419 132
1141 3300041404 Ga0439436_0002994 Ga0439436_0002994_4436_4852 132
1142 3300041405 Ga0439438_000001 Ga0439438_000001_448112_448516 132
1143 3300041405 Ga0439438_001188 Ga0439438_001188_8671_9075 132
1144 3300041405 Ga0439438_001930 Ga0439438_001930_1184_1588 132
1145 3300041405 Ga0439438_008658 Ga0439438_008658_1027_1431 132
1146 3300041405 Ga0439438_034767 Ga0439438_034767_459_863 132
1147 3300041406 Ga0439439_0003042 Ga0439439_0003042_1213_1629 132
1148 3300041406 Ga0439439_0014282 Ga0439439_0014282_742_1158 132
1149 3300041407 Ga0439447_004155 Ga0439447_004155_2023_2427 132
1150 3300041407 Ga0439447_005376 Ga0439447_005376_2634_3038 132
1151 3300041407 Ga0439447_028060 Ga0439447_028060_702_1118 132
1152 3300041411 Ga0439466_0000003 Ga0439466_0000003_52258_52662 132
1153 3300041411 Ga0439466_0218156 Ga0439466_0218156_90_506 132
1154 3300041451 Ga0451791_0103488 Ga0451791_0103488_71_469 132
1155 3300041452 Ga0451793_1583412 Ga0451793_1583412_328_744 132
1156 3300041456 Ga0451795_0579443 Ga0451795_0579443_287_703 132
1157 3300041460 Ga0451802_0881816 Ga0451802_0881816_158_562 132
1158 3300041461 Ga0451805_033409 Ga0451805_033409_88_492 132
1159 3300041503 Ga0451847_0790351 Ga0451847_0790351_78_494 132
1160 3300041512 Ga0451853_2599509 Ga0451853_2599509_724_1128 132
1161 3300041997 Ga0439431_0276272 Ga0439431_0276272_70_486 132
1162 3300041999 Ga0439433_0024432 Ga0439433_0024432_622_1038 132
1163 3300041999 Ga0439433_0038479 Ga0439433_0038479_362_778 132
1164 3300042002 Ga0439442_002961 Ga0439442_002961_934_1350 132
1165 3300042004 Ga0439445_0000347 Ga0439445_0000347_319_735 132
1166 3300042004 Ga0439445_0003104 Ga0439445_0003104_1543_1947 132
1167 3300042004 Ga0439445_0200499 Ga0439445_0200499_18_434 132
1168 3300042005 Ga0439448_0244134 Ga0439448_0244134_57_479 132
1169 3300042006 Ga0439432_000662 Ga0439432_000662_561_977 132
1170 3300042006 Ga0439432_008144 Ga0439432_008144_2488_2904 132
1171 3300042006 Ga0439432_010037 Ga0439432_010037_144_548 132
1172 3300042006 Ga0439432_010592 Ga0439432_010592_2705_3109 132
1173 3300042006 Ga0439432_014689 Ga0439432_014689_1901_2305 132
1174 3300042006 Ga0439432_201852 Ga0439432_201852_25_429 132
1175 3300042007 Ga0439449_0000838 Ga0439449_0000838_3193_3609 132
1176 3300042007 Ga0439449_0009132 Ga0439449_0009132_1898_2314 132
1177 3300042007 Ga0439449_0184117 Ga0439449_0184117_262_666 132
1178 3300042010 Ga0439452_000001 Ga0439452_000001_384477_384881 132
1179 3300042010 Ga0439452_000003 Ga0439452_000003_102713_103117 132
1180 3300042010 Ga0439452_000006 Ga0439452_000006_542528_542932 132
1181 3300042010 Ga0439452_000008 Ga0439452_000008_247751_248155 132
1182 3300042010 Ga0439452_000161 Ga0439452_000161_34760_35164 132
1183 3300042010 Ga0439452_000216 Ga0439452_000216_25830_26234 132
1184 3300042010 Ga0439452_000949 Ga0439452_000949_8049_8465 132
1185 3300042010 Ga0439452_002479 Ga0439452_002479_4877_5293 132
1186 3300042014 Ga0439457_011278 Ga0439457_011278_705_1121 132
1187 3300042015 Ga0439462_0002574 Ga0439462_0002574_590_1006 132
1188 3300042016 Ga0439463_006410 Ga0439463_006410_741_1145 132
1189 3300042115 Ga0450911_000124 Ga0450911_000124_19698_20102 132
1190 3300042124 Ga0450922_001261 Ga0450922_001261_984_1388 132
1191 3300042124 Ga0450922_004419 Ga0450922_004419_539_955 132
1192 3300042125 Ga0450923_000221 Ga0450923_000221_2325_2729 132
1193 3300042125 Ga0450923_013904 Ga0450923_013904_49_465 132
1194 3300042134 Ga0450898_012816 Ga0450898_012816_608_1024 132
1195 3300042136 Ga0450900_017373 Ga0450900_017373_154_558 132
1196 3300042137 Ga0450902_019005 Ga0450902_019005_552_956 132
1197 3300042146 Ga0450907_000329 Ga0450907_000329_2292_2696 132
1198 3300042156 Ga0439446_0014658 Ga0439446_0014658_862_1278 132
1199 3300042185 Ga0450909_012251 Ga0450909_012251_59_475 132
1200 3300042185 Ga0450909_015394 Ga0450909_015394_499_915 132
1201 3300042435 Ga0439434_0002221 Ga0439434_0002221_3977_4393 132
1202 3300042439 Ga0439464_0000625 Ga0439464_0000625_2543_2947 132
1203 3300042439 Ga0439464_0003541 Ga0439464_0003541_1763_2167 132
1204 3300042439 Ga0439464_0019306 Ga0439464_0019306_501_905 132
1205 3300042439 Ga0439464_0044551 Ga0439464_0044551_824_1228 132
1206 3300042532 Ga0450893_0004785 Ga0450893_0004785_813_1217 132
1207 3300042532 Ga0450893_0039760 Ga0450893_0039760_189_587 132
1208 3300042876 Ga0451577_0014209 Ga0451577_0014209_5107_5514 132
1209 3300042876 Ga0451577_0118887 Ga0451577_0118887_1543_1956 132
1210 3300044666 Ga0466977_0000007 Ga0466977_0000007_4239_4643 132
