F494690

General Info

Members Datasets Scaffolds Average Seq Length
1546 715 1362 459

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0003778|Ga0496110_0003778_751_2397
Length 548
Sequence VGSAAFSPERDVPRSRRGNGRAAVPAFASICSKLQRLPNKQAINFGFHPPGADRRGKSRPLQTRGLXXXLLIRAPTPVLPAGTTPERAAMSTFDNPFDPERRLNRTGCSCGRHRSQAEHDAQLALQCAQIESEDKRYQGVVASAVMRAVFPKDAARRAFLKSVGASTALAALSQLFPLKTATDVFAQGGAIEKKDLKVGFIPITCATPIIMAHPMGFYSKHGLNVEVIKTAGWAVIRDKTLNKEYDAAHMLSPMPLAITLGAGSNPMPYTMPAVENINGQAITLATKHKDKNDPKVWKGFKFAVPFDYSMHNYLLRYYVAEHGIDPDQDIQIRAVPPPEMVANLRADNIDGFLGPDPFNQRAVYDGVGFIHILSKQLWEGHPCCAFAASKEFVTTMPNTYAALLKSIIDATAFAHKAENRKEIAAAIAPANYLNQPEIVLEQILTGTYADGLGNVKRDPNRIDFDPFPWQSFAVWILTQMKRWGQIKGDVDYKAVAEQVYLATDTAKLMKEVGLTPPTTSSKSFKVMGKEFDPAKPDDYLKSFAIKRV

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
7 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
8 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
9 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
18 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
19 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
20 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
24 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
25 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
26 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221569 Achromobacter sp. Root565 Isolate Unclassified
30 2643221594 Achromobacter sp. Root170 Isolate Unclassified
31 2643221621 Achromobacter sp. Root83 Isolate Unclassified
32 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
33 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
34 2738543013 Variovorax sp. BT01 Isolate Unclassified
35 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
36 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
37 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
38 2791355199
39 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
40 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
41 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
42 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
43 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
44 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
45 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
46 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
47 2821131069 Duganella sp. 1224 Isolate Unclassified
48 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
49 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
50 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
51 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
52 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
53 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
54 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
55 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
56 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
57 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
58 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
59 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
60 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
61 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
62 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
63 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
64 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
65 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
66 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
67 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
68 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
69 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
70 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
71 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
72 2842694124 Methylopila sp. R-72369 Isolate Unclassified
73 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
74 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
75 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
76 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
77 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
78 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
79 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
80 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
81 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
82 2857553236 Duganella sp. R-74557 Isolate Unclassified
83 2857558681 Duganella sp. R-74565 Isolate Unclassified
84 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
85 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
86 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
87 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
88 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
89 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
90 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
91 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
92 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
93 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
94 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
95 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
96 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
97 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
98 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
99 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
100 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
101 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
102 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
103 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
104 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
105 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
106 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
107 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
108 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
109 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
110 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
111 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
112 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
113 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
114 2904699407
115 2906610324
116 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
117 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
118 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
119 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
120 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
121 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
122 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
123 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
124 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
125 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
126 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
127 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
128 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
129 2922425934
130 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
131 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
132 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
133 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
134 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
135 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
136 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
137 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
138 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
139 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
140 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
141 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
142 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
143 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
144 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
145 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
146 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
147 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
148 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
149 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
150 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
151 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
152 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
153 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
154 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
155 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
156 2941479691
157 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
158 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
159 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
160 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
161 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
162 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
163 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
164 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
165 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
166 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
167 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
168 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
169 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
170 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
171 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
172 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
173 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
174 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
175 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
176 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
177 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
178 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
179 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
180 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
181 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
182 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
183 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
184 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
185 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
186 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
187 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
188 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
189 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
190 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
191 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
192 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
193 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
194 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
195 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
196 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
197 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
198 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
199 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
200 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
201 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
202 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
203 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
204 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
205 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
206 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
207 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
208 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
209 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
210 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
211 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
212 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
213 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
214 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
215 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
216 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
217 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
218 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
219 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
220 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
221 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
222 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
