F495248

General Info

Members Datasets Scaffolds Average Seq Length
1661 575 1530 296

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0156289|Ga0436363_0156289_99_1067
Length 322
Sequence MNVEVKPAAVLADMLADAPMIESIGVVGAGQMGNGIAHVCAQASLSVVLLDVAQDALDKAITTISRNMDRQAQRGTLSVEQKSAAIARIQTSTDYAAFAGCFFVVEAATEKESVKLAILRSLTPHLKPSCLLASNTSSIPITRLAAATDRPEKFIGMHFMNPVPVMKLVEIIRGIATTDATYALVRDLALGLDKTPVEVRDFPGFISNRVLLPMINEAIYALYEGVASAEAIDTVMKLGMNHPMGPLTLADFIGLDTCLAIMNVLYDGFGDSKYRPCPLLKQYVAAGWLGKKSGRGFYHYAADGKASAAGSNGAAKPAATTA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
6 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
7 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
8 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
9 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
10 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
11 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
12 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
13 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
14 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
15 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
16 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
17 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
18 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
19 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
20 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
21 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
22 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
23 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
24 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
25 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
26 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
27 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
28 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
29 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
30 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
31 2738541278 Niastella sp. CF465 Isolate Unclassified
32 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
33 2738541283 Pedobacter sp. OK701 Isolate Unclassified
34 2738541284 Pedobacter sp. YR016 Isolate Unclassified
35 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
36 2738541302 Pedobacter sp. CF074 Isolate Unclassified
37 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
38 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
39 2738543023 Pedobacter sp. OK628 Isolate Unclassified
40 2739367651 Pedobacter sp. OK291 Isolate Unclassified
41 2739367663 Pedobacter sp. YR510 Isolate Unclassified
42 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
43 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
44 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
45 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
46 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
47 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
48 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
49 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
50 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
51 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
52 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
53 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
54 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
55 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
56 2818991437 Pedobacter terrae 518 Isolate Unclassified
57 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
58 2818991444 Filimonas endophytica 3197 Isolate Unclassified
59 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
60 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
61 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
62 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
63 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
64 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
65 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
66 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
67 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
68 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
69 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
70 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
71 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
72 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
73 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
74 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
75 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
76 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
77 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
78 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
79 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
80 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
81 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
82 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
83 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
84 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
85 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
86 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
87 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
88 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
89 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
90 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
91 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
92 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
93 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
94 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
95 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
96 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
97 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
98 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
99 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
100 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
101 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
102 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
103 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
104 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
105 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
106 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
107 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
108 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
109 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
110 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
111 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
112 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
113 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
114 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
115 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
116 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
117 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
118 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
119 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
120 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
121 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
122 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
123 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
124 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
125 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
126 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
127 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
128 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
129 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
130 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
131 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
132 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
133 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
134 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
135 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
136 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
137 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
138 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
139 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
140 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
141 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
142 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
143 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
144 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
146 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
147 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
148 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
149 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
150 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
151 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
152 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
153 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
154 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
155 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
156 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
157 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
158 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
159 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
160 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
161 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
162 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
163 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
164 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
165 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
166 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
167 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
168 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
169 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
170 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
171 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
172 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
173 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
174 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
175 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
176 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
177 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
178 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
179 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
180 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
181 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
182 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
183 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
184 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
185 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
186 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
187 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
188 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
189 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
190 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
191 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
192 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
193 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
194 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
195 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
196 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
197 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
198 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
199 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
200 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
201 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
202 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
203 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
204 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
205 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
206 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
207 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
208 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
209 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
210 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
211 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
212 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
213 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
214 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
215 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
216 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
217 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
218 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
219 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
220 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
221 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
222 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
223 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
224 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
225 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
226 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
227 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
228 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
229 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
230 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
231 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
232 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
233 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
234 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
235 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
236 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
237 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
238 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
239 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
240 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
241 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
242 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
243 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
244 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
245 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
246 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
247 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
248 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
249 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
250 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
251 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
252 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
253 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
254 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
255 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
256 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
257 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
258 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
259 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
260 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
261 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
262 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
263 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
264 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
265 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
266 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
267 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
268 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
269 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
270 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
271 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
273 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
274 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
275 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
277 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
278 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
280 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
281 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
283 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
285 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
287 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
345 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
346 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
347 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
348 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
352 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
353 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
354 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
355 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
356 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
357 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
358 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
359 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
360 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
361 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
362 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
363 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
364 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
365 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
366 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
367 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
368 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
369 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
370 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
371 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
372 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
373 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
374 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
375 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
376 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
377 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
378 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
379 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
380 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
381 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
382 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
383 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
384 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
385 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
386 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
387 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
388 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
389 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
390 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
391 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
392 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
393 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
394 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
395 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
396 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
397 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
398 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
399 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
400 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
401 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
402 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
403 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
404 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
405 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
406 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
407 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
408 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
409 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
410 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
411 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
412 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
413 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
414 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
415 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
416 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
417 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
418 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
419 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
420 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
421 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
422 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
423 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
424 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
425 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
426 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
427 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
428 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
429 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
430 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
431 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
432 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
433 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
434 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
435 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
436 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
437 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
438 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
439 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
440 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
441 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
442 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
443 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
444 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
445 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
446 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
447 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
448 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
449 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
450 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
451 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
452 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
453 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
454 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
455 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
456 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
457 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
458 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
459 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
460 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
461 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
462 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
463 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
464 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
465 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
466 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
467 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
468 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
469 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
470 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
471 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
472 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
473 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
474 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
475 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
476 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
477 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
478 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
479 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
480 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
481 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
482 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
483 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
484 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
485 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
493 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
495 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
497 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
498 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
499 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
500 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
501 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
502 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
503 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
504 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
505 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
506 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
507 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
508 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
509 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
510 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
511 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
512 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
513 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
514 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
515 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
516 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
517 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
518 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
519 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
520 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
521 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
522 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
523 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
524 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
525 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
526 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
527 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
528 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
529 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
530 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
531 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
532 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
533 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
534 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
535 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
536 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
537 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
538 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
539 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
540 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
541 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
542 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
543 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
544 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
545 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
546 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
547 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
548 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
549 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
550 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
551 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
552 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
553 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
554 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
555 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
556 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
557 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
558 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
559 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
560 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
561 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
562 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
563 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
564 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
565 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
566 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
567 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
568 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
569 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
570 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
571 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
572 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
573 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
574 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
575 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.81
Metatranscriptomes 0.24
Isolates 7.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 6.56
Nodule 0.12
Rhizoplane 0.6
Rhizosphere 82.36
Stem 0
Stem Tuber 0
Unclassified 10.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 SwRhRL2b_contig_2173254 2162886007 Bacteria 3520
3 SwRhRL2b_contig_2434048 2162886007 Bacteria 3550
4 SwRhRL2b_contig_2678590 2162886007 Bacteria 9311
5 JGI24739J22299_10010206 3300001989 Bacteria 3489
6 JGI24739J22299_10013537 3300001989 Bacteria 2976
7 JGI24737J22298_10038410 3300001990 Bacteria 1474
8 JGI24735J21928_10027358 3300002067 Bacteria 1709
9 JGI25154J39366_1000019 3300002738 Bacteria 234419
10 JGI25152J39213_1000894 3300002773 Bacteria 14641
11 JGI25150J39212_1000051 3300002774 Bacteria 72281
12 Ga0006759J45824_1089253 3300003163 Bacteria 1179
13 JGI25151J46595_10000205 3300003187 Bacteria 72281
14 JGI25153J46596_10000144 3300003215 Bacteria 72281
15 JGI25153J46596_10000324 3300003215 Bacteria 34778
16 rootH1_10001951 3300003316 Bacteria 18746
17 rootH1_10004056 3300003316 Bacteria 10350
18 rootH1_10004056 3300003323 Bacteria 14628
19 rootH2_10000230 3300003320 Bacteria 58157
20 rootH2_10025473 3300003320 Bacteria 20163
21 rootH2_10030707 3300003320 Bacteria 10843
22 rootH2_10032420 3300003320 Bacteria 4102
23 rootH2_10105619 3300003320 Bacteria 5272
24 rootH2_10110894 3300003320 Bacteria 1212
25 rootH2_10141236 3300003320 Bacteria 9169
26 rootH2_10161305 3300003320 Bacteria 5862
27 rootL2_10036423 3300003322 Bacteria 5523
28 rootH1_10000188 3300003323 Bacteria 3844
29 rootH1_10009140 3300003323 Bacteria 116095
30 rootH1_10010000 3300003323 Bacteria 7142
31 rootH1_10020851 3300003323 Bacteria 4197
32 rootH1_10021086 3300003323 Bacteria 19057
33 rootH1_10031539 3300003323 Bacteria 15372
34 rootH1_10048247 3300003323 Bacteria 4942
35 rootH1_10087740 3300003323 Bacteria 2894
36 rootH1_10097804 3300003323 Bacteria 3577
37 rootH1_10196799 3300003323 Bacteria 7745
38 rootH1_10239411 3300003323 Bacteria 1233
39 JGI25160J50197_1013603 3300003354 Bacteria 2765
40 JGI25160J50197_1015581 3300003354 Bacteria 2490
41 JGI25160J50197_1045618 3300003354 Bacteria 968
42 Ga0006562J51391_1006008 3300003578 Bacteria 7207
43 Ga0032354_1091257 3300003693 Bacteria 1161
44 Ga0055542_1003789 3300003762 Bacteria 3931
45 Ga0055526_1011612 3300003771 Bacteria 3946
46 Ga0055536_1000030 3300003781 Bacteria 153926
47 Ga0055534_1003684 3300003784 Bacteria 4740
48 Ga0055528_1000360 3300003790 Bacteria 37052
49 Ga0055530_10000723 3300003791 Bacteria 27721
50 Ga0055530_10010766 3300003791 Bacteria 3343
51 Ga0055531_10000153 3300003794 Bacteria 80166
52 Ga0055531_10000156 3300003794 Bacteria 78858
53 Ga0055543_1009253 3300004625 Bacteria 2129
54 Ga0065165_1000402 3300005262 Bacteria 69844
55 Ga0065165_1000835 3300005262 Bacteria 40473
56 Ga0065165_1010985 3300005262 Bacteria 3839
57 Ga0065714_10002361 3300005288 Bacteria 37849
58 Ga0065714_10003057 3300005288 Bacteria 24007
59 Ga0065714_10003305 3300005288 Bacteria 11301
60 Ga0065714_10024048 3300005288 Bacteria 2169
61 Ga0065714_10064513 3300005288 Bacteria 45040
62 Ga0065714_10064933 3300005288 Bacteria 15206
63 Ga0065714_10067901 3300005288 Bacteria 5122
64 Ga0065714_10080906 3300005288 Bacteria 2409
65 Ga0065714_10132309 3300005288 Bacteria 1228
66 Ga0065714_10138407 3300005288 Bacteria 1190
67 Ga0065704_10000238 3300005289 Bacteria 87424
68 Ga0065704_10070140 3300005289 Bacteria 482257
69 Ga0065704_10070945 3300005289 Bacteria 14340
70 Ga0065704_10071089 3300005289 Bacteria 13245
71 Ga0065704_10071898 3300005289 Bacteria 9663
72 Ga0065704_10072798 3300005289 Bacteria 7990
73 Ga0065704_10173413 3300005289 Bacteria 1278
74 Ga0065712_10000992 3300005290 Bacteria 8632
75 Ga0065712_10099414 3300005290 Bacteria 2055
76 Ga0065712_10172843 3300005290 Bacteria 1234
77 Ga0065715_10101395 3300005293 Bacteria 3200
78 Ga0065715_10248732 3300005293 Bacteria 1174
79 Ga0065707_10172508 3300005295 Bacteria 1474
80 Ga0070658_10000019 3300005327 Bacteria 194742
81 Ga0070658_10000620 3300005327 Bacteria 30623
82 Ga0070676_10000165 3300005328 Bacteria 26705
83 Ga0070676_10004448 3300005328 Bacteria 7378
84 Ga0070676_10009053 3300005328 Bacteria 5386
85 Ga0070683_100000490 3300005329 Bacteria 27911
86 Ga0070683_100008790 3300005329 Bacteria 8589
87 Ga0070683_100019095 3300005329 Bacteria 6082
88 Ga0070683_100033031 3300005329 Bacteria 4715
89 Ga0070683_100037917 3300005329 Bacteria 4414
90 Ga0070683_100214037 3300005329 Bacteria 1831
91 Ga0070690_100014558 3300005330 Bacteria 4668
92 Ga0070690_100222605 3300005330 Bacteria 1323
93 Ga0070670_100023449 3300005331 Bacteria 5312
94 Ga0070670_100045231 3300005331 Bacteria 3783
95 Ga0070670_100045675 3300005331 Bacteria 3766
96 Ga0070670_100124091 3300005331 Bacteria 2228
97 Ga0070670_100322721 3300005331 Bacteria 1353
98 Ga0068869_100035053 3300005334 Bacteria 3555
99 Ga0068869_100222530 3300005334 Bacteria 1497
100 Ga0068869_100278780 3300005334 Bacteria 1344
101 Ga0070666_10000149 3300005335 Bacteria 47838
102 Ga0070666_10026992 3300005335 Bacteria 3757
103 Ga0070666_10045180 3300005335 Bacteria 2952
104 Ga0070666_10101986 3300005335 Bacteria 1978
105 Ga0070666_10113350 3300005335 Bacteria 1876
106 Ga0070666_10124451 3300005335 Bacteria 1789
107 Ga0070680_100013984 3300005336 Bacteria 6264
108 Ga0070680_100109344 3300005336 Bacteria 2300
109 Ga0070680_100290676 3300005336 Bacteria 1385
110 Ga0070682_100000005 3300005337 Bacteria 386439