1211 3300044669 Ga0466981_0000016 Ga0466981_0000016_80629_81033 132
1212 3300044673 Ga0453683_0504451 Ga0453683_0504451_249_662 132
1213 3300044712 Ga0453684_0014200 Ga0453684_0014200_10159_10572 132
1214 3300044712 Ga0453684_1211732 Ga0453684_1211732_218_631 132
1215 3300044765 Ga0466970_0209074 Ga0466970_0209074_495_911 132
1216 3300044901 Ga0466960_0037103 Ga0466960_0037103_1439_1855 132
1217 3300046452 Ga0495617_012114 Ga0495617_012114_800_1204 132
1218 3300046453 Ga0495627_000027 Ga0495627_000027_17946_18350 132
1219 3300046453 Ga0495627_162336 Ga0495627_162336_29_433 132
1220 3300046454 Ga0495592_0206827 Ga0495592_0206827_378_794 132
1221 3300046458 Ga0495591_000014 Ga0495591_000014_209001_209405 132
1222 3300046458 Ga0495591_000238 Ga0495591_000238_17241_17645 132
1223 3300046458 Ga0495591_002770 Ga0495591_002770_1115_1519 132
1224 3300046458 Ga0495591_005174 Ga0495591_005174_2970_3374 132
1225 3300046458 Ga0495591_084621 Ga0495591_084621_208_612 132
1226 3300046460 Ga0495638_0002381 Ga0495638_0002381_7914_8318 132
1227 3300046460 Ga0495638_0013990 Ga0495638_0013990_355_777 132
1228 3300046462 Ga0495651_0005777 Ga0495651_0005777_2978_3406 132
1229 3300046462 Ga0495651_0414476 Ga0495651_0414476_10_426 132
1230 3300046471 Ga0495650_0000021 Ga0495650_0000021_143952_144356 132
1231 3300046471 Ga0495650_0000032 Ga0495650_0000032_264674_265078 132
1232 3300046471 Ga0495650_0000396 Ga0495650_0000396_68919_69317 132
1233 3300046474 Ga0495605_0004747 Ga0495605_0004747_6107_6514 132
1234 3300046474 Ga0495605_0033547 Ga0495605_0033547_1669_2073 132
1235 3300046474 Ga0495605_0073615 Ga0495605_0073615_16_438 132
1236 3300046474 Ga0495605_0127430 Ga0495605_0127430_219_623 132
1237 3300046475 Ga0495639_0006891 Ga0495639_0006891_2721_3137 132
1238 3300046491 Ga0495584_0006445 Ga0495584_0006445_3948_4352 132
1239 3300046491 Ga0495584_0034114 Ga0495584_0034114_1580_1987 132
1240 3300046492 Ga0495585_0004620 Ga0495585_0004620_4439_4843 132
1241 3300046500 Ga0495596_0000366 Ga0495596_0000366_17133_17540 132
1242 3300046500 Ga0495596_0045021 Ga0495596_0045021_124_528 132
1243 3300046501 Ga0495607_0007488 Ga0495607_0007488_6886_7290 132
1244 3300046501 Ga0495607_0009243 Ga0495607_0009243_3103_3510 132
1245 3300046501 Ga0495607_0178868 Ga0495607_0178868_103_507 132
1246 3300046507 Ga0495606_0001314 Ga0495606_0001314_21528_21932 132
1247 3300046512 Ga0495610_0001226 Ga0495610_0001226_11588_11995 132
1248 3300046513 Ga0495616_0001943 Ga0495616_0001943_6789_7211 132
1249 3300046513 Ga0495616_0002001 Ga0495616_0002001_5924_6331 132
1250 3300046513 Ga0495616_0086880 Ga0495616_0086880_874_1278 132
1251 3300046514 Ga0495618_0028883 Ga0495618_0028883_2889_3317 132
1252 3300046515 Ga0495620_0003066 Ga0495620_0003066_5762_6166 132
1253 3300046515 Ga0495620_0145922 Ga0495620_0145922_340_744 132
1254 3300046515 Ga0495620_0147396 Ga0495620_0147396_285_707 132
1255 3300046516 Ga0495628_0000059 Ga0495628_0000059_41151_41579 132
1256 3300046516 Ga0495628_0295816 Ga0495628_0295816_599_1027 132
1257 3300046516 Ga0495628_0548866 Ga0495628_0548866_44_460 132
1258 3300046517 Ga0495630_0123685 Ga0495630_0123685_776_1192 132
1259 3300046518 Ga0495631_0000414 Ga0495631_0000414_17928_18350 132
1260 3300046519 Ga0495632_0131606 Ga0495632_0131606_716_1120 132
1261 3300046519 Ga0495632_0354786 Ga0495632_0354786_131_535 132
1262 3300046520 Ga0495637_0031616 Ga0495637_0031616_1274_1696 132
1263 3300046522 Ga0495643_0019114 Ga0495643_0019114_2334_2738 132
1264 3300046522 Ga0495643_0022631 Ga0495643_0022631_1202_1606 132
1265 3300046522 Ga0495643_0025319 Ga0495643_0025319_928_1326 132
1266 3300046522 Ga0495643_0028334 Ga0495643_0028334_425_829 132
1267 3300046522 Ga0495643_0081546 Ga0495643_0081546_1197_1601 132
1268 3300046523 Ga0495644_0002242 Ga0495644_0002242_2605_3009 132
1269 3300046524 Ga0495648_0000299 Ga0495648_0000299_12069_12473 132
1270 3300046524 Ga0495648_0006462 Ga0495648_0006462_5816_6220 132
1271 3300046524 Ga0495648_0021944 Ga0495648_0021944_2918_3325 132
1272 3300046529 Ga0495652_0004625 Ga0495652_0004625_4777_5205 132
1273 3300046530 Ga0495654_0000019 Ga0495654_0000019_203231_203635 132
1274 3300046530 Ga0495654_0001152 Ga0495654_0001152_14283_14687 132
1275 3300046530 Ga0495654_0002661 Ga0495654_0002661_8852_9256 132
1276 3300046530 Ga0495654_0008751 Ga0495654_0008751_3093_3497 132
1277 3300046530 Ga0495654_0011360 Ga0495654_0011360_2136_2558 132
1278 3300046530 Ga0495654_0053428 Ga0495654_0053428_1236_1640 132