223 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
224 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
225 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
226 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
227 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
228 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
229 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
230 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
231 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
232 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
233 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
234 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
235 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
236 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
237 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
238 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
239 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
240 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
241 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
242 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
243 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
244 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
245 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
246 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
247 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
248 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
249 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
250 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
251 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
252 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
253 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
254 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
255 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
256 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
257 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
258 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
259 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
260 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
261 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
262 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
263 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
264 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
265 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
266 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
267 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
268 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
269 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
270 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
271 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
272 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
273 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
274 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
275 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
276 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
277 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
278 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
279 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
280 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
281 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
282 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
283 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
284 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
285 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
286 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
287 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
288 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
289 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
290 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
291 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
292 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
293 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
294 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
295 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
296 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
297 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
298 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
299 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
300 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
301 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
302 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
303 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
304 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
305 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
306 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
307 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
308 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
309 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
310 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
311 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
312 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
313 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
314 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
315 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
316 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
317 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
318 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
319 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
320 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
321 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
322 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
323 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
324 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
325 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
326 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
327 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
328 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
329 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
330 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
331 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
332 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
333 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
334 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
335 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
336 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
337 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
338 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
339 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
340 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
341 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
342 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
343 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
344 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
345 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
346 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
347 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
348 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
349 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
350 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
351 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
354 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
355 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
356 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
357 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
358 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
359 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
361 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
362 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
364 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
365 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
366 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
367 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
368 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
369 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
371 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
372 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
373 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
374 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
429 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
433 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
434 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
440 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
441 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
442 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
443 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
445 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
447 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
448 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
449 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
453 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
454 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
455 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
456 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
457 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
458 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
459 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
460 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
461 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
462 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
463 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
464 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
465 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
466 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
467 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
468 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
469 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
470 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
471 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
472 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
473 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
474 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
475 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
476 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
477 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
478 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
479 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
480 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
481 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
482 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
483 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
484 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
485 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
486 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
487 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
488 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
489 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
490 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
491 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
492 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
493 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
494 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
495 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
496 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
497 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
498 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
499 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
500 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
501 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
502 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
503 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
504 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
505 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