111 Ga0070682_100000353 3300005337 Bacteria 31269
112 Ga0070682_100000455 3300005337 Bacteria 25816
113 Ga0070682_100052137 3300005337 Bacteria 2560
114 Ga0070682_100055112 3300005337 Bacteria 2496
115 Ga0070682_100080907 3300005337 Bacteria 2102
116 Ga0070682_100397247 3300005337 Bacteria 1042
117 Ga0068868_100001512 3300005338 Bacteria 15994
118 Ga0068868_100009759 3300005338 Bacteria 6925
119 Ga0068868_100035335 3300005338 Bacteria 3863
120 Ga0068868_100095591 3300005338 Bacteria 2399
121 Ga0068868_100315327 3300005338 Bacteria 1331
122 Ga0068868_100542909 3300005338 Bacteria 1024
123 Ga0070660_100013586 3300005339 Bacteria 5847
124 Ga0070660_100024845 3300005339 Bacteria 4450
125 Ga0070660_100028630 3300005339 Bacteria 4170
126 Ga0070660_100086147 3300005339 Bacteria 2471
127 Ga0070660_100118568 3300005339 Bacteria 2111
128 Ga0070660_100302607 3300005339 Bacteria 1311
129 Ga0070660_100338361 3300005339 Bacteria 1238
130 Ga0070689_100007084 3300005340 Bacteria 7810
131 Ga0070689_100027440 3300005340 Bacteria 4293
132 Ga0070689_100053460 3300005340 Bacteria 3126
133 Ga0070689_100063420 3300005340 Bacteria 2876
134 Ga0070689_100079996 3300005340 Bacteria 2565
135 Ga0070689_100104131 3300005340 Bacteria 2250
136 Ga0070691_10000108 3300005341 Bacteria 24654
137 Ga0070691_10012823 3300005341 Bacteria 3841
138 Ga0070687_100004245 3300005343 Bacteria 5694
139 Ga0070687_100017865 3300005343 Bacteria 3272
140 Ga0070687_100169158 3300005343 Bacteria 1299
141 Ga0070661_100013211 3300005344 Bacteria 5797
142 Ga0070661_100014716 3300005344 Bacteria 5517
143 Ga0070661_100212627 3300005344 Bacteria 1481
144 Ga0070668_100000116 3300005347 Bacteria 49265
145 Ga0070668_100041075 3300005347 Bacteria 3543
146 Ga0070668_100344354 3300005347 Bacteria 1260
147 Ga0070668_100445138 3300005347 Bacteria 1113
148 Ga0070669_100001238 3300005353 Bacteria 18500
149 Ga0070669_100021706 3300005353 Bacteria 4589
150 Ga0070675_100007791 3300005354 Bacteria 8295
151 Ga0070675_100021277 3300005354 Bacteria 5182
152 Ga0070675_100023522 3300005354 Bacteria 4928
153 Ga0070675_100027436 3300005354 Bacteria 4574
154 Ga0070675_100259399 3300005354 Bacteria 1523
155 Ga0070675_100449113 3300005354 Bacteria 1156
156 Ga0070671_100007630 3300005355 Bacteria 8653
157 Ga0070671_100173151 3300005355 Bacteria 1826
158 Ga0070671_100278658 3300005355 Bacteria 1422
159 Ga0070673_100000521 3300005364 Bacteria 20630
160 Ga0070673_100002836 3300005364 Bacteria 10670
161 Ga0070673_100026243 3300005364 Bacteria 4301
162 Ga0070673_100050105 3300005364 Bacteria 3263
163 Ga0070673_100086001 3300005364 Bacteria 2561
164 Ga0070673_100236278 3300005364 Bacteria 1587
165 Ga0070673_100317680 3300005364 Bacteria 1375
166 Ga0070673_100481225 3300005364 Bacteria 1120
167 Ga0070673_100601736 3300005364 Bacteria 1003
168 Ga0070688_100020624 3300005365 Bacteria 3834
169 Ga0070688_100058227 3300005365 Bacteria 2432
170 Ga0070688_100088239 3300005365 Bacteria 2022
171 Ga0070688_100198694 3300005365 Bacteria 1402
172 Ga0070659_100000854 3300005366 Bacteria 22245
173 Ga0070659_100015398 3300005366 Bacteria 5728
174 Ga0070659_100064896 3300005366 Bacteria 2891
175 Ga0070659_100082653 3300005366 Bacteria 2566
176 Ga0070659_100194917 3300005366 Bacteria 1666
177 Ga0070667_100000652 3300005367 Bacteria 33714
178 Ga0070667_100037432 3300005367 Bacteria 4067
179 Ga0070667_100062287 3300005367 Bacteria 3159
180 Ga0070667_100062561 3300005367 Bacteria 3153
181 Ga0070667_100097378 3300005367 Bacteria 2538
182 Ga0070667_100221593 3300005367 Bacteria 1684
183 Ga0070714_100019735 3300005435 Bacteria 5497
184 Ga0070714_100028118 3300005435 Bacteria 4662
185 Ga0070701_10063559 3300005438 Bacteria 1953
186 Ga0070705_100078932 3300005440 Bacteria 2015
187 Ga0070700_100313123 3300005441 Bacteria 1150
188 Ga0070708_100131227 3300005445 Bacteria 2319
189 Ga0070708_100149144 3300005445 Bacteria 2174
190 Ga0070663_100077955 3300005455 Bacteria 2427
191 Ga0070678_100021123 3300005456 Bacteria 4287
192 Ga0070678_100035033 3300005456 Bacteria 3501
193 Ga0070662_100000185 3300005457 Bacteria 36147
194 Ga0070662_100001619 3300005457 Bacteria 13887
195 Ga0070662_100043870 3300005457 Bacteria 3201
196 Ga0070662_100054985 3300005457 Bacteria 2886
197 Ga0070681_10005301 3300005458 Bacteria 12452
198 Ga0070681_10038676 3300005458 Bacteria 4782
199 Ga0070681_10147632 3300005458 Bacteria 2279
200 Ga0070681_10150936 3300005458 Bacteria 2250
201 Ga0070681_10203847 3300005458 Bacteria 1895
202 Ga0070681_10358338 3300005458 Bacteria 1369
203 Ga0068867_100001301 3300005459 Bacteria 17246
204 Ga0068867_100001831 3300005459 Bacteria 14825
205 Ga0068867_100017992 3300005459 Bacteria 5021
206 Ga0068867_100019059 3300005459 Bacteria 4885
207 Ga0068867_100042333 3300005459 Bacteria 3331
208 Ga0068867_100108711 3300005459 Bacteria 2127
209 Ga0068867_100112021 3300005459 Bacteria 2098
210 Ga0068867_100140983 3300005459 Bacteria 1884
211 Ga0068867_100153104 3300005459 Bacteria 1813
212 Ga0070685_10029690 3300005466 Bacteria 3040
213 Ga0070685_10055309 3300005466 Bacteria 2305
214 Ga0070685_10219722 3300005466 Bacteria 1244
215 Ga0070706_100001897 3300005467 Bacteria 21585
216 Ga0070698_100004450 3300005471 Bacteria 15399
217 Ga0070698_100006719 3300005471 Bacteria 12477
218 Ga0070698_100046304 3300005471 Bacteria 4447
219 Ga0070698_100065647 3300005471 Bacteria 3653
220 Ga0070698_100085777 3300005471 Bacteria 3135
221 Ga0070699_100000898 3300005518 Bacteria 27761
222 Ga0070699_100005118 3300005518 Bacteria 11532
223 Ga0070679_100000684 3300005530 Bacteria 29020
224 Ga0070679_100000973 3300005530 Bacteria 24934
225 Ga0070679_100017813 3300005530 Bacteria 6879
226 Ga0070679_100055296 3300005530 Bacteria 3952
227 Ga0070679_100058796 3300005530 Bacteria 3831
228 Ga0070679_100157974 3300005530 Bacteria 2242
229 Ga0070679_100165970 3300005530 Bacteria 2181
230 Ga0070679_100170362 3300005530 Bacteria 2150
231 Ga0070679_100249019 3300005530 Bacteria 1733
232 Ga0070684_100001352 3300005535 Bacteria 17565
233 Ga0070684_100003219 3300005535 Bacteria 12214
234 Ga0070684_100022740 3300005535 Bacteria 5233
235 Ga0070684_100024742 3300005535 Bacteria 5039
236 Ga0070684_100039209 3300005535 Bacteria 4073
237 Ga0070684_100086908 3300005535 Bacteria 2776
238 Ga0070684_100099941 3300005535 Bacteria 2590
239 Ga0070684_100209603 3300005535 Bacteria 1776
240 Ga0070684_100597227 3300005535 Bacteria 1026
241 Ga0068853_100003822 3300005539 Bacteria 11533
242 Ga0068853_100003840 3300005539 Bacteria 11512
243 Ga0068853_100010559 3300005539 Bacteria 7467
244 Ga0068853_100014740 3300005539 Bacteria 6415
245 Ga0068853_100018808 3300005539 Bacteria 5721
246 Ga0068853_100034968 3300005539 Bacteria 4266
247 Ga0068853_100040230 3300005539 Bacteria 3988
248 Ga0068853_100055268 3300005539 Bacteria 3422
249 Ga0068853_100057677 3300005539 Bacteria 3351
250 Ga0068853_100088732 3300005539 Bacteria 2715
251 Ga0068853_100134213 3300005539 Bacteria 2218
252 Ga0068853_100135766 3300005539 Bacteria 2205
253 Ga0068853_100304975 3300005539 Bacteria 1473
254 Ga0070672_100000038 3300005543 Bacteria 57709
255 Ga0070672_100019728 3300005543 Bacteria 4900
256 Ga0070672_100054264 3300005543 Bacteria 3137
257 Ga0070672_100329967 3300005543 Bacteria 1298
258 Ga0070686_100000009 3300005544 Bacteria 202453
259 Ga0070686_100084247 3300005544 Bacteria 2112
260 Ga0070686_100152913 3300005544 Bacteria 1618
261 Ga0070686_100253836 3300005544 Bacteria 1286
262 Ga0070686_100314805 3300005544 Bacteria 1165
263 Ga0070695_100171337 3300005545 Bacteria 1531
264 Ga0070696_100000338 3300005546 Bacteria 28429
265 Ga0070696_100096932 3300005546 Bacteria 2108
266 Ga0070693_100022172 3300005547 Bacteria 3372
267 Ga0070665_100000003 3300005548 Bacteria 811857
268 Ga0070665_100000013 3300005548 Bacteria 484927
269 Ga0070665_100000504 3300005548 Bacteria 55959
270 Ga0068855_100000424 3300005563 Bacteria 52152
271 Ga0068855_100002280 3300005563 Bacteria 23696
272 Ga0068855_100004799 3300005563 Bacteria 16505
273 Ga0068855_100004987 3300005563 Bacteria 16203
274 Ga0068855_100007323 3300005563 Bacteria 13371
275 Ga0068855_100032608 3300005563 Bacteria 6218
276 Ga0068855_100051013 3300005563 Bacteria 4874
277 Ga0068855_100091566 3300005563 Bacteria 3507
278 Ga0068855_100099457 3300005563 Bacteria 3350
279 Ga0068855_100133364 3300005563 Bacteria 2835
280 Ga0068855_100171289 3300005563 Bacteria 2459
281 Ga0068855_100239514 3300005563 Bacteria 2028
282 Ga0068855_100440427 3300005563 Bacteria 1423
283 Ga0070664_100000887 3300005564 Bacteria 23244
284 Ga0070664_100027435 3300005564 Bacteria 4732
285 Ga0070664_100096084 3300005564 Bacteria 2571
286 Ga0070664_100218197 3300005564 Bacteria 1706
287 Ga0070664_100269108 3300005564 Bacteria 1534
288 Ga0068857_100001871 3300005577 Bacteria 16937
289 Ga0068857_100030476 3300005577 Bacteria 4763
290 Ga0068857_100037108 3300005577 Bacteria 4316
291 Ga0068857_100086576 3300005577 Bacteria 2802
292 Ga0068857_100090030 3300005577 Bacteria 2746
293 Ga0068857_100099568 3300005577 Bacteria 2608
294 Ga0068857_100125945 3300005577 Bacteria 2308
295 Ga0068857_100150650 3300005577 Bacteria 2107
296 Ga0068857_100551347 3300005577 Bacteria 1086
297 Ga0068854_100000001 3300005578 Bacteria 608908
298 Ga0068854_100037888 3300005578 Bacteria 3387
299 Ga0068854_100058665 3300005578 Bacteria 2779
300 Ga0068854_100059696 3300005578 Bacteria 2757
301 Ga0068854_100162486 3300005578 Bacteria 1731
302 Ga0068854_100179910 3300005578 Bacteria 1651
303 Ga0068854_100388785 3300005578 Bacteria 1151
304 Ga0068856_100000092 3300005614 Bacteria 84781
305 Ga0068856_100015638 3300005614 Bacteria 7335
306 Ga0068856_100063370 3300005614 Bacteria 3653
307 Ga0068856_100065310 3300005614 Bacteria 3596
308 Ga0068856_100104346 3300005614 Bacteria 2828
309 Ga0068856_100117548 3300005614 Bacteria 2659
310 Ga0068852_100000207 3300005616 Bacteria 39824
311 Ga0068852_100000372 3300005616 Bacteria 30292
312 Ga0068852_100001739 3300005616 Bacteria 14830
313 Ga0068852_100049153 3300005616 Bacteria 3607
314 Ga0068852_100056318 3300005616 Bacteria 3397
315 Ga0068852_100074782 3300005616 Bacteria 2985
316 Ga0068852_100157239 3300005616 Bacteria 2119
317 Ga0068852_100319746 3300005616 Bacteria 1507
318 Ga0068852_100501042 3300005616 Bacteria 1209
319 Ga0068859_100000037 3300005617 Bacteria 165480
320 Ga0068859_100000297 3300005617 Bacteria 49416
321 Ga0068859_100012921 3300005617 Bacteria 8389
322 Ga0068859_100018938 3300005617 Bacteria 6915
323 Ga0068859_100032567 3300005617 Bacteria 5235
324 Ga0068859_100038533 3300005617 Bacteria 4795
325 Ga0068859_100041123 3300005617 Bacteria 4644
326 Ga0068859_100060520 3300005617 Bacteria 3815
327 Ga0068859_100066417 3300005617 Bacteria 3642
328 Ga0068859_100119093 3300005617 Bacteria 2706
329 Ga0068859_100125357 3300005617 Bacteria 2637
330 Ga0068864_100001608 3300005618 Bacteria 18629
331 Ga0068864_100033690 3300005618 Bacteria 4355
332 Ga0068864_100056794 3300005618 Bacteria 3381
333 Ga0068864_100082848 3300005618 Bacteria 2816
334 Ga0068864_100112111 3300005618 Bacteria 2430
335 Ga0068864_100153123 3300005618 Bacteria 2090
336 Ga0068861_100024095 3300005719 Bacteria 4397
337 Ga0068861_100046336 3300005719 Bacteria 3277
338 Ga0068861_100426160 3300005719 Bacteria 1183
339 Ga0068851_10000211 3300005834 Bacteria 27822
340 Ga0068851_10004628 3300005834 Bacteria 6210
341 Ga0068851_10058142 3300005834 Bacteria 1975
342 Ga0068851_10081233 3300005834 Bacteria 1693
343 Ga0068851_10159207 3300005834 Bacteria 1239
344 Ga0068851_10230800 3300005834 Bacteria 1043
345 Ga0068870_10026851 3300005840 Bacteria 2874
346 Ga0068863_100004928 3300005841 Bacteria 13158
347 Ga0068863_100010020 3300005841 Bacteria 9222
348 Ga0068863_100024182 3300005841 Bacteria 5795
349 Ga0068863_100087086 3300005841 Bacteria 2959
350 Ga0068863_100127460 3300005841 Bacteria 2429
351 Ga0068863_100229108 3300005841 Bacteria 1792
352 Ga0068863_100277979 3300005841 Bacteria 1622
353 Ga0068863_100459948 3300005841 Bacteria 1250
354 Ga0068858_100045372 3300005842 Bacteria 4073
355 Ga0068858_100191217 3300005842 Bacteria 1934
356 Ga0068860_100000060 3300005843 Bacteria 195631
357 Ga0068860_100001930 3300005843 Bacteria 21943
358 Ga0068860_100002513 3300005843 Bacteria 19240
359 Ga0068860_100003819 3300005843 Bacteria 15494
360 Ga0068860_100006581 3300005843 Bacteria 11668
361 Ga0068860_100008084 3300005843 Bacteria 10475
362 Ga0068860_100017699 3300005843 Bacteria 6941
363 Ga0068860_100023835 3300005843 Bacteria 5917
364 Ga0068860_100038051 3300005843 Bacteria 4603
365 Ga0068860_100519160 3300005843 Bacteria 1191
366 Ga0068862_100009911 3300005844 Bacteria 7870
367 Ga0068862_100019107 3300005844 Bacteria 5713
368 Ga0068862_100202793 3300005844 Bacteria 1789
369 Ga0068862_100445040 3300005844 Bacteria 1220
370 Ga0081539_10000377 3300005985 Bacteria 97368
371 Ga0070716_100207196 3300006173 Bacteria 1308
372 Ga0075366_10000849 3300006195 Bacteria 14722
373 Ga0075366_10021480 3300006195 Bacteria 3752
374 Ga0075366_10053427 3300006195 Bacteria 2400
375 Ga0075366_10118894 3300006195 Bacteria 1592
376 Ga0097621_100000054 3300006237 Bacteria 59756
377 Ga0097621_100000538 3300006237 Bacteria 26658
378 Ga0097621_100003328 3300006237 Bacteria 11058
379 Ga0097621_100007933 3300006237 Bacteria 7618
380 Ga0097621_100009287 3300006237 Bacteria 7135
381 Ga0097621_100088709 3300006237 Bacteria 2584
382 Ga0097621_100121199 3300006237 Bacteria 2218
383 Ga0097621_100122047 3300006237 Bacteria 2211
384 Ga0097621_100502867 3300006237 Bacteria 1098
385 Ga0068871_100000145 3300006358 Bacteria 46320
386 Ga0068871_100000452 3300006358 Bacteria 28201
387 Ga0068871_100003693 3300006358 Bacteria 10518
388 Ga0068871_100008083 3300006358 Bacteria 7553
389 Ga0068871_100019024 3300006358 Bacteria 5235
390 Ga0068871_100588731 3300006358 Bacteria 1011
391 Ga0075428_100025789 3300006844 Bacteria 6510
392 Ga0075428_100217290 3300006844 Bacteria 2065
393 Ga0075428_100482962 3300006844 Bacteria 1326
394 Ga0075430_100002888 3300006846 Bacteria 14388
395 Ga0075430_100088252 3300006846 Bacteria 2595
396 Ga0075429_100005622 3300006880 Bacteria 10805
397 Ga0075429_100035668 3300006880 Bacteria 4326
398 Ga0075429_100098599 3300006880 Bacteria 2549
399 Ga0068865_100000051 3300006881 Bacteria 65346
400 Ga0068865_100001621 3300006881 Bacteria 13188
401 Ga0068865_100034481 3300006881 Bacteria 3396
402 Ga0068865_100072902 3300006881 Bacteria 2440
403 Ga0068865_100135783 3300006881 Bacteria 1848
404 Ga0097620_100000037 3300006931 Bacteria 165480
405 Ga0097620_100000297 3300006931 Bacteria 49416
406 Ga0097620_100012921 3300006931 Bacteria 8389
407 Ga0097620_100018938 3300006931 Bacteria 6915
408 Ga0097620_100032569 3300006931 Bacteria 5235
409 Ga0097620_100038533 3300006931 Bacteria 4795
410 Ga0097620_100041125 3300006931 Bacteria 4644
411 Ga0097620_100060522 3300006931 Bacteria 3815
412 Ga0097620_100066417 3300006931 Bacteria 3642
413 Ga0097620_100119099 3300006931 Bacteria 2706
414 Ga0097620_100125356 3300006931 Bacteria 2637
415 Ga0097620_100184357 3300006931 Bacteria 2171
416 Ga0105251_10046770 3300009011 Bacteria 2081
417 Ga0105244_10000004 3300009036 Bacteria 492478
418 Ga0105244_10000050 3300009036 Bacteria 138868
419 Ga0105240_10000288 3300009093 Bacteria 98146
420 Ga0105240_10000486 3300009093 Bacteria 73492
421 Ga0105240_10001336 3300009093 Bacteria 42397
422 Ga0105240_10002538 3300009093 Bacteria 29284
423 Ga0105240_10002890 3300009093 Bacteria 27120
424 Ga0105240_10035851 3300009093 Bacteria 6388
425 Ga0105240_10036520 3300009093 Bacteria 6319
426 Ga0105240_10036908 3300009093 Bacteria 6283
427 Ga0105240_10039015 3300009093 Bacteria 6086
428 Ga0105240_10058938 3300009093 Bacteria 4793
429 Ga0105240_10090460 3300009093 Bacteria 3740
430 Ga0105240_10091789 3300009093 Bacteria 3709
431 Ga0105240_10113122 3300009093 Bacteria 3280
432 Ga0105240_10354242 3300009093 Bacteria 1664
433 Ga0105240_10356391 3300009093 Bacteria 1658
434 Ga0105240_10399782 3300009093 Bacteria 1548
435 Ga0105240_10618733 3300009093 Bacteria 1190
436 Ga0111539_10010702 3300009094 Bacteria 11550
437 Ga0111539_10057146 3300009094 Bacteria 4634
438 Ga0111539_10109423 3300009094 Bacteria 3243
439 Ga0111539_10430513 3300009094 Bacteria 1536
440 Ga0105245_10069229 3300009098 Bacteria 3199
441 Ga0105247_10124201 3300009101 Bacteria 1676
442 Ga0114129_10062706 3300009147 Bacteria 5192
443 Ga0114129_10217408 3300009147 Bacteria 2580
444 Ga0114129_10881896 3300009147 Bacteria 1135
445 Ga0105243_10000714 3300009148 Bacteria 31987
446 Ga0105241_10000144 3300009174 Bacteria 50819
447 Ga0105241_10000159 3300009174 Bacteria 49102
448 Ga0105241_10009012 3300009174 Bacteria 7337
449 Ga0105241_10016889 3300009174 Bacteria 5357
450 Ga0105241_10023476 3300009174 Bacteria 4574
451 Ga0105241_10026541 3300009174 Bacteria 4310
452 Ga0105241_10128325 3300009174 Bacteria 2050
453 Ga0105241_10479124 3300009174 Bacteria 1106
454 Ga0105242_10008025 3300009176 Bacteria 8131
455 Ga0105242_10012643 3300009176 Bacteria 6500
456 Ga0105242_10019823 3300009176 Bacteria 5268
457 Ga0105242_10074643 3300009176 Bacteria 2822
458 Ga0105242_10145055 3300009176 Bacteria 2064
459 Ga0105242_10201298 3300009176 Bacteria 1769
460 Ga0105242_10303376 3300009176 Bacteria 1458
461 Ga0105242_10455481 3300009176 Bacteria 1207
462 Ga0105242_10609050 3300009176 Bacteria 1056
463 Ga0105237_10000340 3300009545 Bacteria 65768
464 Ga0105237_10001447 3300009545 Bacteria 31365
465 Ga0105237_10002246 3300009545 Bacteria 24061
466 Ga0105237_10002692 3300009545 Bacteria 21745
467 Ga0105237_10003438 3300009545 Bacteria 18794
468 Ga0105237_10003874 3300009545 Bacteria 17567
469 Ga0105237_10006527 3300009545 Bacteria 12911
470 Ga0105237_10014277 3300009545 Bacteria 8317
471 Ga0105237_10020082 3300009545 Bacteria 6896
472 Ga0105237_10037688 3300009545 Bacteria 4885
473 Ga0105237_10050656 3300009545 Bacteria 4172
474 Ga0105237_10082559 3300009545 Bacteria 3204
475 Ga0105237_10574565 3300009545 Bacteria 1134
476 Ga0105238_10001478 3300009551 Bacteria 23578
477 Ga0105238_10033082 3300009551 Bacteria 5261
478 Ga0105238_10178291 3300009551 Bacteria 2101
479 Ga0105249_10006624 3300009553 Bacteria 10077
480 Ga0105249_10019222 3300009553 Bacteria 6092
481 Ga0105249_10020766 3300009553 Bacteria 5873
482 Ga0105249_10024592 3300009553 Bacteria 5414
483 Ga0105249_10039265 3300009553 Bacteria 4297
484 Ga0105249_10109118 3300009553 Bacteria 2613
485 Ga0105249_10140985 3300009553 Bacteria 2312
486 Ga0105249_10171192 3300009553 Bacteria 2106
487 Ga0105249_10181116 3300009553 Bacteria 2050
488 Ga0105249_10273496 3300009553 Bacteria 1684
489 Ga0105249_10283010 3300009553 Bacteria 1657
490 Ga0105249_10303249 3300009553 Bacteria 1603
491 Ga0105249_10312134 3300009553 Bacteria 1581
492 Ga0105239_10000002 3300010375 Bacteria 610298
493 Ga0105239_10003371 3300010375 Bacteria 19606
494 Ga0105239_10004649 3300010375 Bacteria 16319
495 Ga0105239_10005221 3300010375 Bacteria 15287
496 Ga0105239_10007261 3300010375 Bacteria 12728
497 Ga0105239_10007528 3300010375 Bacteria 12487
498 Ga0105239_10009550 3300010375 Bacteria 10916
499 Ga0105239_10013160 3300010375 Bacteria 9192
500 Ga0105239_10022636 3300010375 Bacteria 6928
501 Ga0105239_10026857 3300010375 Bacteria 6336
502 Ga0105239_10043544 3300010375 Bacteria 4921
503 Ga0105239_10048749 3300010375 Bacteria 4644
504 Ga0105239_10059029 3300010375 Bacteria 4210
505 Ga0105239_10064731 3300010375 Bacteria 4014
506 Ga0105239_10071969 3300010375 Bacteria 3799
507 Ga0105239_10105947 3300010375 Bacteria 3114
508 Ga0105239_10106259 3300010375 Bacteria 3110
509 Ga0105239_10156519 3300010375 Bacteria 2545
510 Ga0105239_10420467 3300010375 Bacteria 1514
511 Ga0105246_10031234 3300011119 Bacteria 3523
512 Ga0105246_10161198 3300011119 Bacteria 1709
513 Ga0105246_10204698 3300011119 Bacteria 1537
514 Ga0157373_10000002 3300013100 Bacteria 750094
515 Ga0157373_10000022 3300013100 Bacteria 164884
516 Ga0157373_10000240 3300013100 Bacteria 44977
517 Ga0157373_10003717 3300013100 Bacteria 11545
518 Ga0157373_10010053 3300013100 Bacteria 6971
519 Ga0157373_10016960 3300013100 Bacteria 5306
520 Ga0157373_10024848 3300013100 Bacteria 4337
521 Ga0157373_10041929 3300013100 Bacteria 3273
522 Ga0157373_10043691 3300013100 Bacteria 3200
523 Ga0157373_10156476 3300013100 Bacteria 1603
524 Ga0157373_10197718 3300013100 Bacteria 1417
525 Ga0157373_10218164 3300013100 Bacteria 1345
526 Ga0157373_10384962 3300013100 Bacteria 1004
527 Ga0157371_10000034 3300013102 Bacteria 223947
528 Ga0157371_10000052 3300013102 Bacteria 179522
529 Ga0157371_10000315 3300013102 Bacteria 62944
530 Ga0157371_10001806 3300013102 Bacteria 21624
531 Ga0157371_10001838 3300013102 Bacteria 21398
532 Ga0157371_10002042 3300013102 Bacteria 19900
533 Ga0157371_10002767 3300013102 Bacteria 16483
534 Ga0157371_10009079 3300013102 Bacteria 7857
535 Ga0157371_10019323 3300013102 Bacteria 5027
536 Ga0157371_10025742 3300013102 Bacteria 4284
537 Ga0157371_10030858 3300013102 Bacteria 3863
538 Ga0157371_10032647 3300013102 Bacteria 3745
539 Ga0157371_10032676 3300013102 Bacteria 3743
540 Ga0157371_10035173 3300013102 Bacteria 3591
541 Ga0157371_10051810 3300013102 Bacteria 2916
542 Ga0157371_10069008 3300013102 Bacteria 2502
543 Ga0157371_10103420 3300013102 Bacteria 2021
544 Ga0157371_10103550 3300013102 Bacteria 2020
545 Ga0157371_10145591 3300013102 Bacteria 1688
546 Ga0157371_10159989 3300013102 Bacteria 1608
547 Ga0157371_10442534 3300013102 Bacteria 955
548 Ga0157370_10001848 3300013104 Bacteria 26098
549 Ga0157370_10003381 3300013104 Bacteria 18754
550 Ga0157370_10006627 3300013104 Bacteria 12725
551 Ga0157370_10006991 3300013104 Bacteria 12324
552 Ga0157370_10007182 3300013104 Bacteria 12153
553 Ga0157370_10007499 3300013104 Bacteria 11852
554 Ga0157370_10010995 3300013104 Bacteria 9492
555 Ga0157370_10014889 3300013104 Bacteria 7935
556 Ga0157370_10022321 3300013104 Bacteria 6299
557 Ga0157370_10027225 3300013104 Bacteria 5637
558 Ga0157370_10035152 3300013104 Bacteria 4873
559 Ga0157370_10040466 3300013104 Bacteria 4500
560 Ga0157370_10041127 3300013104 Bacteria 4462
561 Ga0157370_10062774 3300013104 Bacteria 3522
562 Ga0157370_10064117 3300013104 Bacteria 3479
563 Ga0157370_10066514 3300013104 Bacteria 3408
564 Ga0157370_10116882 3300013104 Bacteria 2491
565 Ga0157370_10158000 3300013104 Bacteria 2109
566 Ga0157370_10191187 3300013104 Bacteria 1900
567 Ga0157370_10204600 3300013104 Bacteria 1831
568 Ga0157370_10295832 3300013104 Bacteria 1495
569 Ga0157370_10308836 3300013104 Bacteria 1459
570 Ga0157370_10502848 3300013104 Bacteria 1113
571 Ga0157369_10000002 3300013105 Bacteria 524510
572 Ga0157369_10000546 3300013105 Bacteria 49491
573 Ga0157369_10002262 3300013105 Bacteria 23146
574 Ga0157369_10012625 3300013105 Bacteria 9578
575 Ga0157369_10064429 3300013105 Bacteria 3947
576 Ga0157369_10123229 3300013105 Bacteria 2749
577 Ga0157369_10126597 3300013105 Bacteria 2708
578 Ga0157369_10165029 3300013105 Bacteria 2336
579 Ga0157369_10198778 3300013105 Bacteria 2105
580 Ga0157369_10214794 3300013105 Bacteria 2015
581 Ga0157369_10220944 3300013105 Bacteria 1983
582 Ga0157369_10228004 3300013105 Bacteria 1948
583 Ga0157369_10228096 3300013105 Bacteria 1948
584 Ga0157369_10229542 3300013105 Bacteria 1941
585 Ga0157369_10304194 3300013105 Bacteria 1658
586 Ga0157369_10310389 3300013105 Bacteria 1640
587 Ga0157374_10000007 3300013296 Bacteria 595643
588 Ga0157374_10001618 3300013296 Bacteria 18887
589 Ga0157374_10006545 3300013296 Bacteria 9895
590 Ga0157374_10009663 3300013296 Bacteria 8282
591 Ga0157374_10041358 3300013296 Bacteria 4248
592 Ga0157374_10046398 3300013296 Bacteria 4024
593 Ga0157374_10091140 3300013296 Bacteria 2907
594 Ga0157374_10109266 3300013296 Bacteria 2658
595 Ga0157374_10157830 3300013296 Bacteria 2208
596 Ga0157374_10201422 3300013296 Bacteria 1949
597 Ga0157374_10419676 3300013296 Bacteria 1337
598 Ga0157378_10006148 3300013297 Bacteria 10518
599 Ga0157378_10019271 3300013297 Bacteria 5997
600 Ga0157378_10019552 3300013297 Bacteria 5954
601 Ga0157378_10038445 3300013297 Bacteria 4241
602 Ga0157378_10079509 3300013297 Bacteria 2960
603 Ga0157378_10098479 3300013297 Bacteria 2666
604 Ga0157378_10141317 3300013297 Bacteria 2236
605 Ga0157378_10261061 3300013297 Bacteria 1662
606 Ga0157378_10536456 3300013297 Bacteria 1174
607 Ga0163162_10000064 3300013306 Bacteria 103542
608 Ga0163162_10000213 3300013306 Bacteria 53744
609 Ga0163162_10000330 3300013306 Bacteria 43379
610 Ga0163162_10000386 3300013306 Bacteria 40256
611 Ga0163162_10000487 3300013306 Bacteria 36809
612 Ga0163162_10000942 3300013306 Bacteria 27029
613 Ga0163162_10002936 3300013306 Bacteria 16266
614 Ga0163162_10009251 3300013306 Bacteria 9586
615 Ga0163162_10182430 3300013306 Bacteria 2225
616 Ga0163162_10192462 3300013306 Bacteria 2167
617 Ga0163162_10192528 3300013306 Bacteria 2167
618 Ga0163162_10354953 3300013306 Bacteria 1599
619 Ga0163162_10435430 3300013306 Bacteria 1443
620 Ga0163162_10499781 3300013306 Bacteria 1346
621 Ga0157372_10000186 3300013307 Bacteria 68701
622 Ga0157372_10001707 3300013307 Bacteria 23820
623 Ga0157372_10001805 3300013307 Bacteria 23257
624 Ga0157372_10003368 3300013307 Bacteria 17241
625 Ga0157372_10005795 3300013307 Bacteria 13155
626 Ga0157372_10010801 3300013307 Bacteria 9720
627 Ga0157372_10013159 3300013307 Bacteria 8828
628 Ga0157372_10015096 3300013307 Bacteria 8268
629 Ga0157372_10019462 3300013307 Bacteria 7317
630 Ga0157372_10053501 3300013307 Bacteria 4500
631 Ga0157372_10054631 3300013307 Bacteria 4456
632 Ga0157372_10070389 3300013307 Bacteria 3936
633 Ga0157372_10083574 3300013307 Bacteria 3617
634 Ga0157372_10136917 3300013307 Bacteria 2821
635 Ga0157372_10145531 3300013307 Bacteria 2733
636 Ga0157372_10150168 3300013307 Bacteria 2689
637 Ga0157372_10195265 3300013307 Bacteria 2345
638 Ga0157372_10429567 3300013307 Bacteria 1540
639 Ga0157372_10482947 3300013307 Bacteria 1444
640 Ga0157372_10578885 3300013307 Bacteria 1308
641 Ga0157372_10686438 3300013307 Bacteria 1192
642 Ga0157372_10864322 3300013307 Bacteria 1050
643 Ga0157375_10000178 3300013308 Bacteria 59417
644 Ga0157375_10000548 3300013308 Bacteria 33804
645 Ga0157375_10000813 3300013308 Bacteria 27357
646 Ga0157375_10015502 3300013308 Bacteria 6823
647 Ga0157375_10022597 3300013308 Bacteria 5791
648 Ga0157375_10032794 3300013308 Bacteria 4929
649 Ga0157375_10054458 3300013308 Bacteria 3940
650 Ga0157375_10076124 3300013308 Bacteria 3382
651 Ga0157375_10091194 3300013308 Bacteria 3108
652 Ga0157375_10182179 3300013308 Bacteria 2252
653 Ga0157375_10185943 3300013308 Bacteria 2231
654 Ga0157375_10439993 3300013308 Bacteria 1469
655 Ga0157375_10589767 3300013308 Bacteria 1271
656 Ga0163163_10000046 3300014325 Bacteria 133543
657 Ga0163163_10000218 3300014325 Bacteria 59659
658 Ga0163163_10002472 3300014325 Bacteria 15623
659 Ga0163163_10075694 3300014325 Bacteria 3359
660 Ga0163163_10137520 3300014325 Bacteria 2484
661 Ga0163163_10189930 3300014325 Bacteria 2102
662 Ga0157380_10008479 3300014326 Bacteria 7342
663 Ga0157380_10081357 3300014326 Bacteria 2649
664 Ga0157380_10102557 3300014326 Bacteria 2386
665 Ga0157380_10111320 3300014326 Bacteria 2301
666 Ga0182008_10000010 3300014497 Bacteria 301527
667 Ga0182008_10000129 3300014497 Bacteria 57359
668 Ga0182008_10000726 3300014497 Bacteria 23436
669 Ga0182008_10001151 3300014497 Bacteria 18248
670 Ga0157377_10008517 3300014745 Bacteria 5005
671 Ga0157377_10068354 3300014745 Bacteria 2047
672 Ga0157377_10068656 3300014745 Bacteria 2043
673 Ga0157377_10304580 3300014745 Bacteria 1053
674 Ga0157379_10000020 3300014968 Bacteria 92868
675 Ga0157379_10063857 3300014968 Bacteria 3291
676 Ga0157379_10104067 3300014968 Bacteria 2548
677 Ga0157376_10000297 3300014969 Bacteria 33467
678 Ga0157376_10001923 3300014969 Bacteria 13869
679 Ga0157376_10010993 3300014969 Bacteria 6651
680 Ga0157376_10152574 3300014969 Bacteria 2085
681 Ga0157376_10198771 3300014969 Bacteria 1843
682 Ga0157376_10386664 3300014969 Bacteria 1349
683 Ga0157376_10464473 3300014969 Bacteria 1237
684 Ga0182006_1000012 3300015261 Bacteria 394239
685 Ga0182006_1000505 3300015261 Bacteria 29828
686 Ga0182006_1002042 3300015261 Bacteria 11329
687 Ga0182006_1002694 3300015261 Bacteria 9542
688 Ga0182006_1003243 3300015261 Bacteria 8439
689 Ga0182006_1009439 3300015261 Bacteria 4370
690 Ga0182006_1061253 3300015261 Bacteria 1419
691 Ga0182007_10000001 3300015262 Bacteria 1127301
692 Ga0182007_10035102 3300015262 Bacteria 1690
693 Ga0182005_1000023 3300015265 Bacteria 246328
694 Ga0183373_1003 3300015682 Bacteria 558813
695 Ga0163161_10000007 3300017792 Bacteria 301614
696 Ga0163161_10000224 3300017792 Bacteria 51786
697 Ga0163161_10000950 3300017792 Bacteria 22231
698 Ga0163161_10001201 3300017792 Bacteria 19515
699 Ga0163161_10001536 3300017792 Bacteria 17042
700 Ga0163161_10002262 3300017792 Bacteria 13802
701 Ga0163161_10175262 3300017792 Bacteria 1641
702 Ga0206356_11441053 3300020070 Bacteria 10504
703 Ga0213872_10027527 3300021361 Bacteria 2609
704 Ga0213874_10055996 3300021377 Bacteria 1223
705 Ga0213876_10019878 3300021384 Bacteria 3547
706 Ga0213876_10041036 3300021384 Bacteria 2445
707 Ga0213876_10053991 3300021384 Bacteria 2122
708 Ga0213875_10001725 3300021388 Bacteria 13710
709 Ga0213875_10002342 3300021388 Bacteria 11447
710 Ga0213875_10046959 3300021388 Bacteria 2026
711 Ga0209436_100215 3300025208 Bacteria 26688
712 Ga0209258_100068 3300025242 Bacteria 286288
713 Ga0207425_1000007 3300025245 Bacteria 777411
714 Ga0209646_1000003 3300025246 Bacteria 1160860
715 Ga0209646_1000557 3300025246 Bacteria 15708
716 Ga0209646_1006591 3300025246 Bacteria 1943
717 Ga0209026_1000351 3300025250 Bacteria 43657
718 Ga0209026_1001293 3300025250 Bacteria 11348
719 Ga0209026_1001890 3300025250 Bacteria 8522
720 Ga0209148_1000182 3300025254 Bacteria 123558
721 Ga0209129_1000006 3300025258 Bacteria 777761
722 Ga0209233_1001459 3300025261 Bacteria 9332
723 Ga0209673_1000194 3300025273 Bacteria 122640
724 Ga0209130_1001519 3300025284 Bacteria 14922
725 Ga0209675_1000116 3300025291 Bacteria 111613
726 Ga0209676_1000001 3300025292 Bacteria 1852142
727 Ga0209025_1000025 3300025294 Bacteria 524454
728 Ga0209564_1002770 3300025295 Bacteria 13142
729 Ga0209564_1018457 3300025295 Bacteria 2656
730 Ga0209564_1032622 3300025295 Bacteria 1565
731 Ga0209758_1000016 3300025297 Bacteria 778557
732 Ga0209758_1005012 3300025297 Bacteria 10564
733 Ga0209758_1005299 3300025297 Bacteria 10069
734 Ga0209758_1006844 3300025297 Bacteria 7984
735 Ga0209050_1000018 3300025298 Bacteria 723263
736 Ga0209050_1000765 3300025298 Bacteria 46179
737 Ga0209050_1005793 3300025298 Bacteria 7598
738 Ga0207426_1000051 3300025302 Bacteria 391700
739 Ga0207426_1000698 3300025302 Bacteria 40078
740 Ga0207426_1003100 3300025302 Bacteria 9502
741 Ga0207426_1003377 3300025302 Bacteria 8755
742 Ga0207426_1033695 3300025302 Bacteria 1649
743 Ga0209257_1000001 3300025304 Bacteria 2274655
744 Ga0209257_1000005 3300025304 Bacteria 1592528
745 Ga0207697_10041542 3300025315 Bacteria 1888
746 Ga0207656_10001225 3300025321 Bacteria 8462
747 Ga0207656_10053808 3300025321 Bacteria 1748
748 Ga0207655_1000008 3300025728 Bacteria 734289
749 Ga0207655_1000480 3300025728 Bacteria 51524
750 Ga0207682_10005264 3300025893 Bacteria 5291
751 Ga0207642_10013913 3300025899 Bacteria 2952
752 Ga0207710_10001860 3300025900 Bacteria 10160
753 Ga0207680_10000122 3300025903 Bacteria 36234
754 Ga0207680_10026027 3300025903 Bacteria 3237
755 Ga0207647_10000011 3300025904 Bacteria 156667
756 Ga0207647_10000030 3300025904 Bacteria 106974
757 Ga0207647_10000093 3300025904 Bacteria 68094
758 Ga0207647_10175645 3300025904 Bacteria 1246
759 Ga0207645_10000652 3300025907 Bacteria 28838
760 Ga0207645_10000716 3300025907 Bacteria 27613
761 Ga0207645_10009152 3300025907 Bacteria 6867
762 Ga0207643_10001321 3300025908 Bacteria 14375
763 Ga0207705_10000069 3300025909 Bacteria 133094
764 Ga0207705_10013031 3300025909 Bacteria 6001
765 Ga0207705_10038520 3300025909 Bacteria 3423
766 Ga0207705_10134475 3300025909 Unclassified 1842
767 Ga0207705_10214348 3300025909 Bacteria 1461
768 Ga0207684_10022615 3300025910 Bacteria 5366
769 Ga0207654_10000765 3300025911 Bacteria 17701
770 Ga0207654_10003555 3300025911 Bacteria 7880
771 Ga0207654_10003795 3300025911 Bacteria 7619
772 Ga0207707_10000317 3300025912 Bacteria 50861
773 Ga0207707_10012901 3300025912 Bacteria 7273
774 Ga0207707_10031015 3300025912 Bacteria 4676
775 Ga0207707_10084341 3300025912 Bacteria 2775
776 Ga0207695_10000064 3300025913 Bacteria 346010
777 Ga0207695_10000130 3300025913 Bacteria 224214
778 Ga0207695_10000170 3300025913 Bacteria 192469
779 Ga0207695_10001063 3300025913 Bacteria 48025
780 Ga0207695_10001252 3300025913 Bacteria 43328
781 Ga0207695_10003137 3300025913 Bacteria 23613
782 Ga0207695_10005821 3300025913 Bacteria 16211
783 Ga0207695_10007582 3300025913 Bacteria 13759
784 Ga0207695_10022346 3300025913 Bacteria 7183
785 Ga0207695_10029276 3300025913 Bacteria 6090
786 Ga0207695_10061629 3300025913 Bacteria 3876
787 Ga0207695_10088895 3300025913 Bacteria 3108
788 Ga0207695_10120409 3300025913 Bacteria 2593
789 Ga0207695_10304710 3300025913 Bacteria 1484
790 Ga0207671_10001726 3300025914 Bacteria 24605
791 Ga0207671_10002818 3300025914 Bacteria 18085
792 Ga0207671_10004790 3300025914 Bacteria 12750
793 Ga0207671_10008461 3300025914 Bacteria 8723
794 Ga0207671_10021002 3300025914 Bacteria 4962
795 Ga0207671_10035702 3300025914 Bacteria 3687
796 Ga0207671_10056473 3300025914 Bacteria 2909
797 Ga0207660_10001972 3300025917 Bacteria 13679
798 Ga0207660_10070780 3300025917 Bacteria 2536
799 Ga0207660_10164749 3300025917 Bacteria 1713
800 Ga0207662_10007258 3300025918 Bacteria 6025
801 Ga0207662_10008205 3300025918 Bacteria 5714
802 Ga0207662_10052087 3300025918 Bacteria 2436
803 Ga0207662_10055033 3300025918 Bacteria 2374
804 Ga0207662_10087399 3300025918 Bacteria 1912
805 Ga0207657_10016490 3300025919 Bacteria 7124
806 Ga0207657_10023752 3300025919 Bacteria 5701
807 Ga0207657_10037451 3300025919 Bacteria 4330
808 Ga0207657_10049987 3300025919 Bacteria 3640
809 Ga0207657_10084882 3300025919 Bacteria 2653
810 Ga0207657_10159740 3300025919 Bacteria 1831
811 Ga0207649_10014837 3300025920 Bacteria 4370
812 Ga0207652_10000013 3300025921 Bacteria 222247
813 Ga0207652_10000035 3300025921 Bacteria 138263
814 Ga0207652_10000456 3300025921 Bacteria 42137
815 Ga0207652_10004312 3300025921 Bacteria 11594
816 Ga0207652_10011733 3300025921 Bacteria 7072
817 Ga0207652_10039216 3300025921 Bacteria 4019
818 Ga0207652_10163411 3300025921 Bacteria 1996
819 Ga0207681_10054364 3300025923 Bacteria 2722