1279 3300046530 Ga0495654_0054888 Ga0495654_0054888_761_1165 132
1280 3300046530 Ga0495654_0183630 Ga0495654_0183630_446_850 132
1281 3300046535 Ga0495586_0097772 Ga0495586_0097772_184_600 132
1282 3300046538 Ga0495609_0010849 Ga0495609_0010849_2900_3307 132
1283 3300046539 Ga0495621_0004439 Ga0495621_0004439_1039_1455 132
1284 3300046542 Ga0495597_0000720 Ga0495597_0000720_13976_14380 132
1285 3300046543 Ga0495645_0054792 Ga0495645_0054792_507_935 132
1286 3300046615 Ga0495656_0005434 Ga0495656_0005434_2768_3175 132
1287 3300046616 Ga0495668_0053240 Ga0495668_0053240_1377_1799 132
1288 3300046648 Ga0495611_0035919 Ga0495611_0035919_716_1120 132
1289 3300046660 Ga0495625_0005285 Ga0495625_0005285_166_570 132
1290 3300046660 Ga0495625_0014435 Ga0495625_0014435_1581_2003 132
1291 3300046663 Ga0495635_0083588 Ga0495635_0083588_308_724 132
1292 3300046665 Ga0495661_0009993 Ga0495661_0009993_2783_3190 132
1293 3300046674 Ga0495588_0000437 Ga0495588_0000437_14098_14502 132
1294 3300046679 Ga0495623_0003538 Ga0495623_0003538_4114_4542 132
1295 3300046680 Ga0495646_0002246 Ga0495646_0002246_10006_10434 132
1296 3300046680 Ga0495646_0441126 Ga0495646_0441126_40_462 132
1297 3300046684 Ga0495669_0147709 Ga0495669_0147709_175_591 132
1298 3300046689 Ga0495613_0714846 Ga0495613_0714846_68_490 132
1299 3300046690 Ga0495624_0020855 Ga0495624_0020855_2241_2663 132
1300 3300046690 Ga0495624_0255279 Ga0495624_0255279_600_1028 132
1301 3300046691 Ga0495670_0016868 Ga0495670_0016868_2433_2855 132
1302 3300046692 Ga0495671_0001044 Ga0495671_0001044_11492_11899 132
1303 3300046692 Ga0495671_0258152 Ga0495671_0258152_126_530 132
1304 3300046694 Ga0495649_0013339 Ga0495649_0013339_2710_3114 132
1305 3300046694 Ga0495649_0014855 Ga0495649_0014855_2675_3079 132
1306 3300046694 Ga0495649_0042287 Ga0495649_0042287_858_1262 132
1307 3300046694 Ga0495649_0107137 Ga0495649_0107137_662_1066 132
1308 3300046794 Ga0495589_0000001 Ga0495589_0000001_57937_58341 132
1309 3300046794 Ga0495589_0039635 Ga0495589_0039635_1769_2176 132
1310 3300046794 Ga0495589_0052967 Ga0495589_0052967_1536_1940 132
1311 3300046809 Ga0495600_0511904 Ga0495600_0511904_295_711 132
1312 3300046809 Ga0495600_0682364 Ga0495600_0682364_124_552 132
1313 3300046810 Ga0495660_0000004 Ga0495660_0000004_920645_921043 132
1314 3300046810 Ga0495660_0000021 Ga0495660_0000021_112594_112998 132
1315 3300046810 Ga0495660_0006528 Ga0495660_0006528_4464_4868 132
1316 3300046810 Ga0495660_0037106 Ga0495660_0037106_2023_2427 132
1317 3300047317 Ga0495604_0391285 Ga0495604_0391285_309_725 132
1318 3300047318 Ga0495636_0010570 Ga0495636_0010570_1435_1842 132
1319 3300047320 Ga0495672_0000002 Ga0495672_0000002_225536_225940 132
1320 3300047320 Ga0495672_0000012 Ga0495672_0000012_459559_459963 132
1321 3300047320 Ga0495672_0000020 Ga0495672_0000020_51787_52191 132
1322 3300047320 Ga0495672_0024648 Ga0495672_0024648_3338_3745 132
1323 3300047321 Ga0495676_0008592 Ga0495676_0008592_2755_3177 132
1324 3300047323 Ga0495683_0020678 Ga0495683_0020678_856_1260 132
1325 3300047446 Ga0495679_000020 Ga0495679_000020_16809_17213 132
1326 3300047446 Ga0495679_002132 Ga0495679_002132_8969_9373 132
1327 3300047446 Ga0495679_002328 Ga0495679_002328_1139_1543 132
1328 3300047446 Ga0495679_047995 Ga0495679_047995_133_537 132
1329 3300047447 Ga0495685_004966 Ga0495685_004966_2955_3362 132
1330 3300047469 Ga0495673_0000065 Ga0495673_0000065_35400_35804 132
1331 3300047469 Ga0495673_0000081 Ga0495673_0000081_29977_30381 132
1332 3300047673 Ga0495593_0034149 Ga0495593_0034149_492_914 132
1333 3300048088 Ga0495602_0012279 Ga0495602_0012279_4662_5090 132
1334 3300048088 Ga0495602_0147112 Ga0495602_0147112_1367_1795 132
1335 3300048089 Ga0495614_0004433 Ga0495614_0004433_3551_3973 132
1336 3300048903 Ga0496100_0006740 Ga0496100_0006740_3611_4015 132
1337 3300048903 Ga0496100_0013256 Ga0496100_0013256_2023_2439 132
1338 3300048903 Ga0496100_0028570 Ga0496100_0028570_1178_1582 132
1339 3300048903 Ga0496100_0125278 Ga0496100_0125278_514_918 132
1340 3300048903 Ga0496100_1483057 Ga0496100_1483057_110_514 132
1341 3300048904 Ga0496101_0000314 Ga0496101_0000314_21315_21719 132
1342 3300048904 Ga0496101_0203711 Ga0496101_0203711_630_1034 132
1343 3300048904 Ga0496101_0383973 Ga0496101_0383973_282_686 132
1344 3300048904 Ga0496101_0592517 Ga0496101_0592517_226_642 132
1345 3300048904 Ga0496101_0927755 Ga0496101_0927755_137_556 132
1346 3300048904 Ga0496101_1288540 Ga0496101_1288540_95_499 132
1347 3300048905 Ga0496102_0005511 Ga0496102_0005511_9562_9966 132