506 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
507 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
508 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
509 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
510 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
511 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
512 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
513 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
514 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
515 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
516 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
517 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
518 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
519 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
520 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
521 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
522 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
523 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
524 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
525 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
526 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
527 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
528 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
529 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
530 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
531 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
532 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
533 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
534 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
535 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
536 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
537 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
538 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
539 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
540 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
541 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
542 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
543 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
544 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
545 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
546 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
547 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
548 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
549 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
550 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
551 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
552 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
553 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
554 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
555 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
556 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
557 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
558 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
559 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
560 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
561 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
562 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
563 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
564 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
565 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
566 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
567 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
568 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
569 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
570 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
571 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
572 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
573 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
574 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
575 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
576 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
577 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
578 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
579 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
580 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
581 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
582 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
583 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
584 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
585 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
586 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
587 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
588 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
589 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
590 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
591 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
592 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
593 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
594 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
595 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
596 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
597 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
598 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
599 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
600 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
601 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
602 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
603 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
604 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
605 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
606 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
607 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
608 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
609 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
610 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
611 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
612 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
613 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
614 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
615 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
616 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
617 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
618 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
619 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
620 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
621 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
622 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
623 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
624 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
625 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
626 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
627 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
628 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
629 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
630 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
631 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
632 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
633 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
634 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
635 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
636 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
637 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
638 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
639 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
640 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
641 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
642 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
643 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
644 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
645 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
646 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
647 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
648 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
649 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
650 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
651 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
652 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
653 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
654 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
655 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
656 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
657 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
658 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
659 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
660 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
661 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
662 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
663 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
664 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
665 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
666 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
667 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
668 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
669 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
670 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
671 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
672 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
673 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
674 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
675 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
676 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
677 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
678 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
679 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
680 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
681 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
682 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
683 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
684 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
685 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
686 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
687 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
688 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
689 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
690 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
691 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
692 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
693 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
694 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
695 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
696 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
697 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
698 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
699 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
700 641522639 Methylobacterium sp. 4-46 Isolate Nodule
701 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
702 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
703 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
704 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
705 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
706 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
707 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
708 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
709 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
710 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
711 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
712 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
713 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
714 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
715 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.46
Metatranscriptomes 0
Isolates 11.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.77