820 Ga0207681_10069179 3300025923 Bacteria 2455
821 Ga0207681_10071584 3300025923 Bacteria 2419
822 Ga0207694_10016025 3300025924 Bacteria 5656
823 Ga0207694_10020911 3300025924 Bacteria 4955
824 Ga0207694_10066212 3300025924 Bacteria 2818
825 Ga0207694_10117772 3300025924 Bacteria 2118
826 Ga0207650_10005437 3300025925 Bacteria 8696
827 Ga0207650_10012262 3300025925 Bacteria 5915
828 Ga0207650_10188420 3300025925 Bacteria 1647
829 Ga0207650_10240509 3300025925 Bacteria 1463
830 Ga0207650_10295995 3300025925 Bacteria 1321
831 Ga0207650_10441955 3300025925 Bacteria 1081
832 Ga0207659_10012869 3300025926 Bacteria 5341
833 Ga0207659_10020238 3300025926 Bacteria 4396
834 Ga0207659_10060146 3300025926 Bacteria 2733
835 Ga0207659_10284745 3300025926 Bacteria 1352
836 Ga0207664_10023739 3300025929 Bacteria 4599
837 Ga0207644_10008482 3300025931 Bacteria 6728
838 Ga0207644_10014222 3300025931 Bacteria 5322
839 Ga0207644_10097628 3300025931 Bacteria 2201
840 Ga0207690_10003762 3300025932 Bacteria 8994
841 Ga0207690_10039633 3300025932 Bacteria 3075
842 Ga0207690_10060194 3300025932 Bacteria 2576
843 Ga0207690_10076772 3300025932 Bacteria 2320
844 Ga0207690_10270110 3300025932 Bacteria 1321
845 Ga0207706_10000243 3300025933 Bacteria 59842
846 Ga0207706_10000960 3300025933 Bacteria 29510
847 Ga0207706_10007335 3300025933 Bacteria 10196
848 Ga0207706_10029076 3300025933 Bacteria 4935
849 Ga0207706_10074559 3300025933 Bacteria 2984
850 Ga0207686_10000893 3300025934 Bacteria 17996
851 Ga0207686_10196389 3300025934 Bacteria 1442
852 Ga0207686_10292736 3300025934 Bacteria 1206
853 Ga0207709_10000385 3300025935 Bacteria 43862
854 Ga0207670_10010640 3300025936 Bacteria 5308
855 Ga0207670_10067313 3300025936 Bacteria 2464
856 Ga0207670_10069241 3300025936 Bacteria 2433
857 Ga0207670_10237539 3300025936 Bacteria 1402
858 Ga0207704_10000046 3300025938 Bacteria 86187
859 Ga0207704_10001715 3300025938 Bacteria 9809
860 Ga0207704_10055723 3300025938 Bacteria 2417
861 Ga0207704_10251117 3300025938 Bacteria 1328
862 Ga0207665_10198606 3300025939 Bacteria 1460
863 Ga0207691_10000013 3300025940 Bacteria 147349
864 Ga0207691_10023117 3300025940 Bacteria 5853
865 Ga0207691_10037040 3300025940 Bacteria 4518
866 Ga0207691_10151805 3300025940 Bacteria 2036
867 Ga0207691_10269584 3300025940 Bacteria 1466
868 Ga0207689_10018622 3300025942 Bacteria 5858
869 Ga0207689_10030399 3300025942 Bacteria 4501
870 Ga0207689_10037050 3300025942 Bacteria 4048
871 Ga0207689_10047129 3300025942 Bacteria 3560
872 Ga0207689_10134090 3300025942 Bacteria 2039
873 Ga0207689_10177894 3300025942 Bacteria 1754
874 Ga0207689_10273500 3300025942 Bacteria 1398
875 Ga0207689_10317289 3300025942 Bacteria 1293
876 Ga0207661_10002525 3300025944 Bacteria 12595
877 Ga0207661_10004578 3300025944 Bacteria 9691
878 Ga0207661_10034379 3300025944 Bacteria 3941
879 Ga0207661_10114832 3300025944 Bacteria 2283
880 Ga0207661_10319741 3300025944 Bacteria 1395
881 Ga0207679_10001836 3300025945 Bacteria 13215
882 Ga0207679_10085593 3300025945 Bacteria 2422
883 Ga0207679_10124602 3300025945 Bacteria 2057
884 Ga0207679_10168844 3300025945 Bacteria 1799
885 Ga0207679_10484342 3300025945 Bacteria 1102
886 Ga0207667_10000239 3300025949 Bacteria 76776
887 Ga0207667_10000409 3300025949 Bacteria 58374
888 Ga0207667_10000876 3300025949 Bacteria 38469
889 Ga0207667_10001727 3300025949 Bacteria 27517
890 Ga0207667_10003906 3300025949 Bacteria 18334
891 Ga0207667_10007947 3300025949 Bacteria 12658
892 Ga0207667_10009468 3300025949 Bacteria 11471
893 Ga0207667_10009667 3300025949 Bacteria 11342
894 Ga0207667_10010158 3300025949 Bacteria 11026
895 Ga0207667_10013674 3300025949 Bacteria 9276
896 Ga0207667_10038396 3300025949 Bacteria 5115
897 Ga0207667_10048086 3300025949 Bacteria 4512
898 Ga0207667_10051902 3300025949 Bacteria 4321
899 Ga0207667_10116102 3300025949 Bacteria 2758
900 Ga0207667_10195020 3300025949 Bacteria 2078
901 Ga0207651_10000468 3300025960 Bacteria 17037
902 Ga0207651_10104611 3300025960 Bacteria 2110
903 Ga0207651_10208329 3300025960 Bacteria 1572
904 Ga0207651_10436841 3300025960 Bacteria 1120
905 Ga0207651_10494415 3300025960 Bacteria 1056
906 Ga0207712_10004227 3300025961 Bacteria 9060
907 Ga0207712_10005693 3300025961 Bacteria 7856
908 Ga0207712_10008770 3300025961 Bacteria 6396
909 Ga0207712_10021924 3300025961 Bacteria 4199
910 Ga0207712_10096244 3300025961 Bacteria 2191
911 Ga0207668_10000295 3300025972 Bacteria 32756
912 Ga0207668_10123391 3300025972 Bacteria 1965
913 Ga0207668_10159509 3300025972 Bacteria 1756
914 Ga0207668_10325537 3300025972 Bacteria 1277
915 Ga0207668_10448565 3300025972 Bacteria 1100
916 Ga0207640_10000003 3300025981 Bacteria 505282
917 Ga0207640_10026917 3300025981 Bacteria 3498
918 Ga0207640_10093250 3300025981 Bacteria 2091
919 Ga0207658_10005989 3300025986 Bacteria 8313
920 Ga0207658_10058238 3300025986 Bacteria 2874
921 Ga0207658_10131215 3300025986 Bacteria 2013
922 Ga0207658_10131331 3300025986 Bacteria 2012
923 Ga0207677_10009715 3300026023 Bacteria 5419
924 Ga0207677_10528906 3300026023 Bacteria 1024
925 Ga0207703_10001005 3300026035 Bacteria 27079
926 Ga0207703_10030189 3300026035 Bacteria 4282
927 Ga0207703_10088782 3300026035 Bacteria 2595
928 Ga0207639_10001884 3300026041 Bacteria 14093
929 Ga0207639_10003462 3300026041 Bacteria 10618
930 Ga0207639_10003621 3300026041 Bacteria 10377
931 Ga0207639_10009995 3300026041 Bacteria 6558
932 Ga0207639_10015497 3300026041 Bacteria 5380
933 Ga0207639_10022128 3300026041 Bacteria 4577
934 Ga0207639_10095011 3300026041 Bacteria 2394
935 Ga0207639_10155125 3300026041 Bacteria 1922
936 Ga0207639_10315236 3300026041 Bacteria 1387
937 Ga0207639_10425471 3300026041 Bacteria 1201
938 Ga0207678_10019032 3300026067 Bacteria 6031
939 Ga0207678_10032984 3300026067 Bacteria 4512
940 Ga0207678_10133369 3300026067 Bacteria 2119
941 Ga0207678_10368085 3300026067 Bacteria 1241
942 Ga0207702_10001849 3300026078 Bacteria 20848
943 Ga0207702_10025828 3300026078 Bacteria 4875
944 Ga0207702_10034899 3300026078 Bacteria 4206
945 Ga0207702_10045223 3300026078 Bacteria 3704
946 Ga0207702_10082017 3300026078 Bacteria 2803
947 Ga0207702_10139415 3300026078 Bacteria 2192
948 Ga0207702_10335977 3300026078 Bacteria 1442
949 Ga0207702_10422683 3300026078 Bacteria 1289
950 Ga0207641_10000121 3300026088 Bacteria 114943
951 Ga0207641_10007872 3300026088 Bacteria 8841
952 Ga0207641_10017376 3300026088 Bacteria 5889
953 Ga0207641_10026539 3300026088 Bacteria 4782
954 Ga0207641_10169730 3300026088 Bacteria 1990
955 Ga0207641_10187368 3300026088 Bacteria 1899
956 Ga0207641_10220352 3300026088 Bacteria 1759
957 Ga0207641_10236040 3300026088 Bacteria 1702
958 Ga0207648_10000257 3300026089 Bacteria 57438
959 Ga0207648_10006608 3300026089 Bacteria 11516
960 Ga0207648_10013283 3300026089 Bacteria 7671
961 Ga0207648_10024715 3300026089 Bacteria 5358
962 Ga0207648_10038642 3300026089 Bacteria 4199
963 Ga0207648_10067003 3300026089 Bacteria 3131
964 Ga0207648_10295816 3300026089 Bacteria 1451
965 Ga0207676_10001058 3300026095 Bacteria 20966
966 Ga0207676_10013780 3300026095 Bacteria 5804
967 Ga0207676_10030767 3300026095 Bacteria 4032
968 Ga0207676_10078717 3300026095 Bacteria 2671
969 Ga0207676_10084159 3300026095 Bacteria 2592
970 Ga0207676_10222150 3300026095 Bacteria 1683
971 Ga0207674_10001258 3300026116 Bacteria 33135
972 Ga0207674_10026912 3300026116 Bacteria 6099
973 Ga0207674_10029400 3300026116 Bacteria 5785
974 Ga0207674_10050362 3300026116 Bacteria 4255
975 Ga0207674_10067559 3300026116 Bacteria 3599
976 Ga0207674_10108632 3300026116 Bacteria 2750
977 Ga0207674_10141577 3300026116 Bacteria 2364
978 Ga0207674_10254511 3300026116 Bacteria 1703
979 Ga0207674_10293853 3300026116 Bacteria 1573
980 Ga0207674_10526691 3300026116 Bacteria 1142
981 Ga0207675_100000762 3300026118 Bacteria 32039
982 Ga0207675_100016606 3300026118 Bacteria 6875
983 Ga0207675_100039146 3300026118 Bacteria 4425
984 Ga0207675_100083763 3300026118 Bacteria 2991
985 Ga0207675_100091523 3300026118 Bacteria 2860
986 Ga0207675_100165899 3300026118 Bacteria 2109
987 Ga0207675_100297429 3300026118 Bacteria 1571
988 Ga0207683_10020515 3300026121 Bacteria 5653
989 Ga0207683_10101735 3300026121 Bacteria 2566
990 Ga0207698_10001507 3300026142 Bacteria 13555
991 Ga0207698_10015124 3300026142 Bacteria 5158
992 Ga0207698_10021343 3300026142 Bacteria 4476
993 Ga0207698_10089483 3300026142 Bacteria 2514
994 Ga0207698_10133598 3300026142 Bacteria 2125
995 Ga0207698_10256356 3300026142 Bacteria 1604
996 Ga0207698_10272969 3300026142 Bacteria 1560
997 Ga0207698_10377523 3300026142 Bacteria 1347
998 Ga0207698_10471918 3300026142 Bacteria 1215
999 Ga0209281_1000116 3300027111 Bacteria 209707
1000 Ga0210002_1021460 3300027617 Bacteria 1044
1001 Ga0209974_10035082 3300027876 Bacteria 1665
1002 Ga0207428_10013193 3300027907 Bacteria 7233
1003 Ga0207428_10035988 3300027907 Bacteria 4041
1004 Ga0207428_10324915 3300027907 Bacteria 1136
1005 Ga0268266_10000024 3300028379 Bacteria 490820
1006 Ga0268266_10000078 3300028379 Bacteria 213632
1007 Ga0268266_10002084 3300028379 Bacteria 22148
1008 Ga0268266_10015921 3300028379 Bacteria 6435
1009 Ga0268265_10013369 3300028380 Bacteria 5577
1010 Ga0268265_10196297 3300028380 Bacteria 1747
1011 Ga0268265_10281367 3300028380 Bacteria 1488
1012 Ga0268265_10292717 3300028380 Bacteria 1462
1013 Ga0268264_10000109 3300028381 Bacteria 208477
1014 Ga0268264_10004538 3300028381 Bacteria 11831
1015 Ga0268264_10005427 3300028381 Bacteria 10800
1016 Ga0268264_10005664 3300028381 Bacteria 10587
1017 Ga0268264_10014974 3300028381 Bacteria 6365
1018 Ga0268264_10020798 3300028381 Bacteria 5362
1019 Ga0268264_10036652 3300028381 Bacteria 4041
1020 Ga0268264_10082072 3300028381 Bacteria 2757
1021 Ga0268264_10310871 3300028381 Bacteria 1487
1022 Ga0307517_10018951 3300028786 Bacteria 8861
1023 Ga0307517_10051260 3300028786 Bacteria 4171
1024 Ga0307515_10000010 3300028794 Bacteria 651586
1025 Ga0307515_10000061 3300028794 Bacteria 251841
1026 Ga0307515_10000469 3300028794 Bacteria 96345
1027 Ga0307515_10000778 3300028794 Bacteria 73451
1028 Ga0307515_10003029 3300028794 Bacteria 35637
1029 Ga0307515_10011558 3300028794 Bacteria 16742
1030 Ga0307515_10261059 3300028794 Bacteria 1468
1031 Ga0307515_10368975 3300028794 Bacteria 1073
1032 Ga0265338_10077514 3300028800 Bacteria 2809
1033 Ga0265338_10078686 3300028800 Bacteria 2779
1034 Ga0265324_10043029 3300029957 Bacteria 1560
1035 Ga0307511_10000455 3300030521 Bacteria 44094
1036 Ga0307511_10143505 3300030521 Bacteria 1394
1037 Ga0316177_1124334 3300030731 Bacteria 3217
1038 Ga0316183_1174733 3300030742 Bacteria 32145
1039 Ga0316181_1092606 3300030744 Bacteria 18862
1040 Ga0265331_10038163 3300031250 Bacteria 2349
1041 Ga0265327_10000051 3300031251 Bacteria 257963
1042 Ga0265327_10000219 3300031251 Bacteria 116606
1043 Ga0265327_10014024 3300031251 Bacteria 5277
1044 Ga0307513_10011590 3300031456 Bacteria 10947
1045 Ga0307513_10354056 3300031456 Bacteria 1215
1046 Ga0307509_10029926 3300031507 Bacteria 6031
1047 Ga0307509_10066464 3300031507 Bacteria 3783
1048 Ga0307509_10110275 3300031507 Bacteria 2758
1049 Ga0307408_100000801 3300031548 Bacteria 25175
1050 Ga0307408_100003540 3300031548 Bacteria 10633
1051 Ga0307408_100019914 3300031548 Bacteria 4521
1052 Ga0265313_10025066 3300031595 Bacteria 3171
1053 Ga0265314_10069177 3300031711 Bacteria 2370
1054 Ga0316576_10117690 3300031727 Bacteria 1994
1055 Ga0307516_10005541 3300031730 Bacteria 15056
1056 Ga0307516_10049737 3300031730 Bacteria 4117
1057 Ga0307516_10114825 3300031730 Bacteria 2490
1058 Ga0307405_10000002 3300031731 Bacteria 575196
1059 Ga0307405_10000026 3300031731 Bacteria 118954
1060 Ga0307405_10032191 3300031731 Bacteria 3097
1061 Ga0307413_10000019 3300031824 Bacteria 45584
1062 Ga0307413_10015140 3300031824 Bacteria 3944
1063 Ga0307410_10024479 3300031852 Bacteria 3772
1064 Ga0307406_10000038 3300031901 Bacteria 76386
1065 Ga0307406_10001880 3300031901 Bacteria 11460
1066 Ga0307406_10009431 3300031901 Bacteria 5472
1067 Ga0307406_10130235 3300031901 Bacteria 1765
1068 Ga0307407_10000032 3300031903 Bacteria 87003
1069 Ga0307407_10002036 3300031903 Bacteria 7714
1070 Ga0307412_10000007 3300031911 Bacteria 486267
1071 Ga0307412_10000018 3300031911 Bacteria 284374
1072 Ga0307412_10000175 3300031911 Bacteria 45704
1073 Ga0307412_10002066 3300031911 Bacteria 11141
1074 Ga0307412_10007859 3300031911 Bacteria 6073
1075 Ga0307412_10010470 3300031911 Bacteria 5342
1076 Ga0307412_10043584 3300031911 Bacteria 2922
1077 Ga0307409_100087536 3300031995 Bacteria 2539
1078 Ga0307416_100000003 3300032002 Bacteria 509060
1079 Ga0307416_100000045 3300032002 Bacteria 126832
1080 Ga0307416_100012288 3300032002 Bacteria 5760
1081 Ga0307416_100040565 3300032002 Bacteria 3618
1082 Ga0307414_10000001 3300032004 Bacteria 1352954
1083 Ga0307414_10000048 3300032004 Bacteria 130217
1084 Ga0307414_10000200 3300032004 Bacteria 40376
1085 Ga0307414_10008062 3300032004 Bacteria 5952
1086 Ga0307414_10008445 3300032004 Bacteria 5839
1087 Ga0307414_10021005 3300032004 Bacteria 4084
1088 Ga0307414_10042757 3300032004 Bacteria 3081
1089 Ga0307414_10063408 3300032004 Bacteria 2626
1090 Ga0307414_10079718 3300032004 Bacteria 2391
1091 Ga0307414_10105158 3300032004 Bacteria 2133
1092 Ga0307414_10108215 3300032004 Bacteria 2108
1093 Ga0307414_10187639 3300032004 Bacteria 1670
1094 Ga0307414_10364447 3300032004 Bacteria 1244
1095 Ga0307411_10000013 3300032005 Bacteria 145335
1096 Ga0307411_10011513 3300032005 Bacteria 4779
1097 Ga0307411_10158471 3300032005 Bacteria 1692
1098 Ga0307415_100257726 3300032126 Bacteria 1421
1099 Ga0307415_100480271 3300032126 Bacteria 1082
1100 Ga0316583_10002539 3300032133 Bacteria 6356
1101 Ga0316583_10058520 3300032133 Bacteria 1352
1102 Ga0307510_10001211 3300033180 Bacteria 27977
1103 Ga0307510_10029288 3300033180 Bacteria 6270
1104 Ga0316574_0096071 3300035398 Bacteria 1893
1105 Ga0373935_0118781 3300035692 Bacteria 1764
1106 Ga0373935_0132040 3300035692 Bacteria 1679
1107 Ga0373927_0157505 3300035695 Bacteria 1488
1108 Ga0373937_0250921 3300036401 Bacteria 1668
1109 Ga0316584_0065713 3300036712 Bacteria 2718
1110 Ga0373925_0130635 3300037068 Bacteria 1958
1111 Ga0395899_0000950 3300037312 Bacteria 27103
1112 Ga0395899_0002365 3300037312 Bacteria 15356
1113 Ga0395899_0002966 3300037312 Bacteria 13583
1114 Ga0395899_0021120 3300037312 Bacteria 4937
1115 Ga0395899_0026711 3300037312 Bacteria 4355
1116 Ga0395899_0092688 3300037312 Bacteria 2187
1117 Ga0395899_0139949 3300037312 Bacteria 1722
1118 Ga0395900_0000014 3300037418 Bacteria 386513
1119 Ga0395900_0002099 3300037418 Bacteria 22311
1120 Ga0395900_0019416 3300037418 Bacteria 6929
1121 Ga0395900_0020465 3300037418 Bacteria 6754
1122 Ga0395900_0022668 3300037418 Bacteria 6426
1123 Ga0395900_0057377 3300037418 Bacteria 4008
1124 Ga0395900_0085018 3300037418 Bacteria 3252
1125 Ga0395900_0163868 3300037418 Bacteria 2266
1126 Ga0395900_0200879 3300037418 Bacteria 2017
1127 Ga0395900_0297733 3300037418 Bacteria 1600
1128 Ga0395898_0003279 3300037466 Bacteria 18196
1129 Ga0395898_0053462 3300037466 Bacteria 3944
1130 Ga0395898_0108210 3300037466 Bacteria 2665
1131 Ga0395898_0143181 3300037466 Bacteria 2289
1132 Ga0395898_0175655 3300037466 Bacteria 2047
1133 Ga0395898_0233397 3300037466 Bacteria 1754
1134 Ga0395905_0000037 3300037471 Bacteria 261808
1135 Ga0395905_0000145 3300037471 Bacteria 116795
1136 Ga0395905_0007667 3300037471 Bacteria 10708
1137 Ga0395905_0010753 3300037471 Bacteria 8873
1138 Ga0395905_0146491 3300037471 Bacteria 2222
1139 Ga0395905_0177710 3300037471 Bacteria 1998
1140 Ga0436364_0124774 3300037853 Bacteria 12232
1141 Ga0436364_0263606 3300037853 Bacteria 1678
1142 Ga0436364_0335834 3300037853 Bacteria 10527
1143 Ga0436364_0527339 3300037853 Bacteria 2143
1144 Ga0436364_0680771 3300037853 Bacteria 4849
1145 Ga0436364_0711825 3300037853 Bacteria 1723
1146 Ga0436364_1395677 3300037853 Bacteria 5660
1147 Ga0395901_0000117 3300038443 Bacteria 105071
1148 Ga0395901_0008828 3300038443 Bacteria 10202
1149 Ga0395901_0020717 3300038443 Bacteria 6731
1150 Ga0395901_0028625 3300038443 Bacteria 5730
1151 Ga0395901_0108578 3300038443 Bacteria 2913
1152 Ga0395901_0150985 3300038443 Bacteria 2441
1153 Ga0395901_0221536 3300038443 Bacteria 1977
1154 Ga0395901_0285876 3300038443 Bacteria 1712
1155 Ga0436365_0187021 3300039437 Bacteria 7066
1156 Ga0436365_0614130 3300039437 Bacteria 27402
1157 Ga0436365_0692375 3300039437 Bacteria 2549
1158 Ga0436365_1167736 3300039437 Bacteria 1128
1159 Ga0436365_1431762 3300039437 Bacteria 1161
1160 Ga0436365_1705244 3300039437 Bacteria 1631
1161 Ga0436360_0238484 3300039438 Bacteria 1013
1162 Ga0436360_0552842 3300039438 Bacteria 1800
1163 Ga0436360_0858616 3300039438 Bacteria 1112
1164 Ga0436360_0912519 3300039438 Bacteria 1115
1165 Ga0436360_1172065 3300039438 Bacteria 1016
1166 Ga0436360_1357712 3300039438 Bacteria 2403
1167 Ga0436361_0108982 3300039447 Bacteria 1076
1168 Ga0436361_0191006 3300039447 Bacteria 14062
1169 Ga0436361_0286485 3300039447 Bacteria 6704
1170 Ga0436361_0640991 3300039447 Bacteria 7674
1171 Ga0436361_1096116 3300039447 Bacteria 1236
1172 Ga0436361_1131553 3300039447 Bacteria 1692
1173 Ga0436363_0107063 3300039450 Bacteria 1671
1174 Ga0436363_0156289 3300039450 Bacteria 1221
1175 Ga0436363_1014168 3300039450 Bacteria 1485
1176 Ga0436363_1327048 3300039450 Bacteria 3252
1177 Ga0436363_1429132 3300039450 Bacteria 1546
1178 Ga0436362_0528742 3300039453 Bacteria 2125
1179 Ga0436362_1161122 3300039453 Bacteria 1301
1180 Ga0439436_0018190 3300041404 Bacteria 2101
1181 Ga0439439_0021425 3300041406 Bacteria 1611
1182 Ga0439447_002503 3300041407 Bacteria 6684
1183 Ga0439466_0003065 3300041411 Bacteria 6506
1184 Ga0439465_0001507 3300041413 Bacteria 7555
1185 Ga0451807_0790979 3300041486 Bacteria 1428
1186 Ga0451837_1313197 3300041494 Bacteria 1446
1187 Ga0451841_0285170 3300041498 Bacteria 1048
1188 Ga0439441_032938 3300042001 Bacteria 1012
1189 Ga0439445_0002356 3300042004 Bacteria 4198
1190 Ga0439449_0051049 3300042007 Bacteria 1530
1191 Ga0439457_002980 3300042014 Bacteria 4704
1192 Ga0439462_0004484 3300042015 Bacteria 3411
1193 Ga0450899_006776 3300042135 Bacteria 1244
1194 Ga0451577_0001803 3300042876 Bacteria 27398
1195 Ga0451577_0009458 3300042876 Bacteria 9386
1196 Ga0451577_0052398 3300042876 Bacteria 3644
1197 Ga0451577_0053025 3300042876 Bacteria 3621
1198 Ga0466972_0000013 3300044658 Bacteria 229345
1199 Ga0466966_0000045 3300044684 Bacteria 92504
1200 Ga0466961_0002285 3300044693 Bacteria 11905
1201 Ga0466964_0057032 3300044706 Bacteria 1616
1202 Ga0453684_0000132 3300044712 Bacteria 331157
1203 Ga0453684_0001324 3300044712 Bacteria 73175
1204 Ga0453684_0001992 3300044712 Bacteria 52379
1205 Ga0453684_0085930 3300044712 Bacteria 3907
1206 Ga0453684_0116908 3300044712 Bacteria 3228
1207 Ga0453684_0124951 3300044712 Bacteria 3098
1208 Ga0453684_0206628 3300044712 Bacteria 2285
1209 Ga0453684_0208460 3300044712 Bacteria 2274
1210 Ga0453684_0237329 3300044712 Bacteria 2101
1211 Ga0453684_0440157 3300044712 Bacteria 1453
1212 Ga0453684_0939380 3300044712 Bacteria 924
1213 Ga0466968_0106048 3300044735 Bacteria 1259
1214 Ga0466970_0019422 3300044765 Bacteria 3524
1215 Ga0466957_0000156 3300044842 Bacteria 29671
1216 Ga0466957_0192797 3300044842 Bacteria 1336
1217 Ga0466957_0301490 3300044842 Bacteria 1077
1218 Ga0466959_0000023 3300045049 Bacteria 124545
1219 Ga0466959_0002751 3300045049 Bacteria 11327
1220 Ga0466959_0117825 3300045049 Bacteria 1890
1221 Ga0466959_0133933 3300045049 Bacteria 1755
1222 Ga0451576_0000012 3300045051 Bacteria 674684
1223 Ga0451576_0003337 3300045051 Bacteria 22238
1224 Ga0451576_0010351 3300045051 Bacteria 10708
1225 Ga0451576_0035608 3300045051 Bacteria 5280
1226 Ga0451576_0385547 3300045051 Bacteria 1469
1227 Ga0451576_0817388 3300045051 Bacteria 978
1228 Ga0466967_0039205 3300045976 Bacteria 4071
1229 Ga0495627_000002 3300046453 Bacteria 903861
1230 Ga0495627_039056 3300046453 Bacteria 1465
1231 Ga0495592_0087566 3300046454 Bacteria 2240
1232 Ga0495590_0016811 3300046457 Bacteria 2640
1233 Ga0495638_0000003 3300046460 Bacteria 888792
1234 Ga0495638_0028263 3300046460 Bacteria 3623
1235 Ga0495650_0000014 3300046471 Bacteria 581606
1236 Ga0495650_0075015 3300046471 Bacteria 1317
1237 Ga0495580_0110399 3300046472 Bacteria 1910
1238 Ga0495664_0039169 3300046477 Bacteria 2800
1239 Ga0495585_0001092 3300046492 Bacteria 22350
1240 Ga0495585_0002645 3300046492 Bacteria 12593
1241 Ga0495596_0005716 3300046500 Bacteria 5836
1242 Ga0495596_0071405 3300046500 Bacteria 1348
1243 Ga0495607_0117693 3300046501 Bacteria 1399
1244 Ga0495606_0000096 3300046507 Bacteria 151500
1245 Ga0495606_0009086 3300046507 Bacteria 8468
1246 Ga0495606_0077987 3300046507 Bacteria 2067
1247 Ga0495606_0096851 3300046507 Bacteria 1804
1248 Ga0495610_0000009 3300046512 Bacteria 554843
1249 Ga0495610_0000427 3300046512 Bacteria 43336
1250 Ga0495610_0000472 3300046512 Bacteria 41524
1251 Ga0495610_0000791 3300046512 Bacteria 29641
1252 Ga0495616_0006078 3300046513 Bacteria 7357
1253 Ga0495628_0107843 3300046516 Bacteria 2144
1254 Ga0495630_0046886 3300046517 Bacteria 3231
1255 Ga0495630_0087576 3300046517 Bacteria 2352
1256 Ga0495631_0014272 3300046518 Bacteria 3838
1257 Ga0495632_0001031 3300046519 Bacteria 24102
1258 Ga0495637_0046286 3300046520 Bacteria 1841
1259 Ga0495643_0007955 3300046522 Bacteria 6760
1260 Ga0495643_0212208 3300046522 Bacteria 923
1261 Ga0495648_0022634 3300046524 Bacteria 4320
1262 Ga0495652_0166635 3300046529 Bacteria 1705
1263 Ga0495652_0363210 3300046529 Bacteria 1034
1264 Ga0495654_0000001 3300046530 Bacteria 1513197
1265 Ga0495586_0209159 3300046535 Bacteria 1107
1266 Ga0495587_0163765 3300046536 Bacteria 1265
1267 Ga0495609_0000130 3300046538 Bacteria 81359
1268 Ga0495609_0065609 3300046538 Bacteria 1600
1269 Ga0495621_0010363 3300046539 Bacteria 2849
1270 Ga0495633_0000002 3300046558 Bacteria 488754
1271 Ga0495633_0000058 3300046558 Bacteria 147584
1272 Ga0495633_0000081 3300046558 Bacteria 125903
1273 Ga0495633_0003017 3300046558 Bacteria 11482
1274 Ga0495633_0050424 3300046558 Bacteria 1962
1275 Ga0495668_0000003 3300046616 Bacteria 695023
1276 Ga0495668_0000677 3300046616 Bacteria 41080
1277 Ga0495668_0001458 3300046616 Bacteria 22752
1278 Ga0495634_0004906 3300046642 Bacteria 10354
1279 Ga0495611_0006112 3300046648 Bacteria 5137
1280 Ga0495625_0000003 3300046660 Bacteria 686847
1281 Ga0495625_0000846 3300046660 Bacteria 41815
1282 Ga0495625_0001053 3300046660 Bacteria 36204
1283 Ga0495625_0007782 3300046660 Bacteria 9252
1284 Ga0495625_0081162 3300046660 Bacteria 2257
1285 Ga0495625_0219254 3300046660 Bacteria 1247
1286 Ga0495661_0001756 3300046665 Bacteria 17434
1287 Ga0495661_0063170 3300046665 Bacteria 2190
1288 Ga0495657_0156168 3300046675 Bacteria 1414
1289 Ga0495623_0043173 3300046679 Bacteria 2870
1290 Ga0495658_0011980 3300046683 Bacteria 4378
1291 Ga0495658_0024033 3300046683 Bacteria 3241
1292 Ga0495658_0271174 3300046683 Bacteria 1070
1293 Ga0495613_0086982 3300046689 Bacteria 2266
1294 Ga0495649_0000002 3300046694 Bacteria 1093458
1295 Ga0495674_0032089 3300047319 Bacteria 4767
1296 Ga0495672_0011633 3300047320 Bacteria 6197
1297 Ga0495672_0012039 3300047320 Bacteria 6058
1298 Ga0495672_0139392 3300047320 Bacteria 1268
1299 Ga0495687_000014 3300047443 Bacteria 366896
1300 Ga0495687_001036 3300047443 Bacteria 27592
1301 Ga0495687_001602 3300047443 Bacteria 20428
1302 Ga0495673_0045627 3300047469 Bacteria 1947
1303 Ga0495684_0133622 3300047471 Bacteria 1862
1304 Ga0495684_0272103 3300047471 Bacteria 1225
1305 Ga0495686_0000022 3300047472 Bacteria 403456
1306 Ga0495686_0000034 3300047472 Bacteria 325038
1307 Ga0495686_0000367 3300047472 Bacteria 73112
1308 Ga0495686_0001743 3300047472 Bacteria 22322
1309 Ga0495686_0003019 3300047472 Bacteria 14949
1310 Ga0495686_0010729 3300047472 Bacteria 6497
1311 Ga0495686_0036083 3300047472 Bacteria 3173
1312 Ga0495686_0048951 3300047472 Bacteria 2662
1313 Ga0495614_0017370 3300048089 Bacteria 3126
1314 Ga0496101_0013706 3300048904 Bacteria 5437
1315 Ga0496103_0059333 3300048906 Bacteria 2377
1316 Ga0496108_0014827 3300048911 Bacteria 6360
1317 Ga0496109_0340482 3300048912 Bacteria 1416
1318 Ga0496114_0294137 3300048917 Bacteria 1433
1319 Ga0496114_0368449 3300048917 Bacteria 1271
1320 Ga0496115_0087065 3300048918 Bacteria 2549
1321 Ga0496115_0281224 3300048918 Bacteria 1366
1322 Ga0496116_0000022 3300048919 Bacteria 482506
1323 Ga0496116_0000047 3300048919 Bacteria 315121
1324 Ga0496117_0000074 3300048920 Bacteria 232732
1325 Ga0496118_0001188 3300048921 Bacteria 40165
1326 Ga0496118_0023205 3300048921 Bacteria 5396
1327 Ga0496118_0153203 3300048921 Bacteria 1439
1328 Ga0496119_0000426 3300048922 Bacteria 58016
1329 Ga0496121_0000343 3300048924 Bacteria 96972
1330 Ga0496121_0009602 3300048924 Bacteria 11085
1331 Ga0496121_0064683 3300048924 Bacteria 2981
1332 Ga0496122_0000354 3300048925 Bacteria 98798
1333 Ga0496122_0000357 3300048925 Bacteria 98456
1334 Ga0496122_0000598 3300048925 Bacteria 74168
1335 Ga0496122_0000789 3300048925 Bacteria 60958
1336 Ga0496122_0003624 3300048925 Bacteria 20088
1337 Ga0496122_0014216 3300048925 Bacteria 7713
1338 Ga0496123_0001991 3300048926 Bacteria 26413
1339 Ga0496123_0002415 3300048926 Bacteria 23304
1340 Ga0496123_0007740 3300048926 Bacteria 10030
1341 Ga0496123_0094824 3300048926 Bacteria 1757
1342 Ga0496124_0005359 3300048927 Bacteria 14481
1343 Ga0496124_0092182 3300048927 Bacteria 2468
1344 Ga0496124_0175115 3300048927 Bacteria 1657
1345 Ga0496125_0000050 3300048928 Bacteria 286703
1346 Ga0496125_0000286 3300048928 Bacteria 99915
1347 Ga0496125_0001036 3300048928 Bacteria 43109
1348 Ga0496125_0020214 3300048928 Bacteria 6256
1349 Ga0496126_0001468 3300048929 Bacteria 36714
1350 Ga0496126_0009501 3300048929 Bacteria 10319
1351 Ga0496126_0057468 3300048929 Bacteria 3512
1352 Ga0496126_0065319 3300048929 Unclassified 3257
1353 Ga0496126_0100998 3300048929 Bacteria 2524
1354 Ga0496126_0272877 3300048929 Bacteria 1403
1355 Ga0501298_000106 3300049521 Bacteria 9717
1356 Ga0501031_0000757 3300049568 Bacteria 19442
1357 Ga0501032_0007292 3300049569 Bacteria 8093
1358 Ga0501032_0023495 3300049569 Bacteria 4258
1359 Ga0501032_0065860 3300049569 Bacteria 2422
1360 Ga0501033_0000028 3300049570 Bacteria 161436
1361 Ga0501033_0012561 3300049570 Bacteria 6462
1362 Ga0501034_0000074 3300049571 Bacteria 175369
1363 Ga0501034_0000115 3300049571 Bacteria 146825
1364 Ga0501034_0000363 3300049571 Bacteria 77256
1365 Ga0501034_0085615 3300049571 Bacteria 3153
1366 Ga0501034_0093171 3300049571 Bacteria 3009
1367 Ga0501034_0190810 3300049571 Bacteria 2011
1368 Ga0501034_0255519 3300049571 Bacteria 1696
1369 Ga0501034_0298918 3300049571 Bacteria 1547
1370 Ga0501036_0002989 3300049572 Bacteria 13442
1371 Ga0501036_0061774 3300049572 Bacteria 3173
1372 Ga0501036_0190302 3300049572 Bacteria 1726
1373 Ga0501037_0153691 3300049573 Bacteria 1643
1374 Ga0501038_0013147 3300049574 Bacteria 7549
1375 Ga0501038_0209966 3300049574 Bacteria 1558
1376 Ga0501039_0003283 3300049575 Bacteria 12098
1377 Ga0501043_0002401 3300049579 Bacteria 15856
1378 Ga0501043_0140515 3300049579 Bacteria 1891
1379 Ga0501043_0211969 3300049579 Bacteria 1501
1380 Ga0501046_0015984 3300049580 Bacteria 6294
1381 Ga0501047_0006088 3300049581 Bacteria 11338
1382 Ga0501047_0007483 3300049581 Bacteria 10275
1383 Ga0501047_0018935 3300049581 Bacteria 6603
1384 Ga0501047_0021293 3300049581 Bacteria 6224
1385 Ga0501047_0128891 3300049581 Bacteria 2410
1386 Ga0501048_0027732 3300049582 Bacteria 4112
1387 Ga0501048_0035049 3300049582 Bacteria 3615
1388 Ga0501048_0330527 3300049582 Bacteria 1086
1389 Ga0501068_0203530 3300049584 Bacteria 1256
1390 Ga0501069_0215862 3300049585 Bacteria 1114
1391 Ga0501069_0216348 3300049585 Bacteria 1113
1392 Ga0501070_0014181 3300049586 Bacteria 6706
1393 Ga0501070_0167148 3300049586 Bacteria 1812
1394 Ga0501070_0208243 3300049586 Bacteria 1605
1395 Ga0501070_0426641 3300049586 Bacteria 1070
1396 Ga0501073_0058809 3300049589 Bacteria 2686
1397 Ga0501073_0094268 3300049589 Bacteria 2079
1398 Ga0501074_0000815 3300049590 Bacteria 19756
1399 Ga0501076_0276247 3300049592 Bacteria 1376
1400 Ga0501206_019302 3300049653 Bacteria 964
1401 Ga0501207_002619 3300049654 Bacteria 2343
1402 Ga0501207_012747 3300049654 Bacteria 1267
1403 Ga0501223_001886 3300049663 Bacteria 4727
1404 Ga0501223_002515 3300049663 Bacteria 4058
1405 Ga0501223_005427 3300049663 Bacteria 2678
1406 Ga0501224_001146 3300049664 Bacteria 3461
1407 Ga0501235_002262 3300049669 Bacteria 4144
1408 Ga0501243_002218 3300049675 Bacteria 2830
1409 Ga0501249_000021 3300049679 Bacteria 94598
1410 Ga0501257_001165 3300049686 Bacteria 5373
1411 Ga0501259_000663 3300049688 Bacteria 5508
1412 Ga0501259_006093 3300049688 Bacteria 1914
1413 Ga0501261_001376 3300049690 Bacteria 2979
1414 Ga0501219_000283 3300049703 Bacteria 9024
1415 Ga0501221_001422 3300049704 Bacteria 3956
1416 Ga0501225_0000104 3300049705 Bacteria 26591
1417 Ga0501225_0000966 3300049705 Bacteria 8993
1418 Ga0501225_0008139 3300049705 Bacteria 3015
1419 Ga0501225_0020594 3300049705 Bacteria 1823
1420 Ga0501225_0037668 3300049705 Bacteria 1333
1421 Ga0501234_015381 3300049707 Bacteria 1204
1422 Ga0501245_001190 3300049708 Bacteria 3360
1423 Ga0501080_0030430 3300049742 Bacteria 5029
1424 Ga0501080_0193060 3300049742 Bacteria 1871
1425 Ga0501080_0216519 3300049742 Bacteria 1754
1426 Ga0501080_0219204 3300049742 Bacteria 1741
1427 Ga0501083_0094683 3300049744 Bacteria 1971
1428 Ga0501083_0232891 3300049744 Bacteria 1199
1429 Ga0501232_005086 3300049757 Bacteria 1290
1430 Ga0501241_000046 3300049758 Bacteria 36316
1431 Ga0501241_001023 3300049758 Bacteria 5913
1432 Ga0501241_004726 3300049758 Bacteria 2542
1433 Ga0501241_010751 3300049758 Bacteria 1662
1434 Ga0501264_000172 3300049761 Bacteria 10543
1435 Ga0501266_000005 3300049763 Bacteria 346750
1436 Ga0501266_003461 3300049763 Bacteria 1957
1437 Ga0501269_000938 3300049766 Bacteria 4248
1438 Ga0501269_006791 3300049766 Bacteria 1382
1439 Ga0501279_010928 3300049775 Bacteria 1224
1440 Ga0501280_000623 3300049776 Bacteria 8087
1441 Ga0501035_0005702 3300049822 Bacteria 11748
1442 Ga0501035_0006466 3300049822 Bacteria 11007
1443 Ga0501035_0012462 3300049822 Bacteria 7857
1444 Ga0501035_0182177 3300049822 Bacteria 1809
1445 Ga0501035_0443991 3300049822 Bacteria 1074
1446 Ga0501044_0001410 3300049823 Bacteria 28196
1447 Ga0501044_0013587 3300049823 Bacteria 8799
1448 Ga0501044_0044477 3300049823 Bacteria 4607
1449 Ga0501044_0074255 3300049823 Bacteria 3455
1450 Ga0501044_0075975 3300049823 Bacteria 3411
1451 Ga0501044_0169498 3300049823 Bacteria 2155
1452 Ga0501044_0534921 3300049823 Bacteria 1070
1453 Ga0501045_0000380 3300049824 Bacteria 26716
1454 Ga0501045_0186382 3300049824 Bacteria 1546
1455 Ga0501284_00041 3300050005 Bacteria 50589
1456 nmdc:mga0k408_10430_c1 3300050493 Bacteria 5023
1457 nmdc:mga0k408_175_c1 3300050493 Bacteria 32183
1458 nmdc:mga0k408_70668_c1 3300050493 Bacteria 2037
1459 nmdc:mga05p37_1489_c1 3300050507 Bacteria 27247
1460 nmdc:mga05p37_235392_c1 3300050507 Bacteria 2204
1461 nmdc:mga09592_320113_c1 3300050508 Bacteria 1344
1462 nmdc:mga09592_33821_c1 3300050508 Bacteria 4270
1463 nmdc:mga09592_58488_c1 3300050508 Bacteria 3259
1464 nmdc:mga09592_8374_c1 3300050508 Bacteria 8405
1465 nmdc:mga0qj67_44032_c1 3300050509 Bacteria 3516
1466 nmdc:mga0qj67_79577_c1 3300050509 Bacteria 2625
1467 nmdc:mga08y16_130587_c1 3300050511 Bacteria 2612
1468 nmdc:mga08y16_226436_c1 3300050511 Bacteria 1935
1469 nmdc:mga08y16_29337_c1 3300050511 Bacteria 5796
1470 nmdc:mga08y16_58894_c1 3300050511 Bacteria 4013
1471 nmdc:mga08y16_8584_c1 3300050511 Bacteria 10706
1472 nmdc:mga0n895_193849_c1 3300050512 Bacteria 2063
1473 Ga0495619_0234385 3300053085 Bacteria 1272
1474 Ga0500578_0000155 3300053086 Bacteria 80380
1475 Ga0500578_0031314 3300053086 Bacteria 3418
1476 Ga0500644_0000267 3300053088 Bacteria 29406
1477 Ga0500646_0001240 3300053090 Bacteria 6842
1478 Ga0500646_0008454 3300053090 Bacteria 2632
1479 Ga0500646_0029674 3300053090 Bacteria 1498
1480 Ga0500647_0106336 3300053091 Bacteria 1337
1481 Ga0500583_0000043 3300053092 Bacteria 81313
1482 Ga0500583_0002749 3300053092 Bacteria 5369
1483 Ga0500583_0017441 3300053092 Bacteria 2893
1484 Ga0500583_0094654 3300053092 Bacteria 1457
1485 Ga0500651_0001157 3300053093 Bacteria 13091
1486 Ga0500566_0037856 3300053094 Bacteria 2793
1487 Ga0500640_001728 3300053095 Bacteria 6819
1488 Ga0500641_0000027 3300053096 Bacteria 106908
1489 Ga0500641_0000083 3300053096 Bacteria 37649
1490 Ga0500641_0000415 3300053096 Bacteria 15797
1491 Ga0500641_0051164 3300053096 Bacteria 1699
1492 Ga0500554_000172 3300053102 Bacteria 13381
1493 Ga0500556_0066938 3300053104 Bacteria 1335
1494 Ga0500569_000319 3300053109 Bacteria 7709
1495 Ga0500595_000017 3300053119 Bacteria 206032
1496 Ga0500608_000329 3300053122 Bacteria 18275
1497 Ga0500614_000174 3300053123 Bacteria 16459
1498 Ga0500614_010475 3300053123 Bacteria 1992
1499 Ga0500618_000004 3300053125 Bacteria 293180
1500 Ga0500618_005734 3300053125 Bacteria 3742
1501 Ga0500652_004080 3300053131 Bacteria 4485
1502 Ga0500658_0000550 3300053134 Bacteria 15772
1503 Ga0500559_0006396 3300053136 Bacteria 5322
1504 Ga0500559_0015345 3300053136 Bacteria 3235
1505 Ga0500559_0025420 3300053136 Bacteria 2519
1506 Ga0500559_0036704 3300053136 Bacteria 2121
1507 Ga0500568_0004600 3300053139 Bacteria 7343
1508 Ga0500568_0100822 3300053139 Bacteria 1083
1509 Ga0500577_0006687 3300053142 Bacteria 3195
1510 Ga0500589_047465 3300053147 Bacteria 1999
1511 Ga0500590_079001 3300053148 Bacteria 1620
1512 Ga0500604_0001214 3300053151 Bacteria 7176
1513 Ga0500616_0000007 3300053153 Bacteria 836875
1514 Ga0500616_0004544 3300053153 Bacteria 9826
1515 Ga0500616_0014667 3300053153 Bacteria 4496
1516 Ga0500619_034142 3300053154 Bacteria 1570
1517 Ga0500622_0000003 3300053156 Bacteria 613483
1518 Ga0500622_0000841 3300053156 Bacteria 26265
1519 Ga0500622_0000864 3300053156 Bacteria 25792
1520 Ga0500622_0001251 3300053156 Bacteria 20775
1521 Ga0500622_0001894 3300053156 Bacteria 15796
1522 Ga0500622_0009447 3300053156 Bacteria 5396
1523 Ga0500633_0076677 3300053160 Bacteria 1203
1524 Ga0500636_0040285 3300053177 Bacteria 2763
1525 Ga0500584_042747 3300053726 Bacteria 2072
1526 Ga0500611_000077 3300053727 Bacteria 38126
1527 Ga0501084_0111865 3300054114 Bacteria 2295
1528 Ga0501084_0186693 3300054114 Bacteria 1749
1529 Ga0501082_0145745 3300060353 Bacteria 2055
1530 Ga0501082_0407727 3300060353 Bacteria 1186