1348 3300048905 Ga0496102_0108549 Ga0496102_0108549_219_635 132
1349 3300048905 Ga0496102_0266586 Ga0496102_0266586_209_613 132
1350 3300048905 Ga0496102_0493239 Ga0496102_0493239_66_470 132
1351 3300048906 Ga0496103_0092134 Ga0496103_0092134_168_572 132
1352 3300048906 Ga0496103_0172794 Ga0496103_0172794_342_746 132
1353 3300048907 Ga0496104_0000893 Ga0496104_0000893_5928_6332 132
1354 3300048907 Ga0496104_0001151 Ga0496104_0001151_15638_16036 132
1355 3300048907 Ga0496104_0452682 Ga0496104_0452682_383_787 132
1356 3300048907 Ga0496104_1047988 Ga0496104_1047988_88_495 132
1357 3300048907 Ga0496104_1632241 Ga0496104_1632241_72_476 132
1358 3300048908 Ga0496105_0001685 Ga0496105_0001685_13048_13452 132
1359 3300048908 Ga0496105_0019956 Ga0496105_0019956_616_1032 132
1360 3300048908 Ga0496105_0118704 Ga0496105_0118704_131_550 132
1361 3300048908 Ga0496105_0157490 Ga0496105_0157490_672_1076 132
1362 3300048909 Ga0496106_0048665 Ga0496106_0048665_2746_3162 132
1363 3300048909 Ga0496106_1184926 Ga0496106_1184926_76_480 132
1364 3300048910 Ga0496107_0257645 Ga0496107_0257645_33_449 132
1365 3300048910 Ga0496107_0700337 Ga0496107_0700337_38_460 132
1366 3300048911 Ga0496108_0059934 Ga0496108_0059934_918_1334 132
1367 3300048912 Ga0496109_0078498 Ga0496109_0078498_2130_2546 132
1368 3300048913 Ga0496110_0306314 Ga0496110_0306314_26_430 132
1369 3300048913 Ga0496110_1303227 Ga0496110_1303227_25_441 132
1370 3300048916 Ga0496113_0110179 Ga0496113_0110179_995_1399 132
1371 3300048916 Ga0496113_0182493 Ga0496113_0182493_536_952 132
1372 3300048916 Ga0496113_0747444 Ga0496113_0747444_257_673 132
1373 3300048917 Ga0496114_0634583 Ga0496114_0634583_157_573 132
1374 3300048919 Ga0496116_0000001 Ga0496116_0000001_1328126_1328530 132
1375 3300048919 Ga0496116_0000094 Ga0496116_0000094_146183_146581 132
1376 3300048919 Ga0496116_0000431 Ga0496116_0000431_38908_39312 132
1377 3300048919 Ga0496116_0000679 Ga0496116_0000679_11274_11678 132
1378 3300048919 Ga0496116_0000738 Ga0496116_0000738_21608_22012 132
1379 3300048919 Ga0496116_0000930 Ga0496116_0000930_14389_14793 132
1380 3300048919 Ga0496116_0005086 Ga0496116_0005086_3200_3619 132
1381 3300048919 Ga0496116_0007904 Ga0496116_0007904_3549_3953 132
1382 3300048919 Ga0496116_0011708 Ga0496116_0011708_2742_3149 132
1383 3300048919 Ga0496116_0017298 Ga0496116_0017298_1154_1558 132
1384 3300048919 Ga0496116_0018592 Ga0496116_0018592_3889_4293 132
1385 3300048919 Ga0496116_0023072 Ga0496116_0023072_2328_2747 132
1386 3300048919 Ga0496116_0035310 Ga0496116_0035310_724_1128 132
1387 3300048919 Ga0496116_0084036 Ga0496116_0084036_294_713 132
1388 3300048919 Ga0496116_0088658 Ga0496116_0088658_1349_1753 132
1389 3300048919 Ga0496116_0125206 Ga0496116_0125206_443_847 132
1390 3300048919 Ga0496116_0166367 Ga0496116_0166367_633_1037 132
1391 3300048920 Ga0496117_0000004 Ga0496117_0000004_354760_355164 132
1392 3300048920 Ga0496117_0001414 Ga0496117_0001414_19942_20346 132
1393 3300048920 Ga0496117_0002234 Ga0496117_0002234_13373_13777 132
1394 3300048920 Ga0496117_0002320 Ga0496117_0002320_20384_20788 132
1395 3300048920 Ga0496117_0003205 Ga0496117_0003205_8463_8867 132
1396 3300048920 Ga0496117_0007415 Ga0496117_0007415_7145_7543 132
1397 3300048920 Ga0496117_0008133 Ga0496117_0008133_5080_5484 132
1398 3300048920 Ga0496117_0009227 Ga0496117_0009227_1419_1823 132
1399 3300048920 Ga0496117_0010043 Ga0496117_0010043_5850_6254 132
1400 3300048920 Ga0496117_0012413 Ga0496117_0012413_4146_4550 132
1401 3300048920 Ga0496117_0015407 Ga0496117_0015407_2076_2495 132
1402 3300048920 Ga0496117_0035442 Ga0496117_0035442_2197_2601 132
1403 3300048920 Ga0496117_0039172 Ga0496117_0039172_1981_2385 132
1404 3300048920 Ga0496117_0046718 Ga0496117_0046718_1763_2167 132
1405 3300048920 Ga0496117_0063088 Ga0496117_0063088_2015_2419 132
1406 3300048920 Ga0496117_0086922 Ga0496117_0086922_990_1394 132
1407 3300048920 Ga0496117_0124537 Ga0496117_0124537_740_1144 132
1408 3300048920 Ga0496117_0147540 Ga0496117_0147540_762_1184 132
1409 3300048921 Ga0496118_0000072 Ga0496118_0000072_98633_99037 132
1410 3300048921 Ga0496118_0002508 Ga0496118_0002508_7845_8249 132
1411 3300048921 Ga0496118_0003626 Ga0496118_0003626_5850_6254 132
1412 3300048921 Ga0496118_0003664 Ga0496118_0003664_10500_10904 132
1413 3300048921 Ga0496118_0008346 Ga0496118_0008346_7566_7988 132
1414 3300048921 Ga0496118_0008657 Ga0496118_0008657_2850_3248 132
1415 3300048921 Ga0496118_0022858 Ga0496118_0022858_3276_3695 132