Nodule 6.27
Rhizoplane 6.47
Rhizosphere 67.46
Stem 0
Stem Tuber 0
Unclassified 10.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745205 2209111006 Bacteria 15596
2 ARcpr5oldR_c000087 3300000041 Bacteria 16704
3 ARSoilYngRDRAFT_c00048 3300000042 Bacteria 19122
4 ARcpr5yngRDRAFT_c000112 3300000043 Bacteria 12890
5 ARSoilOldRDRAFT_c000094 3300000044 Bacteria 16730
6 ARCol0yngRDRAFT_1000121 3300000652 Bacteria 13929
7 JGI24752J21851_1003222 3300001976 Bacteria 2152
8 JGI24739J22299_10002910 3300001989 Bacteria 6562
9 JGI24737J22298_10001520 3300001990 Bacteria 8263
10 JGI24743J22301_10002453 3300001991 Bacteria 2796
11 JGI24750J21931_1000426 3300002070 Bacteria 6876
12 JGI24745J21846_1000426 3300002073 Bacteria 3746
13 JGI24748J21848_1000786 3300002074 Bacteria 3432
14 JGI24738J21930_10000707 3300002075 Bacteria 9630
15 JGI24749J21850_1001137 3300002076 Bacteria 3773
16 JGI24744J21845_10004543 3300002077 Bacteria 2868
17 JGI24035J26624_1000282 3300002126 Bacteria 4781
18 JGI24034J26672_10000879 3300002239 Bacteria 3908
19 JGI24742J22300_10001239 3300002244 Bacteria 3999
20 JGI24742J22300_10003139 3300002244 Bacteria 2672
21 JGI24751J29686_10004754 3300002459 Bacteria 2760
22 JGI25155J39150_1000538 3300002704 Bacteria 8785
23 JGI25156J39149_1000150 3300002705 Bacteria 51558
24 JGI25154J39366_1000165 3300002738 Bacteria 51558
25 JGI25154J39366_1000210 3300002738 Bacteria 41877
26 JGI25157J39369_1000383 3300002741 Bacteria 30452
27 JGI25406J46586_10000801 3300003203 Bacteria 14848
28 JGI25406J46586_10001211 3300003203 Bacteria 12134
29 JGI25406J46586_10003389 3300003203 Bacteria 7501
30 JGI25406J46586_10003524 3300003203 Bacteria 7347
31 JGI25406J46586_10003889 3300003203 Bacteria 6980
32 JGI25153J46596_10002222 3300003215 Bacteria 11325
33 JGI25153J46596_10002589 3300003215 Bacteria 10366
34 JGI25153J46596_10003283 3300003215 Bacteria 9084
35 JGI25153J46596_10006877 3300003215 Bacteria 5680
36 JGI25153J46596_10014889 3300003215 Bacteria 3204
37 JGI25160J50197_1006259 3300003354 Bacteria 4838
38 JGI25160J50197_1006800 3300003354 Bacteria 4580
39 JGI25404J52841_10002956 3300003659 Bacteria 3298
40 Ga0055538_1000054 3300003751 Bacteria 123566
41 Ga0055539_1000066 3300003752 Bacteria 136557
42 Ga0055533_1000076 3300003756 Bacteria 136557
43 Ga0055532_1000097 3300003758 Bacteria 98781
44 Ga0055525_1000098 3300003759 Bacteria 136557
45 Ga0055535_1003562 3300003761 Bacteria 4319
46 Ga0055540_1002994 3300003792 Bacteria 8459
47 Ga0055531_10000152 3300003794 Bacteria 80208
48 Ga0055531_10003706 3300003794 Bacteria 9615
49 Ga0055541_1000056 3300003841 Bacteria 123566
50 Ga0055543_1002979 3300004625 Bacteria 5254
51 Ga0065165_1001284 3300005262 Bacteria 28344
52 Ga0065165_1022456 3300005262 Bacteria 2162
53 Ga0065704_10002258 3300005289 Bacteria 9242
54 Ga0065712_10068851 3300005290 Bacteria 8789
55 Ga0065712_10075439 3300005290 Bacteria 3861
56 Ga0065712_10084632 3300005290 Bacteria 2749
57 Ga0065715_10093263 3300005293 Bacteria 4731
58 Ga0065715_10105949 3300005293 Bacteria 2861
59 Ga0065715_10164299 3300005293 Bacteria 1600
60 Ga0065707_10021875 3300005295 Bacteria 1759
61 Ga0065707_10098445 3300005295 Bacteria 3085
62 Ga0070676_10022543 3300005328 Bacteria 3531
63 Ga0070676_10034566 3300005328 Bacteria 2902
64 Ga0070683_100018296 3300005329 Bacteria 6203
65 Ga0070683_100075511 3300005329 Bacteria 3149
66 Ga0070683_100178315 3300005329 Bacteria 2017
67 Ga0070690_100012396 3300005330 Bacteria 5017
68 Ga0070690_100084812 3300005330 Bacteria 2077
69 Ga0070670_100000081 3300005331 Bacteria 92043
70 Ga0070670_100002578 3300005331 Bacteria 14984
71 Ga0070670_100016676 3300005331 Bacteria 6304
72 Ga0070670_100041518 3300005331 Bacteria 3954
73 Ga0070670_100113853 3300005331 Bacteria 2332
74 Ga0070677_10000893 3300005333 Bacteria 9811
75 Ga0070677_10027474 3300005333 Bacteria 2143
76 Ga0068869_100007674 3300005334 Bacteria 6908
77 Ga0070666_10031431 3300005335 Bacteria 3505
78 Ga0070680_100022312 3300005336 Bacteria 5040
79 Ga0070682_100030025 3300005337 Bacteria 3277
80 Ga0068868_100006926 3300005338 Bacteria 8053
81 Ga0068868_100060713 3300005338 Bacteria 2994
82 Ga0070660_100008270 3300005339 Bacteria 7271
83 Ga0070660_100123502 3300005339 Bacteria 2067
84 Ga0070689_100003410 3300005340 Bacteria 10568
85 Ga0070689_100016937 3300005340 Bacteria 5343
86 Ga0070691_10005653 3300005341 Bacteria 5700
87 Ga0070687_100004982 3300005343 Bacteria 5344
88 Ga0070661_100020584 3300005344 Bacteria 4707
89 Ga0070661_100100792 3300005344 Bacteria 2147
90 Ga0070692_10002117 3300005345 Bacteria 7588
91 Ga0070668_100015686 3300005347 Bacteria 5666
92 Ga0070668_100171527 3300005347 Bacteria 1766
93 Ga0070669_100016043 3300005353 Bacteria 5345
94 Ga0070669_100112005 3300005353 Bacteria 2072
95 Ga0070675_100005492 3300005354 Bacteria 9707
96 Ga0070675_100038825 3300005354 Bacteria 3883
97 Ga0070675_100187170 3300005354 Bacteria 1792
98 Ga0070671_100011767 3300005355 Bacteria 7038
99 Ga0070671_100031211 3300005355 Bacteria 4400
100 Ga0070671_100109138 3300005355 Bacteria 2324
101 Ga0070674_100008724 3300005356 Bacteria 6047
102 Ga0070674_100021106 3300005356 Bacteria 4175
103 Ga0070674_100080008 3300005356 Bacteria 2332
104 Ga0070674_100085197 3300005356 Bacteria 2267
105 Ga0070673_100002682 3300005364 Bacteria 10899
106 Ga0070688_100004383 3300005365 Bacteria 7340
107 Ga0070659_100004732 3300005366 Bacteria 9722
108 Ga0070659_100146899 3300005366 Bacteria 1921
109 Ga0070667_100001429 3300005367 Bacteria 21397
110 Ga0070667_100029364 3300005367 Bacteria 4580
111 Ga0070667_100068653 3300005367 Bacteria 3016
112 Ga0070667_100100389 3300005367 Bacteria 2499
113 Ga0070703_10017295 3300005406 Bacteria 2076
114 Ga0070709_10001642 3300005434 Bacteria 12118
115 Ga0070709_10003602 3300005434 Bacteria 8319
116 Ga0070709_10005467 3300005434 Bacteria 6884
117 Ga0070714_100013820 3300005435 Bacteria 6473
118 Ga0070714_100033661 3300005435 Bacteria 4286
119 Ga0070713_100002130 3300005436 Bacteria 12807
120 Ga0070713_100003091 3300005436 Bacteria 10950
121 Ga0070713_100020726 3300005436 Bacteria 5045
122 Ga0070713_100094960 3300005436 Bacteria 2571
123 Ga0070713_100131037 3300005436 Bacteria 2211
124 Ga0070713_100254603 3300005436 Bacteria 1602
125 Ga0070710_10001132 3300005437 Bacteria 12626
126 Ga0070710_10003655 3300005437 Bacteria 7275
127 Ga0070710_10015367 3300005437 Bacteria 3873
128 Ga0070710_10031412 3300005437 Bacteria 2867
129 Ga0070701_10007846 3300005438 Bacteria 4588
130 Ga0070711_100037088 3300005439 Bacteria 3269
131 Ga0070711_100185497 3300005439 Bacteria 1595
132 Ga0070700_100010970 3300005441 Bacteria 5010
133 Ga0070700_100038270 3300005441 Bacteria 2922
134 Ga0070694_100006993 3300005444 Bacteria 6860
135 Ga0070694_100114741 3300005444 Bacteria 1924
136 Ga0070708_100005534 3300005445 Bacteria 10011
137 Ga0070708_100022450 3300005445 Bacteria 5353
138 Ga0070708_100137961 3300005445 Bacteria 2260
139 Ga0070663_100026359 3300005455 Bacteria 3937
140 Ga0070663_100072320 3300005455 Bacteria 2512
141 Ga0070678_100023744 3300005456 Bacteria 4092
142 Ga0070678_100033200 3300005456 Bacteria 3581
143 Ga0070678_100033206 3300005456 Bacteria 3580
144 Ga0070662_100013871 3300005457 Bacteria 5367
145 Ga0070662_100098404 3300005457 Bacteria 2209
146 Ga0070681_10006215 3300005458 Bacteria 11606
147 Ga0070681_10019127 3300005458 Bacteria 6854
148 Ga0068867_100018968 3300005459 Bacteria 4896
149 Ga0068867_100073968 3300005459 Bacteria 2553
150 Ga0070685_10024114 3300005466 Bacteria 3338
151 Ga0070685_10062627 3300005466 Bacteria 2181
152 Ga0070707_100003645 3300005468 Bacteria 14522
153 Ga0070707_100059338 3300005468 Bacteria 3671
154 Ga0070707_100313543 3300005468 Bacteria 1524
155 Ga0070698_100002784 3300005471 Bacteria 19250
156 Ga0070698_100166882 3300005471 Bacteria 2144
157 Ga0070699_100010274 3300005518 Bacteria 8095
158 Ga0070699_100198807 3300005518 Bacteria 1782
159 Ga0070679_100016263 3300005530 Bacteria 7168
160 Ga0070684_100042489 3300005535 Bacteria 3924
161 Ga0070684_100056596 3300005535 Bacteria 3423
162 Ga0070684_100090112 3300005535 Bacteria 2726
163 Ga0070697_100109945 3300005536 Bacteria 2296
164 Ga0070697_100111263 3300005536 Bacteria 2283
165 Ga0070672_100010094 3300005543 Bacteria 6539
166 Ga0070672_100037636 3300005543 Bacteria 3692
167 Ga0070672_100046964 3300005543 Bacteria 3348
168 Ga0070672_100060655 3300005543 Bacteria 2979
169 Ga0070686_100001845 3300005544 Bacteria 11820
170 Ga0070686_100153092 3300005544 Bacteria 1617
171 Ga0070695_100003597 3300005545 Bacteria 9050
172 Ga0070695_100156811 3300005545 Bacteria 1594
173 Ga0070696_100013188 3300005546 Bacteria 5545
174 Ga0070696_100054561 3300005546 Bacteria 2785
175 Ga0070693_100014637 3300005547 Bacteria 4023
176 Ga0070693_100020390 3300005547 Bacteria 3495
177 Ga0070693_100128699 3300005547 Bacteria 1580
178 Ga0070665_100102801 3300005548 Bacteria 2861
179 Ga0070665_100123475 3300005548 Bacteria 2591
180 Ga0070665_100224776 3300005548 Bacteria 1877
181 Ga0070665_100332681 3300005548 Bacteria 1523
182 Ga0070704_100003777 3300005549 Bacteria 8716
183 Ga0070704_100010479 3300005549 Bacteria 5642
184 Ga0068855_100147013 3300005563 Bacteria 2682
185 Ga0068855_100167406 3300005563 Bacteria 2491
186 Ga0070664_100057460 3300005564 Bacteria 3307
187 Ga0068857_100000825 3300005577 Bacteria 23201
188 Ga0068857_100071409 3300005577 Bacteria 3093
189 Ga0068854_100005746 3300005578 Bacteria 7847
190 Ga0068854_100006416 3300005578 Bacteria 7482
191 Ga0068854_100066660 3300005578 Bacteria 2620
192 Ga0068856_100004702 3300005614 Bacteria 13558
193 Ga0068856_100220812 3300005614 Bacteria 1910
194 Ga0070702_100007181 3300005615 Bacteria 5320
195 Ga0070702_100027848 3300005615 Bacteria 3054
196 Ga0068852_100005334 3300005616 Bacteria 9180
197 Ga0068852_100020468 3300005616 Bacteria 5263
198 Ga0068852_100055070 3300005616 Bacteria 3431
199 Ga0068859_100012382 3300005617 Bacteria 8581
200 Ga0068859_100058039 3300005617 Bacteria 3898
201 Ga0068859_100153704 3300005617 Bacteria 2377
202 Ga0068864_100000016 3300005618 Bacteria 292454
203 Ga0068864_100003085 3300005618 Bacteria 13757
204 Ga0068864_100030383 3300005618 Bacteria 4578
205 Ga0068864_100033236 3300005618 Bacteria 4385
206 Ga0068864_100084285 3300005618 Bacteria 2792
207 Ga0068864_100133971 3300005618 Bacteria 2229
208 Ga0068866_10001247 3300005718 Bacteria 11006
209 Ga0068861_100018109 3300005719 Bacteria 5010
210 Ga0068861_100018613 3300005719 Bacteria 4949
211 Ga0068861_100161561 3300005719 Bacteria 1848
212 Ga0068851_10077990 3300005834 Bacteria 1725
213 Ga0068870_10006935 3300005840 Bacteria 5024
214 Ga0068870_10010077 3300005840 Bacteria 4324
215 Ga0068870_10011056 3300005840 Bacteria 4170
216 Ga0068863_100001887 3300005841 Bacteria 20811
217 Ga0068863_100020493 3300005841 Bacteria 6319
218 Ga0068863_100093151 3300005841 Bacteria 2859
219 Ga0068863_100218130 3300005841 Bacteria 1837
220 Ga0068858_100063302 3300005842 Bacteria 3422
221 Ga0068858_100108934 3300005842 Bacteria 2586
222 Ga0068858_100122130 3300005842 Bacteria 2436
223 Ga0068858_100167279 3300005842 Bacteria 2072
224 Ga0068860_100002390 3300005843 Bacteria 19702
225 Ga0068860_100026283 3300005843 Bacteria 5612
226 Ga0068860_100075903 3300005843 Bacteria 3196
227 Ga0068860_100077921 3300005843 Bacteria 3152
228 Ga0068862_100000068 3300005844 Bacteria 123535
229 Ga0068862_100010699 3300005844 Bacteria 7576
230 Ga0068862_100133755 3300005844 Bacteria 2196
231 Ga0081455_10000200 3300005937 Bacteria 76013
232 Ga0081455_10000768 3300005937 Bacteria 41613
233 Ga0081455_10005811 3300005937 Bacteria 13435
234 Ga0081455_10028316 3300005937 Bacteria 5120
235 Ga0081455_10052106 3300005937 Bacteria 3506
236 Ga0081455_10067882 3300005937 Bacteria 2970
237 Ga0081538_10000527 3300005981 Bacteria 42416
238 Ga0081538_10041924 3300005981 Bacteria 2897
239 Ga0081538_10051173 3300005981 Bacteria 2484
240 Ga0081540_1000303 3300005983 Bacteria 50969
241 Ga0081540_1000459 3300005983 Bacteria 40435
242 Ga0081540_1000726 3300005983 Bacteria 30344
243 Ga0081540_1002649 3300005983 Bacteria 14558
244 Ga0081540_1003830 3300005983 Bacteria 11775
245 Ga0081540_1003910 3300005983 Bacteria 11604
246 Ga0081540_1006666 3300005983 Bacteria 8358
247 Ga0081540_1009787 3300005983 Bacteria 6562