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1431762 Ga0436365_1431762_194_1051 254
2 3300039450 Ga0436363_1429132 Ga0436363_1429132_331_1179 258
3 3300021377 Ga0213874_10055996 Ga0213874_100559962 259
4 3300037853 Ga0436364_0680771 Ga0436364_0680771_2690_3562 260
5 3300031548 Ga0307408_100000801 Ga0307408_10000080116 262
6 3300031901 Ga0307406_10001880 Ga0307406_100018806 262
7 3300025942 Ga0207689_10273500 Ga0207689_102735001 263
8 3300048929 Ga0496126_0065319 Ga0496126_0065319_636_1439 267
9 3300021384 Ga0213876_10019878 Ga0213876_100198782 268
10 3300021388 Ga0213875_10046959 Ga0213875_100469592 268
11 3300037853 Ga0436364_1395677 Ga0436364_1395677_1634_2440 268
12 3300039437 Ga0436365_0692375 Ga0436365_0692375_391_1197 268
13 3300039450 Ga0436363_0107063 Ga0436363_0107063_283_1089 268
14 3300039453 Ga0436362_0528742 Ga0436362_0528742_963_1769 268
15 3300005445 Ga0070708_100149144 Ga0070708_1001491443 269
16 3300005467 Ga0070706_100001897 Ga0070706_10000189716 269
17 3300005471 Ga0070698_100006719 Ga0070698_10000671913 269
18 3300005518 Ga0070699_100005118 Ga0070699_1000051186 269
19 3300013100 Ga0157373_10384962 Ga0157373_103849621 269
20 3300021361 Ga0213872_10027527 Ga0213872_100275273 269
21 3300025910 Ga0207684_10022615 Ga0207684_100226155 269
22 3300037853 Ga0436364_0527339 Ga0436364_0527339_368_1177 269
23 3300039438 Ga0436360_1172065 Ga0436360_1172065_171_980 269
24 3300039447 Ga0436361_1131553 Ga0436361_1131553_183_992 269
25 3300039450 Ga0436363_1327048 Ga0436363_1327048_1309_2118 269
26 3300009147 Ga0114129_10217408 Ga0114129_102174082 272
27 3300044712 Ga0453684_0939380 Ga0453684_0939380_81_902 273
28 3300021388 Ga0213875_10001725 Ga0213875_100017259 277
29 3300037853 Ga0436364_0124774 Ga0436364_0124774_1877_2710 277
30 3300037853 Ga0436364_0335834 Ga0436364_0335834_8454_9287 277
31 3300035398 Ga0316574_0096071 Ga0316574_0096071_451_1308 278
32 3300039447 Ga0436361_1096116 Ga0436361_1096116_341_1177 278
33 3300005341 Ga0070691_10000108 Ga0070691_100001085 279
34 3300005435 Ga0070714_100019735 Ga0070714_1000197354 279
35 3300005435 Ga0070714_100028118 Ga0070714_1000281182 279
36 3300005535 Ga0070684_100086908 Ga0070684_1000869082 279
37 3300005616 Ga0068852_100074782 Ga0068852_1000747822 279
38 3300009093 Ga0105240_10091789 Ga0105240_100917893 279
39 3300026067 Ga0207678_10019032 Ga0207678_100190325 279
40 3300026142 Ga0207698_10021343 Ga0207698_100213432 279
41 3300037466 Ga0395898_0233397 Ga0395898_0233397_709_1548 279
42 3300038443 Ga0395901_0285876 Ga0395901_0285876_207_1046 279
43 3300039438 Ga0436360_0238484 Ga0436360_0238484_117_956 279
44 3300039438 Ga0436360_0912519 Ga0436360_0912519_73_912 279
45 3300039447 Ga0436361_0286485 Ga0436361_0286485_1840_2679 279
46 3300039450 Ga0436363_1014168 Ga0436363_1014168_393_1247 279
47 3300039453 Ga0436362_1161122 Ga0436362_1161122_85_966 279
48 3300042876 Ga0451577_0053025 Ga0451577_0053025_1094_2002 279
49 3300045051 Ga0451576_0817388 Ga0451576_0817388_20_859 279
50 iso_pu_bacteria 2816332336 2817620853 279
51 iso_pu_bacteria 2852673933 2852674229 279
52 iso_pu_bacteria 2857460504 2857460809 279
53 iso_pu_bacteria 2898907183 2898907899 279
54 iso_pu_bacteria 2915606848 2915610539 279
55 iso_pu_bacteria 2928510474 2928510871 279
56 iso_pu_bacteria 2929183550 2929189385 279
57 3300005539 Ga0068853_100018808 Ga0068853_1000188083 280
58 3300005578 Ga0068854_100000001 Ga0068854_100000001517 280
59 3300005614 Ga0068856_100015638 Ga0068856_1000156384 280
60 3300006880 Ga0075429_100098599 Ga0075429_1000985992 280
61 3300020070 Ga0206356_11441053 Ga0206356_114410537 280
62 3300025981 Ga0207640_10000003 Ga0207640_10000003288 280
63 3300026041 Ga0207639_10022128 Ga0207639_100221283 280
64 3300026078 Ga0207702_10025828 Ga0207702_100258282 280
65 3300050508 nmdc:mga09592_58488_c1 nmdc:mga09592_58488_c1_1457_2299 280
66 3300005545 Ga0070695_100171337 Ga0070695_1001713371 281
67 3300005546 Ga0070696_100096932 Ga0070696_1000969322 281
68 3300005563 Ga0068855_100007323 Ga0068855_1000073234 281
69 3300005563 Ga0068855_100091566 Ga0068855_1000915662 281
70 3300006173 Ga0070716_100207196 Ga0070716_1002071962 281
71 3300021388 Ga0213875_10002342 Ga0213875_100023429 281
72 3300025949 Ga0207667_10000239 Ga0207667_1000023969 281
73 3300025949 Ga0207667_10000409 Ga0207667_100004095 281
74 3300031911 Ga0307412_10007859 Ga0307412_100078597 281
75 3300039438 Ga0436360_0552842 Ga0436360_0552842_280_1137 281
76 3300005518 Ga0070699_100000898 Ga0070699_10000089829 282
77 3300005546 Ga0070696_100000338 Ga0070696_1000003387 282
78 3300006846 Ga0075430_100088252 Ga0075430_1000882522 282
79 3300014969 Ga0157376_10386664 Ga0157376_103866642 282
80 3300025932 Ga0207690_10270110 Ga0207690_102701102 282
81 3300025944 Ga0207661_10319741 Ga0207661_103197412 282
82 3300046529 Ga0495652_0166635 Ga0495652_0166635_53_901 282
83 3300046675 Ga0495657_0156168 Ga0495657_0156168_344_1192 282
84 3300046679 Ga0495623_0043173 Ga0495623_0043173_1517_2365 282
85 3300050509 nmdc:mga0qj67_79577_c1 nmdc:mga0qj67_79577_c1_702_1571 282
86 3300053085 Ga0495619_0234385 Ga0495619_0234385_266_1114 282
87 3300005535 Ga0070684_100597227 Ga0070684_1005972271 283
88 3300025939 Ga0207665_10198606 Ga0207665_101986063 283
89 3300037471 Ga0395905_0000145 Ga0395905_0000145_38788_39639 283
90 3300042876 Ga0451577_0052398 Ga0451577_0052398_547_1401 283
91 3300044712 Ga0453684_0000132 Ga0453684_0000132_36986_37837 283
92 3300049581 Ga0501047_0018935 Ga0501047_0018935_818_1672 283
93 3300049581 Ga0501047_0128891 Ga0501047_0128891_1111_1965 283
94 3300049589 Ga0501073_0094268 Ga0501073_0094268_783_1637 283
95 3300049823 Ga0501044_0169498 Ga0501044_0169498_1143_1997 283
96 iso_pu_bacteria 2816332295 2817482047 283
97 iso_pu_bacteria 3006858327 3006862476 283
98 3300031250 Ga0265331_10038163 Ga0265331_100381632 284
99 3300032133 Ga0316583_10002539 Ga0316583_100025396 284
100 3300032133 Ga0316583_10058520 Ga0316583_100585202 284
101 3300044712 Ga0453684_0237329 Ga0453684_0237329_1183_2037 284
102 3300049584 Ga0501068_0203530 Ga0501068_0203530_82_939 284
103 3300049586 Ga0501070_0167148 Ga0501070_0167148_25_882 284
104 3300049592 Ga0501076_0276247 Ga0501076_0276247_140_994 284
105 iso_pu_bacteria 2888578766 2888579942 284
106 3300039447 Ga0436361_0108982 Ga0436361_0108982_30_893 285
107 3300005329 Ga0070683_100037917 Ga0070683_1000379173 286
108 3300005535 Ga0070684_100024742 Ga0070684_1000247423 286
109 3300005577 Ga0068857_100099568 Ga0068857_1000995682 286
110 3300013307 Ga0157372_10195265 Ga0157372_101952653 286
111 3300025912 Ga0207707_10012901 Ga0207707_100129013 286
112 3300025917 Ga0207660_10070780 Ga0207660_100707803 286
113 3300025921 Ga0207652_10004312 Ga0207652_100043128 286
114 3300025944 Ga0207661_10034379 Ga0207661_100343793 286
115 3300036712 Ga0316584_0065713 Ga0316584_0065713_1527_2387 286
116 3300005544 Ga0070686_100000009 Ga0070686_100000009179 287
117 3300005364 Ga0070673_100317680 Ga0070673_1003176802 288
118 3300013105 Ga0157369_10310389 Ga0157369_103103892 288
119 3300013296 Ga0157374_10046398 Ga0157374_100463982 288
120 3300013297 Ga0157378_10098479 Ga0157378_100984792 288
121 3300025960 Ga0207651_10208329 Ga0207651_102083292 288
122 3300037312 Ga0395899_0021120 Ga0395899_0021120_1866_2735 288
123 3300037466 Ga0395898_0175655 Ga0395898_0175655_582_1451 288
124 3300038443 Ga0395901_0028625 Ga0395901_0028625_745_1614 288
125 3300050507 nmdc:mga05p37_235392_c1 nmdc:mga05p37_235392_c1_1120_1989 288
126 3300005337 Ga0070682_100397247 Ga0070682_1003972471 289
127 3300005364 Ga0070673_100601736 Ga0070673_1006017361 289
128 3300013102 Ga0157371_10442534 Ga0157371_104425341 289
129 3300014326 Ga0157380_10111320 Ga0157380_101113202 289
130 3300025929 Ga0207664_10023739 Ga0207664_100237392 289
131 3300025940 Ga0207691_10023117 Ga0207691_100231175 289
132 3300025960 Ga0207651_10494415 Ga0207651_104944152 289
133 3300026095 Ga0207676_10084159 Ga0207676_100841592 289
134 3300037853 Ga0436364_0263606 Ga0436364_0263606_15_884 289
135 3300037853 Ga0436364_0711825 Ga0436364_0711825_102_986 289
136 3300039437 Ga0436365_1167736 Ga0436365_1167736_84_953 289
137 3300039447 Ga0436361_0640991 Ga0436361_0640991_35_919 289
138 3300049705 Ga0501225_0008139 Ga0501225_0008139_846_1718 289
139 3300005340 Ga0070689_100027440 Ga0070689_1000274402 290
140 3300005340 Ga0070689_100104131 Ga0070689_1001041311 290
141 3300005440 Ga0070705_100078932 Ga0070705_1000789322 290
142 3300006880 Ga0075429_100035668 Ga0075429_1000356682 290
143 3300009553 Ga0105249_10109118 Ga0105249_101091182 290
144 3300025918 Ga0207662_10052087 Ga0207662_100520873 290
145 3300025918 Ga0207662_10055033 Ga0207662_100550334 290
146 3300025936 Ga0207670_10237539 Ga0207670_102375391 290
147 3300028786 Ga0307517_10051260 Ga0307517_100512602 290
148 3300031507 Ga0307509_10029926 Ga0307509_100299262 290
149 3300031730 Ga0307516_10049737 Ga0307516_100497375 290
150 3300031730 Ga0307516_10114825 Ga0307516_101148252 290
151 3300049744 Ga0501083_0232891 Ga0501083_0232891_64_939 290
152 3300050508 nmdc:mga09592_33821_c1 nmdc:mga09592_33821_c1_456_1331 290
153 iso_pu_bacteria 2884791551 2884795426 290
154 iso_pu_bacteria 2929177148 2929179002 290
155 iso_pu_bacteria 2945977869 2945981405 290
156 iso_pu_bacteria 2946013367 2946019196 290
157 iso_pu_bacteria 2958512119 2958515315 290
158 3300005445 Ga0070708_100131227 Ga0070708_1001312272 291
159 3300005614 Ga0068856_100117548 Ga0068856_1001175483 291
160 3300031456 Ga0307513_10011590 Ga0307513_100115903 291
161 3300032126 Ga0307415_100257726 Ga0307415_1002577262 291
162 3300039438 Ga0436360_0858616 Ga0436360_0858616_73_948 291
163 3300049569 Ga0501032_0023495 Ga0501032_0023495_2428_3315 291
164 iso_pu_bacteria 2519899754 2520878810 291
165 iso_pu_bacteria 2643221600 2644011480 291
166 iso_pu_bacteria 2643221716 2644642276 291
167 iso_pu_bacteria 2643221725 2644685273 291
168 iso_pu_bacteria 2738541278 2738726304 291
169 iso_pu_bacteria 2738541279 2738731932 291
170 iso_pu_bacteria 2738541284 2738760872 291
171 iso_pu_bacteria 2738541285 2738764497 291
172 iso_pu_bacteria 2738543007 2739213512 291
173 iso_pu_bacteria 2738543023 2739303987 291
174 iso_pu_bacteria 2802428842 2802654188 291
175 iso_pu_bacteria 2816332280 2817415787 291
176 iso_pu_bacteria 2818991444 2819588583 291
177 iso_pu_bacteria 2818991460 2819680683 291
178 iso_pu_bacteria 2857618242 2857619091 291
179 iso_pu_bacteria 2881359912 2881360433 291
180 iso_pu_bacteria 2896085136 2896087952 291
181 iso_pu_bacteria 2896109856 2896112334 291
182 iso_pu_bacteria 2903895155 2903898576 291
183 iso_pu_bacteria 2904555929 2904556601 291
184 iso_pu_bacteria 2910245624 2910247597 291
185 iso_pu_bacteria 2919191525 2919194073 291
186 iso_pu_bacteria 2919509842 2919509873 291
187 iso_pu_bacteria 2929921140 2929927142 291
188 iso_pu_bacteria 2958458903 2958463360 291
189 iso_pu_bacteria 2977268062 2977269696 291
190 iso_pu_bacteria 8036736890 8036738090 291
191 iso_pu_bacteria 8054307821 8054308239 291
192 iso_pu_bacteria 8055419101 8055421464 291
193 iso_pu_bacteria 8056440228 8056443925 291
194 3300028800 Ga0265338_10077514 Ga0265338_100775142 292
195 3300028800 Ga0265338_10078686 Ga0265338_100786862 292
196 3300032126 Ga0307415_100480271 Ga0307415_1004802711 292
197 iso_pu_bacteria 2523533629 2524006061 292
198 iso_pu_bacteria 2599185184 2599478512 292
199 iso_pu_bacteria 2738541283 2738756548 292
200 iso_pu_bacteria 2739367866 2740032952 292
201 iso_pu_bacteria 2775506987 2776613057 292
202 iso_pu_bacteria 2833640130 2833644144 292
203 iso_pu_bacteria 2842903701 2842906804 292
204 iso_pu_bacteria 2881247448 2881248478 292
205 iso_pu_bacteria 2919186247 2919187353 292
206 iso_pu_bacteria 2919692658 2919693203 292
207 iso_pu_bacteria 2928078545 2928080436 292
208 iso_pu_bacteria 2928147474 2928149392 292
209 iso_pu_bacteria 2932082852 2932083223 292
210 iso_pu_bacteria 2939664404 2939665379 292
211 iso_pu_bacteria 2965320100 2965323455 292
212 3300005471 Ga0070698_100004450 Ga0070698_10000445017 293
213 3300005471 Ga0070698_100085777 Ga0070698_1000857772 293
214 3300009553 Ga0105249_10024592 Ga0105249_100245924 293
215 3300025918 Ga0207662_10087399 Ga0207662_100873992 293
216 3300025961 Ga0207712_10008770 Ga0207712_100087704 293
217 3300031731 Ga0307405_10032191 Ga0307405_100321913 293
218 3300047320 Ga0495672_0012039 Ga0495672_0012039_4329_5216 293
219 3300049571 Ga0501034_0000363 Ga0501034_0000363_41749_42630 293
220 3300049574 Ga0501038_0209966 Ga0501038_0209966_633_1514 293
221 3300053096 Ga0500641_0051164 Ga0500641_0051164_186_1067 293
222 iso_pu_bacteria 2511231000 2511234315 293
223 iso_pu_bacteria 2513020052 2513235376 293
224 iso_pu_bacteria 2582581278 2585143354 293
225 iso_pu_bacteria 2582581281 2585159642 293
226 iso_pu_bacteria 2582581282 2585163895 293
227 iso_pu_bacteria 2582581873 2585425082 293
228 iso_pu_bacteria 2585427687 2586209490 293
229 iso_pu_bacteria 2585428045 2587677701 293
230 iso_pu_bacteria 2585428060 2587746850 293
231 iso_pu_bacteria 2585428061 2587750912 293
232 iso_pu_bacteria 2585428095 2587867936 293
233 iso_pu_bacteria 2585428115 2587943368 293
234 iso_pu_bacteria 2585428182 2588209617 293
235 iso_pu_bacteria 2585428183 2588213908 293
236 iso_pu_bacteria 2585428184 2588218471 293
237 iso_pu_bacteria 2585428185 2588225838 293
238 iso_pu_bacteria 2585428187 2588231654 293
239 iso_pu_bacteria 2588253712 2588444917 293
240 iso_pu_bacteria 2588254255 2590601215 293
241 iso_pu_bacteria 2588254257 2590612499 293
242 iso_pu_bacteria 2643221667 2644369881 293
243 iso_pu_bacteria 2728369107 2729199225 293
244 iso_pu_bacteria 2738541273 2738700650 293
245 iso_pu_bacteria 2738541302 2738853633 293
246 iso_pu_bacteria 2738543014 2739254399 293
247 iso_pu_bacteria 2739367651 2739588866 293
248 iso_pu_bacteria 2739367857 2740000777 293
249 iso_pu_bacteria 2739367858 2740005593 293
250 iso_pu_bacteria 2739367874 2740058414 293
251 iso_pu_bacteria 2751185877 2753671161 293
252 iso_pu_bacteria 2772190705 2772604137 293
253 iso_pu_bacteria 2775506739 2775672471 293
254 iso_pu_bacteria 2816332188 2816873727 293
255 iso_pu_bacteria 2818991437 2819548026 293
256 iso_pu_bacteria 2839989709 2839992780 293
257 iso_pu_bacteria 2842083920 2842085015 293
258 iso_pu_bacteria 2842722452 2842726316 293
259 iso_pu_bacteria 2842909656 2842910567 293
260 iso_pu_bacteria 2849281842 2849282178 293
261 iso_pu_bacteria 2857613821 2857614526 293
262 iso_pu_bacteria 2884634485 2884635304 293
263 iso_pu_bacteria 2889290771 2889291005 293
264 iso_pu_bacteria 2904419702 2904419812 293
265 iso_pu_bacteria 2904445276 2904445515 293
266 iso_pu_bacteria 2905999023 2905999660 293
267 iso_pu_bacteria 2919097161 2919098902 293
268 iso_pu_bacteria 2919399522 2919400459 293
269 iso_pu_bacteria 2919683626 2919687159 293
270 iso_pu_bacteria 2929150217 2929153032 293
271 iso_pu_bacteria 2929239360 2929244898 293
272 iso_pu_bacteria 2945924605 2945927748 293
273 iso_pu_bacteria 2945997725 2946000883 293
274 iso_pu_bacteria 2954016120 2954017790 293
275 iso_pu_bacteria 2977243572 2977245670 293
276 iso_pu_bacteria 2984572630 2984575319 293
277 iso_pu_bacteria 2984606641 2984608773 293
278 iso_pu_bacteria 2993372514 2993373042 293
279 iso_pu_bacteria 2993480792 2993483726 293
280 iso_pu_bacteria 8055592153 8055594064 293
281 3300001989 JGI24739J22299_10010206 JGI24739J22299_100102064 294
282 3300001989 JGI24739J22299_10013537 JGI24739J22299_100135374 294
283 3300003320 rootH2_10141236 rootH2_101412364 294
284 3300003323 rootH1_10009140 rootH1_1000914037 294
285 3300003323 rootH1_10021086 rootH1_100210868 294
286 3300003323 rootH1_10087740 rootH1_100877403 294
287 3300003323 rootH1_10097804 rootH1_100978044 294
288 3300005290 Ga0065712_10099414 Ga0065712_100994141 294
289 3300005295 Ga0065707_10172508 Ga0065707_101725082 294
290 3300005331 Ga0070670_100045231 Ga0070670_1000452314 294
291 3300005347 Ga0070668_100041075 Ga0070668_1000410751 294
292 3300005353 Ga0070669_100001238 Ga0070669_10000123810 294
293 3300005354 Ga0070675_100007791 Ga0070675_1000077919 294
294 3300005364 Ga0070673_100002836 Ga0070673_1000028365 294
295 3300005365 Ga0070688_100020624 Ga0070688_1000206243 294
296 3300005438 Ga0070701_10063559 Ga0070701_100635591 294
297 3300005457 Ga0070662_100054985 Ga0070662_1000549853 294
298 3300005543 Ga0070672_100054264 Ga0070672_1000542643 294
299 3300005577 Ga0068857_100150650 Ga0068857_1001506503 294
300 3300005617 Ga0068859_100119093 Ga0068859_1001190933 294
301 3300005719 Ga0068861_100046336 Ga0068861_1000463363 294
302 3300005840 Ga0068870_10026851 Ga0068870_100268513 294
303 3300005844 Ga0068862_100019107 Ga0068862_1000191072 294
304 3300006844 Ga0075428_100482962 Ga0075428_1004829622 294
305 3300006881 Ga0068865_100072902 Ga0068865_1000729021 294
306 3300006931 Ga0097620_100119099 Ga0097620_1001190993 294
307 3300009094 Ga0111539_10010702 Ga0111539_100107029 294
308 3300009553 Ga0105249_10039265 Ga0105249_100392652 294
309 3300013105 Ga0157369_10220944 Ga0157369_102209442 294
310 3300013306 Ga0163162_10435430 Ga0163162_104354303 294
311 3300013308 Ga0157375_10054458 Ga0157375_100544583 294
312 3300014326 Ga0157380_10008479 Ga0157380_100084797 294
313 3300014745 Ga0157377_10304580 Ga0157377_103045801 294
314 3300025315 Ga0207697_10041542 Ga0207697_100415421 294
315 3300025926 Ga0207659_10284745 Ga0207659_102847451 294
316 3300025933 Ga0207706_10029076 Ga0207706_100290763 294
317 3300025938 Ga0207704_10055723 Ga0207704_100557232 294
318 3300025942 Ga0207689_10134090 Ga0207689_101340902 294
319 3300025961 Ga0207712_10021924 Ga0207712_100219245 294
320 3300025972 Ga0207668_10448565 Ga0207668_104485651 294
321 3300026088 Ga0207641_10169730 Ga0207641_101697303 294
322 3300026116 Ga0207674_10026912 Ga0207674_100269124 294
323 3300026116 Ga0207674_10067559 Ga0207674_100675593 294
324 3300026116 Ga0207674_10141577 Ga0207674_101415773 294
325 3300026118 Ga0207675_100000762 Ga0207675_10000076219 294
326 3300026118 Ga0207675_100297429 Ga0207675_1002974291 294
327 3300027907 Ga0207428_10324915 Ga0207428_103249151 294
328 3300028380 Ga0268265_10281367 Ga0268265_102813671 294
329 3300028794 Ga0307515_10000778 Ga0307515_1000077836 294
330 3300031456 Ga0307513_10354056 Ga0307513_103540561 294
331 3300037418 Ga0395900_0002099 Ga0395900_0002099_869_1753 294
332 3300039438 Ga0436360_1357712 Ga0436360_1357712_1346_2248 294
333 3300041406 Ga0439439_0021425 Ga0439439_0021425_201_1091 294
334 3300042007 Ga0439449_0051049 Ga0439449_0051049_610_1500 294
335 3300042135 Ga0450899_006776 Ga0450899_006776_208_1098 294
336 3300044712 Ga0453684_0440157 Ga0453684_0440157_328_1212 294
337 3300046453 Ga0495627_039056 Ga0495627_039056_415_1299 294
338 3300046500 Ga0495596_0071405 Ga0495596_0071405_20_910 294
339 3300046501 Ga0495607_0117693 Ga0495607_0117693_116_1000 294
340 3300046522 Ga0495643_0007955 Ga0495643_0007955_3618_4508 294
341 3300046558 Ga0495633_0000058 Ga0495633_0000058_59124_60008 294
342 3300047320 Ga0495672_0011633 Ga0495672_0011633_3322_4206 294
343 3300048918 Ga0496115_0087065 Ga0496115_0087065_76_960 294
344 3300048928 Ga0496125_0000286 Ga0496125_0000286_44558_45442 294
345 3300048929 Ga0496126_0057468 Ga0496126_0057468_1633_2517 294
346 3300049705 Ga0501225_0000104 Ga0501225_0000104_9481_10365 294
347 3300050511 nmdc:mga08y16_226436_c1 nmdc:mga08y16_226436_c1_930_1820 294
348 3300053090 Ga0500646_0001240 Ga0500646_0001240_3978_4862 294
349 3300053090 Ga0500646_0029674 Ga0500646_0029674_75_959 294
350 3300053139 Ga0500568_0004600 Ga0500568_0004600_1253_2137 294
351 3300053177 Ga0500636_0040285 Ga0500636_0040285_1064_1951 294
352 iso_pu_bacteria 2739367663 2739645252 294
353 iso_pu_bacteria 2818991442 2819572546 294
354 iso_pu_bacteria 2821136567 2821140061 294
355 iso_pu_bacteria 2857627736 2857628992 294
356 iso_pu_bacteria 2904467357 2904472182 294
357 iso_pu_bacteria 2919437846 2919441655 294
358 3300002738 JGI25154J39366_1000019 JGI25154J39366_1000019160 295
359 3300003215 JGI25153J46596_10000324 JGI25153J46596_1000032431 295
360 3300003320 rootH2_10030707 rootH2_100307079 295
361 3300003320 rootH2_10110894 rootH2_101108941 295
362 3300003323 rootH1_10020851 rootH1_100208515 295
363 3300003354 JGI25160J50197_1015581 JGI25160J50197_10155812 295
364 3300003578 Ga0006562J51391_1006008 Ga0006562J51391_10060082 295
365 3300003794 Ga0055531_10000156 Ga0055531_100001568 295
366 3300005262 Ga0065165_1000835 Ga0065165_100083521 295
367 3300005288 Ga0065714_10002361 Ga0065714_1000236128 295
368 3300005288 Ga0065714_10003305 Ga0065714_100033052 295
369 3300005288 Ga0065714_10024048 Ga0065714_100240482 295
370 3300005288 Ga0065714_10132309 Ga0065714_101323092 295
371 3300005288 Ga0065714_10138407 Ga0065714_101384072 295
372 3300005289 Ga0065704_10072798 Ga0065704_100727988 295
373 3300005289 Ga0065704_10173413 Ga0065704_101734131 295
374 3300005290 Ga0065712_10000992 Ga0065712_100009929 295
375 3300005293 Ga0065715_10101395 Ga0065715_101013954 295
376 3300005293 Ga0065715_10248732 Ga0065715_102487321 295
377 3300005328 Ga0070676_10009053 Ga0070676_100090534 295
378 3300005329 Ga0070683_100000490 Ga0070683_10000049015 295
379 3300005329 Ga0070683_100214037 Ga0070683_1002140371 295
380 3300005330 Ga0070690_100222605 Ga0070690_1002226052 295
381 3300005334 Ga0068869_100035053 Ga0068869_1000350533 295
382 3300005334 Ga0068869_100222530 Ga0068869_1002225301 295
383 3300005337 Ga0070682_100055112 Ga0070682_1000551122 295
384 3300005338 Ga0068868_100009759 Ga0068868_1000097595 295
385 3300005339 Ga0070660_100013586 Ga0070660_1000135863 295
386 3300005339 Ga0070660_100302607 Ga0070660_1003026072 295
387 3300005340 Ga0070689_100007084 Ga0070689_1000070843 295
388 3300005340 Ga0070689_100079996 Ga0070689_1000799962 295
389 3300005343 Ga0070687_100017865 Ga0070687_1000178653 295
390 3300005344 Ga0070661_100013211 Ga0070661_1000132116 295
391 3300005353 Ga0070669_100021706 Ga0070669_1000217062 295
392 3300005354 Ga0070675_100023522 Ga0070675_1000235224 295
393 3300005354 Ga0070675_100449113 Ga0070675_1004491132 295
394 3300005364 Ga0070673_100050105 Ga0070673_1000501051 295
395 3300005364 Ga0070673_100236278 Ga0070673_1002362782 295
396 3300005365 Ga0070688_100198694 Ga0070688_1001986943 295
397 3300005366 Ga0070659_100064896 Ga0070659_1000648964 295
398 3300005366 Ga0070659_100082653 Ga0070659_1000826532 295
399 3300005367 Ga0070667_100037432 Ga0070667_1000374324 295
400 3300005459 Ga0068867_100042333 Ga0068867_1000423334 295
401 3300005459 Ga0068867_100112021 Ga0068867_1001120213 295
402 3300005466 Ga0070685_10055309 Ga0070685_100553092 295
403 3300005471 Ga0070698_100046304 Ga0070698_1000463045 295
404 3300005530 Ga0070679_100000684 Ga0070679_10000068414 295
405 3300005535 Ga0070684_100039209 Ga0070684_1000392093 295
406 3300005539 Ga0068853_100003840 Ga0068853_1000038409 295
407 3300005539 Ga0068853_100014740 Ga0068853_1000147408 295
408 3300005543 Ga0070672_100019728 Ga0070672_1000197284 295
409 3300005544 Ga0070686_100314805 Ga0070686_1003148051 295
410 3300005563 Ga0068855_100133364 Ga0068855_1001333643 295
411 3300005564 Ga0070664_100000887 Ga0070664_10000088712 295
412 3300005564 Ga0070664_100218197 Ga0070664_1002181971 295
413 3300005577 Ga0068857_100001871 Ga0068857_1000018711 295
414 3300005578 Ga0068854_100058665 Ga0068854_1000586651 295
415 3300005614 Ga0068856_100000092 Ga0068856_10000009216 295
416 3300005616 Ga0068852_100000207 Ga0068852_10000020713 295
417 3300005616 Ga0068852_100001739 Ga0068852_10000173911 295
418 3300005616 Ga0068852_100157239 Ga0068852_1001572391 295
419 3300005617 Ga0068859_100032567 Ga0068859_1000325674 295
420 3300005617 Ga0068859_100038533 Ga0068859_1000385335 295
421 3300005617 Ga0068859_100041123 Ga0068859_1000411233 295
422 3300005617 Ga0068859_100060520 Ga0068859_1000605204 295
423 3300005617 Ga0068859_100066417 Ga0068859_1000664175 295
424 3300005618 Ga0068864_100082848 Ga0068864_1000828482 295
425 3300005618 Ga0068864_100112111 Ga0068864_1001121111 295
426 3300005719 Ga0068861_100024095 Ga0068861_1000240954 295
427 3300005834 Ga0068851_10058142 Ga0068851_100581422 295
428 3300005841 Ga0068863_100277979 Ga0068863_1002779792 295
429 3300005841 Ga0068863_100459948 Ga0068863_1004599482 295
430 3300005843 Ga0068860_100002513 Ga0068860_1000025135 295
431 3300005843 Ga0068860_100038051 Ga0068860_1000380516 295
432 3300005844 Ga0068862_100445040 Ga0068862_1004450402 295
433 3300006195 Ga0075366_10118894 Ga0075366_101188941 295
434 3300006237 Ga0097621_100003328 Ga0097621_10000332815 295
435 3300006237 Ga0097621_100088709 Ga0097621_1000887092 295
436 3300006844 Ga0075428_100217290 Ga0075428_1002172901 295
437 3300006931 Ga0097620_100032569 Ga0097620_1000325694 295
438 3300006931 Ga0097620_100038533 Ga0097620_1000385335 295
439 3300006931 Ga0097620_100041125 Ga0097620_1000411253 295
440 3300006931 Ga0097620_100060522 Ga0097620_1000605223 295