1416 3300048921 Ga0496118_0023065 Ga0496118_0023065_2041_2445 132
1417 3300048921 Ga0496118_0031286 Ga0496118_0031286_3967_4371 132
1418 3300048921 Ga0496118_0031499 Ga0496118_0031499_1094_1492 132
1419 3300048921 Ga0496118_0045544 Ga0496118_0045544_116_520 132
1420 3300048921 Ga0496118_0117588 Ga0496118_0117588_1157_1576 132
1421 3300048921 Ga0496118_0236351 Ga0496118_0236351_220_636 132
1422 3300048922 Ga0496119_0000008 Ga0496119_0000008_361804_362208 132
1423 3300048922 Ga0496119_0000080 Ga0496119_0000080_20689_21093 132
1424 3300048922 Ga0496119_0000156 Ga0496119_0000156_47509_47913 132
1425 3300048922 Ga0496119_0000677 Ga0496119_0000677_27975_28379 132
1426 3300048922 Ga0496119_0002331 Ga0496119_0002331_16554_16958 132
1427 3300048922 Ga0496119_0002686 Ga0496119_0002686_7912_8316 132
1428 3300048922 Ga0496119_0004122 Ga0496119_0004122_12545_12949 132
1429 3300048922 Ga0496119_0004498 Ga0496119_0004498_11245_11649 132
1430 3300048922 Ga0496119_0005466 Ga0496119_0005466_8767_9165 132
1431 3300048922 Ga0496119_0007741 Ga0496119_0007741_1349_1753 132
1432 3300048922 Ga0496119_0019148 Ga0496119_0019148_647_1051 132
1433 3300048922 Ga0496119_0019675 Ga0496119_0019675_3521_3940 132
1434 3300048922 Ga0496119_0034475 Ga0496119_0034475_868_1272 132
1435 3300048922 Ga0496119_0242819 Ga0496119_0242819_57_461 132
1436 3300048922 Ga0496119_0246500 Ga0496119_0246500_42_461 132
1437 3300048923 Ga0496120_0000035 Ga0496120_0000035_155402_155806 132
1438 3300048923 Ga0496120_0000040 Ga0496120_0000040_54779_55183 132
1439 3300048923 Ga0496120_0000075 Ga0496120_0000075_142423_142827 132
1440 3300048923 Ga0496120_0000128 Ga0496120_0000128_19975_20379 132
1441 3300048923 Ga0496120_0000302 Ga0496120_0000302_54414_54818 132
1442 3300048923 Ga0496120_0000477 Ga0496120_0000477_55005_55409 132
1443 3300048923 Ga0496120_0002786 Ga0496120_0002786_5533_5952 132
1444 3300048923 Ga0496120_0003693 Ga0496120_0003693_9288_9692 132
1445 3300048923 Ga0496120_0003747 Ga0496120_0003747_5431_5835 132
1446 3300048923 Ga0496120_0003837 Ga0496120_0003837_8461_8865 132
1447 3300048923 Ga0496120_0005107 Ga0496120_0005107_10032_10430 132
1448 3300048923 Ga0496120_0006986 Ga0496120_0006986_6242_6646 132
1449 3300048923 Ga0496120_0035747 Ga0496120_0035747_1646_2050 132
1450 3300048923 Ga0496120_0043456 Ga0496120_0043456_1944_2348 132
1451 3300048923 Ga0496120_0073631 Ga0496120_0073631_597_1001 132
1452 3300048924 Ga0496121_0000047 Ga0496121_0000047_144252_144656 132
1453 3300048924 Ga0496121_0000124 Ga0496121_0000124_149791_150210 132
1454 3300048924 Ga0496121_0001134 Ga0496121_0001134_31934_32338 132
1455 3300048924 Ga0496121_0002661 Ga0496121_0002661_17104_17508 132
1456 3300048924 Ga0496121_0002930 Ga0496121_0002930_13541_13945 132
1457 3300048924 Ga0496121_0003880 Ga0496121_0003880_14411_14815 132
1458 3300048924 Ga0496121_0007669 Ga0496121_0007669_11329_11745 132
1459 3300048924 Ga0496121_0010355 Ga0496121_0010355_7393_7797 132
1460 3300048924 Ga0496121_0015971 Ga0496121_0015971_2767_3174 132
1461 3300048924 Ga0496121_0041514 Ga0496121_0041514_1103_1519 132
1462 3300048924 Ga0496121_0052914 Ga0496121_0052914_2061_2465 132
1463 3300048924 Ga0496121_0056690 Ga0496121_0056690_1039_1458 132
1464 3300048925 Ga0496122_0000007 Ga0496122_0000007_240336_240734 132
1465 3300048925 Ga0496122_0000033 Ga0496122_0000033_280286_280705 132
1466 3300048925 Ga0496122_0000356 Ga0496122_0000356_21495_21899 132
1467 3300048925 Ga0496122_0001024 Ga0496122_0001024_14724_15128 132
1468 3300048925 Ga0496122_0001367 Ga0496122_0001367_2017_2421 132
1469 3300048925 Ga0496122_0001535 Ga0496122_0001535_18692_19096 132
1470 3300048925 Ga0496122_0004005 Ga0496122_0004005_4231_4647 132
1471 3300048925 Ga0496122_0004980 Ga0496122_0004980_3575_3979 132
1472 3300048925 Ga0496122_0006622 Ga0496122_0006622_9244_9648 132
1473 3300048925 Ga0496122_0007333 Ga0496122_0007333_7845_8249 132
1474 3300048925 Ga0496122_0012310 Ga0496122_0012310_4693_5100 132
1475 3300048925 Ga0496122_0018241 Ga0496122_0018241_724_1143 132
1476 3300048925 Ga0496122_0052511 Ga0496122_0052511_2263_2667 132
1477 3300048925 Ga0496122_0067614 Ga0496122_0067614_935_1357 132
1478 3300048925 Ga0496122_0067953 Ga0496122_0067953_707_1111 132
1479 3300048925 Ga0496122_0085176 Ga0496122_0085176_1567_1983 132
1480 3300048925 Ga0496122_0089083 Ga0496122_0089083_79_483 132
1481 3300048925 Ga0496122_0126517 Ga0496122_0126517_235_639 132
1482 3300048925 Ga0496122_0137705 Ga0496122_0137705_1033_1437 132
1483 3300048925 Ga0496122_0142086 Ga0496122_0142086_1084_1488 132