248 Ga0081540_1012946 3300005983 Bacteria 5450
249 Ga0081540_1024563 3300005983 Bacteria 3495
250 Ga0081540_1026854 3300005983 Bacteria 3276
251 Ga0081540_1027228 3300005983 Bacteria 3243
252 Ga0081540_1036114 3300005983 Bacteria 2640
253 Ga0081539_10000008 3300005985 Bacteria 525071
254 Ga0081539_10000747 3300005985 Bacteria 64612
255 Ga0081539_10001010 3300005985 Bacteria 51943
256 Ga0081539_10002027 3300005985 Bacteria 30522
257 Ga0081539_10004951 3300005985 Bacteria 14150
258 Ga0081539_10039464 3300005985 Bacteria 2785
259 Ga0070717_10002186 3300006028 Bacteria 13725
260 Ga0070717_10018588 3300006028 Bacteria 5431
261 Ga0070717_10023179 3300006028 Bacteria 4915
262 Ga0075365_10025380 3300006038 Bacteria 3751
263 Ga0075365_10098867 3300006038 Bacteria 1996
264 Ga0075368_10002361 3300006042 Bacteria 6139
265 Ga0075368_10028649 3300006042 Bacteria 2152
266 Ga0075364_10001029 3300006051 Bacteria 14811
267 Ga0075364_10044728 3300006051 Bacteria 2880
268 Ga0075432_10007773 3300006058 Bacteria 3654
269 Ga0070715_10000320 3300006163 Bacteria 11866
270 Ga0070715_10000420 3300006163 Bacteria 10819
271 Ga0070715_10006169 3300006163 Bacteria 4057
272 Ga0070715_10010703 3300006163 Bacteria 3277
273 Ga0070715_10015703 3300006163 Bacteria 2830
274 Ga0070716_100001867 3300006173 Bacteria 9562
275 Ga0070716_100020203 3300006173 Bacteria 3493
276 Ga0070716_100044394 3300006173 Bacteria 2490
277 Ga0070716_100059932 3300006173 Bacteria 2196
278 Ga0070712_100001878 3300006175 Bacteria 12816
279 Ga0070712_100055421 3300006175 Bacteria 2777
280 Ga0075362_10009545 3300006177 Bacteria 3756
281 Ga0075362_10022812 3300006177 Bacteria 2641
282 Ga0075367_10006118 3300006178 Bacteria 6051
283 Ga0075367_10013796 3300006178 Bacteria 4357
284 Ga0075367_10021373 3300006178 Bacteria 3616
285 Ga0075367_10038273 3300006178 Bacteria 2791
286 Ga0075369_10011401 3300006186 Bacteria 3497
287 Ga0075366_10024479 3300006195 Bacteria 3521
288 Ga0075366_10045627 3300006195 Bacteria 2597
289 Ga0075366_10049192 3300006195 Bacteria 2502
290 Ga0075366_10063442 3300006195 Bacteria 2196
291 Ga0097621_100018375 3300006237 Bacteria 5338
292 Ga0097621_100186922 3300006237 Bacteria 1792
293 Ga0075370_10036524 3300006353 Bacteria 2759
294 Ga0068871_100017948 3300006358 Bacteria 5367
295 Ga0068871_100164342 3300006358 Bacteria 1899
296 Ga0075428_100000103 3300006844 Bacteria 71205
297 Ga0075428_100003399 3300006844 Bacteria 17407
298 Ga0075428_100009742 3300006844 Bacteria 10673
299 Ga0075428_100098353 3300006844 Bacteria 3190
300 Ga0075428_100138048 3300006844 Bacteria 2651
301 Ga0075428_100291397 3300006844 Bacteria 1755
302 Ga0075430_100000133 3300006846 Bacteria 47377
303 Ga0075430_100004771 3300006846 Bacteria 11408
304 Ga0075430_100065258 3300006846 Bacteria 3058
305 Ga0075430_100213323 3300006846 Bacteria 1602
306 Ga0075431_100001293 3300006847 Bacteria 22854
307 Ga0075431_100002259 3300006847 Bacteria 18467
308 Ga0075431_100037647 3300006847 Bacteria 4981
309 Ga0075431_100083102 3300006847 Bacteria 3306
310 Ga0075431_100208278 3300006847 Bacteria 1998
311 Ga0075433_10000506 3300006852 Bacteria 25421
312 Ga0075433_10001540 3300006852 Bacteria 17038
313 Ga0075433_10068973 3300006852 Bacteria 3104
314 Ga0075433_10159343 3300006852 Bacteria 2008
315 Ga0075434_100000472 3300006871 Bacteria 30053
316 Ga0075434_100001125 3300006871 Bacteria 21994
317 Ga0075434_100004709 3300006871 Bacteria 12330
318 Ga0075434_100021009 3300006871 Bacteria 6341
319 Ga0075434_100080376 3300006871 Bacteria 3256
320 Ga0075434_100115829 3300006871 Bacteria 2693
321 Ga0075434_100202054 3300006871 Bacteria 2007
322 Ga0075429_100000163 3300006880 Bacteria 42270
323 Ga0075429_100020211 3300006880 Bacteria 5774
324 Ga0075429_100075942 3300006880 Bacteria 2926
325 Ga0068865_100006160 3300006881 Bacteria 7310
326 Ga0068865_100021323 3300006881 Bacteria 4211
327 Ga0068865_100078669 3300006881 Bacteria 2359
328 Ga0097620_100012381 3300006931 Bacteria 8581
329 Ga0097620_100058038 3300006931 Bacteria 3898
330 Ga0097620_100153701 3300006931 Bacteria 2377
331 Ga0099824_1022507 3300006942 Bacteria 4141
332 Ga0075435_100005547 3300007076 Bacteria 8828
333 Ga0075435_100006632 3300007076 Bacteria 8201
334 Ga0075435_100029304 3300007076 Bacteria 4319
335 Ga0075435_100056294 3300007076 Bacteria 3178
336 Ga0075435_100076789 3300007076 Bacteria 2738
337 Ga0075435_100120272 3300007076 Bacteria 2191
338 Ga0075435_100163692 3300007076 Bacteria 1875
339 Ga0099794_10009565 3300007265 Bacteria 4083
340 Ga0099795_10000216 3300007788 Bacteria 9967
341 Ga0099795_10002853 3300007788 Bacteria 4177
342 Ga0105251_10002065 3300009011 Bacteria 16214
343 Ga0105240_10003119 3300009093 Bacteria 26094
344 Ga0105240_10015980 3300009093 Bacteria 10175
345 Ga0105240_10020880 3300009093 Bacteria 8723
346 Ga0105240_10062547 3300009093 Bacteria 4634
347 Ga0111539_10000389 3300009094 Bacteria 54333
348 Ga0111539_10004544 3300009094 Bacteria 18148
349 Ga0111539_10005030 3300009094 Bacteria 17186
350 Ga0111539_10005183 3300009094 Bacteria 16889
351 Ga0111539_10025207 3300009094 Bacteria 7290
352 Ga0111539_10027318 3300009094 Bacteria 6969
353 Ga0111539_10033030 3300009094 Bacteria 6283
354 Ga0111539_10066357 3300009094 Bacteria 4262
355 Ga0105245_10004886 3300009098 Bacteria 11794
356 Ga0105245_10015633 3300009098 Bacteria 6619
357 Ga0105245_10189971 3300009098 Bacteria 1967
358 Ga0105247_10003705 3300009101 Bacteria 9922
359 Ga0105247_10037800 3300009101 Bacteria 2945
360 Ga0105247_10040980 3300009101 Bacteria 2832
361 Ga0114129_10002163 3300009147 Bacteria 27081
362 Ga0114129_10003194 3300009147 Bacteria 22994
363 Ga0114129_10021030 3300009147 Bacteria 9267
364 Ga0114129_10022094 3300009147 Bacteria 9028
365 Ga0114129_10046959 3300009147 Bacteria 6068
366 Ga0114129_10172096 3300009147 Bacteria 2951
367 Ga0114129_10178412 3300009147 Bacteria 2892
368 Ga0114129_10202623 3300009147 Bacteria 2686
369 Ga0114129_10233588 3300009147 Bacteria 2476
370 Ga0105243_10006915 3300009148 Bacteria 8742
371 Ga0105243_10016177 3300009148 Bacteria 5644
372 Ga0105243_10094100 3300009148 Bacteria 2474
373 Ga0105241_10012907 3300009174 Bacteria 6130
374 Ga0105241_10018500 3300009174 Bacteria 5125
375 Ga0105241_10056744 3300009174 Bacteria 3003
376 Ga0105242_10005843 3300009176 Bacteria 9482
377 Ga0105248_10008593 3300009177 Bacteria 11215
378 Ga0105248_10030646 3300009177 Bacteria 6007
379 Ga0105248_10090547 3300009177 Bacteria 3445
380 Ga0105248_10095407 3300009177 Bacteria 3349
381 Ga0105248_10122502 3300009177 Bacteria 2933
382 Ga0105248_10239281 3300009177 Bacteria 2043
383 Ga0105237_10025782 3300009545 Bacteria 6011
384 Ga0105237_10031793 3300009545 Bacteria 5346
385 Ga0105237_10134246 3300009545 Bacteria 2469
386 Ga0105237_10190843 3300009545 Bacteria 2049
387 Ga0105238_10003628 3300009551 Bacteria 15389
388 Ga0105238_10018690 3300009551 Bacteria 7059
389 Ga0105238_10052431 3300009551 Bacteria 4101
390 Ga0105249_10018756 3300009553 Bacteria 6163
391 Ga0105249_10094744 3300009553 Bacteria 2799
392 Ga0099796_10000421 3300010159 Bacteria 7021
393 Ga0099796_10006609 3300010159 Bacteria 2981
394 Ga0105239_10043580 3300010375 Bacteria 4919
395 Ga0105239_10044826 3300010375 Bacteria 4847
396 Ga0105239_10058713 3300010375 Bacteria 4222
397 Ga0105239_10078857 3300010375 Bacteria 3624
398 Ga0105239_10216347 3300010375 Bacteria 2148
399 Ga0105246_10017018 3300011119 Bacteria 4617
400 Ga0105246_10030521 3300011119 Bacteria 3561
401 Ga0105246_10034450 3300011119 Bacteria 3375
402 Ga0105246_10154825 3300011119 Bacteria 1740
403 Ga0157373_10150890 3300013100 Bacteria 1635
404 Ga0157371_10023732 3300013102 Bacteria 4484
405 Ga0157369_10249398 3300013105 Bacteria 1853
406 Ga0157374_10003804 3300013296 Bacteria 12691
407 Ga0157374_10010540 3300013296 Bacteria 7955
408 Ga0157374_10025104 3300013296 Bacteria 5346
409 Ga0157378_10007681 3300013297 Bacteria 9410
410 Ga0157378_10013539 3300013297 Bacteria 7135
411 Ga0157378_10065470 3300013297 Bacteria 3253
412 Ga0157378_10079320 3300013297 Bacteria 2964
413 Ga0163162_10013059 3300013306 Bacteria 8105
414 Ga0163162_10039006 3300013306 Bacteria 4743
415 Ga0157372_10031288 3300013307 Bacteria 5826
416 Ga0157375_10021128 3300013308 Bacteria 5962
417 Ga0157375_10037929 3300013308 Bacteria 4623
418 Ga0157375_10076771 3300013308 Bacteria 3369
419 Ga0157375_10173210 3300013308 Bacteria 2307
420 Ga0157375_10300125 3300013308 Bacteria 1770
421 Ga0157375_10431132 3300013308 Bacteria 1484
422 Ga0163163_10004872 3300014325 Bacteria 11539
423 Ga0163163_10009467 3300014325 Bacteria 8699
424 Ga0163163_10080858 3300014325 Bacteria 3250
425 Ga0163163_10099722 3300014325 Bacteria 2926
426 Ga0163163_10157549 3300014325 Bacteria 2315
427 Ga0157380_10001774 3300014326 Bacteria 14253
428 Ga0157377_10003064 3300014745 Bacteria 7499
429 Ga0157377_10052389 3300014745 Bacteria 2304
430 Ga0157377_10088694 3300014745 Bacteria 1822
431 Ga0157379_10031492 3300014968 Bacteria 4725
432 Ga0157379_10058893 3300014968 Bacteria 3435
433 Ga0157379_10073604 3300014968 Bacteria 3058
434 Ga0157376_10002959 3300014969 Bacteria 11657
435 Ga0157376_10004003 3300014969 Bacteria 10189
436 Ga0182006_1001196 3300015261 Bacteria 16214
437 Ga0163161_10003456 3300017792 Bacteria 11069
438 Ga0163161_10019750 3300017792 Bacteria 4726
439 Ga0214544_1000020 3300021320 Bacteria 178560
440 Ga0214542_1000024 3300021321 Bacteria 191218
441 Ga0214545_1000011 3300021324 Bacteria 190550
442 Ga0214545_1029344 3300021324 Bacteria 2491
443 Ga0214543_1000033 3300021327 Bacteria 190419
444 Ga0213872_10003584 3300021361 Bacteria 8540
445 Ga0213872_10016312 3300021361 Bacteria 3449
446 Ga0213872_10048178 3300021361 Bacteria 1937
447 Ga0213876_10001998 3300021384 Bacteria 12203
448 Ga0209435_100040 3300025206 Bacteria 115475
449 Ga0209784_100002 3300025224 Bacteria 1753105
450 Ga0209566_100003 3300025225 Bacteria 1753105
451 Ga0209674_100004 3300025226 Bacteria 1753105
452 Ga0209147_100141 3300025229 Bacteria 115466
453 Ga0209563_100006 3300025230 Bacteria 1753105
454 Ga0209563_101304 3300025230 Bacteria 6806
455 Ga0209437_100229 3300025233 Bacteria 95900
456 Ga0209258_100657 3300025242 Bacteria 25150
457 Ga0207425_1009865 3300025245 Bacteria 2352
458 Ga0209646_1000204 3300025246 Bacteria 69552
459 Ga0209646_1000253 3300025246 Bacteria 53522
460 Ga0209026_1000306 3300025250 Bacteria 53524
461 Ga0209677_100003 3300025253 Bacteria 1753105
462 Ga0209677_102281 3300025253 Bacteria 7406
463 Ga0209677_102285 3300025253 Bacteria 7388
464 Ga0209759_1000298 3300025256 Bacteria 68472
465 Ga0209759_1000398 3300025256 Bacteria 53628
466 Ga0209233_1001066 3300025261 Bacteria 11357
467 Ga0209233_1004907 3300025261 Bacteria 4499
468 Ga0209233_1005718 3300025261 Bacteria 4099
469 Ga0207666_1000077 3300025271 Bacteria 16262
470 Ga0209673_1014952 3300025273 Bacteria 2976
471 Ga0207673_1000891 3300025290 Bacteria 3206
472 Ga0209675_1003720 3300025291 Bacteria 7091
473 Ga0209676_1002143 3300025292 Bacteria 14987
474 Ga0209564_1014473 3300025295 Bacteria 3278
475 Ga0209758_1000294 3300025297 Bacteria 98618
476 Ga0209758_1000407 3300025297 Bacteria 73945
477 Ga0209758_1000952 3300025297 Bacteria 39040
478 Ga0209758_1001983 3300025297 Bacteria 22130
479 Ga0209758_1002883 3300025297 Bacteria 16636
480 Ga0209758_1008305 3300025297 Bacteria 6775
481 Ga0209758_1032704 3300025297 Bacteria 2105
482 Ga0209050_1000925 3300025298 Bacteria 38696
483 Ga0209256_1000545 3300025299 Bacteria 54076
484 Ga0209256_1006969 3300025299 Bacteria 5755
485 Ga0207426_1001388 3300025302 Bacteria 20462
486 Ga0207426_1006921 3300025302 Bacteria 4821
487 Ga0207426_1031258 3300025302 Bacteria 1738
488 Ga0209051_1000059 3300025303 Bacteria 260307
489 Ga0209257_1000022 3300025304 Bacteria 765258
490 Ga0209257_1001136 3300025304 Bacteria 34058
491 Ga0207697_10001615 3300025315 Bacteria 12170
492 Ga0207697_10029005 3300025315 Bacteria 2264
493 Ga0207697_10031871 3300025315 Bacteria 2157
494 Ga0207656_10018123 3300025321 Bacteria 2767
495 Ga0207713_1002261 3300025735 Bacteria 14219
496 Ga0207682_10000009 3300025893 Bacteria 86366
497 Ga0207682_10007879 3300025893 Bacteria 4230
498 Ga0207682_10008819 3300025893 Bacteria 3988
499 Ga0207692_10007013 3300025898 Bacteria 4600
500 Ga0207692_10008475 3300025898 Bacteria 4253
501 Ga0207642_10011334 3300025899 Bacteria 3176