441 3300006931 Ga0097620_100066417 Ga0097620_1000664175 295
442 3300006931 Ga0097620_100184357 Ga0097620_1001843572 295
443 3300009011 Ga0105251_10046770 Ga0105251_100467703 295
444 3300009036 Ga0105244_10000004 Ga0105244_10000004386 295
445 3300009101 Ga0105247_10124201 Ga0105247_101242013 295
446 3300009147 Ga0114129_10881896 Ga0114129_108818961 295
447 3300009176 Ga0105242_10008025 Ga0105242_100080259 295
448 3300009176 Ga0105242_10303376 Ga0105242_103033761 295
449 3300009176 Ga0105242_10455481 Ga0105242_104554812 295
450 3300009545 Ga0105237_10006527 Ga0105237_1000652710 295
451 3300009551 Ga0105238_10178291 Ga0105238_101782911 295
452 3300009553 Ga0105249_10006624 Ga0105249_1000662412 295
453 3300009553 Ga0105249_10140985 Ga0105249_101409853 295
454 3300009553 Ga0105249_10312134 Ga0105249_103121342 295
455 3300010375 Ga0105239_10064731 Ga0105239_100647313 295
456 3300013100 Ga0157373_10000002 Ga0157373_1000000230 295
457 3300013100 Ga0157373_10156476 Ga0157373_101564761 295
458 3300013102 Ga0157371_10025742 Ga0157371_100257423 295
459 3300013102 Ga0157371_10103420 Ga0157371_101034202 295
460 3300013104 Ga0157370_10007499 Ga0157370_1000749911 295
461 3300013104 Ga0157370_10027225 Ga0157370_100272252 295
462 3300013104 Ga0157370_10041127 Ga0157370_100411276 295
463 3300013104 Ga0157370_10158000 Ga0157370_101580002 295
464 3300013104 Ga0157370_10502848 Ga0157370_105028481 295
465 3300013105 Ga0157369_10002262 Ga0157369_1000226210 295
466 3300013105 Ga0157369_10304194 Ga0157369_103041942 295
467 3300013296 Ga0157374_10419676 Ga0157374_104196761 295
468 3300013297 Ga0157378_10019552 Ga0157378_100195526 295
469 3300013306 Ga0163162_10000386 Ga0163162_1000038615 295
470 3300013306 Ga0163162_10009251 Ga0163162_100092515 295
471 3300013306 Ga0163162_10192528 Ga0163162_101925282 295
472 3300013306 Ga0163162_10354953 Ga0163162_103549532 295
473 3300013307 Ga0157372_10005795 Ga0157372_1000579510 295
474 3300013307 Ga0157372_10083574 Ga0157372_100835743 295
475 3300013307 Ga0157372_10686438 Ga0157372_106864382 295
476 3300013308 Ga0157375_10091194 Ga0157375_100911942 295
477 3300013308 Ga0157375_10185943 Ga0157375_101859433 295
478 3300013308 Ga0157375_10589767 Ga0157375_105897672 295
479 3300014326 Ga0157380_10081357 Ga0157380_100813571 295
480 3300014497 Ga0182008_10000010 Ga0182008_10000010179 295
481 3300014745 Ga0157377_10068354 Ga0157377_100683542 295
482 3300014969 Ga0157376_10198771 Ga0157376_101987712 295
483 3300015261 Ga0182006_1003243 Ga0182006_10032432 295
484 3300015261 Ga0182006_1061253 Ga0182006_10612532 295
485 3300017792 Ga0163161_10000007 Ga0163161_10000007154 295
486 3300025208 Ga0209436_100215 Ga0209436_10021520 295
487 3300025246 Ga0209646_1000003 Ga0209646_1000003772 295
488 3300025246 Ga0209646_1000557 Ga0209646_10005578 295
489 3300025250 Ga0209026_1001293 Ga0209026_10012938 295
490 3300025284 Ga0209130_1001519 Ga0209130_10015195 295
491 3300025297 Ga0209758_1005012 Ga0209758_10050128 295
492 3300025302 Ga0207426_1000051 Ga0207426_1000051136 295
493 3300025302 Ga0207426_1000698 Ga0207426_10006984 295
494 3300025304 Ga0209257_1000005 Ga0209257_10000051214 295
495 3300025728 Ga0207655_1000008 Ga0207655_1000008202 295
496 3300025893 Ga0207682_10005264 Ga0207682_100052643 295
497 3300025900 Ga0207710_10001860 Ga0207710_1000186010 295
498 3300025904 Ga0207647_10000011 Ga0207647_10000011145 295
499 3300025907 Ga0207645_10009152 Ga0207645_100091526 295
500 3300025908 Ga0207643_10001321 Ga0207643_100013213 295
501 3300025909 Ga0207705_10134475 Ga0207705_101344752 295
502 3300025914 Ga0207671_10004790 Ga0207671_100047902 295
503 3300025918 Ga0207662_10007258 Ga0207662_100072584 295
504 3300025919 Ga0207657_10023752 Ga0207657_100237526 295
505 3300025919 Ga0207657_10159740 Ga0207657_101597402 295
506 3300025920 Ga0207649_10014837 Ga0207649_100148372 295
507 3300025921 Ga0207652_10039216 Ga0207652_100392163 295
508 3300025923 Ga0207681_10054364 Ga0207681_100543643 295
509 3300025923 Ga0207681_10069179 Ga0207681_100691792 295
510 3300025923 Ga0207681_10071584 Ga0207681_100715842 295
511 3300025925 Ga0207650_10295995 Ga0207650_102959952 295
512 3300025925 Ga0207650_10441955 Ga0207650_104419551 295
513 3300025926 Ga0207659_10012869 Ga0207659_100128694 295
514 3300025932 Ga0207690_10060194 Ga0207690_100601943 295
515 3300025933 Ga0207706_10074559 Ga0207706_100745592 295
516 3300025934 Ga0207686_10000893 Ga0207686_100008937 295
517 3300025936 Ga0207670_10010640 Ga0207670_100106403 295
518 3300025936 Ga0207670_10069241 Ga0207670_100692411 295
519 3300025942 Ga0207689_10030399 Ga0207689_100303994 295
520 3300025942 Ga0207689_10037050 Ga0207689_100370502 295
521 3300025942 Ga0207689_10177894 Ga0207689_101778941 295
522 3300025944 Ga0207661_10002525 Ga0207661_1000252510 295
523 3300025945 Ga0207679_10001836 Ga0207679_100018364 295
524 3300025945 Ga0207679_10085593 Ga0207679_100855932 295
525 3300025949 Ga0207667_10195020 Ga0207667_101950203 295
526 3300025961 Ga0207712_10004227 Ga0207712_100042278 295
527 3300026041 Ga0207639_10009995 Ga0207639_100099952 295
528 3300026041 Ga0207639_10315236 Ga0207639_103152362 295
529 3300026067 Ga0207678_10133369 Ga0207678_101333692 295
530 3300026078 Ga0207702_10001849 Ga0207702_100018499 295
531 3300026078 Ga0207702_10422683 Ga0207702_104226832 295
532 3300026088 Ga0207641_10026539 Ga0207641_100265393 295
533 3300026088 Ga0207641_10236040 Ga0207641_102360402 295
534 3300026089 Ga0207648_10013283 Ga0207648_100132836 295
535 3300026095 Ga0207676_10078717 Ga0207676_100787172 295
536 3300026116 Ga0207674_10001258 Ga0207674_1000125823 295
537 3300026116 Ga0207674_10029400 Ga0207674_1002940011 295
538 3300026116 Ga0207674_10526691 Ga0207674_105266912 295
539 3300026118 Ga0207675_100016606 Ga0207675_1000166066 295
540 3300026118 Ga0207675_100039146 Ga0207675_1000391463 295
541 3300026142 Ga0207698_10001507 Ga0207698_100015077 295
542 3300026142 Ga0207698_10015124 Ga0207698_100151243 295
543 3300027617 Ga0210002_1021460 Ga0210002_10214601 295
544 3300027876 Ga0209974_10035082 Ga0209974_100350822 295
545 3300028381 Ga0268264_10082072 Ga0268264_100820723 295
546 3300028381 Ga0268264_10310871 Ga0268264_103108711 295
547 3300028786 Ga0307517_10018951 Ga0307517_100189513 295
548 3300028794 Ga0307515_10011558 Ga0307515_100115582 295
549 3300031507 Ga0307509_10066464 Ga0307509_100664643 295
550 3300031727 Ga0316576_10117690 Ga0316576_101176903 295
551 3300031731 Ga0307405_10000002 Ga0307405_10000002303 295
552 3300031824 Ga0307413_10000019 Ga0307413_1000001919 295
553 3300031824 Ga0307413_10015140 Ga0307413_100151404 295
554 3300031852 Ga0307410_10024479 Ga0307410_100244794 295
555 3300031901 Ga0307406_10130235 Ga0307406_101302352 295
556 3300031911 Ga0307412_10010470 Ga0307412_100104706 295
557 3300032002 Ga0307416_100040565 Ga0307416_1000405654 295
558 3300032004 Ga0307414_10008062 Ga0307414_100080627 295
559 3300032004 Ga0307414_10042757 Ga0307414_100427573 295
560 3300032004 Ga0307414_10105158 Ga0307414_101051582 295
561 3300032004 Ga0307414_10187639 Ga0307414_101876392 295
562 3300032005 Ga0307411_10000013 Ga0307411_1000001383 295
563 3300037068 Ga0373925_0130635 Ga0373925_0130635_420_1307 295
564 3300037418 Ga0395900_0085018 Ga0395900_0085018_341_1228 295
565 3300037471 Ga0395905_0007667 Ga0395905_0007667_608_1495 295
566 3300041404 Ga0439436_0018190 Ga0439436_0018190_1155_2042 295
567 3300041411 Ga0439466_0003065 Ga0439466_0003065_5238_6125 295
568 3300041486 Ga0451807_0790979 Ga0451807_0790979_507_1403 295
569 3300042001 Ga0439441_032938 Ga0439441_032938_57_944 295
570 3300042014 Ga0439457_002980 Ga0439457_002980_3312_4199 295
571 3300042015 Ga0439462_0004484 Ga0439462_0004484_2471_3358 295
572 3300044712 Ga0453684_0116908 Ga0453684_0116908_510_1412 295
573 3300046460 Ga0495638_0028263 Ga0495638_0028263_1373_2260 295
574 3300046539 Ga0495621_0010363 Ga0495621_0010363_751_1638 295
575 3300048918 Ga0496115_0281224 Ga0496115_0281224_297_1184 295
576 3300048919 Ga0496116_0000047 Ga0496116_0000047_281637_282524 295
577 3300048921 Ga0496118_0023205 Ga0496118_0023205_3996_4883 295
578 3300048924 Ga0496121_0009602 Ga0496121_0009602_8861_9748 295
579 3300048924 Ga0496121_0064683 Ga0496121_0064683_1994_2881 295
580 3300048927 Ga0496124_0092182 Ga0496124_0092182_910_1797 295
581 3300048927 Ga0496124_0175115 Ga0496124_0175115_725_1612 295
582 3300048928 Ga0496125_0000050 Ga0496125_0000050_33507_34394 295
583 3300048929 Ga0496126_0100998 Ga0496126_0100998_766_1653 295
584 3300049568 Ga0501031_0000757 Ga0501031_0000757_11471_12358 295
585 3300049569 Ga0501032_0007292 Ga0501032_0007292_6033_6920 295
586 3300049570 Ga0501033_0000028 Ga0501033_0000028_71007_71894 295
587 3300049571 Ga0501034_0000074 Ga0501034_0000074_74671_75558 295
588 3300049571 Ga0501034_0085615 Ga0501034_0085615_2243_3130 295
589 3300049571 Ga0501034_0093171 Ga0501034_0093171_1400_2287 295
590 3300049572 Ga0501036_0002989 Ga0501036_0002989_5614_6513 295
591 3300049572 Ga0501036_0061774 Ga0501036_0061774_234_1121 295
592 3300049573 Ga0501037_0153691 Ga0501037_0153691_335_1222 295
593 3300049574 Ga0501038_0013147 Ga0501038_0013147_643_1530 295
594 3300049575 Ga0501039_0003283 Ga0501039_0003283_1196_2083 295
595 3300049579 Ga0501043_0002401 Ga0501043_0002401_8937_9824 295
596 3300049580 Ga0501046_0015984 Ga0501046_0015984_2971_3870 295
597 3300049581 Ga0501047_0021293 Ga0501047_0021293_5254_6153 295
598 3300049582 Ga0501048_0027732 Ga0501048_0027732_1252_2151 295
599 3300049582 Ga0501048_0035049 Ga0501048_0035049_839_1726 295
600 3300049585 Ga0501069_0215862 Ga0501069_0215862_16_903 295
601 3300049586 Ga0501070_0014181 Ga0501070_0014181_4595_5494 295
602 3300049590 Ga0501074_0000815 Ga0501074_0000815_4425_5324 295
603 3300049663 Ga0501223_001886 Ga0501223_001886_1983_2870 295
604 3300049679 Ga0501249_000021 Ga0501249_000021_77642_78529 295
605 3300049742 Ga0501080_0030430 Ga0501080_0030430_818_1717 295
606 3300049744 Ga0501083_0094683 Ga0501083_0094683_890_1789 295
607 3300049758 Ga0501241_010751 Ga0501241_010751_500_1387 295
608 3300049763 Ga0501266_000005 Ga0501266_000005_10146_11033 295
609 3300049822 Ga0501035_0005702 Ga0501035_0005702_2484_3371 295
610 3300049822 Ga0501035_0006466 Ga0501035_0006466_2234_3133 295
611 3300049823 Ga0501044_0001410 Ga0501044_0001410_12692_13579 295
612 3300049823 Ga0501044_0013587 Ga0501044_0013587_1694_2593 295
613 3300049824 Ga0501045_0000380 Ga0501045_0000380_12559_13446 295
614 3300049824 Ga0501045_0186382 Ga0501045_0186382_381_1280 295
615 3300050511 nmdc:mga08y16_130587_c1 nmdc:mga08y16_130587_c1_1406_2305 295
616 3300053092 Ga0500583_0000043 Ga0500583_0000043_23293_24180 295
617 3300053096 Ga0500641_0000027 Ga0500641_0000027_74938_75825 295
618 3300053096 Ga0500641_0000415 Ga0500641_0000415_2429_3316 295
619 3300053104 Ga0500556_0066938 Ga0500556_0066938_130_1017 295
620 3300053125 Ga0500618_005734 Ga0500618_005734_2266_3153 295
621 3300053136 Ga0500559_0036704 Ga0500559_0036704_20_907 295
622 3300053139 Ga0500568_0100822 Ga0500568_0100822_60_947 295
623 3300053156 Ga0500622_0009447 Ga0500622_0009447_2831_3718 295
624 3300053726 Ga0500584_042747 Ga0500584_042747_1061_1948 295
625 3300053727 Ga0500611_000077 Ga0500611_000077_30548_31435 295
626 3300060353 Ga0501082_0407727 Ga0501082_0407727_52_951 295
627 iso_pu_bacteria 2765235839 2765573323 295
628 iso_pu_bacteria 2852623160 2852623436 295
629 iso_pu_bacteria 2852627209 2852627318 295
630 iso_pu_bacteria 2871720351 2871720718 295
631 iso_pu_bacteria 2884933994 2884937686 295
632 2162886007 SwRhRL2b_contig_2173254 SwRhRL2b_0478.00001760 296
633 2162886007 SwRhRL2b_contig_2678590 SwRhRL2b_0755.00002280 296
634 3300001990 JGI24737J22298_10038410 JGI24737J22298_100384102 296
635 3300002067 JGI24735J21928_10027358 JGI24735J21928_100273583 296
636 3300003320 rootH2_10161305 rootH2_101613053 296
637 3300003354 JGI25160J50197_1013603 JGI25160J50197_10136032 296
638 3300003354 JGI25160J50197_1045618 JGI25160J50197_10456181 296
639 3300003762 Ga0055542_1003789 Ga0055542_10037892 296
640 3300003771 Ga0055526_1011612 Ga0055526_10116122 296
641 3300003790 Ga0055528_1000360 Ga0055528_100036027 296
642 3300003791 Ga0055530_10010766 Ga0055530_100107663 296
643 3300004625 Ga0055543_1009253 Ga0055543_10092532 296
644 3300005262 Ga0065165_1000402 Ga0065165_100040252 296
645 3300005288 Ga0065714_10003057 Ga0065714_1000305718 296
646 3300005288 Ga0065714_10080906 Ga0065714_100809062 296
647 3300005289 Ga0065704_10000238 Ga0065704_100002383 296
648 3300005289 Ga0065704_10071089 Ga0065704_100710899 296
649 3300005289 Ga0065704_10071898 Ga0065704_100718989 296
650 3300005290 Ga0065712_10172843 Ga0065712_101728431 296
651 3300005327 Ga0070658_10000019 Ga0070658_1000001979 296
652 3300005329 Ga0070683_100019095 Ga0070683_1000190951 296
653 3300005329 Ga0070683_100033031 Ga0070683_1000330313 296
654 3300005331 Ga0070670_100045675 Ga0070670_1000456752 296
655 3300005331 Ga0070670_100322721 Ga0070670_1003227212 296
656 3300005334 Ga0068869_100278780 Ga0068869_1002787802 296
657 3300005335 Ga0070666_10026992 Ga0070666_100269923 296
658 3300005337 Ga0070682_100000005 Ga0070682_100000005197 296
659 3300005337 Ga0070682_100000455 Ga0070682_10000045519 296
660 3300005337 Ga0070682_100080907 Ga0070682_1000809072 296
661 3300005338 Ga0068868_100095591 Ga0068868_1000955912 296
662 3300005338 Ga0068868_100315327 Ga0068868_1003153271 296
663 3300005339 Ga0070660_100024845 Ga0070660_1000248456 296
664 3300005339 Ga0070660_100118568 Ga0070660_1001185682 296
665 3300005340 Ga0070689_100053460 Ga0070689_1000534603 296
666 3300005344 Ga0070661_100014716 Ga0070661_1000147165 296
667 3300005344 Ga0070661_100212627 Ga0070661_1002126272 296
668 3300005347 Ga0070668_100344354 Ga0070668_1003443541 296
669 3300005354 Ga0070675_100021277 Ga0070675_1000212774 296
670 3300005355 Ga0070671_100278658 Ga0070671_1002786582 296
671 3300005364 Ga0070673_100481225 Ga0070673_1004812251 296
672 3300005365 Ga0070688_100058227 Ga0070688_1000582273 296
673 3300005366 Ga0070659_100000854 Ga0070659_10000085415 296
674 3300005366 Ga0070659_100194917 Ga0070659_1001949172 296
675 3300005441 Ga0070700_100313123 Ga0070700_1003131231 296
676 3300005458 Ga0070681_10005301 Ga0070681_100053016 296
677 3300005458 Ga0070681_10358338 Ga0070681_103583381 296
678 3300005459 Ga0068867_100019059 Ga0068867_1000190595 296
679 3300005459 Ga0068867_100140983 Ga0068867_1001409832 296
680 3300005466 Ga0070685_10029690 Ga0070685_100296901 296
681 3300005530 Ga0070679_100000973 Ga0070679_10000097319 296
682 3300005530 Ga0070679_100055296 Ga0070679_1000552963 296
683 3300005530 Ga0070679_100249019 Ga0070679_1002490192 296
684 3300005535 Ga0070684_100022740 Ga0070684_1000227404 296
685 3300005535 Ga0070684_100099941 Ga0070684_1000999412 296
686 3300005539 Ga0068853_100010559 Ga0068853_1000105596 296
687 3300005539 Ga0068853_100057677 Ga0068853_1000576772 296
688 3300005539 Ga0068853_100088732 Ga0068853_1000887322 296
689 3300005543 Ga0070672_100329967 Ga0070672_1003299672 296
690 3300005544 Ga0070686_100253836 Ga0070686_1002538361 296
691 3300005547 Ga0070693_100022172 Ga0070693_1000221723 296
692 3300005563 Ga0068855_100004987 Ga0068855_10000498713 296
693 3300005563 Ga0068855_100051013 Ga0068855_1000510134 296
694 3300005563 Ga0068855_100099457 Ga0068855_1000994574 296
695 3300005563 Ga0068855_100239514 Ga0068855_1002395143 296
696 3300005564 Ga0070664_100027435 Ga0070664_1000274355 296
697 3300005564 Ga0070664_100096084 Ga0070664_1000960843 296
698 3300005564 Ga0070664_100269108 Ga0070664_1002691083 296
699 3300005577 Ga0068857_100037108 Ga0068857_1000371084 296
700 3300005577 Ga0068857_100090030 Ga0068857_1000900302 296
701 3300005577 Ga0068857_100125945 Ga0068857_1001259452 296
702 3300005578 Ga0068854_100059696 Ga0068854_1000596963 296
703 3300005616 Ga0068852_100049153 Ga0068852_1000491533 296
704 3300005616 Ga0068852_100056318 Ga0068852_1000563183 296
705 3300005616 Ga0068852_100319746 Ga0068852_1003197462 296
706 3300005617 Ga0068859_100000297 Ga0068859_10000029732 296
707 3300005617 Ga0068859_100012921 Ga0068859_1000129217 296
708 3300005617 Ga0068859_100125357 Ga0068859_1001253573 296
709 3300005618 Ga0068864_100001608 Ga0068864_1000016084 296
710 3300005618 Ga0068864_100153123 Ga0068864_1001531233 296
711 3300005834 Ga0068851_10159207 Ga0068851_101592072 296
712 3300005834 Ga0068851_10230800 Ga0068851_102308002 296
713 3300005841 Ga0068863_100087086 Ga0068863_1000870863 296
714 3300005841 Ga0068863_100229108 Ga0068863_1002291083 296
715 3300005842 Ga0068858_100045372 Ga0068858_1000453725 296
716 3300005843 Ga0068860_100003819 Ga0068860_1000038191 296
717 3300005843 Ga0068860_100023835 Ga0068860_1000238352 296
718 3300005844 Ga0068862_100009911 Ga0068862_1000099117 296
719 3300006195 Ga0075366_10021480 Ga0075366_100214805 296
720 3300006237 Ga0097621_100122047 Ga0097621_1001220473 296
721 3300006358 Ga0068871_100019024 Ga0068871_1000190243 296
722 3300006358 Ga0068871_100588731 Ga0068871_1005887311 296
723 3300006931 Ga0097620_100000297 Ga0097620_10000029722 296
724 3300006931 Ga0097620_100012921 Ga0097620_1000129217 296
725 3300006931 Ga0097620_100125356 Ga0097620_1001253563 296
726 3300009093 Ga0105240_10000288 Ga0105240_100002887 296
727 3300009093 Ga0105240_10000486 Ga0105240_1000048618 296
728 3300009093 Ga0105240_10001336 Ga0105240_100013362 296
729 3300009093 Ga0105240_10036520 Ga0105240_100365204 296
730 3300009093 Ga0105240_10113122 Ga0105240_101131222 296
731 3300009093 Ga0105240_10356391 Ga0105240_103563913 296
732 3300009094 Ga0111539_10109423 Ga0111539_101094233 296
733 3300009174 Ga0105241_10000144 Ga0105241_1000014419 296
734 3300009174 Ga0105241_10009012 Ga0105241_100090127 296
735 3300009174 Ga0105241_10479124 Ga0105241_104791241 296
736 3300009176 Ga0105242_10145055 Ga0105242_101450552 296
737 3300009176 Ga0105242_10609050 Ga0105242_106090501 296
738 3300009545 Ga0105237_10000340 Ga0105237_1000034035 296
739 3300009545 Ga0105237_10002246 Ga0105237_1000224610 296
740 3300009545 Ga0105237_10020082 Ga0105237_100200825 296
741 3300009545 Ga0105237_10050656 Ga0105237_100506562 296
742 3300009545 Ga0105237_10574565 Ga0105237_105745651 296
743 3300009551 Ga0105238_10001478 Ga0105238_100014782 296
744 3300010375 Ga0105239_10007528 Ga0105239_100075285 296
745 3300010375 Ga0105239_10022636 Ga0105239_100226367 296
746 3300010375 Ga0105239_10059029 Ga0105239_100590294 296
747 3300013100 Ga0157373_10000240 Ga0157373_1000024024 296
748 3300013100 Ga0157373_10003717 Ga0157373_100037177 296
749 3300013100 Ga0157373_10010053 Ga0157373_100100537 296
750 3300013102 Ga0157371_10000052 Ga0157371_1000005259 296
751 3300013102 Ga0157371_10000315 Ga0157371_1000031547 296
752 3300013102 Ga0157371_10002042 Ga0157371_1000204214 296
753 3300013102 Ga0157371_10002767 Ga0157371_1000276714 296
754 3300013102 Ga0157371_10035173 Ga0157371_100351731 296
755 3300013102 Ga0157371_10159989 Ga0157371_101599891 296
756 3300013104 Ga0157370_10006627 Ga0157370_100066272 296
757 3300013104 Ga0157370_10006991 Ga0157370_100069913 296
758 3300013104 Ga0157370_10022321 Ga0157370_100223216 296
759 3300013104 Ga0157370_10062774 Ga0157370_100627743 296
760 3300013104 Ga0157370_10064117 Ga0157370_100641173 296
761 3300013104 Ga0157370_10204600 Ga0157370_102046002 296
762 3300013105 Ga0157369_10165029 Ga0157369_101650293 296
763 3300013296 Ga0157374_10000007 Ga0157374_10000007195 296
764 3300013296 Ga0157374_10006545 Ga0157374_100065454 296
765 3300013296 Ga0157374_10109266 Ga0157374_101092663 296
766 3300013297 Ga0157378_10006148 Ga0157378_1000614810 296
767 3300013297 Ga0157378_10536456 Ga0157378_105364561 296
768 3300013306 Ga0163162_10192462 Ga0163162_101924623 296
769 3300013307 Ga0157372_10000186 Ga0157372_100001864 296
770 3300013307 Ga0157372_10003368 Ga0157372_100033686 296
771 3300013307 Ga0157372_10136917 Ga0157372_101369173 296
772 3300013307 Ga0157372_10145531 Ga0157372_101455312 296
773 3300013307 Ga0157372_10150168 Ga0157372_101501682 296
774 3300013308 Ga0157375_10022597 Ga0157375_100225975 296
775 3300014325 Ga0163163_10002472 Ga0163163_100024724 296
776 3300014326 Ga0157380_10102557 Ga0157380_101025571 296
777 3300014497 Ga0182008_10000726 Ga0182008_100007267 296
778 3300014745 Ga0157377_10068656 Ga0157377_100686562 296
779 3300014969 Ga0157376_10010993 Ga0157376_100109934 296
780 3300015261 Ga0182006_1000505 Ga0182006_10005059 296
781 3300015261 Ga0182006_1009439 Ga0182006_10094395 296
782 3300017792 Ga0163161_10001536 Ga0163161_100015368 296
783 3300025242 Ga0209258_100068 Ga0209258_100068207 296
784 3300025246 Ga0209646_1006591 Ga0209646_10065912 296
785 3300025250 Ga0209026_1000351 Ga0209026_100035116 296
786 3300025254 Ga0209148_1000182 Ga0209148_100018227 296
787 3300025261 Ga0209233_1001459 Ga0209233_100145910 296
788 3300025273 Ga0209673_1000194 Ga0209673_10001945 296
789 3300025295 Ga0209564_1002770 Ga0209564_10027709 296
790 3300025295 Ga0209564_1018457 Ga0209564_10184573 296
791 3300025295 Ga0209564_1032622 Ga0209564_10326222 296
792 3300025297 Ga0209758_1005299 Ga0209758_10052993 296
793 3300025297 Ga0209758_1006844 Ga0209758_10068444 296
794 3300025298 Ga0209050_1000765 Ga0209050_100076519 296
795 3300025302 Ga0207426_1003100 Ga0207426_10031001 296
796 3300025302 Ga0207426_1003377 Ga0207426_10033771 296
797 3300025904 Ga0207647_10000030 Ga0207647_1000003036 296
798 3300025909 Ga0207705_10000069 Ga0207705_1000006981 296
799 3300025911 Ga0207654_10000765 Ga0207654_1000076510 296
800 3300025912 Ga0207707_10000317 Ga0207707_1000031728 296
801 3300025913 Ga0207695_10000170 Ga0207695_10000170157 296
802 3300025913 Ga0207695_10001063 Ga0207695_100010633 296
803 3300025913 Ga0207695_10001252 Ga0207695_1000125227 296
804 3300025913 Ga0207695_10005821 Ga0207695_1000582115 296
805 3300025913 Ga0207695_10007582 Ga0207695_100075828 296
806 3300025913 Ga0207695_10304710 Ga0207695_103047101 296
807 3300025914 Ga0207671_10001726 Ga0207671_1000172613 296
808 3300025914 Ga0207671_10035702 Ga0207671_100357023 296
809 3300025917 Ga0207660_10001972 Ga0207660_100019723 296
810 3300025919 Ga0207657_10016490 Ga0207657_100164903 296
811 3300025919 Ga0207657_10037451 Ga0207657_100374516 296
812 3300025921 Ga0207652_10000456 Ga0207652_1000045614 296
813 3300025924 Ga0207694_10016025 Ga0207694_100160255 296
814 3300025924 Ga0207694_10117772 Ga0207694_101177722 296
815 3300025925 Ga0207650_10005437 Ga0207650_100054378 296
816 3300025926 Ga0207659_10060146 Ga0207659_100601462 296
817 3300025932 Ga0207690_10003762 Ga0207690_100037623 296
818 3300025933 Ga0207706_10007335 Ga0207706_100073352 296
819 3300025936 Ga0207670_10067313 Ga0207670_100673133 296
820 3300025940 Ga0207691_10151805 Ga0207691_101518052 296
821 3300025942 Ga0207689_10317289 Ga0207689_103172892 296
822 3300025944 Ga0207661_10114832 Ga0207661_101148323 296
823 3300025945 Ga0207679_10124602 Ga0207679_101246022 296
824 3300025945 Ga0207679_10484342 Ga0207679_104843421 296
825 3300025949 Ga0207667_10009667 Ga0207667_100096674 296
826 3300025949 Ga0207667_10013674 Ga0207667_100136743 296
827 3300025960 Ga0207651_10436841 Ga0207651_104368411 296
828 3300025972 Ga0207668_10325537 Ga0207668_103255371 296
829 3300026035 Ga0207703_10030189 Ga0207703_100301893 296
830 3300026041 Ga0207639_10003462 Ga0207639_100034622 296
831 3300026041 Ga0207639_10015497 Ga0207639_100154972 296
832 3300026078 Ga0207702_10082017 Ga0207702_100820171 296
833 3300026088 Ga0207641_10007872 Ga0207641_100078724 296
834 3300026088 Ga0207641_10187368 Ga0207641_101873682 296
835 3300026088 Ga0207641_10220352 Ga0207641_102203522 296
836 3300026089 Ga0207648_10024715 Ga0207648_100247154 296
837 3300026095 Ga0207676_10001058 Ga0207676_1000105819 296
838 3300026116 Ga0207674_10050362 Ga0207674_100503622 296
839 3300026116 Ga0207674_10293853 Ga0207674_102938532 296
840 3300026118 Ga0207675_100083763 Ga0207675_1000837633 296
841 3300026142 Ga0207698_10089483 Ga0207698_100894831 296
842 3300026142 Ga0207698_10133598 Ga0207698_101335981 296
843 3300026142 Ga0207698_10272969 Ga0207698_102729692 296
844 3300026142 Ga0207698_10377523 Ga0207698_103775232 296
845 3300027907 Ga0207428_10035988 Ga0207428_100359883 296
846 3300028380 Ga0268265_10013369 Ga0268265_100133693 296
847 3300028381 Ga0268264_10020798 Ga0268264_100207984 296
848 3300028381 Ga0268264_10036652 Ga0268264_100366523 296
849 3300028794 Ga0307515_10000010 Ga0307515_10000010174 296
850 3300028794 Ga0307515_10000061 Ga0307515_10000061115 296
851 3300028794 Ga0307515_10261059 Ga0307515_102610592 296
852 3300028794 Ga0307515_10368975 Ga0307515_103689751 296
853 3300029957 Ga0265324_10043029 Ga0265324_100430291 296
854 3300030521 Ga0307511_10000455 Ga0307511_100004552 296
855 3300030731 Ga0316177_1124334 Ga0316177_11243342 296
856 3300030742 Ga0316183_1174733 Ga0316183_117473325 296
857 3300030744 Ga0316181_1092606 Ga0316181_109260611 296
858 3300031251 Ga0265327_10000219 Ga0265327_1000021935 296