1484 3300048925 Ga0496122_0248225 Ga0496122_0248225_517_921 132
1485 3300048926 Ga0496123_0000004 Ga0496123_0000004_536496_536894 132
1486 3300048926 Ga0496123_0000248 Ga0496123_0000248_22898_23302 132
1487 3300048926 Ga0496123_0000263 Ga0496123_0000263_15223_15639 132
1488 3300048926 Ga0496123_0000309 Ga0496123_0000309_17313_17717 132
1489 3300048926 Ga0496123_0000827 Ga0496123_0000827_28855_29274 132
1490 3300048926 Ga0496123_0001080 Ga0496123_0001080_19260_19664 132
1491 3300048926 Ga0496123_0002455 Ga0496123_0002455_7608_8012 132
1492 3300048926 Ga0496123_0003432 Ga0496123_0003432_14011_14415 132
1493 3300048926 Ga0496123_0003815 Ga0496123_0003815_5886_6293 132
1494 3300048926 Ga0496123_0005121 Ga0496123_0005121_137_541 132
1495 3300048926 Ga0496123_0006692 Ga0496123_0006692_510_914 132
1496 3300048926 Ga0496123_0008295 Ga0496123_0008295_9117_9521 132
1497 3300048926 Ga0496123_0031257 Ga0496123_0031257_1959_2363 132
1498 3300048926 Ga0496123_0031549 Ga0496123_0031549_441_860 132
1499 3300048926 Ga0496123_0048163 Ga0496123_0048163_637_1059 132
1500 3300048926 Ga0496123_0080653 Ga0496123_0080653_18_422 132
1501 3300048926 Ga0496123_0107980 Ga0496123_0107980_277_699 132
1502 3300048926 Ga0496123_0135435 Ga0496123_0135435_62_466 132
1503 3300048926 Ga0496123_0186925 Ga0496123_0186925_155_559 132
1504 3300048926 Ga0496123_0231341 Ga0496123_0231341_384_788 132
1505 3300048926 Ga0496123_0382431 Ga0496123_0382431_138_557 132
1506 3300048927 Ga0496124_0000004 Ga0496124_0000004_336692_337108 132
1507 3300048927 Ga0496124_0000008 Ga0496124_0000008_636822_637226 132
1508 3300048927 Ga0496124_0000025 Ga0496124_0000025_245034_245432 132
1509 3300048927 Ga0496124_0000097 Ga0496124_0000097_58900_59304 132
1510 3300048927 Ga0496124_0000180 Ga0496124_0000180_52808_53212 132
1511 3300048927 Ga0496124_0000659 Ga0496124_0000659_42069_42473 132
1512 3300048927 Ga0496124_0001108 Ga0496124_0001108_39934_40338 132
1513 3300048927 Ga0496124_0005507 Ga0496124_0005507_9460_9864 132
1514 3300048927 Ga0496124_0006593 Ga0496124_0006593_5168_5590 132
1515 3300048927 Ga0496124_0011293 Ga0496124_0011293_1911_2315 132
1516 3300048927 Ga0496124_0012761 Ga0496124_0012761_6011_6415 132
1517 3300048927 Ga0496124_0018225 Ga0496124_0018225_5864_6280 132
1518 3300048927 Ga0496124_0025818 Ga0496124_0025818_1114_1518 132
1519 3300048927 Ga0496124_0028216 Ga0496124_0028216_2109_2513 132
1520 3300048927 Ga0496124_0043725 Ga0496124_0043725_137_541 132
1521 3300048927 Ga0496124_0050738 Ga0496124_0050738_2711_3115 132
1522 3300048927 Ga0496124_0092781 Ga0496124_0092781_903_1322 132
1523 3300048927 Ga0496124_0102126 Ga0496124_0102126_143_547 132
1524 3300048927 Ga0496124_0110891 Ga0496124_0110891_1763_2167 132
1525 3300048927 Ga0496124_0114707 Ga0496124_0114707_1615_2019 132
1526 3300048927 Ga0496124_0121468 Ga0496124_0121468_1354_1770 132
1527 3300048927 Ga0496124_0126256 Ga0496124_0126256_1150_1569 132
1528 3300048927 Ga0496124_0140729 Ga0496124_0140729_1138_1542 132
1529 3300048927 Ga0496124_0275538 Ga0496124_0275538_218_637 132
1530 3300048927 Ga0496124_0289900 Ga0496124_0289900_174_578 132
1531 3300048927 Ga0496124_0396997 Ga0496124_0396997_205_609 132
1532 3300048927 Ga0496124_0498316 Ga0496124_0498316_170_589 132
1533 3300048927 Ga0496124_0963776 Ga0496124_0963776_18_422 132
1534 3300048928 Ga0496125_0000013 Ga0496125_0000013_342446_342844 132
1535 3300048928 Ga0496125_0000055 Ga0496125_0000055_150319_150723 132
1536 3300048928 Ga0496125_0003192 Ga0496125_0003192_6184_6588 132
1537 3300048928 Ga0496125_0004562 Ga0496125_0004562_7645_8049 132
1538 3300048928 Ga0496125_0011417 Ga0496125_0011417_7973_8377 132
1539 3300048928 Ga0496125_0012992 Ga0496125_0012992_5662_6081 132
1540 3300048928 Ga0496125_0019540 Ga0496125_0019540_3893_4312 132
1541 3300048928 Ga0496125_0031099 Ga0496125_0031099_730_1134 132
1542 3300048928 Ga0496125_0031681 Ga0496125_0031681_1870_2274 132
1543 3300048928 Ga0496125_0033541 Ga0496125_0033541_2803_3225 132
1544 3300048928 Ga0496125_0051081 Ga0496125_0051081_226_648 132
1545 3300048928 Ga0496125_0056246 Ga0496125_0056246_853_1257 132
1546 3300048928 Ga0496125_0065514 Ga0496125_0065514_1942_2346 132
1547 3300048928 Ga0496125_0101308 Ga0496125_0101308_762_1166 132
1548 3300048928 Ga0496125_0102529 Ga0496125_0102529_1014_1418 132
1549 3300048928 Ga0496125_0125272 Ga0496125_0125272_1114_1533 132
1550 3300048928 Ga0496125_0172485 Ga0496125_0172485_964_1368 132
1551 3300048929 Ga0496126_0000524 Ga0496126_0000524_69902_70300 132