502 Ga0207642_10089442 3300025899 Bacteria 1517
503 Ga0207710_10017532 3300025900 Bacteria 3038
504 Ga0207710_10018129 3300025900 Bacteria 2992
505 Ga0207710_10018417 3300025900 Bacteria 2969
506 Ga0207710_10023791 3300025900 Bacteria 2633
507 Ga0207688_10001372 3300025901 Bacteria 12640
508 Ga0207688_10010399 3300025901 Bacteria 5064
509 Ga0207688_10015227 3300025901 Bacteria 4173
510 Ga0207688_10058016 3300025901 Bacteria 2178
511 Ga0207688_10061197 3300025901 Bacteria 2122
512 Ga0207680_10055095 3300025903 Bacteria 2395
513 Ga0207647_10006480 3300025904 Bacteria 8506
514 Ga0207647_10035209 3300025904 Bacteria 3192
515 Ga0207685_10005926 3300025905 Bacteria 3277
516 Ga0207699_10001319 3300025906 Bacteria 11796
517 Ga0207699_10002443 3300025906 Bacteria 8765
518 Ga0207699_10049238 3300025906 Bacteria 2480
519 Ga0207645_10002502 3300025907 Bacteria 14418
520 Ga0207645_10018918 3300025907 Bacteria 4524
521 Ga0207643_10000292 3300025908 Bacteria 34914
522 Ga0207643_10000418 3300025908 Bacteria 28078
523 Ga0207643_10040888 3300025908 Bacteria 2611
524 Ga0207643_10064491 3300025908 Bacteria 2096
525 Ga0207654_10015148 3300025911 Bacteria 3995
526 Ga0207654_10017669 3300025911 Bacteria 3734
527 Ga0207654_10030110 3300025911 Bacteria 2977
528 Ga0207707_10002931 3300025912 Bacteria 15207
529 Ga0207695_10001540 3300025913 Bacteria 37977
530 Ga0207695_10017000 3300025913 Bacteria 8486
531 Ga0207695_10023519 3300025913 Bacteria 6958
532 Ga0207671_10032015 3300025914 Bacteria 3915
533 Ga0207671_10066825 3300025914 Bacteria 2677
534 Ga0207671_10139691 3300025914 Bacteria 1866
535 Ga0207671_10175033 3300025914 Bacteria 1668
536 Ga0207693_10001385 3300025915 Bacteria 21487
537 Ga0207693_10001566 3300025915 Bacteria 20200
538 Ga0207693_10011746 3300025915 Bacteria 7079
539 Ga0207693_10013334 3300025915 Bacteria 6626
540 Ga0207693_10064329 3300025915 Bacteria 2873
541 Ga0207663_10000136 3300025916 Bacteria 34085
542 Ga0207663_10006786 3300025916 Bacteria 5893
543 Ga0207660_10000893 3300025917 Bacteria 19637
544 Ga0207660_10180090 3300025917 Bacteria 1641
545 Ga0207662_10000861 3300025918 Bacteria 13998
546 Ga0207662_10064505 3300025918 Bacteria 2204
547 Ga0207657_10003725 3300025919 Bacteria 16199
548 Ga0207657_10012700 3300025919 Bacteria 8299
549 Ga0207657_10036461 3300025919 Bacteria 4401
550 Ga0207649_10004064 3300025920 Bacteria 7965
551 Ga0207649_10071124 3300025920 Bacteria 2221
552 Ga0207652_10002516 3300025921 Bacteria 15403
553 Ga0207646_10007486 3300025922 Bacteria 11082
554 Ga0207681_10008223 3300025923 Bacteria 6379
555 Ga0207681_10014965 3300025923 Bacteria 4833
556 Ga0207681_10040181 3300025923 Bacteria 3111
557 Ga0207694_10014930 3300025924 Bacteria 5857
558 Ga0207694_10035008 3300025924 Bacteria 3851
559 Ga0207650_10000288 3300025925 Bacteria 51267
560 Ga0207650_10001712 3300025925 Bacteria 15568
561 Ga0207650_10001829 3300025925 Bacteria 15043
562 Ga0207650_10002115 3300025925 Bacteria 13878
563 Ga0207650_10045906 3300025925 Bacteria 3215
564 Ga0207659_10001554 3300025926 Bacteria 13628
565 Ga0207659_10016654 3300025926 Bacteria 4789
566 Ga0207659_10116180 3300025926 Bacteria 2042
567 Ga0207687_10001197 3300025927 Bacteria 17741
568 Ga0207687_10006940 3300025927 Bacteria 7460
569 Ga0207687_10013222 3300025927 Bacteria 5391
570 Ga0207687_10124106 3300025927 Bacteria 1936
571 Ga0207700_10006688 3300025928 Bacteria 6994
572 Ga0207700_10023730 3300025928 Bacteria 4236
573 Ga0207700_10032460 3300025928 Bacteria 3724
574 Ga0207700_10041044 3300025928 Bacteria 3382
575 Ga0207664_10013549 3300025929 Bacteria 5857
576 Ga0207664_10060688 3300025929 Bacteria 3014
577 Ga0207664_10068985 3300025929 Bacteria 2842
578 Ga0207664_10079804 3300025929 Bacteria 2658
579 Ga0207644_10001963 3300025931 Bacteria 13295
580 Ga0207644_10014948 3300025931 Bacteria 5204
581 Ga0207644_10041902 3300025931 Bacteria 3241
582 Ga0207644_10104521 3300025931 Bacteria 2132
583 Ga0207690_10005575 3300025932 Bacteria 7436
584 Ga0207706_10002827 3300025933 Bacteria 16841
585 Ga0207706_10014998 3300025933 Bacteria 7015
586 Ga0207706_10024198 3300025933 Bacteria 5444
587 Ga0207706_10095387 3300025933 Bacteria 2616
588 Ga0207686_10001310 3300025934 Bacteria 14258
589 Ga0207686_10001988 3300025934 Bacteria 11265
590 Ga0207709_10002910 3300025935 Bacteria 10449
591 Ga0207709_10009749 3300025935 Bacteria 5293
592 Ga0207709_10016042 3300025935 Bacteria 4158
593 Ga0207709_10145261 3300025935 Bacteria 1636
594 Ga0207670_10002928 3300025936 Bacteria 9025
595 Ga0207670_10010411 3300025936 Bacteria 5356
596 Ga0207669_10000909 3300025937 Bacteria 12533
597 Ga0207669_10159702 3300025937 Bacteria 1590
598 Ga0207704_10004639 3300025938 Bacteria 6300
599 Ga0207704_10006693 3300025938 Bacteria 5397
600 Ga0207665_10000064 3300025939 Bacteria 68931
601 Ga0207665_10001510 3300025939 Bacteria 15663
602 Ga0207665_10002822 3300025939 Bacteria 11647
603 Ga0207665_10008638 3300025939 Bacteria 6706
604 Ga0207665_10049190 3300025939 Bacteria 2832
605 Ga0207691_10005519 3300025940 Bacteria 12220
606 Ga0207691_10025609 3300025940 Bacteria 5537
607 Ga0207691_10061618 3300025940 Bacteria 3407
608 Ga0207691_10091423 3300025940 Bacteria 2727
609 Ga0207691_10137905 3300025940 Bacteria 2151
610 Ga0207691_10198351 3300025940 Bacteria 1748
611 Ga0207691_10243719 3300025940 Bacteria 1553
612 Ga0207711_10001144 3300025941 Bacteria 25260
613 Ga0207711_10037712 3300025941 Bacteria 4107
614 Ga0207711_10043321 3300025941 Bacteria 3838
615 Ga0207689_10001448 3300025942 Bacteria 22699
616 Ga0207689_10019790 3300025942 Bacteria 5669
617 Ga0207689_10039992 3300025942 Bacteria 3882
618 Ga0207689_10065521 3300025942 Bacteria 2988
619 Ga0207661_10002433 3300025944 Bacteria 12827
620 Ga0207661_10048530 3300025944 Bacteria 3375
621 Ga0207661_10060818 3300025944 Bacteria 3050
622 Ga0207679_10003604 3300025945 Bacteria 9607
623 Ga0207679_10075413 3300025945 Bacteria 2559
624 Ga0207667_10111248 3300025949 Bacteria 2825
625 Ga0207651_10001703 3300025960 Bacteria 10145
626 Ga0207651_10047471 3300025960 Bacteria 2895
627 Ga0207712_10003650 3300025961 Bacteria 9700
628 Ga0207668_10001981 3300025972 Bacteria 11973
629 Ga0207640_10003763 3300025981 Bacteria 8180
630 Ga0207640_10008114 3300025981 Bacteria 5812
631 Ga0207640_10061301 3300025981 Bacteria 2491
632 Ga0207658_10000466 3300025986 Bacteria 37801
633 Ga0207658_10031138 3300025986 Bacteria 3785
634 Ga0207677_10001053 3300026023 Bacteria 15130
635 Ga0207677_10029878 3300026023 Bacteria 3470
636 Ga0207677_10219604 3300026023 Bacteria 1524
637 Ga0207703_10017302 3300026035 Bacteria 5627
638 Ga0207703_10023676 3300026035 Bacteria 4829
639 Ga0207703_10031824 3300026035 Bacteria 4173
640 Ga0207703_10084827 3300026035 Bacteria 2649
641 Ga0207703_10097711 3300026035 Bacteria 2482
642 Ga0207703_10279628 3300026035 Bacteria 1515
643 Ga0207639_10040853 3300026041 Bacteria 3465
644 Ga0207639_10051630 3300026041 Bacteria 3128
645 Ga0207678_10002714 3300026067 Bacteria 16050
646 Ga0207678_10006709 3300026067 Bacteria 10210
647 Ga0207678_10030296 3300026067 Bacteria 4724
648 Ga0207708_10002881 3300026075 Bacteria 12675
649 Ga0207708_10003108 3300026075 Bacteria 12219
650 Ga0207708_10038305 3300026075 Bacteria 3652
651 Ga0207708_10102100 3300026075 Bacteria 2220
652 Ga0207641_10000103 3300026088 Bacteria 122350
653 Ga0207641_10008745 3300026088 Bacteria 8365
654 Ga0207641_10009054 3300026088 Bacteria 8223
655 Ga0207641_10079739 3300026088 Bacteria 2839
656 Ga0207648_10003666 3300026089 Bacteria 16077
657 Ga0207648_10006999 3300026089 Bacteria 11151
658 Ga0207648_10009796 3300026089 Bacteria 9155
659 Ga0207648_10074823 3300026089 Bacteria 2952
660 Ga0207648_10108021 3300026089 Bacteria 2442
661 Ga0207676_10000044 3300026095 Bacteria 161679
662 Ga0207676_10010622 3300026095 Bacteria 6563
663 Ga0207676_10016879 3300026095 Bacteria 5285
664 Ga0207676_10052284 3300026095 Bacteria 3192
665 Ga0207676_10073921 3300026095 Bacteria 2744
666 Ga0207674_10024031 3300026116 Bacteria 6517
667 Ga0207674_10047126 3300026116 Bacteria 4421
668 Ga0207674_10151319 3300026116 Bacteria 2278
669 Ga0207674_10154307 3300026116 Bacteria 2252
670 Ga0207674_10258133 3300026116 Bacteria 1690
671 Ga0207675_100005413 3300026118 Bacteria 12230
672 Ga0207675_100029224 3300026118 Bacteria 5137
673 Ga0207675_100039892 3300026118 Bacteria 4381
674 Ga0207675_100042588 3300026118 Bacteria 4239
675 Ga0207683_10000782 3300026121 Bacteria 29001
676 Ga0207683_10001222 3300026121 Bacteria 23313
677 Ga0207683_10014258 3300026121 Bacteria 6772
678 Ga0207683_10030958 3300026121 Bacteria 4641
679 Ga0207683_10185100 3300026121 Bacteria 1889
680 Ga0207698_10000603 3300026142 Bacteria 21081
681 Ga0207698_10033824 3300026142 Bacteria 3719
682 Ga0207698_10045774 3300026142 Bacteria 3298
683 Ga0207698_10154018 3300026142 Bacteria 1999
684 Ga0209389_1000011 3300027296 Bacteria 223265
685 Ga0209389_1000424 3300027296 Bacteria 25082
686 Ga0209589_1004180 3300027357 Bacteria 25082
687 Ga0209489_100017 3300027361 Bacteria 223265
688 Ga0209489_104563 3300027361 Bacteria 25351
689 Ga0209700_100027 3300027363 Bacteria 223462
690 Ga0209179_1005548 3300027512 Bacteria 1982
691 Ga0210002_1003574 3300027617 Bacteria 2295
692 Ga0209588_1017593 3300027671 Bacteria 2217
693 Ga0209998_10001207 3300027717 Bacteria 6346
694 Ga0209998_10006448 3300027717 Bacteria 2437
695 Ga0209974_10001210 3300027876 Bacteria 9241
696 Ga0209974_10020357 3300027876 Bacteria 2199
697 Ga0207428_10000164 3300027907 Bacteria 91968
698 Ga0207428_10000391 3300027907 Bacteria 54825
699 Ga0207428_10002684 3300027907 Bacteria 17726
700 Ga0207428_10030850 3300027907 Bacteria 4428
701 Ga0207428_10033735 3300027907 Bacteria 4200
702 Ga0207428_10157801 3300027907 Bacteria 1724
703 Ga0268266_10003117 3300028379 Bacteria 16871
704 Ga0268266_10005300 3300028379 Bacteria 12094
705 Ga0268266_10137128 3300028379 Bacteria 2192
706 Ga0268266_10245286 3300028379 Bacteria 1655
707 Ga0268265_10000142 3300028380 Bacteria 91165
708 Ga0268265_10067166 3300028380 Bacteria 2775
709 Ga0268265_10157663 3300028380 Bacteria 1923
710 Ga0268264_10000035 3300028381 Bacteria 398196
711 Ga0268264_10007183 3300028381 Bacteria 9329
712 Ga0268264_10124929 3300028381 Bacteria 2273
713 Ga0265337_1019331 3300028556 Bacteria 2148
714 Ga0265319_1001186 3300028563 Bacteria 16109
715 Ga0265334_10004555 3300028573 Bacteria 6143
716 Ga0265334_10026011 3300028573 Bacteria 2365
717 Ga0265318_10002015 3300028577 Bacteria 11243
718 Ga0265318_10002315 3300028577 Bacteria 10231
719 Ga0265318_10002586 3300028577 Bacteria 9581
720 Ga0265323_10000768 3300028653 Bacteria 17199
721 Ga0265322_10003636 3300028654 Bacteria 4638
722 Ga0265336_10000106 3300028666 Bacteria 63839
723 Ga0307517_10000049 3300028786 Bacteria 160368
724 Ga0307515_10008473 3300028794 Bacteria 20029
725 Ga0265338_10000065 3300028800 Bacteria 188966
726 Ga0265324_10001808 3300029957 Bacteria 11615
727 Ga0307511_10000948 3300030521 Bacteria 30775
728 Ga0265330_10013442 3300031235 Bacteria 3814
729 Ga0265330_10020506 3300031235 Bacteria 3020
730 Ga0265332_10007484 3300031238 Bacteria 4937
731 Ga0265332_10028029 3300031238 Bacteria 2466
732 Ga0265328_10003748 3300031239 Bacteria 6699
733 Ga0265320_10009181 3300031240 Bacteria 5983
734 Ga0265320_10038913 3300031240 Bacteria 2381
735 Ga0265325_10012239 3300031241 Bacteria 4909
736 Ga0265325_10023047 3300031241 Bacteria 3405
737 Ga0265329_10008771 3300031242 Bacteria 3813
738 Ga0265329_10008995 3300031242 Bacteria 3753
739 Ga0265339_10021009 3300031249 Bacteria 3807
740 Ga0265331_10000945 3300031250 Bacteria 23156
741 Ga0265331_10025683 3300031250 Bacteria 2970
742 Ga0265327_10021443 3300031251 Bacteria 3898
743 Ga0265316_10071014 3300031344 Bacteria 2684
744 Ga0265316_10109432 3300031344 Bacteria 2094
745 Ga0265316_10122993 3300031344 Bacteria 1959
746 Ga0307513_10091203 3300031456 Bacteria 3106
747 Ga0307509_10029697 3300031507 Bacteria 6062
748 Ga0307509_10083377 3300031507 Bacteria 3295
749 Ga0307408_100018764 3300031548 Bacteria 4648
750 Ga0307508_10000090 3300031616 Bacteria 106893
751 Ga0265314_10000220 3300031711 Bacteria 84921
752 Ga0265314_10026005 3300031711 Bacteria 4404
753 Ga0265314_10127697 3300031711 Bacteria 1590
754 Ga0265342_10006047 3300031712 Bacteria 9083
755 Ga0265342_10011954 3300031712 Bacteria 5900