859 3300031251 Ga0265327_10014024 Ga0265327_100140242 296
860 3300031507 Ga0307509_10110275 Ga0307509_101102753 296
861 3300031911 Ga0307412_10000018 Ga0307412_10000018201 296
862 3300032004 Ga0307414_10000048 Ga0307414_10000048104 296
863 3300032004 Ga0307414_10008445 Ga0307414_100084456 296
864 3300032005 Ga0307411_10011513 Ga0307411_100115133 296
865 3300033180 Ga0307510_10029288 Ga0307510_100292883 296
866 3300037471 Ga0395905_0177710 Ga0395905_0177710_701_1591 296
867 3300038443 Ga0395901_0108578 Ga0395901_0108578_590_1480 296
868 3300041494 Ga0451837_1313197 Ga0451837_1313197_202_1092 296
869 3300042876 Ga0451577_0009458 Ga0451577_0009458_2966_3859 296
870 3300044693 Ga0466961_0002285 Ga0466961_0002285_3155_4045 296
871 3300044712 Ga0453684_0085930 Ga0453684_0085930_411_1301 296
872 3300044712 Ga0453684_0124951 Ga0453684_0124951_180_1070 296
873 3300044712 Ga0453684_0206628 Ga0453684_0206628_1302_2192 296
874 3300044712 Ga0453684_0208460 Ga0453684_0208460_1038_1928 296
875 3300044735 Ga0466968_0106048 Ga0466968_0106048_201_1091 296
876 3300044765 Ga0466970_0019422 Ga0466970_0019422_1512_2402 296
877 3300044842 Ga0466957_0192797 Ga0466957_0192797_117_1007 296
878 3300044842 Ga0466957_0301490 Ga0466957_0301490_70_978 296
879 3300045049 Ga0466959_0002751 Ga0466959_0002751_7067_7957 296
880 3300045049 Ga0466959_0117825 Ga0466959_0117825_40_930 296
881 3300045051 Ga0451576_0003337 Ga0451576_0003337_13316_14206 296
882 3300045051 Ga0451576_0010351 Ga0451576_0010351_1377_2267 296
883 3300046457 Ga0495590_0016811 Ga0495590_0016811_1552_2442 296
884 3300046460 Ga0495638_0000003 Ga0495638_0000003_104447_105337 296
885 3300046471 Ga0495650_0000014 Ga0495650_0000014_115306_116196 296
886 3300046492 Ga0495585_0001092 Ga0495585_0001092_4076_4966 296
887 3300046507 Ga0495606_0000096 Ga0495606_0000096_115134_116024 296
888 3300046507 Ga0495606_0009086 Ga0495606_0009086_6491_7381 296
889 3300046513 Ga0495616_0006078 Ga0495616_0006078_1000_1890 296
890 3300046520 Ga0495637_0046286 Ga0495637_0046286_76_966 296
891 3300046648 Ga0495611_0006112 Ga0495611_0006112_1132_2022 296
892 3300046660 Ga0495625_0000003 Ga0495625_0000003_119890_120780 296
893 3300046660 Ga0495625_0219254 Ga0495625_0219254_246_1136 296
894 3300046665 Ga0495661_0001756 Ga0495661_0001756_12869_13759 296
895 3300046694 Ga0495649_0000002 Ga0495649_0000002_886213_887103 296
896 3300047443 Ga0495687_001602 Ga0495687_001602_10583_11473 296
897 3300047469 Ga0495673_0045627 Ga0495673_0045627_247_1137 296
898 3300047472 Ga0495686_0000034 Ga0495686_0000034_225740_226630 296
899 3300047472 Ga0495686_0036083 Ga0495686_0036083_2089_2991 296
900 3300048925 Ga0496122_0000789 Ga0496122_0000789_54638_55528 296
901 3300048926 Ga0496123_0002415 Ga0496123_0002415_2395_3285 296
902 3300049521 Ga0501298_000106 Ga0501298_000106_2591_3481 296
903 3300049571 Ga0501034_0298918 Ga0501034_0298918_569_1459 296
904 3300049579 Ga0501043_0211969 Ga0501043_0211969_440_1330 296
905 3300049653 Ga0501206_019302 Ga0501206_019302_59_949 296
906 3300049654 Ga0501207_002619 Ga0501207_002619_832_1722 296
907 3300049663 Ga0501223_005427 Ga0501223_005427_59_949 296
908 3300049664 Ga0501224_001146 Ga0501224_001146_797_1687 296
909 3300049669 Ga0501235_002262 Ga0501235_002262_203_1093 296
910 3300049675 Ga0501243_002218 Ga0501243_002218_613_1503 296
911 3300049688 Ga0501259_000663 Ga0501259_000663_2073_2963 296
912 3300049690 Ga0501261_001376 Ga0501261_001376_1801_2691 296
913 3300049704 Ga0501221_001422 Ga0501221_001422_342_1232 296
914 3300049705 Ga0501225_0000966 Ga0501225_0000966_5780_6670 296
915 3300049705 Ga0501225_0020594 Ga0501225_0020594_846_1736 296
916 3300049707 Ga0501234_015381 Ga0501234_015381_16_906 296
917 3300049708 Ga0501245_001190 Ga0501245_001190_1629_2519 296
918 3300049742 Ga0501080_0193060 Ga0501080_0193060_126_1016 296
919 3300049757 Ga0501232_005086 Ga0501232_005086_204_1094 296
920 3300049758 Ga0501241_001023 Ga0501241_001023_3178_4068 296
921 3300049758 Ga0501241_004726 Ga0501241_004726_1361_2251 296
922 3300049775 Ga0501279_010928 Ga0501279_010928_229_1119 296
923 3300049823 Ga0501044_0075975 Ga0501044_0075975_1453_2346 296
924 3300050493 nmdc:mga0k408_10430_c1 nmdc:mga0k408_10430_c1_843_1733 296
925 3300050493 nmdc:mga0k408_70668_c1 nmdc:mga0k408_70668_c1_914_1822 296
926 3300050511 nmdc:mga08y16_29337_c1 nmdc:mga08y16_29337_c1_4223_5113 296
927 3300053088 Ga0500644_0000267 Ga0500644_0000267_21296_22186 296
928 3300053090 Ga0500646_0008454 Ga0500646_0008454_1416_2306 296
929 3300053092 Ga0500583_0002749 Ga0500583_0002749_3247_4137 296
930 3300053092 Ga0500583_0094654 Ga0500583_0094654_378_1268 296
931 3300053093 Ga0500651_0001157 Ga0500651_0001157_2100_2990 296
932 3300053096 Ga0500641_0000083 Ga0500641_0000083_5288_6178 296
933 3300053109 Ga0500569_000319 Ga0500569_000319_1661_2551 296
934 3300053134 Ga0500658_0000550 Ga0500658_0000550_14130_15020 296
935 3300053136 Ga0500559_0015345 Ga0500559_0015345_49_939 296
936 3300053142 Ga0500577_0006687 Ga0500577_0006687_1800_2690 296
937 3300053148 Ga0500590_079001 Ga0500590_079001_211_1101 296
938 3300053153 Ga0500616_0014667 Ga0500616_0014667_1210_2100 296
939 3300053154 Ga0500619_034142 Ga0500619_034142_240_1130 296
940 3300053156 Ga0500622_0000864 Ga0500622_0000864_431_1321 296
941 3300053160 Ga0500633_0076677 Ga0500633_0076677_72_962 296
942 2162886007 SwRhRL2b_contig_2434048 SwRhRL2b_0986.00001930 297
943 3300003320 rootH2_10025473 rootH2_1002547315 297
944 3300003320 rootH2_10032420 rootH2_100324203 297
945 3300003320 rootH2_10105619 rootH2_101056193 297
946 3300003781 Ga0055536_1000030 Ga0055536_100003013 297
947 3300003784 Ga0055534_1003684 Ga0055534_10036843 297
948 3300003791 Ga0055530_10000723 Ga0055530_1000072320 297
949 3300005288 Ga0065714_10064513 Ga0065714_1006451310 297
950 3300005288 Ga0065714_10064933 Ga0065714_1006493316 297
951 3300005288 Ga0065714_10067901 Ga0065714_100679015 297
952 3300005289 Ga0065704_10070945 Ga0065704_100709455 297
953 3300005329 Ga0070683_100008790 Ga0070683_1000087905 297
954 3300005335 Ga0070666_10124451 Ga0070666_101244512 297
955 3300005336 Ga0070680_100013984 Ga0070680_1000139842 297
956 3300005336 Ga0070680_100109344 Ga0070680_1001093442 297
957 3300005336 Ga0070680_100290676 Ga0070680_1002906762 297
958 3300005337 Ga0070682_100000353 Ga0070682_10000035313 297
959 3300005338 Ga0068868_100035335 Ga0068868_1000353353 297
960 3300005339 Ga0070660_100028630 Ga0070660_1000286303 297
961 3300005339 Ga0070660_100086147 Ga0070660_1000861474 297
962 3300005339 Ga0070660_100338361 Ga0070660_1003383611 297
963 3300005347 Ga0070668_100445138 Ga0070668_1004451381 297
964 3300005355 Ga0070671_100007630 Ga0070671_1000076305 297
965 3300005455 Ga0070663_100077955 Ga0070663_1000779552 297
966 3300005457 Ga0070662_100000185 Ga0070662_10000018522 297
967 3300005458 Ga0070681_10038676 Ga0070681_100386763 297
968 3300005458 Ga0070681_10150936 Ga0070681_101509362 297
969 3300005458 Ga0070681_10203847 Ga0070681_102038472 297
970 3300005459 Ga0068867_100001831 Ga0068867_1000018313 297
971 3300005530 Ga0070679_100017813 Ga0070679_1000178132 297
972 3300005530 Ga0070679_100058796 Ga0070679_1000587963 297
973 3300005530 Ga0070679_100157974 Ga0070679_1001579742 297
974 3300005530 Ga0070679_100165970 Ga0070679_1001659703 297
975 3300005530 Ga0070679_100170362 Ga0070679_1001703622 297
976 3300005535 Ga0070684_100001352 Ga0070684_10000135214 297
977 3300005539 Ga0068853_100034968 Ga0068853_1000349681 297
978 3300005539 Ga0068853_100040230 Ga0068853_1000402304 297
979 3300005539 Ga0068853_100135766 Ga0068853_1001357661 297
980 3300005544 Ga0070686_100152913 Ga0070686_1001529131 297
981 3300005548 Ga0070665_100000013 Ga0070665_100000013185 297
982 3300005563 Ga0068855_100002280 Ga0068855_1000022808 297
983 3300005563 Ga0068855_100004799 Ga0068855_1000047997 297
984 3300005563 Ga0068855_100032608 Ga0068855_1000326082 297
985 3300005577 Ga0068857_100086576 Ga0068857_1000865763 297
986 3300005577 Ga0068857_100551347 Ga0068857_1005513471 297
987 3300005578 Ga0068854_100162486 Ga0068854_1001624862 297
988 3300005578 Ga0068854_100388785 Ga0068854_1003887851 297
989 3300005614 Ga0068856_100063370 Ga0068856_1000633704 297
990 3300005614 Ga0068856_100065310 Ga0068856_1000653103 297
991 3300005614 Ga0068856_100104346 Ga0068856_1001043462 297
992 3300005834 Ga0068851_10004628 Ga0068851_100046287 297
993 3300005834 Ga0068851_10081233 Ga0068851_100812332 297
994 3300005843 Ga0068860_100000060 Ga0068860_100000060176 297
995 3300005843 Ga0068860_100008084 Ga0068860_1000080842 297
996 3300005844 Ga0068862_100202793 Ga0068862_1002027932 297
997 3300005985 Ga0081539_10000377 Ga0081539_1000037790 297
998 3300006880 Ga0075429_100005622 Ga0075429_10000562210 297
999 3300006881 Ga0068865_100034481 Ga0068865_1000344812 297
1000 3300009036 Ga0105244_10000050 Ga0105244_1000005027 297
1001 3300009093 Ga0105240_10035851 Ga0105240_100358513 297
1002 3300009093 Ga0105240_10036908 Ga0105240_100369084 297
1003 3300009093 Ga0105240_10090460 Ga0105240_100904601 297
1004 3300009093 Ga0105240_10399782 Ga0105240_103997821 297
1005 3300009093 Ga0105240_10618733 Ga0105240_106187332 297
1006 3300009094 Ga0111539_10057146 Ga0111539_100571461 297
1007 3300009147 Ga0114129_10062706 Ga0114129_100627063 297
1008 3300009148 Ga0105243_10000714 Ga0105243_100007147 297
1009 3300009174 Ga0105241_10023476 Ga0105241_100234762 297
1010 3300009174 Ga0105241_10128325 Ga0105241_101283252 297
1011 3300009545 Ga0105237_10037688 Ga0105237_100376885 297
1012 3300009545 Ga0105237_10082559 Ga0105237_100825593 297
1013 3300009551 Ga0105238_10033082 Ga0105238_100330822 297
1014 3300009553 Ga0105249_10181116 Ga0105249_101811161 297
1015 3300009553 Ga0105249_10283010 Ga0105249_102830102 297
1016 3300010375 Ga0105239_10000002 Ga0105239_10000002444 297
1017 3300010375 Ga0105239_10003371 Ga0105239_1000337114 297
1018 3300010375 Ga0105239_10043544 Ga0105239_100435444 297
1019 3300010375 Ga0105239_10106259 Ga0105239_101062592 297
1020 3300011119 Ga0105246_10031234 Ga0105246_100312343 297
1021 3300011119 Ga0105246_10204698 Ga0105246_102046981 297
1022 3300013100 Ga0157373_10000022 Ga0157373_10000022120 297
1023 3300013100 Ga0157373_10016960 Ga0157373_100169602 297
1024 3300013100 Ga0157373_10041929 Ga0157373_100419293 297
1025 3300013100 Ga0157373_10043691 Ga0157373_100436915 297
1026 3300013100 Ga0157373_10197718 Ga0157373_101977181 297
1027 3300013102 Ga0157371_10000034 Ga0157371_1000003497 297
1028 3300013102 Ga0157371_10001806 Ga0157371_1000180611 297
1029 3300013102 Ga0157371_10001838 Ga0157371_1000183820 297
1030 3300013102 Ga0157371_10009079 Ga0157371_100090793 297
1031 3300013102 Ga0157371_10019323 Ga0157371_100193235 297
1032 3300013102 Ga0157371_10030858 Ga0157371_100308585 297
1033 3300013102 Ga0157371_10032647 Ga0157371_100326475 297
1034 3300013102 Ga0157371_10032676 Ga0157371_100326763 297
1035 3300013102 Ga0157371_10051810 Ga0157371_100518102 297
1036 3300013102 Ga0157371_10103550 Ga0157371_101035502 297
1037 3300013104 Ga0157370_10001848 Ga0157370_1000184818 297
1038 3300013104 Ga0157370_10003381 Ga0157370_100033816 297
1039 3300013104 Ga0157370_10010995 Ga0157370_1001099511 297
1040 3300013104 Ga0157370_10014889 Ga0157370_100148894 297
1041 3300013104 Ga0157370_10035152 Ga0157370_100351524 297
1042 3300013104 Ga0157370_10066514 Ga0157370_100665143 297
1043 3300013104 Ga0157370_10191187 Ga0157370_101911872 297
1044 3300013104 Ga0157370_10295832 Ga0157370_102958322 297
1045 3300013105 Ga0157369_10000002 Ga0157369_10000002182 297
1046 3300013105 Ga0157369_10000546 Ga0157369_1000054615 297
1047 3300013105 Ga0157369_10012625 Ga0157369_100126259 297
1048 3300013105 Ga0157369_10123229 Ga0157369_101232293 297
1049 3300013105 Ga0157369_10126597 Ga0157369_101265973 297
1050 3300013105 Ga0157369_10198778 Ga0157369_101987783 297
1051 3300013105 Ga0157369_10214794 Ga0157369_102147942 297
1052 3300013105 Ga0157369_10228096 Ga0157369_102280963 297
1053 3300013105 Ga0157369_10229542 Ga0157369_102295423 297
1054 3300013296 Ga0157374_10041358 Ga0157374_100413584 297
1055 3300013296 Ga0157374_10091140 Ga0157374_100911402 297
1056 3300013296 Ga0157374_10157830 Ga0157374_101578301 297
1057 3300013296 Ga0157374_10201422 Ga0157374_102014224 297
1058 3300013297 Ga0157378_10261061 Ga0157378_102610613 297
1059 3300013306 Ga0163162_10000213 Ga0163162_100002133 297
1060 3300013306 Ga0163162_10000330 Ga0163162_1000033032 297
1061 3300013306 Ga0163162_10002936 Ga0163162_100029366 297
1062 3300013307 Ga0157372_10001805 Ga0157372_100018053 297
1063 3300013307 Ga0157372_10010801 Ga0157372_100108014 297
1064 3300013307 Ga0157372_10013159 Ga0157372_100131598 297
1065 3300013307 Ga0157372_10019462 Ga0157372_100194622 297
1066 3300013307 Ga0157372_10070389 Ga0157372_100703894 297
1067 3300013307 Ga0157372_10429567 Ga0157372_104295672 297
1068 3300013307 Ga0157372_10482947 Ga0157372_104829472 297
1069 3300013307 Ga0157372_10578885 Ga0157372_105788852 297
1070 3300013307 Ga0157372_10864322 Ga0157372_108643221 297
1071 3300013308 Ga0157375_10000178 Ga0157375_100001787 297
1072 3300013308 Ga0157375_10032794 Ga0157375_100327945 297
1073 3300013308 Ga0157375_10076124 Ga0157375_100761242 297
1074 3300014325 Ga0163163_10075694 Ga0163163_100756943 297
1075 3300014497 Ga0182008_10000129 Ga0182008_1000012940 297
1076 3300014497 Ga0182008_10001151 Ga0182008_100011518 297
1077 3300014745 Ga0157377_10008517 Ga0157377_100085173 297
1078 3300014968 Ga0157379_10063857 Ga0157379_100638572 297
1079 3300015261 Ga0182006_1000012 Ga0182006_100001268 297
1080 3300015261 Ga0182006_1002042 Ga0182006_10020422 297
1081 3300015261 Ga0182006_1002694 Ga0182006_10026949 297
1082 3300015262 Ga0182007_10000001 Ga0182007_10000001591 297
1083 3300015262 Ga0182007_10035102 Ga0182007_100351021 297
1084 3300015682 Ga0183373_1003 Ga0183373_100322 297
1085 3300017792 Ga0163161_10000224 Ga0163161_100002241 297
1086 3300017792 Ga0163161_10001201 Ga0163161_1000120115 297
1087 3300017792 Ga0163161_10002262 Ga0163161_100022622 297
1088 3300021384 Ga0213876_10041036 Ga0213876_100410363 297
1089 3300025250 Ga0209026_1001890 Ga0209026_10018903 297
1090 3300025291 Ga0209675_1000116 Ga0209675_100011633 297
1091 3300025292 Ga0209676_1000001 Ga0209676_10000011077 297
1092 3300025298 Ga0209050_1000018 Ga0209050_1000018506 297
1093 3300025298 Ga0209050_1005793 Ga0209050_10057936 297
1094 3300025321 Ga0207656_10053808 Ga0207656_100538081 297
1095 3300025728 Ga0207655_1000480 Ga0207655_10004808 297
1096 3300025904 Ga0207647_10000093 Ga0207647_1000009317 297
1097 3300025904 Ga0207647_10175645 Ga0207647_101756452 297
1098 3300025909 Ga0207705_10013031 Ga0207705_100130313 297
1099 3300025909 Ga0207705_10038520 Ga0207705_100385202 297
1100 3300025909 Ga0207705_10214348 Ga0207705_102143481 297
1101 3300025911 Ga0207654_10003795 Ga0207654_100037958 297
1102 3300025912 Ga0207707_10031015 Ga0207707_100310154 297
1103 3300025912 Ga0207707_10084341 Ga0207707_100843412 297
1104 3300025913 Ga0207695_10003137 Ga0207695_100031376 297
1105 3300025913 Ga0207695_10061629 Ga0207695_100616293 297
1106 3300025913 Ga0207695_10088895 Ga0207695_100888953 297
1107 3300025917 Ga0207660_10164749 Ga0207660_101647493 297
1108 3300025919 Ga0207657_10049987 Ga0207657_100499872 297
1109 3300025919 Ga0207657_10084882 Ga0207657_100848822 297
1110 3300025921 Ga0207652_10000035 Ga0207652_1000003581 297
1111 3300025921 Ga0207652_10011733 Ga0207652_100117334 297
1112 3300025921 Ga0207652_10163411 Ga0207652_101634113 297
1113 3300025931 Ga0207644_10008482 Ga0207644_100084825 297
1114 3300025932 Ga0207690_10039633 Ga0207690_100396333 297
1115 3300025933 Ga0207706_10000243 Ga0207706_1000024313 297
1116 3300025935 Ga0207709_10000385 Ga0207709_1000038521 297
1117 3300025944 Ga0207661_10004578 Ga0207661_1000457811 297
1118 3300025949 Ga0207667_10001727 Ga0207667_1000172712 297
1119 3300025949 Ga0207667_10003906 Ga0207667_1000390617 297
1120 3300025949 Ga0207667_10007947 Ga0207667_100079475 297
1121 3300025949 Ga0207667_10038396 Ga0207667_100383964 297
1122 3300025949 Ga0207667_10051902 Ga0207667_100519022 297
1123 3300025949 Ga0207667_10116102 Ga0207667_101161023 297
1124 3300025972 Ga0207668_10123391 Ga0207668_101233911 297
1125 3300025981 Ga0207640_10026917 Ga0207640_100269173 297
1126 3300026041 Ga0207639_10003621 Ga0207639_100036212 297
1127 3300026041 Ga0207639_10095011 Ga0207639_100950112 297
1128 3300026041 Ga0207639_10155125 Ga0207639_101551253 297
1129 3300026067 Ga0207678_10032984 Ga0207678_100329844 297
1130 3300026078 Ga0207702_10034899 Ga0207702_100348992 297
1131 3300026078 Ga0207702_10139415 Ga0207702_101394153 297
1132 3300026078 Ga0207702_10335977 Ga0207702_103359772 297
1133 3300026089 Ga0207648_10038642 Ga0207648_100386425 297
1134 3300026095 Ga0207676_10222150 Ga0207676_102221502 297
1135 3300026116 Ga0207674_10108632 Ga0207674_101086323 297
1136 3300026116 Ga0207674_10254511 Ga0207674_102545112 297
1137 3300027111 Ga0209281_1000116 Ga0209281_100011669 297
1138 3300028379 Ga0268266_10000024 Ga0268266_10000024216 297
1139 3300028380 Ga0268265_10196297 Ga0268265_101962972 297
1140 3300028381 Ga0268264_10000109 Ga0268264_10000109110 297
1141 3300028381 Ga0268264_10005664 Ga0268264_100056647 297
1142 3300031548 Ga0307408_100003540 Ga0307408_10000354012 297
1143 3300031731 Ga0307405_10000026 Ga0307405_1000002675 297
1144 3300031901 Ga0307406_10000038 Ga0307406_1000003864 297
1145 3300031903 Ga0307407_10000032 Ga0307407_1000003250 297
1146 3300031903 Ga0307407_10002036 Ga0307407_100020369 297
1147 3300031911 Ga0307412_10000007 Ga0307412_10000007351 297
1148 3300031911 Ga0307412_10000175 Ga0307412_100001756 297
1149 3300031911 Ga0307412_10002066 Ga0307412_1000206613 297
1150 3300031911 Ga0307412_10043584 Ga0307412_100435843 297
1151 3300032002 Ga0307416_100000003 Ga0307416_100000003253 297
1152 3300032002 Ga0307416_100000045 Ga0307416_10000004583 297
1153 3300032004 Ga0307414_10000001 Ga0307414_10000001758 297
1154 3300032004 Ga0307414_10000200 Ga0307414_1000020010 297
1155 3300032004 Ga0307414_10021005 Ga0307414_100210054 297
1156 3300032004 Ga0307414_10063408 Ga0307414_100634081 297
1157 3300032004 Ga0307414_10079718 Ga0307414_100797183 297
1158 3300032004 Ga0307414_10364447 Ga0307414_103644471 297
1159 3300033180 Ga0307510_10001211 Ga0307510_1000121112 297
1160 3300035692 Ga0373935_0132040 Ga0373935_0132040_211_1104 297
1161 3300036401 Ga0373937_0250921 Ga0373937_0250921_745_1638 297
1162 3300037312 Ga0395899_0000950 Ga0395899_0000950_23214_24107 297
1163 3300037312 Ga0395899_0002365 Ga0395899_0002365_7012_7905 297
1164 3300037312 Ga0395899_0026711 Ga0395899_0026711_3278_4171 297
1165 3300037312 Ga0395899_0092688 Ga0395899_0092688_366_1259 297
1166 3300037312 Ga0395899_0139949 Ga0395899_0139949_602_1495 297
1167 3300037418 Ga0395900_0000014 Ga0395900_0000014_129607_130500 297
1168 3300037418 Ga0395900_0019416 Ga0395900_0019416_1099_1992 297
1169 3300037418 Ga0395900_0163868 Ga0395900_0163868_992_1885 297
1170 3300037418 Ga0395900_0297733 Ga0395900_0297733_502_1395 297
1171 3300037466 Ga0395898_0053462 Ga0395898_0053462_1825_2718 297
1172 3300037466 Ga0395898_0108210 Ga0395898_0108210_746_1639 297
1173 3300037466 Ga0395898_0143181 Ga0395898_0143181_1020_1913 297
1174 3300037471 Ga0395905_0000037 Ga0395905_0000037_129597_130490 297
1175 3300037471 Ga0395905_0010753 Ga0395905_0010753_5103_5996 297
1176 3300037471 Ga0395905_0146491 Ga0395905_0146491_400_1293 297
1177 3300038443 Ga0395901_0000117 Ga0395901_0000117_43254_44147 297
1178 3300038443 Ga0395901_0008828 Ga0395901_0008828_7485_8378 297
1179 3300038443 Ga0395901_0020717 Ga0395901_0020717_216_1109 297
1180 3300038443 Ga0395901_0221536 Ga0395901_0221536_142_1035 297
1181 3300039437 Ga0436365_0187021 Ga0436365_0187021_2341_3234 297
1182 3300039437 Ga0436365_1705244 Ga0436365_1705244_272_1165 297
1183 3300039447 Ga0436361_0191006 Ga0436361_0191006_11558_12451 297
1184 3300041407 Ga0439447_002503 Ga0439447_002503_443_1336 297
1185 3300041413 Ga0439465_0001507 Ga0439465_0001507_1296_2189 297
1186 3300041498 Ga0451841_0285170 Ga0451841_0285170_55_948 297
1187 3300042004 Ga0439445_0002356 Ga0439445_0002356_616_1509 297
1188 3300042876 Ga0451577_0001803 Ga0451577_0001803_1143_2036 297
1189 3300044658 Ga0466972_0000013 Ga0466972_0000013_153425_154318 297
1190 3300044706 Ga0466964_0057032 Ga0466964_0057032_398_1291 297
1191 3300044712 Ga0453684_0001992 Ga0453684_0001992_2514_3407 297
1192 3300044842 Ga0466957_0000156 Ga0466957_0000156_23479_24372 297
1193 3300045051 Ga0451576_0035608 Ga0451576_0035608_2805_3698 297
1194 3300045976 Ga0466967_0039205 Ga0466967_0039205_1340_2233 297
1195 3300046453 Ga0495627_000002 Ga0495627_000002_264207_265100 297
1196 3300046472 Ga0495580_0110399 Ga0495580_0110399_942_1835 297
1197 3300046500 Ga0495596_0005716 Ga0495596_0005716_179_1072 297
1198 3300046507 Ga0495606_0077987 Ga0495606_0077987_1159_2052 297
1199 3300046512 Ga0495610_0000009 Ga0495610_0000009_146761_147654 297
1200 3300046512 Ga0495610_0000472 Ga0495610_0000472_11286_12179 297
1201 3300046512 Ga0495610_0000791 Ga0495610_0000791_20785_21678 297
1202 3300046517 Ga0495630_0087576 Ga0495630_0087576_838_1731 297
1203 3300046518 Ga0495631_0014272 Ga0495631_0014272_2100_2993 297
1204 3300046519 Ga0495632_0001031 Ga0495632_0001031_12723_13616 297
1205 3300046522 Ga0495643_0212208 Ga0495643_0212208_10_903 297
1206 3300046529 Ga0495652_0363210 Ga0495652_0363210_120_1013 297
1207 3300046530 Ga0495654_0000001 Ga0495654_0000001_1297985_1298878 297
1208 3300046535 Ga0495586_0209159 Ga0495586_0209159_121_1014 297
1209 3300046538 Ga0495609_0000130 Ga0495609_0000130_25441_26334 297
1210 3300046558 Ga0495633_0000002 Ga0495633_0000002_252626_253519 297
1211 3300046558 Ga0495633_0050424 Ga0495633_0050424_1011_1904 297
1212 3300046616 Ga0495668_0001458 Ga0495668_0001458_11544_12437 297
1213 3300046660 Ga0495625_0001053 Ga0495625_0001053_17538_18431 297
1214 3300046660 Ga0495625_0081162 Ga0495625_0081162_239_1132 297
1215 3300046683 Ga0495658_0011980 Ga0495658_0011980_1245_2138 297
1216 3300047443 Ga0495687_000014 Ga0495687_000014_125079_125972 297
1217 3300047443 Ga0495687_001036 Ga0495687_001036_4991_5884 297
1218 3300047471 Ga0495684_0272103 Ga0495684_0272103_287_1180 297
1219 3300047472 Ga0495686_0000022 Ga0495686_0000022_106345_107238 297
1220 3300047472 Ga0495686_0000367 Ga0495686_0000367_36334_37227 297
1221 3300048906 Ga0496103_0059333 Ga0496103_0059333_231_1124 297
1222 3300048919 Ga0496116_0000022 Ga0496116_0000022_23493_24386 297
1223 3300048920 Ga0496117_0000074 Ga0496117_0000074_26756_27649 297
1224 3300048921 Ga0496118_0001188 Ga0496118_0001188_19391_20284 297
1225 3300048921 Ga0496118_0153203 Ga0496118_0153203_203_1096 297
1226 3300048922 Ga0496119_0000426 Ga0496119_0000426_22740_23633 297
1227 3300048925 Ga0496122_0000354 Ga0496122_0000354_92055_92948 297
1228 3300048925 Ga0496122_0000357 Ga0496122_0000357_23701_24594 297
1229 3300048925 Ga0496122_0000598 Ga0496122_0000598_8997_9890 297
1230 3300048925 Ga0496122_0003624 Ga0496122_0003624_18064_18957 297
1231 3300048925 Ga0496122_0014216 Ga0496122_0014216_1190_2083 297
1232 3300048926 Ga0496123_0001991 Ga0496123_0001991_6163_7056 297
1233 3300048926 Ga0496123_0007740 Ga0496123_0007740_1182_2075 297
1234 3300048926 Ga0496123_0094824 Ga0496123_0094824_331_1224 297
1235 3300048927 Ga0496124_0005359 Ga0496124_0005359_1155_2048 297
1236 3300048928 Ga0496125_0001036 Ga0496125_0001036_36535_37428 297
1237 3300048928 Ga0496125_0020214 Ga0496125_0020214_4202_5095 297
1238 3300048929 Ga0496126_0001468 Ga0496126_0001468_6125_7018 297
1239 3300049569 Ga0501032_0065860 Ga0501032_0065860_787_1680 297
1240 3300049581 Ga0501047_0007483 Ga0501047_0007483_2552_3445 297
1241 3300049586 Ga0501070_0208243 Ga0501070_0208243_324_1217 297
1242 3300049586 Ga0501070_0426641 Ga0501070_0426641_143_1036 297
1243 3300049589 Ga0501073_0058809 Ga0501073_0058809_227_1120 297
1244 3300049654 Ga0501207_012747 Ga0501207_012747_208_1101 297
1245 3300049663 Ga0501223_002515 Ga0501223_002515_2428_3321 297
1246 3300049686 Ga0501257_001165 Ga0501257_001165_984_1877 297
1247 3300049688 Ga0501259_006093 Ga0501259_006093_234_1127 297
1248 3300049705 Ga0501225_0037668 Ga0501225_0037668_258_1151 297
1249 3300049742 Ga0501080_0219204 Ga0501080_0219204_236_1129 297
1250 3300049758 Ga0501241_000046 Ga0501241_000046_20804_21697 297
1251 3300049763 Ga0501266_003461 Ga0501266_003461_89_982 297
1252 3300049766 Ga0501269_000938 Ga0501269_000938_2245_3138 297
1253 3300049776 Ga0501280_000623 Ga0501280_000623_7152_8045 297
1254 3300049822 Ga0501035_0182177 Ga0501035_0182177_196_1089 297
1255 3300050507 nmdc:mga05p37_1489_c1 nmdc:mga05p37_1489_c1_17513_18406 297
1256 3300050511 nmdc:mga08y16_58894_c1 nmdc:mga08y16_58894_c1_1009_1902 297
1257 3300053086 Ga0500578_0000155 Ga0500578_0000155_49200_50093 297
1258 3300053091 Ga0500647_0106336 Ga0500647_0106336_169_1062 297