1552 3300048929 Ga0496126_0001242 Ga0496126_0001242_34565_34969 132
1553 3300048929 Ga0496126_0001275 Ga0496126_0001275_16890_17294 132
1554 3300048929 Ga0496126_0002571 Ga0496126_0002571_17495_17899 132
1555 3300048929 Ga0496126_0004513 Ga0496126_0004513_1150_1569 132
1556 3300048929 Ga0496126_0012055 Ga0496126_0012055_5993_6412 132
1557 3300048929 Ga0496126_0026056 Ga0496126_0026056_4513_4917 132
1558 3300048929 Ga0496126_0095925 Ga0496126_0095925_1889_2293 132
1559 3300048929 Ga0496126_0102516 Ga0496126_0102516_935_1339 132
1560 3300048929 Ga0496126_0113215 Ga0496126_0113215_1888_2292 132
1561 3300048929 Ga0496126_0138297 Ga0496126_0138297_1056_1460 132
1562 3300048929 Ga0496126_0140140 Ga0496126_0140140_813_1217 132
1563 3300048929 Ga0496126_0221148 Ga0496126_0221148_871_1275 132
1564 3300048929 Ga0496126_0421096 Ga0496126_0421096_661_1065 132
1565 3300049127 Ga0501306_044815 Ga0501306_044815_226_636 132
1566 3300049459 Ga0495678_000817 Ga0495678_000817_12351_12755 132
1567 3300049459 Ga0495678_040935 Ga0495678_040935_516_920 132
1568 3300049460 Ga0495682_0000015 Ga0495682_0000015_12490_12894 132
1569 3300049513 Ga0501290_021491 Ga0501290_021491_47_460 132
1570 3300049530 Ga0501314_040360 Ga0501314_040360_97_516 132
1571 3300049531 Ga0501315_101563 Ga0501315_101563_39_461 132
1572 3300049568 Ga0501031_0009408 Ga0501031_0009408_5837_6241 132
1573 3300049570 Ga0501033_0005448 Ga0501033_0005448_2442_2858 132
1574 3300049571 Ga0501034_0000194 Ga0501034_0000194_87953_88360 132
1575 3300049571 Ga0501034_0067693 Ga0501034_0067693_2836_3240 132
1576 3300049571 Ga0501034_0450921 Ga0501034_0450921_612_1028 132
1577 3300049579 Ga0501043_0906553 Ga0501043_0906553_112_516 132
1578 3300049579 Ga0501043_1195240 Ga0501043_1195240_14_430 132
1579 3300049581 Ga0501047_0022639 Ga0501047_0022639_2390_2806 132
1580 3300049582 Ga0501048_0259736 Ga0501048_0259736_252_668 132
1581 3300049663 Ga0501223_013447 Ga0501223_013447_23_427 132
1582 3300049671 Ga0501238_010976 Ga0501238_010976_41_457 132
1583 3300049682 Ga0501252_039108 Ga0501252_039108_29_451 132
1584 3300049686 Ga0501257_049098 Ga0501257_049098_226_648 132
1585 3300049758 Ga0501241_019985 Ga0501241_019985_368_784 132
1586 3300049759 Ga0501262_000217 Ga0501262_000217_638_1060 132
1587 3300049763 Ga0501266_018967 Ga0501266_018967_367_789 132
1588 3300049775 Ga0501279_026092 Ga0501279_026092_280_702 132
1589 3300049822 Ga0501035_0008452 Ga0501035_0008452_681_1097 132
1590 3300049822 Ga0501035_0022942 Ga0501035_0022942_2875_3291 132
1591 3300049822 Ga0501035_0030616 Ga0501035_0030616_481_897 132
1592 3300049823 Ga0501044_0000126 Ga0501044_0000126_22115_22531 132
1593 3300049823 Ga0501044_0030902 Ga0501044_0030902_3634_4050 132
1594 3300050489 nmdc:mga03683_539_c1 nmdc:mga03683_539_c1_3758_4174 132
1595 3300050490 nmdc:mga03n38_13224_c1 nmdc:mga03n38_13224_c1_2628_3044 132
1596 3300050491 nmdc:mga00v17_151655_c1 nmdc:mga00v17_151655_c1_509_925 132
1597 3300050491 nmdc:mga00v17_18093_c1 nmdc:mga00v17_18093_c1_921_1325 132
1598 3300050491 nmdc:mga00v17_210738_c1 nmdc:mga00v17_210738_c1_281_697 132
1599 3300050491 nmdc:mga00v17_223241_c1 nmdc:mga00v17_223241_c1_329_733 132
1600 3300050491 nmdc:mga00v17_223343_c1 nmdc:mga00v17_223343_c1_690_1094 132
1601 3300050491 nmdc:mga00v17_320026_c1 nmdc:mga00v17_320026_c1_339_755 132
1602 3300050491 nmdc:mga00v17_50007_c1 nmdc:mga00v17_50007_c1_1576_1980 132
1603 3300050491 nmdc:mga00v17_629_c1 nmdc:mga00v17_629_c1_8085_8489 132
1604 3300050493 nmdc:mga0k408_546176_c1 nmdc:mga0k408_546176_c1_193_597 132
1605 3300050496 nmdc:mga07m45_122425_c1 nmdc:mga07m45_122425_c1_235_651 132
1606 3300050496 nmdc:mga07m45_297849_c1 nmdc:mga07m45_297849_c1_73_495 132
1607 3300050496 nmdc:mga07m45_42155_c1 nmdc:mga07m45_42155_c1_731_1153 132
1608 3300050516 nmdc:mga0sz30_116214_c1 nmdc:mga0sz30_116214_c1_457_879 132
1609 3300053083 Ga0495655_0116484 Ga0495655_0116484_263_685 132
1610 3300053087 Ga0500643_015944 Ga0500643_015944_1313_1735 132
1611 3300053088 Ga0500644_0006005 Ga0500644_0006005_67_483 132
1612 3300053088 Ga0500644_0051178 Ga0500644_0051178_951_1355 132
1613 3300053090 Ga0500646_0019586 Ga0500646_0019586_646_1062 132
1614 3300053091 Ga0500647_0353846 Ga0500647_0353846_83_505 132
1615 3300053093 Ga0500651_0000054 Ga0500651_0000054_1183_1605 132
1616 3300053096 Ga0500641_0120823 Ga0500641_0120823_162_578 132
1617 3300053108 Ga0500562_007562 Ga0500562_007562_1858_2262 132
1618 3300053108 Ga0500562_120711 Ga0500562_120711_152_574 132