756 Ga0265342_10021271 3300031712 Bacteria 4146
757 Ga0307516_10006682 3300031730 Bacteria 13475
758 Ga0307516_10103897 3300031730 Bacteria 2654
759 Ga0307413_10072121 3300031824 Bacteria 2179
760 Ga0307412_10000335 3300031911 Bacteria 29669
761 Ga0307412_10131089 3300031911 Bacteria 1821
762 Ga0307411_10053158 3300032005 Bacteria 2652
763 Ga0307507_10098971 3300033179 Bacteria 2452
764 Ga0307510_10019318 3300033180 Bacteria 7995
765 Ga0307510_10031887 3300033180 Bacteria 5944
766 Ga0307510_10044427 3300033180 Bacteria 4812
767 Ga0307510_10072820 3300033180 Bacteria 3410
768 Ga0315911_1000011 3300033442 Bacteria 264678
769 Ga0373950_0000340 3300034818 Bacteria 5861
770 Ga0373958_0000223 3300034819 Bacteria 6705
771 Ga0373959_0000418 3300034820 Bacteria 8131
772 Ga0373938_0000580 3300034957 Bacteria 5903
773 Ga0373928_0000151 3300035084 Bacteria 13297
774 Ga0373928_0014812 3300035084 Bacteria 1581
775 Ga0373929_0001036 3300035085 Bacteria 5391
776 Ga0373934_0009191 3300035086 Bacteria 3701
777 Ga0373940_0003150 3300035088 Bacteria 3328
778 Ga0373949_0001703 3300035090 Bacteria 6102
779 Ga0373951_0000232 3300035091 Bacteria 19022
780 Ga0373952_0000567 3300035092 Bacteria 6518
781 Ga0373923_0000595 3300035111 Bacteria 8982
782 Ga0373923_0003802 3300035111 Bacteria 4905
783 Ga0373932_0000366 3300035112 Bacteria 13946
784 Ga0373936_0002231 3300035113 Bacteria 7235
785 Ga0373936_0028657 3300035113 Bacteria 2190
786 Ga0373939_0000753 3300035114 Bacteria 7981
787 Ga0373939_0006530 3300035114 Bacteria 2813
788 Ga0373941_0001679 3300035115 Bacteria 4740
789 Ga0373945_0013753 3300035116 Bacteria 2704
790 Ga0373953_0002952 3300035117 Bacteria 5199
791 Ga0373953_0005683 3300035117 Bacteria 4065
792 Ga0373954_0000951 3300035118 Bacteria 11318
793 Ga0373954_0007519 3300035118 Bacteria 4768
794 Ga0373954_0010242 3300035118 Bacteria 4134
795 Ga0373960_0016590 3300035121 Bacteria 1898
796 Ga0373943_0004323 3300035170 Bacteria 6444
797 Ga0373943_0008124 3300035170 Bacteria 4708
798 Ga0373943_0066244 3300035170 Bacteria 1818
799 Ga0373946_0018323 3300035171 Bacteria 2687
800 Ga0373946_0043539 3300035171 Bacteria 1850
801 Ga0373946_0057985 3300035171 Bacteria 1639
802 Ga0373955_0000360 3300035172 Bacteria 19140
803 Ga0373955_0000643 3300035172 Bacteria 14950
804 Ga0373955_0030797 3300035172 Bacteria 2805
805 Ga0373942_0000780 3300035207 Bacteria 8788
806 Ga0373961_0004799 3300035241 Bacteria 3250
807 Ga0373961_0020487 3300035241 Bacteria 1750
808 Ga0373962_0001878 3300035242 Bacteria 5009
809 Ga0373924_0002747 3300035410 Bacteria 5940
810 Ga0373924_0030057 3300035410 Bacteria 2175
811 Ga0373931_0002260 3300035691 Bacteria 8511
812 Ga0373931_0006487 3300035691 Bacteria 5467
813 Ga0373931_0010679 3300035691 Bacteria 4418
814 Ga0373931_0010912 3300035691 Bacteria 4374
815 Ga0373931_0113141 3300035691 Bacteria 1542
816 Ga0373935_0000075 3300035692 Bacteria 42723
817 Ga0373935_0002949 3300035692 Bacteria 9803
818 Ga0373935_0019417 3300035692 Bacteria 4144
819 Ga0373927_0000950 3300035695 Bacteria 22071
820 Ga0373927_0007183 3300035695 Bacteria 7558
821 Ga0373927_0014279 3300035695 Bacteria 5262
822 Ga0373927_0132370 3300035695 Bacteria 1630
823 Ga0373933_0002546 3300035724 Bacteria 10225
824 Ga0373933_0002722 3300035724 Bacteria 9888
825 Ga0373933_0003920 3300035724 Bacteria 8208
826 Ga0373933_0015393 3300035724 Bacteria 4261
827 Ga0373933_0113081 3300035724 Bacteria 1695
828 Ga0373947_0000138 3300035725 Bacteria 37713
829 Ga0373947_0003025 3300035725 Bacteria 10019
830 Ga0373947_0040432 3300035725 Bacteria 2777
831 Ga0373947_0063903 3300035725 Bacteria 2243
832 Ga0373947_0075867 3300035725 Bacteria 2071
833 Ga0373937_0000057 3300036401 Bacteria 99491
834 Ga0373937_0008436 3300036401 Bacteria 8955
835 Ga0373937_0031959 3300036401 Bacteria 4772
836 Ga0373937_0116753 3300036401 Bacteria 2485
837 Ga0373925_0000078 3300037068 Bacteria 105238
838 Ga0373925_0007900 3300037068 Bacteria 7745
839 Ga0373925_0016899 3300037068 Bacteria 5282
840 Ga0373925_0023694 3300037068 Bacteria 4479
841 Ga0395900_0152680 3300037418 Bacteria 2359
842 Ga0395905_0039879 3300037471 Bacteria 4405
843 Ga0395905_0188380 3300037471 Bacteria 1936
844 Ga0395905_0203419 3300037471 Bacteria 1856
845 Ga0436364_0009978 3300037853 Bacteria 2047
846 Ga0436364_0810480 3300037853 Bacteria 2901
847 Ga0395901_0051193 3300038443 Bacteria 4293
848 Ga0395901_0073367 3300038443 Bacteria 3569
849 Ga0436365_0240210 3300039437 Bacteria 20191
850 Ga0436365_0355346 3300039437 Bacteria 16712
851 Ga0436365_0642532 3300039437 Bacteria 3284
852 Ga0436365_0729222 3300039437 Bacteria 5511
853 Ga0436365_1709207 3300039437 Bacteria 1942
854 Ga0436360_0811388 3300039438 Bacteria 3964
855 Ga0436360_0930029 3300039438 Bacteria 2601
856 Ga0436360_0953856 3300039438 Bacteria 1958
857 Ga0436361_0053786 3300039447 Bacteria 27680
858 Ga0436361_0356069 3300039447 Bacteria 2837
859 Ga0436361_0536912 3300039447 Bacteria 2398
860 Ga0436361_0671651 3300039447 Bacteria 7640
861 Ga0436362_0837923 3300039453 Bacteria 4261
862 Ga0439450_006325 3300042008 Bacteria 2128
863 Ga0439455_0011932 3300042012 Bacteria 1941
864 Ga0439435_0001852 3300042436 Bacteria 4040
865 Ga0439464_0016409 3300042439 Bacteria 2001
866 Ga0451577_0039655 3300042876 Bacteria 4232
867 Ga0466972_0000371 3300044658 Bacteria 24281
868 Ga0466966_0001015 3300044684 Bacteria 17896
869 Ga0466961_0003875 3300044693 Bacteria 9345
870 Ga0453684_0000063 3300044712 Bacteria 486079
871 Ga0453684_0005314 3300044712 Bacteria 25677
872 Ga0453684_0017221 3300044712 Bacteria 11217
873 Ga0453684_0045710 3300044712 Bacteria 5835
874 Ga0453684_0090641 3300044712 Bacteria 3777
875 Ga0466959_0008411 3300045049 Bacteria 7295
876 Ga0466959_0092197 3300045049 Bacteria 2175
877 Ga0451576_0017298 3300045051 Bacteria 7933
878 Ga0495592_0000233 3300046454 Bacteria 48027
879 Ga0495592_0006322 3300046454 Bacteria 8817
880 Ga0495592_0009069 3300046454 Bacteria 7481
881 Ga0495592_0022208 3300046454 Bacteria 4827
882 Ga0495592_0026673 3300046454 Bacteria 4379
883 Ga0495592_0133728 3300046454 Bacteria 1732
884 Ga0495603_0000200 3300046455 Bacteria 31435
885 Ga0495603_0004845 3300046455 Bacteria 8045
886 Ga0495603_0013905 3300046455 Bacteria 4869
887 Ga0495603_0021588 3300046455 Bacteria 3899
888 Ga0495603_0033822 3300046455 Bacteria 3075
889 Ga0495603_0035297 3300046455 Bacteria 3004
890 Ga0495603_0041698 3300046455 Bacteria 2744
891 Ga0495629_0000139 3300046459 Bacteria 63649
892 Ga0495629_0002535 3300046459 Bacteria 14008
893 Ga0495629_0003366 3300046459 Bacteria 12077
894 Ga0495629_0010260 3300046459 Bacteria 6822
895 Ga0495638_0004444 3300046460 Bacteria 10621
896 Ga0495638_0011979 3300046460 Bacteria 5961
897 Ga0495638_0054119 3300046460 Bacteria 2496
898 Ga0495641_0007101 3300046461 Bacteria 7084
899 Ga0495641_0008896 3300046461 Bacteria 6042
900 Ga0495641_0011896 3300046461 Bacteria 4913
901 Ga0495651_0002019 3300046462 Bacteria 15670
902 Ga0495651_0002101 3300046462 Bacteria 15375
903 Ga0495651_0027827 3300046462 Bacteria 4405
904 Ga0495653_0000464 3300046463 Bacteria 31572
905 Ga0495653_0001070 3300046463 Bacteria 21097
906 Ga0495653_0001537 3300046463 Bacteria 18040
907 Ga0495653_0028701 3300046463 Bacteria 4448
908 Ga0495580_0002104 3300046472 Bacteria 17472
909 Ga0495580_0034637 3300046472 Bacteria 3634
910 Ga0495582_0000354 3300046473 Bacteria 25130
911 Ga0495582_0100804 3300046473 Bacteria 1617
912 Ga0495639_0005177 3300046475 Bacteria 5601
913 Ga0495662_0001193 3300046476 Bacteria 12825
914 Ga0495662_0037215 3300046476 Bacteria 2350
915 Ga0495664_0000023 3300046477 Bacteria 126807
916 Ga0495664_0000915 3300046477 Bacteria 15177
917 Ga0495664_0008000 3300046477 Bacteria 5886
918 Ga0495664_0009369 3300046477 Bacteria 5477
919 Ga0495664_0074724 3300046477 Bacteria 2028
920 Ga0495584_0001897 3300046491 Bacteria 12061
921 Ga0495585_0094128 3300046492 Bacteria 1610
922 Ga0495594_0001396 3300046499 Bacteria 12540
923 Ga0495594_0020533 3300046499 Bacteria 3518
924 Ga0495607_0006400 3300046501 Bacteria 8294
925 Ga0495607_0022482 3300046501 Bacteria 3960
926 Ga0495606_0002687 3300046507 Bacteria 20107
927 Ga0495608_0000030 3300046511 Bacteria 145828
928 Ga0495608_0000832 3300046511 Bacteria 21541
929 Ga0495608_0005335 3300046511 Bacteria 9184
930 Ga0495608_0019297 3300046511 Bacteria 4694
931 Ga0495608_0042381 3300046511 Bacteria 3044
932 Ga0495608_0061824 3300046511 Bacteria 2462
933 Ga0495610_0011330 3300046512 Bacteria 5458
934 Ga0495618_0000585 3300046514 Bacteria 25962
935 Ga0495618_0019644 3300046514 Bacteria 4158
936 Ga0495618_0061547 3300046514 Bacteria 2381
937 Ga0495628_0000027 3300046516 Bacteria 126537
938 Ga0495628_0014573 3300046516 Bacteria 6584
939 Ga0495628_0067228 3300046516 Bacteria 2799
940 Ga0495630_0006673 3300046517 Bacteria 8227
941 Ga0495630_0018196 3300046517 Bacteria 5159
942 Ga0495630_0030591 3300046517 Bacteria 4006
943 Ga0495632_0005127 3300046519 Bacteria 8747
944 Ga0495637_0015591 3300046520 Bacteria 3565
945 Ga0495648_0008413 3300046524 Bacteria 8123
946 Ga0495652_0000041 3300046529 Bacteria 126519
947 Ga0495652_0006363 3300046529 Bacteria 10997
948 Ga0495652_0017901 3300046529 Bacteria 6323
949 Ga0495652_0023871 3300046529 Bacteria 5416
950 Ga0495652_0040925 3300046529 Bacteria 4003
951 Ga0495652_0074114 3300046529 Bacteria 2832
952 Ga0495665_0002145 3300046531 Bacteria 10679
953 Ga0495665_0002572 3300046531 Bacteria 9795
954 Ga0495640_0000056 3300046533 Bacteria 62074
955 Ga0495640_0017266 3300046533 Bacteria 5381
956 Ga0495640_0021984 3300046533 Bacteria 4671
957 Ga0495640_0030764 3300046533 Bacteria 3840
958 Ga0495640_0075383 3300046533 Bacteria 2253
959 Ga0495640_0094870 3300046533 Bacteria 1964
960 Ga0495586_0052757 3300046535 Bacteria 2202
961 Ga0495587_0000025 3300046536 Bacteria 147974
962 Ga0495587_0014270 3300046536 Bacteria 4985
963 Ga0495587_0017630 3300046536 Bacteria 4434
964 Ga0495587_0024566 3300046536 Bacteria 3691
965 Ga0495609_0000650 3300046538 Bacteria 27040
966 Ga0495609_0053131 3300046538 Bacteria 1802
967 Ga0495645_0000001 3300046543 Bacteria 657910
968 Ga0495645_0002752 3300046543 Bacteria 11949
969 Ga0495645_0087492 3300046543 Bacteria 2229
970 Ga0495622_0073150 3300046557 Bacteria 1581
971 Ga0495633_0002146 3300046558 Bacteria 14137
972 Ga0495667_0000001 3300046559 Bacteria 834831
973 Ga0495667_0003082 3300046559 Bacteria 11183
974 Ga0495667_0005379 3300046559 Bacteria 8657
975 Ga0495667_0014365 3300046559 Bacteria 5349
976 Ga0495667_0029156 3300046559 Bacteria 3714
977 Ga0495667_0037964 3300046559 Bacteria 3208
978 Ga0495667_0059628 3300046559 Bacteria 2504
979 Ga0495656_0000091 3300046615 Bacteria 38995
980 Ga0495656_0030882 3300046615 Bacteria 2168
981 Ga0495656_0059799 3300046615 Bacteria 1659
982 Ga0495668_0037116 3300046616 Bacteria 2728
983 Ga0495634_0001485 3300046642 Bacteria 20743
984 Ga0495634_0003609 3300046642 Bacteria 12362
985 Ga0495634_0006837 3300046642 Bacteria 8630
986 Ga0495634_0035941 3300046642 Bacteria 3390
987 Ga0495611_0031594 3300046648 Bacteria 2331
988 Ga0495625_0000657 3300046660 Bacteria 49342
989 Ga0495625_0054122 3300046660 Bacteria 2867
990 Ga0495635_0000077 3300046663 Bacteria 60215
991 Ga0495635_0001348 3300046663 Bacteria 16335
992 Ga0495635_0001667 3300046663 Bacteria 14944
993 Ga0495635_0005923 3300046663 Bacteria 8529
994 Ga0495635_0014408 3300046663 Bacteria 5531
995 Ga0495635_0026385 3300046663 Bacteria 4043
996 Ga0495659_0003716 3300046664 Bacteria 4852
997 Ga0495659_0013930 3300046664 Bacteria 2624
998 Ga0495588_0007030 3300046674 Bacteria 5102
999 Ga0495588_0026608 3300046674 Bacteria 2889
1000 Ga0495588_0104312 3300046674 Bacteria 1491
1001 Ga0495657_0000390 3300046675 Bacteria 40745
1002 Ga0495657_0002643 3300046675 Bacteria 14975
1003 Ga0495657_0033520 3300046675 Bacteria 3574
1004 Ga0495657_0044165 3300046675 Bacteria 3033
1005 Ga0495599_0000021 3300046678 Bacteria 127591
1006 Ga0495599_0006501 3300046678 Bacteria 7052
1007 Ga0495599_0031977 3300046678 Bacteria 3303
1008 Ga0495599_0035992 3300046678 Bacteria 3107
1009 Ga0495623_0000141 3300046679 Bacteria 44491
1010 Ga0495623_0007128 3300046679 Bacteria 7258
1011 Ga0495646_0000051 3300046680 Bacteria 60085
1012 Ga0495646_0002199 3300046680 Bacteria 11877
1013 Ga0495646_0010792 3300046680 Bacteria 5803