1259 3300053122 Ga0500608_000329 Ga0500608_000329_423_1316 297
1260 3300053125 Ga0500618_000004 Ga0500618_000004_25818_26711 297
1261 3300053147 Ga0500589_047465 Ga0500589_047465_829_1722 297
1262 3300053151 Ga0500604_0001214 Ga0500604_0001214_1736_2629 297
1263 3300053153 Ga0500616_0000007 Ga0500616_0000007_644001_644894 297
1264 3300053156 Ga0500622_0000003 Ga0500622_0000003_602547_603440 297
1265 3300053156 Ga0500622_0001894 Ga0500622_0001894_9402_10295 297
1266 3300054114 Ga0501084_0186693 Ga0501084_0186693_798_1691 297
1267 3300060353 Ga0501082_0145745 Ga0501082_0145745_1110_2003 297
1268 3300002773 JGI25152J39213_1000894 JGI25152J39213_10008946 298
1269 3300002774 JGI25150J39212_1000051 JGI25150J39212_10000515 298
1270 3300003163 Ga0006759J45824_1089253 Ga0006759J45824_10892531 298
1271 3300003187 JGI25151J46595_10000205 JGI25151J46595_1000020560 298
1272 3300003215 JGI25153J46596_10000144 JGI25153J46596_100001445 298
1273 3300003323 rootH1_10000188 rootH1_100001883 298
1274 3300003323 rootH1_10239411 rootH1_102394112 298
1275 3300003693 Ga0032354_1091257 Ga0032354_10912571 298
1276 3300003794 Ga0055531_10000153 Ga0055531_1000015346 298
1277 3300005327 Ga0070658_10000620 Ga0070658_100006203 298
1278 3300005328 Ga0070676_10004448 Ga0070676_100044485 298
1279 3300005330 Ga0070690_100014558 Ga0070690_1000145583 298
1280 3300005335 Ga0070666_10000149 Ga0070666_1000014916 298
1281 3300005335 Ga0070666_10045180 Ga0070666_100451802 298
1282 3300005335 Ga0070666_10101986 Ga0070666_101019863 298
1283 3300005338 Ga0068868_100001512 Ga0068868_1000015125 298
1284 3300005338 Ga0068868_100542909 Ga0068868_1005429091 298
1285 3300005347 Ga0070668_100000116 Ga0070668_1000001165 298
1286 3300005354 Ga0070675_100027436 Ga0070675_1000274364 298
1287 3300005364 Ga0070673_100000521 Ga0070673_10000052122 298
1288 3300005367 Ga0070667_100000652 Ga0070667_1000006522 298
1289 3300005367 Ga0070667_100062287 Ga0070667_1000622873 298
1290 3300005367 Ga0070667_100097378 Ga0070667_1000973782 298
1291 3300005456 Ga0070678_100021123 Ga0070678_1000211233 298
1292 3300005456 Ga0070678_100035033 Ga0070678_1000350334 298
1293 3300005457 Ga0070662_100001619 Ga0070662_1000016193 298
1294 3300005457 Ga0070662_100043870 Ga0070662_1000438704 298
1295 3300005458 Ga0070681_10147632 Ga0070681_101476321 298
1296 3300005459 Ga0068867_100017992 Ga0068867_1000179922 298
1297 3300005459 Ga0068867_100108711 Ga0068867_1001087112 298
1298 3300005466 Ga0070685_10219722 Ga0070685_102197222 298
1299 3300005471 Ga0070698_100065647 Ga0070698_1000656472 298
1300 3300005535 Ga0070684_100209603 Ga0070684_1002096032 298
1301 3300005539 Ga0068853_100003822 Ga0068853_1000038229 298
1302 3300005539 Ga0068853_100304975 Ga0068853_1003049752 298
1303 3300005543 Ga0070672_100000038 Ga0070672_10000003816 298
1304 3300005544 Ga0070686_100084247 Ga0070686_1000842472 298
1305 3300005548 Ga0070665_100000003 Ga0070665_100000003341 298
1306 3300005548 Ga0070665_100000504 Ga0070665_10000050423 298
1307 3300005563 Ga0068855_100171289 Ga0068855_1001712893 298
1308 3300005563 Ga0068855_100440427 Ga0068855_1004404272 298
1309 3300005616 Ga0068852_100501042 Ga0068852_1005010422 298
1310 3300005617 Ga0068859_100000037 Ga0068859_10000003775 298
1311 3300005618 Ga0068864_100033690 Ga0068864_1000336902 298
1312 3300005618 Ga0068864_100056794 Ga0068864_1000567942 298
1313 3300005719 Ga0068861_100426160 Ga0068861_1004261602 298
1314 3300005834 Ga0068851_10000211 Ga0068851_1000021121 298
1315 3300005841 Ga0068863_100004928 Ga0068863_1000049282 298
1316 3300005841 Ga0068863_100010020 Ga0068863_1000100205 298
1317 3300005842 Ga0068858_100191217 Ga0068858_1001912173 298
1318 3300005843 Ga0068860_100001930 Ga0068860_10000193017 298
1319 3300005843 Ga0068860_100006581 Ga0068860_10000658113 298
1320 3300005843 Ga0068860_100017699 Ga0068860_1000176993 298
1321 3300006237 Ga0097621_100007933 Ga0097621_1000079332 298
1322 3300006237 Ga0097621_100121199 Ga0097621_1001211992 298
1323 3300006237 Ga0097621_100502867 Ga0097621_1005028671 298
1324 3300006358 Ga0068871_100003693 Ga0068871_10000369310 298
1325 3300006844 Ga0075428_100025789 Ga0075428_1000257898 298
1326 3300006846 Ga0075430_100002888 Ga0075430_1000028888 298
1327 3300006881 Ga0068865_100001621 Ga0068865_10000162110 298
1328 3300006931 Ga0097620_100000037 Ga0097620_10000003775 298
1329 3300009093 Ga0105240_10002890 Ga0105240_100028909 298
1330 3300009093 Ga0105240_10039015 Ga0105240_100390155 298
1331 3300009093 Ga0105240_10354242 Ga0105240_103542422 298
1332 3300009174 Ga0105241_10000159 Ga0105241_1000015931 298
1333 3300009176 Ga0105242_10012643 Ga0105242_100126432 298
1334 3300009545 Ga0105237_10002692 Ga0105237_100026924 298
1335 3300009545 Ga0105237_10003438 Ga0105237_100034385 298
1336 3300009553 Ga0105249_10019222 Ga0105249_100192223 298
1337 3300009553 Ga0105249_10020766 Ga0105249_100207661 298
1338 3300010375 Ga0105239_10005221 Ga0105239_1000522112 298
1339 3300010375 Ga0105239_10007261 Ga0105239_100072617 298
1340 3300010375 Ga0105239_10071969 Ga0105239_100719693 298
1341 3300010375 Ga0105239_10105947 Ga0105239_101059471 298
1342 3300011119 Ga0105246_10161198 Ga0105246_101611982 298
1343 3300013104 Ga0157370_10007182 Ga0157370_100071822 298
1344 3300013104 Ga0157370_10040466 Ga0157370_100404664 298
1345 3300013104 Ga0157370_10308836 Ga0157370_103088361 298
1346 3300013105 Ga0157369_10228004 Ga0157369_102280042 298
1347 3300013297 Ga0157378_10038445 Ga0157378_100384453 298
1348 3300013306 Ga0163162_10000064 Ga0163162_1000006412 298
1349 3300013306 Ga0163162_10000487 Ga0163162_1000048724 298
1350 3300013306 Ga0163162_10000942 Ga0163162_1000094212 298
1351 3300013306 Ga0163162_10182430 Ga0163162_101824302 298
1352 3300013307 Ga0157372_10053501 Ga0157372_100535012 298
1353 3300013307 Ga0157372_10054631 Ga0157372_100546314 298
1354 3300013308 Ga0157375_10000548 Ga0157375_100005482 298
1355 3300013308 Ga0157375_10439993 Ga0157375_104399932 298
1356 3300014325 Ga0163163_10000046 Ga0163163_1000004695 298
1357 3300014968 Ga0157379_10000020 Ga0157379_1000002037 298
1358 3300014968 Ga0157379_10104067 Ga0157379_101040672 298
1359 3300014969 Ga0157376_10000297 Ga0157376_100002972 298
1360 3300014969 Ga0157376_10152574 Ga0157376_101525741 298
1361 3300015265 Ga0182005_1000023 Ga0182005_100002319 298
1362 3300017792 Ga0163161_10175262 Ga0163161_101752621 298
1363 3300025245 Ga0207425_1000007 Ga0207425_1000007610 298
1364 3300025258 Ga0209129_1000006 Ga0209129_1000006610 298
1365 3300025294 Ga0209025_1000025 Ga0209025_1000025440 298
1366 3300025297 Ga0209758_1000016 Ga0209758_1000016610 298
1367 3300025304 Ga0209257_1000001 Ga0209257_10000011037 298
1368 3300025321 Ga0207656_10001225 Ga0207656_100012253 298
1369 3300025903 Ga0207680_10000122 Ga0207680_1000012214 298
1370 3300025903 Ga0207680_10026027 Ga0207680_100260272 298
1371 3300025907 Ga0207645_10000716 Ga0207645_100007166 298
1372 3300025911 Ga0207654_10003555 Ga0207654_100035556 298
1373 3300025913 Ga0207695_10029276 Ga0207695_100292763 298
1374 3300025913 Ga0207695_10120409 Ga0207695_101204092 298
1375 3300025914 Ga0207671_10002818 Ga0207671_100028183 298
1376 3300025914 Ga0207671_10008461 Ga0207671_100084613 298
1377 3300025924 Ga0207694_10066212 Ga0207694_100662123 298
1378 3300025926 Ga0207659_10020238 Ga0207659_100202382 298
1379 3300025931 Ga0207644_10097628 Ga0207644_100976282 298
1380 3300025933 Ga0207706_10000960 Ga0207706_100009603 298
1381 3300025934 Ga0207686_10292736 Ga0207686_102927361 298
1382 3300025938 Ga0207704_10001715 Ga0207704_100017153 298
1383 3300025940 Ga0207691_10000013 Ga0207691_1000001368 298
1384 3300025940 Ga0207691_10269584 Ga0207691_102695842 298
1385 3300025942 Ga0207689_10018622 Ga0207689_100186225 298
1386 3300025945 Ga0207679_10168844 Ga0207679_101688443 298
1387 3300025949 Ga0207667_10009468 Ga0207667_100094683 298
1388 3300025960 Ga0207651_10000468 Ga0207651_1000046818 298
1389 3300025960 Ga0207651_10104611 Ga0207651_101046113 298
1390 3300025961 Ga0207712_10005693 Ga0207712_100056933 298
1391 3300025961 Ga0207712_10096244 Ga0207712_100962442 298
1392 3300025972 Ga0207668_10000295 Ga0207668_100002952 298
1393 3300025972 Ga0207668_10159509 Ga0207668_101595092 298
1394 3300025986 Ga0207658_10005989 Ga0207658_100059898 298
1395 3300026023 Ga0207677_10528906 Ga0207677_105289061 298
1396 3300026035 Ga0207703_10001005 Ga0207703_100010052 298
1397 3300026035 Ga0207703_10088782 Ga0207703_100887822 298
1398 3300026041 Ga0207639_10001884 Ga0207639_1000188412 298
1399 3300026041 Ga0207639_10425471 Ga0207639_104254711 298
1400 3300026088 Ga0207641_10000121 Ga0207641_1000012125 298
1401 3300026089 Ga0207648_10006608 Ga0207648_100066084 298
1402 3300026089 Ga0207648_10067003 Ga0207648_100670034 298
1403 3300026095 Ga0207676_10013780 Ga0207676_100137803 298
1404 3300026095 Ga0207676_10030767 Ga0207676_100307672 298
1405 3300026118 Ga0207675_100091523 Ga0207675_1000915233 298
1406 3300026121 Ga0207683_10020515 Ga0207683_100205155 298
1407 3300026142 Ga0207698_10256356 Ga0207698_102563561 298
1408 3300026142 Ga0207698_10471918 Ga0207698_104719182 298
1409 3300028379 Ga0268266_10000078 Ga0268266_10000078131 298
1410 3300028379 Ga0268266_10015921 Ga0268266_100159213 298
1411 3300028380 Ga0268265_10292717 Ga0268265_102927171 298
1412 3300028381 Ga0268264_10004538 Ga0268264_1000453813 298
1413 3300028381 Ga0268264_10005427 Ga0268264_100054274 298
1414 3300028381 Ga0268264_10014974 Ga0268264_100149746 298
1415 3300028794 Ga0307515_10003029 Ga0307515_1000302922 298
1416 3300031711 Ga0265314_10069177 Ga0265314_100691772 298
1417 3300031730 Ga0307516_10005541 Ga0307516_100055418 298
1418 3300031995 Ga0307409_100087536 Ga0307409_1000875362 298
1419 3300032002 Ga0307416_100012288 Ga0307416_1000122885 298
1420 3300032005 Ga0307411_10158471 Ga0307411_101584711 298
1421 3300037418 Ga0395900_0200879 Ga0395900_0200879_36_935 298
1422 3300046471 Ga0495650_0075015 Ga0495650_0075015_176_1072 298
1423 3300046683 Ga0495658_0271174 Ga0495658_0271174_51_947 298
1424 3300047320 Ga0495672_0139392 Ga0495672_0139392_183_1079 298
1425 3300048912 Ga0496109_0340482 Ga0496109_0340482_491_1387 298
1426 3300048917 Ga0496114_0368449 Ga0496114_0368449_310_1206 298
1427 3300048924 Ga0496121_0000343 Ga0496121_0000343_63824_64720 298
1428 3300048929 Ga0496126_0009501 Ga0496126_0009501_6893_7789 298
1429 3300049571 Ga0501034_0000115 Ga0501034_0000115_88904_89800 298
1430 3300049571 Ga0501034_0190810 Ga0501034_0190810_430_1326 298
1431 3300049571 Ga0501034_0255519 Ga0501034_0255519_344_1240 298
1432 3300049582 Ga0501048_0330527 Ga0501048_0330527_114_1010 298
1433 3300049585 Ga0501069_0216348 Ga0501069_0216348_184_1080 298
1434 3300049703 Ga0501219_000283 Ga0501219_000283_2348_3244 298
1435 3300049742 Ga0501080_0216519 Ga0501080_0216519_590_1486 298
1436 3300049822 Ga0501035_0012462 Ga0501035_0012462_2176_3072 298
1437 3300049822 Ga0501035_0443991 Ga0501035_0443991_45_941 298
1438 3300049823 Ga0501044_0044477 Ga0501044_0044477_1451_2347 298
1439 3300049823 Ga0501044_0074255 Ga0501044_0074255_236_1132 298
1440 3300049823 Ga0501044_0534921 Ga0501044_0534921_156_1052 298
1441 3300050005 Ga0501284_00041 Ga0501284_00041_38469_39365 298
1442 3300050508 nmdc:mga09592_320113_c1 nmdc:mga09592_320113_c1_264_1169 298
1443 3300050509 nmdc:mga0qj67_44032_c1 nmdc:mga0qj67_44032_c1_2466_3371 298
1444 3300053086 Ga0500578_0031314 Ga0500578_0031314_813_1709 298
1445 3300053092 Ga0500583_0017441 Ga0500583_0017441_1016_1912 298
1446 3300053156 Ga0500622_0000841 Ga0500622_0000841_9411_10307 298
1447 3300003316 rootH1_10001951 rootH1_100019513 299
1448 3300003316 rootH1_10004056 rootH1_100040565 299
1449 3300003320 rootH2_10000230 rootH2_1000023047 299
1450 3300003322 rootL2_10036423 rootL2_100364237 299
1451 3300003323 rootH1_10010000 rootH1_100100002 299
1452 3300003323 rootH1_10196799 rootH1_101967993 299
1453 3300005328 Ga0070676_10000165 Ga0070676_1000016510 299
1454 3300005341 Ga0070691_10012823 Ga0070691_100128234 299
1455 3300005343 Ga0070687_100169158 Ga0070687_1001691582 299
1456 3300005364 Ga0070673_100026243 Ga0070673_1000262431 299
1457 3300005366 Ga0070659_100015398 Ga0070659_1000153985 299
1458 3300005367 Ga0070667_100062561 Ga0070667_1000625612 299
1459 3300005367 Ga0070667_100221593 Ga0070667_1002215931 299
1460 3300005459 Ga0068867_100001301 Ga0068867_1000013013 299
1461 3300005459 Ga0068867_100153104 Ga0068867_1001531042 299
1462 3300005539 Ga0068853_100134213 Ga0068853_1001342131 299
1463 3300005577 Ga0068857_100030476 Ga0068857_1000304763 299
1464 3300005616 Ga0068852_100000372 Ga0068852_10000037225 299
1465 3300005841 Ga0068863_100127460 Ga0068863_1001274602 299
1466 3300006195 Ga0075366_10000849 Ga0075366_1000084912 299
1467 3300006237 Ga0097621_100000054 Ga0097621_10000005430 299
1468 3300006237 Ga0097621_100000538 Ga0097621_10000053824 299
1469 3300006237 Ga0097621_100009287 Ga0097621_1000092877 299
1470 3300006358 Ga0068871_100000145 Ga0068871_10000014518 299
1471 3300006358 Ga0068871_100000452 Ga0068871_1000004527 299
1472 3300006358 Ga0068871_100008083 Ga0068871_1000080838 299
1473 3300006881 Ga0068865_100000051 Ga0068865_10000005126 299
1474 3300006881 Ga0068865_100135783 Ga0068865_1001357832 299
1475 3300009098 Ga0105245_10069229 Ga0105245_100692293 299
1476 3300009174 Ga0105241_10016889 Ga0105241_100168895 299
1477 3300009174 Ga0105241_10026541 Ga0105241_100265413 299
1478 3300009176 Ga0105242_10019823 Ga0105242_100198235 299
1479 3300009176 Ga0105242_10074643 Ga0105242_100746432 299
1480 3300009176 Ga0105242_10201298 Ga0105242_102012982 299
1481 3300009545 Ga0105237_10001447 Ga0105237_1000144727 299
1482 3300009545 Ga0105237_10003874 Ga0105237_100038749 299
1483 3300009545 Ga0105237_10014277 Ga0105237_100142775 299
1484 3300009553 Ga0105249_10171192 Ga0105249_101711922 299
1485 3300009553 Ga0105249_10303249 Ga0105249_103032491 299
1486 3300010375 Ga0105239_10009550 Ga0105239_100095505 299
1487 3300010375 Ga0105239_10013160 Ga0105239_100131603 299
1488 3300010375 Ga0105239_10026857 Ga0105239_100268574 299
1489 3300010375 Ga0105239_10048749 Ga0105239_100487495 299
1490 3300013102 Ga0157371_10069008 Ga0157371_100690083 299
1491 3300013102 Ga0157371_10145591 Ga0157371_101455912 299
1492 3300013296 Ga0157374_10001618 Ga0157374_1000161814 299
1493 3300013297 Ga0157378_10079509 Ga0157378_100795092 299
1494 3300013297 Ga0157378_10141317 Ga0157378_101413171 299
1495 3300013306 Ga0163162_10499781 Ga0163162_104997812 299
1496 3300013307 Ga0157372_10001707 Ga0157372_100017077 299
1497 3300013308 Ga0157375_10000813 Ga0157375_1000081324 299
1498 3300014325 Ga0163163_10137520 Ga0163163_101375201 299
1499 3300014969 Ga0157376_10001923 Ga0157376_1000192313 299
1500 3300017792 Ga0163161_10000950 Ga0163161_100009507 299
1501 3300021384 Ga0213876_10053991 Ga0213876_100539912 299
1502 3300025899 Ga0207642_10013913 Ga0207642_100139133 299
1503 3300025907 Ga0207645_10000652 Ga0207645_1000065210 299
1504 3300025914 Ga0207671_10021002 Ga0207671_100210023 299
1505 3300025914 Ga0207671_10056473 Ga0207671_100564732 299
1506 3300025921 Ga0207652_10000013 Ga0207652_10000013147 299
1507 3300025924 Ga0207694_10020911 Ga0207694_100209114 299
1508 3300025925 Ga0207650_10240509 Ga0207650_102405091 299
1509 3300025931 Ga0207644_10014222 Ga0207644_100142225 299
1510 3300025932 Ga0207690_10076772 Ga0207690_100767722 299
1511 3300025934 Ga0207686_10196389 Ga0207686_101963892 299
1512 3300025938 Ga0207704_10000046 Ga0207704_1000004625 299
1513 3300025940 Ga0207691_10037040 Ga0207691_100370401 299
1514 3300025942 Ga0207689_10047129 Ga0207689_100471292 299
1515 3300025949 Ga0207667_10048086 Ga0207667_100480863 299
1516 3300025981 Ga0207640_10093250 Ga0207640_100932502 299
1517 3300025986 Ga0207658_10058238 Ga0207658_100582383 299
1518 3300025986 Ga0207658_10131215 Ga0207658_101312153 299
1519 3300026089 Ga0207648_10000257 Ga0207648_1000025751 299
1520 3300031548 Ga0307408_100019914 Ga0307408_1000199143 299
1521 3300031901 Ga0307406_10009431 Ga0307406_100094313 299
1522 3300037312 Ga0395899_0002966 Ga0395899_0002966_10976_11875 299
1523 3300037418 Ga0395900_0022668 Ga0395900_0022668_3876_4775 299
1524 3300037418 Ga0395900_0057377 Ga0395900_0057377_2703_3602 299
1525 3300037466 Ga0395898_0003279 Ga0395898_0003279_14755_15654 299
1526 3300038443 Ga0395901_0150985 Ga0395901_0150985_1389_2288 299
1527 3300039437 Ga0436365_0614130 Ga0436365_0614130_26395_27294 299
1528 3300044712 Ga0453684_0001324 Ga0453684_0001324_60859_61758 299
1529 3300045049 Ga0466959_0133933 Ga0466959_0133933_183_1082 299
1530 3300045051 Ga0451576_0000012 Ga0451576_0000012_562455_563357 299
1531 3300046454 Ga0495592_0087566 Ga0495592_0087566_589_1488 299
1532 3300046507 Ga0495606_0096851 Ga0495606_0096851_184_1089 299
1533 3300046512 Ga0495610_0000427 Ga0495610_0000427_31933_32832 299
1534 3300046516 Ga0495628_0107843 Ga0495628_0107843_669_1568 299
1535 3300046536 Ga0495587_0163765 Ga0495587_0163765_275_1174 299
1536 3300046558 Ga0495633_0003017 Ga0495633_0003017_8732_9631 299
1537 3300046660 Ga0495625_0007782 Ga0495625_0007782_2490_3395 299
1538 3300046665 Ga0495661_0063170 Ga0495661_0063170_284_1183 299
1539 3300046689 Ga0495613_0086982 Ga0495613_0086982_737_1636 299
1540 3300047472 Ga0495686_0003019 Ga0495686_0003019_9619_10518 299
1541 3300047472 Ga0495686_0010729 Ga0495686_0010729_5172_6074 299
1542 3300048904 Ga0496101_0013706 Ga0496101_0013706_1886_2794 299
1543 3300048917 Ga0496114_0294137 Ga0496114_0294137_426_1334 299
1544 3300048929 Ga0496126_0272877 Ga0496126_0272877_78_977 299
1545 3300049570 Ga0501033_0012561 Ga0501033_0012561_4860_5768 299
1546 3300049572 Ga0501036_0190302 Ga0501036_0190302_548_1456 299
1547 3300049579 Ga0501043_0140515 Ga0501043_0140515_961_1869 299
1548 3300049581 Ga0501047_0006088 Ga0501047_0006088_1802_2710 299
1549 3300050493 nmdc:mga0k408_175_c1 nmdc:mga0k408_175_c1_19507_20412 299
1550 3300050512 nmdc:mga0n895_193849_c1 nmdc:mga0n895_193849_c1_1115_2014 299
1551 3300053131 Ga0500652_004080 Ga0500652_004080_2470_3396 299
1552 iso_pu_bacteria 2902048731 2902048831 299
1553 3300003323 rootH1_10048247 rootH1_100482473 300
1554 3300005331 Ga0070670_100023449 Ga0070670_1000234496 300
1555 3300005337 Ga0070682_100052137 Ga0070682_1000521374 300
1556 3300005355 Ga0070671_100173151 Ga0070671_1001731512 300
1557 3300005364 Ga0070673_100086001 Ga0070673_1000860013 300
1558 3300005539 Ga0068853_100055268 Ga0068853_1000552681 300
1559 3300005578 Ga0068854_100179910 Ga0068854_1001799102 300
1560 3300005617 Ga0068859_100018938 Ga0068859_1000189385 300
1561 3300005843 Ga0068860_100519160 Ga0068860_1005191601 300
1562 3300006931 Ga0097620_100018938 Ga0097620_1000189385 300
1563 3300013297 Ga0157378_10019271 Ga0157378_100192715 300
1564 3300013308 Ga0157375_10182179 Ga0157375_101821793 300
1565 3300014325 Ga0163163_10189930 Ga0163163_101899302 300
1566 3300025938 Ga0207704_10251117 Ga0207704_102511171 300
1567 3300025986 Ga0207658_10131331 Ga0207658_101313313 300
1568 3300026023 Ga0207677_10009715 Ga0207677_100097152 300
1569 3300026067 Ga0207678_10368085 Ga0207678_103680851 300
1570 3300026088 Ga0207641_10017376 Ga0207641_100173764 300
1571 3300026089 Ga0207648_10295816 Ga0207648_102958161 300
1572 3300026118 Ga0207675_100165899 Ga0207675_1001658992 300
1573 3300028794 Ga0307515_10000469 Ga0307515_1000046934 300
1574 3300031251 Ga0265327_10000051 Ga0265327_10000051155 300
1575 3300037418 Ga0395900_0020465 Ga0395900_0020465_4287_5192 300
1576 3300046492 Ga0495585_0002645 Ga0495585_0002645_2559_3467 300
1577 3300046524 Ga0495648_0022634 Ga0495648_0022634_3234_4142 300
1578 3300046538 Ga0495609_0065609 Ga0495609_0065609_674_1582 300
1579 3300046558 Ga0495633_0000081 Ga0495633_0000081_117002_117910 300
1580 3300046616 Ga0495668_0000003 Ga0495668_0000003_675792_676700 300
1581 3300046660 Ga0495625_0000846 Ga0495625_0000846_29596_30504 300
1582 3300046683 Ga0495658_0024033 Ga0495658_0024033_1625_2533 300
1583 3300047471 Ga0495684_0133622 Ga0495684_0133622_932_1840 300
1584 3300048089 Ga0495614_0017370 Ga0495614_0017370_366_1274 300
1585 3300053094 Ga0500566_0037856 Ga0500566_0037856_955_1860 300
1586 3300053095 Ga0500640_001728 Ga0500640_001728_1717_2622 300
1587 3300053102 Ga0500554_000172 Ga0500554_000172_8798_9703 300
1588 3300053119 Ga0500595_000017 Ga0500595_000017_3011_3916 300
1589 3300053123 Ga0500614_000174 Ga0500614_000174_11936_12841 300
1590 3300053123 Ga0500614_010475 Ga0500614_010475_310_1218 300
1591 3300053136 Ga0500559_0006396 Ga0500559_0006396_3692_4597 300
1592 3300006195 Ga0075366_10053427 Ga0075366_100534273 301
1593 3300010375 Ga0105239_10004649 Ga0105239_100046493 301
1594 3300025949 Ga0207667_10010158 Ga0207667_100101586 301
1595 3300030521 Ga0307511_10143505 Ga0307511_101435052 301
1596 3300044684 Ga0466966_0000045 Ga0466966_0000045_2503_3423 301
1597 3300045049 Ga0466959_0000023 Ga0466959_0000023_8689_9609 301
1598 3300005262 Ga0065165_1010985 Ga0065165_10109852 302
1599 3300005331 Ga0070670_100124091 Ga0070670_1001240913 302
1600 3300005340 Ga0070689_100063420 Ga0070689_1000634202 302
1601 3300025302 Ga0207426_1033695 Ga0207426_10336952 302
1602 3300025925 Ga0207650_10188420 Ga0207650_101884202 302
1603 3300031595 Ga0265313_10025066 Ga0265313_100250662 302
1604 3300048911 Ga0496108_0014827 Ga0496108_0014827_3237_4166 302
1605 3300054114 Ga0501084_0111865 Ga0501084_0111865_1333_2244 302
1606 3300005535 Ga0070684_100003219 Ga0070684_1000032196 303
1607 3300005563 Ga0068855_100000424 Ga0068855_10000042416 303
1608 3300005578 Ga0068854_100037888 Ga0068854_1000378882 303
1609 3300009093 Ga0105240_10002538 Ga0105240_1000253816 303
1610 3300009093 Ga0105240_10058938 Ga0105240_100589388 303
1611 3300010375 Ga0105239_10156519 Ga0105239_101565193 303
1612 3300010375 Ga0105239_10420467 Ga0105239_104204672 303
1613 3300013100 Ga0157373_10024848 Ga0157373_100248483 303
1614 3300013104 Ga0157370_10116882 Ga0157370_101168821 303
1615 3300013105 Ga0157369_10064429 Ga0157369_100644293 303
1616 3300013307 Ga0157372_10015096 Ga0157372_100150966 303
1617 3300025913 Ga0207695_10000130 Ga0207695_1000013032 303
1618 3300025913 Ga0207695_10022346 Ga0207695_1002234611 303
1619 3300025949 Ga0207667_10000876 Ga0207667_1000087618 303
1620 3300028379 Ga0268266_10002084 Ga0268266_1000208426 303
1621 3300047472 Ga0495686_0048951 Ga0495686_0048951_443_1357 303
1622 3300053136 Ga0500559_0025420 Ga0500559_0025420_30_947 303
1623 3300005335 Ga0070666_10113350 Ga0070666_101133502 304
1624 3300005343 Ga0070687_100004245 Ga0070687_1000042452 304
1625 3300005354 Ga0070675_100259399 Ga0070675_1002593991 304
1626 3300005365 Ga0070688_100088239 Ga0070688_1000882392 304
1627 3300005841 Ga0068863_100024182 Ga0068863_1000241824 304
1628 3300009094 Ga0111539_10430513 Ga0111539_104305131 304
1629 3300014969 Ga0157376_10464473 Ga0157376_104644731 304
1630 3300025918 Ga0207662_10008205 Ga0207662_100082055 304
1631 3300027907 Ga0207428_10013193 Ga0207428_100131938 304
1632 3300035692 Ga0373935_0118781 Ga0373935_0118781_53_970 304
1633 3300035695 Ga0373927_0157505 Ga0373927_0157505_409_1326 304
1634 3300045051 Ga0451576_0385547 Ga0451576_0385547_403_1320 304
1635 3300046477 Ga0495664_0039169 Ga0495664_0039169_1138_2055 304
1636 3300046517 Ga0495630_0046886 Ga0495630_0046886_2180_3097 304
1637 3300046642 Ga0495634_0004906 Ga0495634_0004906_5762_6679 304
1638 3300047319 Ga0495674_0032089 Ga0495674_0032089_1666_2583 304
1639 3300050511 nmdc:mga08y16_8584_c1 nmdc:mga08y16_8584_c1_144_1064 304
1640 3300026078 Ga0207702_10045223 Ga0207702_100452233 305
1641 3300009553 Ga0105249_10273496 Ga0105249_102734961 307
1642 3300053156 Ga0500622_0001251 Ga0500622_0001251_6372_7310 307
1643 3300013100 Ga0157373_10218164 Ga0157373_102181642 308
1644 3300013296 Ga0157374_10009663 Ga0157374_100096635 308
1645 3300013308 Ga0157375_10015502 Ga0157375_100155025 308
1646 3300014325 Ga0163163_10000218 Ga0163163_100002186 308
1647 3300026121 Ga0207683_10101735 Ga0207683_101017351 310
1648 3300032004 Ga0307414_10108215 Ga0307414_101082152 311
1649 3300049761 Ga0501264_000172 Ga0501264_000172_9027_9995 312
1650 3300039450 Ga0436363_0156289 Ga0436363_0156289_99_1067 314
1651 iso_pu_bacteria 2881955468 2881955939 314
1652 3300050508 nmdc:mga09592_8374_c1 nmdc:mga09592_8374_c1_5709_6701 316
1653 3300025925 Ga0207650_10012262 Ga0207650_100122626 320
1654 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00006880 325
1655 3300003323 rootH1_10031539 rootH1_100315397 325
1656 3300005289 Ga0065704_10070140 Ga0065704_10070140251 325
1657 3300025913 Ga0207695_10000064 Ga0207695_10000064331 325
1658 3300046616 Ga0495668_0000677 Ga0495668_0000677_18981_19970 325
1659 3300047472 Ga0495686_0001743 Ga0495686_0001743_3809_4795 325
1660 3300049766 Ga0501269_006791 Ga0501269_006791_109_1095 325
1661 3300053153 Ga0500616_0004544 Ga0500616_0004544_7041_8030 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