1619 3300053110 Ga0500571_000005 Ga0500571_000005_69994_70416 132
1620 3300053116 Ga0500592_003168 Ga0500592_003168_965_1387 132
1621 3300053117 Ga0500593_002899 Ga0500593_002899_1357_1773 132
1622 3300053118 Ga0500594_0000763 Ga0500594_0000763_6209_6631 132
1623 3300053119 Ga0500595_118460 Ga0500595_118460_262_684 132
1624 3300053121 Ga0500607_036794 Ga0500607_036794_207_629 132
1625 3300053122 Ga0500608_024725 Ga0500608_024725_1805_2221 132
1626 3300053125 Ga0500618_014532 Ga0500618_014532_1452_1868 132
1627 3300053126 Ga0500621_000001 Ga0500621_000001_861151_861555 132
1628 3300053133 Ga0500655_000895 Ga0500655_000895_3850_4272 132
1629 3300053136 Ga0500559_0001788 Ga0500559_0001788_3513_3929 132
1630 3300053137 Ga0500561_0016276 Ga0500561_0016276_412_834 132
1631 3300053138 Ga0500564_005575 Ga0500564_005575_3753_4175 132
1632 3300053139 Ga0500568_0002238 Ga0500568_0002238_6328_6750 132
1633 3300053140 Ga0500573_0029700 Ga0500573_0029700_1751_2167 132
1634 3300053141 Ga0500574_000299 Ga0500574_000299_4087_4509 132
1635 3300053151 Ga0500604_0054108 Ga0500604_0054108_327_743 132
1636 3300053153 Ga0500616_0047830 Ga0500616_0047830_717_1139 132
1637 3300053156 Ga0500622_0125928 Ga0500622_0125928_480_896 132
1638 3300053157 Ga0500624_004622 Ga0500624_004622_340_762 132
1639 3300053157 Ga0500624_070879 Ga0500624_070879_92_496 132
1640 3300053161 Ga0500634_0036031 Ga0500634_0036031_1587_1991 132
1641 3300053161 Ga0500634_0107998 Ga0500634_0107998_710_1132 132
1642 3300053162 Ga0500638_004055 Ga0500638_004055_2856_3278 132
1643 3300053730 Ga0500645_011458 Ga0500645_011458_442_858 132
1644 3300055283 Ga0500661_002371 Ga0500661_002371_926_1342 132
1645 iso_pu_bacteria 2511231002 2511245910 132
1646 iso_pu_bacteria 2599185214 2599623235 132
1647 iso_pu_bacteria 2599185226 2599675547 132
1648 iso_pu_bacteria 2599185227 2599680840 132
1649 iso_pu_bacteria 2599185229 2599692855 132
1650 iso_pu_bacteria 2818991436 2819544803 132
1651 iso_pu_bacteria 2818991446 2819600370 132
1652 iso_pu_bacteria 2831265667 2831271836 132
1653 iso_pu_bacteria 2838054893 2838059674 132
1654 iso_pu_bacteria 2842733646 2842735768 132
1655 iso_pu_bacteria 2842747753 2842750921 132
1656 iso_pu_bacteria 2885211737 2885211948 132
1657 iso_pu_bacteria 2899924645 2899928459 132
1658 iso_pu_bacteria 2904449895 2904452436 132
1659 iso_pu_bacteria 2904456579 2904460965 132
1660 iso_pu_bacteria 2919462493 2919463932 132
1661 iso_pu_bacteria 2928037797 2928041380 132
1662 iso_pu_bacteria 2928044640 2928048222 132
1663 iso_pu_bacteria 2928051484 2928056064 132
1664 iso_pu_bacteria 2928064002 2928066454 132
1665 iso_pu_bacteria 2928084124 2928087701 132
1666 iso_pu_bacteria 2929520902 2929522948 132
1667 iso_pu_bacteria 2945945610 2945946068 132
1668 iso_pu_bacteria 2945972063 2945975667 132
1669 iso_pu_bacteria 2954767861 2954768890 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

95

140

0.95

PF00460

Flg_bb_rod

Flagella basal body rod protein

11

41

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cg0-assembly1.cif.gz_p cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.9386 2 130
7nvg-assembly1.cif.gz_V2 salmonella flagellar basal body refined in c1 map 0.9291 1 132
7cg0-assembly1.cif.gz_h cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.9271 2 128
7cg0-assembly1.cif.gz_i cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.9244 2 130
7nvg-assembly1.cif.gz_V2 salmonella flagellar basal body refined in c1 map 0.9224 1 132
ID Description Score Start End Superfamily
af_Q13023_1080_1194_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9185 93 128 1.20.58.60
af_E9Q9K8_1077_1190_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9066 93 128 1.20.58.60
af_Q9VMH8_1_121_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6726 70 129 1.10.287.370
af_Q9M1G8_208_399_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.6204 38 67 3.40.50.880
af_Q94K88_191_391_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6011 12 132 1.25.40.10
ID Description Score Start End GO Terms
AF-F5NSX4-F1-model_v4 Flagellar basal-body rod protein flgC 0.9958 2 68 GO:0009288
AF-A0A6D0ENN2-F1-model_v4 deleted 0.9867 2 110
AF-A0A656YGU4-F1-model_v4 deleted 0.9792 2 63
AF-A0A376UBU8-F1-model_v4 Flagellar basal-body rod protein FlgC 0.977 2 128 GO:0030694
GO:0044781
GO:0071978
AF-A0A1I7F3P2-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9684 2 132 GO:0030694
GO:0071978

Feature Viewer

pLDDT pTM Quality
90.43 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map