204

300

1

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

23

202

0.99

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

23

160

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
7exs-assembly1.cif.gz_A thermomicrobium roseum sarcosine oxidase mutant - s320r 1.001 29 57
3if9-assembly1.cif.gz_B-2 crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate 0.999 30 57
4ysh-assembly1.cif.gz_A crystal structure of glycine oxidase from geobacillus kaustophilus 0.9983 30 57
4c3y-assembly2.cif.gz_E crystal structure of 3-ketosteroid delta1-dehydrogenase from rhodococcus erythropolis sq1 in complex with 1,4-androstadiene-3,17- dione 0.9936 30 57
2zxi-assembly2.cif.gz_D structure of aquifex aeolicus gida in the form ii crystal 0.9893 30 59
ID Description Score Start End Superfamily
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9997 30 57 3.50.50.60
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9982 30 57 3.50.50.60
4kueA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9968 219 303 1.10.1040.10
4kueB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9968 219 303 1.10.1040.10
4kuhF02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9968 219 303 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A0C9T8E5-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase C-terminal domain-containing protein 0.999 220 308 GO:0006631
GO:0016616
AF-A0A7V4A1C2-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.9974 27 122 GO:0006631
GO:0008691
GO:0070403
AF-X1REX1-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase NAD binding domain-containing protein 0.9956 27 103 GO:0006631
GO:0016491
GO:0070403
AF-A0A061S868-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9948 216 307 GO:0006631
GO:0016616
AF-A0A645GXP1-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.35) 0.9946 201 308 GO:0003857
GO:0006635
GO:0008691

Feature Viewer

pLDDT pTM Quality
92.71 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map