1014 Ga0495646_0031676 3300046680 Bacteria 3294
1015 Ga0495646_0081565 3300046680 Bacteria 1884
1016 Ga0495658_0000065 3300046683 Bacteria 52835
1017 Ga0495658_0062648 3300046683 Bacteria 2138
1018 Ga0495658_0077884 3300046683 Bacteria 1939
1019 Ga0495669_0035333 3300046684 Bacteria 2206
1020 Ga0495613_0002672 3300046689 Bacteria 13380
1021 Ga0495624_0001939 3300046690 Bacteria 15749
1022 Ga0495624_0002275 3300046690 Bacteria 14611
1023 Ga0495624_0005832 3300046690 Bacteria 8812
1024 Ga0495624_0049899 3300046690 Bacteria 2653
1025 Ga0495670_0000199 3300046691 Bacteria 26898
1026 Ga0495589_0061358 3300046794 Bacteria 1846
1027 Ga0495600_0000114 3300046809 Bacteria 44972
1028 Ga0495600_0005269 3300046809 Bacteria 7784
1029 Ga0495600_0028768 3300046809 Bacteria 3597
1030 Ga0495600_0071798 3300046809 Bacteria 2261
1031 Ga0495600_0076891 3300046809 Bacteria 2180
1032 Ga0495660_0024370 3300046810 Bacteria 3447
1033 Ga0495581_0000851 3300047315 Bacteria 16242
1034 Ga0495581_0005368 3300047315 Bacteria 7416
1035 Ga0495581_0009905 3300047315 Bacteria 5512
1036 Ga0495604_0000036 3300047317 Bacteria 126707
1037 Ga0495604_0005569 3300047317 Bacteria 9982
1038 Ga0495604_0005625 3300047317 Bacteria 9939
1039 Ga0495604_0008438 3300047317 Bacteria 8136
1040 Ga0495604_0084461 3300047317 Bacteria 2370
1041 Ga0495674_0000102 3300047319 Bacteria 62602
1042 Ga0495674_0000559 3300047319 Bacteria 34585
1043 Ga0495674_0073584 3300047319 Bacteria 2945
1044 Ga0495674_0073683 3300047319 Bacteria 2942
1045 Ga0495674_0239130 3300047319 Bacteria 1497
1046 Ga0495672_0100931 3300047320 Bacteria 1565
1047 Ga0495676_0037239 3300047321 Bacteria 4051
1048 Ga0495680_0001061 3300047322 Bacteria 30436
1049 Ga0495680_0007181 3300047322 Bacteria 10259
1050 Ga0495680_0016879 3300047322 Bacteria 6253
1051 Ga0495680_0036826 3300047322 Bacteria 3923
1052 Ga0495687_004001 3300047443 Bacteria 10251
1053 Ga0495675_0000148 3300047444 Bacteria 49201
1054 Ga0495675_0010844 3300047444 Bacteria 5711
1055 Ga0495675_0024047 3300047444 Bacteria 3881
1056 Ga0495673_0000008 3300047469 Bacteria 752462
1057 Ga0495681_0000922 3300047470 Bacteria 22658
1058 Ga0495684_0000025 3300047471 Bacteria 127037
1059 Ga0495684_0001073 3300047471 Bacteria 22129
1060 Ga0495684_0005198 3300047471 Bacteria 10142
1061 Ga0495684_0051054 3300047471 Bacteria 3157
1062 Ga0495593_0000606 3300047673 Bacteria 20452
1063 Ga0495593_0000682 3300047673 Bacteria 19575
1064 Ga0495593_0000953 3300047673 Bacteria 16903
1065 Ga0495593_0002018 3300047673 Bacteria 12102
1066 Ga0495593_0022456 3300047673 Bacteria 3515
1067 Ga0495602_0000311 3300048088 Bacteria 44943
1068 Ga0495602_0002010 3300048088 Bacteria 20455
1069 Ga0495602_0117562 3300048088 Bacteria 2146
1070 Ga0495602_0165611 3300048088 Bacteria 1721
1071 Ga0495614_0011184 3300048089 Bacteria 3949
1072 Ga0495615_0017359 3300048090 Bacteria 1567
1073 Ga0496100_0001531 3300048903 Bacteria 11342
1074 Ga0496100_0009429 3300048903 Bacteria 5488
1075 Ga0496100_0047368 3300048903 Bacteria 2769
1076 Ga0496100_0072896 3300048903 Bacteria 2297
1077 Ga0496101_0002275 3300048904 Bacteria 11728
1078 Ga0496101_0005103 3300048904 Bacteria 8348
1079 Ga0496101_0015686 3300048904 Bacteria 5112
1080 Ga0496101_0023426 3300048904 Bacteria 4265
1081 Ga0496101_0035927 3300048904 Bacteria 3507
1082 Ga0496102_0002260 3300048905 Bacteria 16503
1083 Ga0496102_0004237 3300048905 Bacteria 12125
1084 Ga0496102_0009466 3300048905 Bacteria 8373
1085 Ga0496102_0072006 3300048905 Bacteria 3175
1086 Ga0496102_0097665 3300048905 Bacteria 2724
1087 Ga0496102_0167526 3300048905 Bacteria 2068
1088 Ga0496103_0004038 3300048906 Bacteria 8917
1089 Ga0496103_0021711 3300048906 Bacteria 3863
1090 Ga0496103_0027506 3300048906 Bacteria 3446
1091 Ga0496103_0032074 3300048906 Bacteria 3205
1092 Ga0496104_0002505 3300048907 Bacteria 15804
1093 Ga0496104_0003501 3300048907 Bacteria 13541
1094 Ga0496104_0005997 3300048907 Bacteria 10649
1095 Ga0496104_0009306 3300048907 Bacteria 8737
1096 Ga0496104_0013196 3300048907 Bacteria 7447
1097 Ga0496104_0054467 3300048907 Bacteria 3781
1098 Ga0496104_0115067 3300048907 Bacteria 2580
1099 Ga0496105_0019841 3300048908 Bacteria 5424
1100 Ga0496105_0025947 3300048908 Bacteria 4775
1101 Ga0496105_0102078 3300048908 Bacteria 2368
1102 Ga0496105_0128423 3300048908 Bacteria 2090
1103 Ga0496106_0000262 3300048909 Bacteria 36919
1104 Ga0496106_0015208 3300048909 Bacteria 5694
1105 Ga0496106_0046597 3300048909 Bacteria 3260
1106 Ga0496106_0075706 3300048909 Bacteria 2578
1107 Ga0496107_0001922 3300048910 Bacteria 13186
1108 Ga0496107_0005227 3300048910 Bacteria 8861
1109 Ga0496107_0063265 3300048910 Bacteria 2681
1110 Ga0496107_0074425 3300048910 Bacteria 2471
1111 Ga0496107_0088582 3300048910 Bacteria 2259
1112 Ga0496107_0089038 3300048910 Bacteria 2253
1113 Ga0496108_0000357 3300048911 Bacteria 38614
1114 Ga0496108_0018407 3300048911 Bacteria 5718
1115 Ga0496108_0029729 3300048911 Bacteria 4527
1116 Ga0496108_0032499 3300048911 Bacteria 4334
1117 Ga0496108_0057939 3300048911 Bacteria 3255
1118 Ga0496108_0059583 3300048911 Bacteria 3210
1119 Ga0496108_0067878 3300048911 Bacteria 3008
1120 Ga0496108_0097387 3300048911 Bacteria 2506
1121 Ga0496108_0098085 3300048911 Bacteria 2497
1122 Ga0496109_0002224 3300048912 Bacteria 16103
1123 Ga0496109_0002394 3300048912 Bacteria 15685
1124 Ga0496109_0008633 3300048912 Bacteria 8673
1125 Ga0496109_0035557 3300048912 Bacteria 4495
1126 Ga0496109_0048639 3300048912 Bacteria 3858
1127 Ga0496109_0055117 3300048912 Bacteria 3627
1128 Ga0496109_0060680 3300048912 Bacteria 3456
1129 Ga0496109_0083342 3300048912 Bacteria 2948
1130 Ga0496109_0262605 3300048912 Bacteria 1626
1131 Ga0496110_0000205 3300048913 Bacteria 37706
1132 Ga0496110_0003778 3300048913 Bacteria 11663
1133 Ga0496110_0003980 3300048913 Bacteria 11375
1134 Ga0496110_0005741 3300048913 Bacteria 9749
1135 Ga0496110_0032897 3300048913 Bacteria 4483
1136 Ga0496110_0039631 3300048913 Bacteria 4103
1137 Ga0496110_0052971 3300048913 Bacteria 3565
1138 Ga0496110_0073614 3300048913 Bacteria 3031
1139 Ga0496110_0075322 3300048913 Bacteria 2998
1140 Ga0496111_0000632 3300048914 Bacteria 18585
1141 Ga0496111_0009563 3300048914 Bacteria 6477
1142 Ga0496111_0035729 3300048914 Bacteria 3553
1143 Ga0496111_0040066 3300048914 Bacteria 3360
1144 Ga0496111_0078761 3300048914 Bacteria 2403
1145 Ga0496111_0103383 3300048914 Bacteria 2095
1146 Ga0496111_0140573 3300048914 Bacteria 1789
1147 Ga0496112_0000117 3300048915 Bacteria 49274
1148 Ga0496112_0006469 3300048915 Bacteria 10288
1149 Ga0496112_0014600 3300048915 Bacteria 7297
1150 Ga0496112_0034574 3300048915 Bacteria 4918
1151 Ga0496112_0067283 3300048915 Bacteria 3535
1152 Ga0496112_0094153 3300048915 Bacteria 2966
1153 Ga0496112_0095342 3300048915 Bacteria 2946
1154 Ga0496112_0096518 3300048915 Bacteria 2926
1155 Ga0496112_0168066 3300048915 Bacteria 2159
1156 Ga0496113_0012280 3300048916 Bacteria 5751
1157 Ga0496113_0074000 3300048916 Bacteria 2597
1158 Ga0496114_0003638 3300048917 Bacteria 11856
1159 Ga0496114_0070632 3300048917 Bacteria 2933
1160 Ga0496114_0097793 3300048917 Bacteria 2501
1161 Ga0496114_0127142 3300048917 Bacteria 2198
1162 Ga0496114_0127904 3300048917 Bacteria 2191
1163 Ga0496115_0002584 3300048918 Bacteria 12996
1164 Ga0496115_0007856 3300048918 Bacteria 7867
1165 Ga0496115_0013022 3300048918 Bacteria 6279
1166 Ga0496115_0027835 3300048918 Bacteria 4425
1167 Ga0496115_0031895 3300048918 Bacteria 4154
1168 Ga0496115_0040608 3300048918 Bacteria 3699
1169 Ga0496115_0042767 3300048918 Bacteria 3611
1170 Ga0496115_0106870 3300048918 Bacteria 2297
1171 Ga0496115_0146166 3300048918 Bacteria 1951
1172 Ga0496116_0003967 3300048919 Bacteria 14367
1173 Ga0496116_0006130 3300048919 Bacteria 10995
1174 Ga0496116_0049570 3300048919 Bacteria 2806
1175 Ga0496116_0058030 3300048919 Bacteria 2526
1176 Ga0496116_0061093 3300048919 Bacteria 2441
1177 Ga0496117_0013767 3300048920 Bacteria 7025
1178 Ga0496117_0052341 3300048920 Bacteria 2877
1179 Ga0496117_0110843 3300048920 Bacteria 1710
1180 Ga0496118_0001099 3300048921 Bacteria 42066
1181 Ga0496118_0013843 3300048921 Bacteria 7594
1182 Ga0496118_0056535 3300048921 Bacteria 2949
1183 Ga0496119_0016661 3300048922 Bacteria 5577
1184 Ga0496119_0033910 3300048922 Bacteria 3374
1185 Ga0496120_0020029 3300048923 Bacteria 4262
1186 Ga0496120_0104179 3300048923 Bacteria 1493
1187 Ga0496121_0000094 3300048924 Bacteria 212726
1188 Ga0496121_0001006 3300048924 Bacteria 50348
1189 Ga0496121_0003460 3300048924 Bacteria 22502
1190 Ga0496121_0033601 3300048924 Bacteria 4637
1191 Ga0496121_0034449 3300048924 Bacteria 4557
1192 Ga0496121_0158666 3300048924 Bacteria 1657
1193 Ga0496122_0000214 3300048925 Bacteria 129132
1194 Ga0496122_0000693 3300048925 Bacteria 67068
1195 Ga0496122_0049843 3300048925 Bacteria 3200
1196 Ga0496123_0000187 3300048926 Bacteria 125396
1197 Ga0496123_0000433 3300048926 Bacteria 75427
1198 Ga0496123_0070311 3300048926 Bacteria 2191
1199 Ga0496124_0000004 3300048927 Bacteria 976131
1200 Ga0496124_0024007 3300048927 Bacteria 5551
1201 Ga0496124_0069590 3300048927 Bacteria 2921
1202 Ga0496125_0000363 3300048928 Bacteria 85601
1203 Ga0496125_0028136 3300048928 Bacteria 5082
1204 Ga0496125_0030111 3300048928 Bacteria 4862
1205 Ga0496125_0074343 3300048928 Bacteria 2635
1206 Ga0496126_0018230 3300048929 Bacteria 6965
1207 Ga0496126_0026719 3300048929 Bacteria 5527
1208 Ga0496126_0118838 3300048929 Bacteria 2294
1209 Ga0496126_0143480 3300048929 Bacteria 2053
1210 Ga0496126_0172212 3300048929 Bacteria 1843
1211 Ga0495678_000012 3300049459 Bacteria 333905
1212 Ga0495678_018166 3300049459 Bacteria 3168
1213 Ga0501036_0138972 3300049572 Bacteria 2050
1214 Ga0501038_0075199 3300049574 Bacteria 2855
1215 Ga0501072_0004057 3300049588 Bacteria 11086
1216 Ga0501076_0111397 3300049592 Bacteria 2212
1217 Ga0501080_0090377 3300049742 Bacteria 2845
1218 nmdc:mga03683_30513_c1 3300050489 Bacteria 2157
1219 nmdc:mga03n38_1633_c1 3300050490 Bacteria 6559
1220 nmdc:mga03n38_39900_c1 3300050490 Bacteria 2038
1221 nmdc:mga00v17_30628_c1 3300050491 Bacteria 3166
1222 nmdc:mga00v17_64616_c1 3300050491 Bacteria 2255
1223 nmdc:mga00v17_6544_c1 3300050491 Bacteria 6184
1224 nmdc:mga0yw44_12756_c1 3300050492 Bacteria 4394
1225 nmdc:mga0yw44_23299_c1 3300050492 Bacteria 3486
1226 nmdc:mga0yw44_5661_c1 3300050492 Bacteria 5946
1227 nmdc:mga0yw44_59421_c1 3300050492 Bacteria 2339
1228 nmdc:mga0yw44_95507_c1 3300050492 Bacteria 1886
1229 nmdc:mga0k408_1761_c1 3300050493 Bacteria 11603
1230 nmdc:mga0k408_48540_c1 3300050493 Bacteria 2456
1231 nmdc:mga06z11_110024_c1 3300050494 Bacteria 1524
1232 nmdc:mga06z11_45409_c1 3300050494 Bacteria 2221
1233 nmdc:mga06z11_68184_c1 3300050494 Bacteria 1875
1234 nmdc:mga06z11_72698_c1 3300050494 Bacteria 1824
1235 nmdc:mga06z11_8463_c1 3300050494 Bacteria 4291
1236 nmdc:mga07m45_13314_c1 3300050496 Bacteria 4362
1237 nmdc:mga07m45_61814_c1 3300050496 Bacteria 2122
1238 nmdc:mga07m45_9639_c1 3300050496 Bacteria 5019
1239 nmdc:mga05p37_1118_c3 3300050507 Bacteria 2050
1240 nmdc:mga05p37_13202_c1 3300050507 Bacteria 9887
1241 nmdc:mga05p37_151_c1 3300050507 Bacteria 65585
1242 nmdc:mga05p37_225993_c1 3300050507 Bacteria 2257
1243 nmdc:mga05p37_69744_c1 3300050507 Bacteria 4324
1244 nmdc:mga05p37_80496_c1 3300050507 Bacteria 4012
1245 nmdc:mga05p37_9089_c1 3300050507 Bacteria 11745
1246 nmdc:mga09592_11500_c1 3300050508 Bacteria 6607
1247 nmdc:mga09592_1771_c1 3300050508 Bacteria 17345
1248 nmdc:mga09592_7025_c1 3300050508 Bacteria 9151
1249 nmdc:mga0qj67_205141_c1 3300050509 Bacteria 1601
1250 nmdc:mga0qj67_3588_c1 3300050509 Bacteria 11199
1251 nmdc:mga0qj67_56258_c1 3300050509 Bacteria 3118
1252 nmdc:mga0qj67_933_c1 3300050509 Bacteria 20130
1253 nmdc:mga06r32_134364_c1 3300050510 Bacteria 2448
1254 nmdc:mga06r32_134961_c1 3300050510 Bacteria 2442
1255 nmdc:mga06r32_16885_c1 3300050510 Bacteria 6659
1256 nmdc:mga06r32_201_c1 3300050510 Bacteria 26944
1257 nmdc:mga08y16_108_c1 3300050511 Bacteria 69804
1258 nmdc:mga08y16_17978_c1 3300050511 Bacteria 7448
1259 nmdc:mga08y16_193529_c1 3300050511 Bacteria 2109
1260 nmdc:mga08y16_62145_c1 3300050511 Bacteria 3900
1261 nmdc:mga08y16_86448_c1 3300050511 Bacteria 3268
1262 nmdc:mga0n895_151330_c1 3300050512 Bacteria 2351
1263 nmdc:mga0n895_244857_c1 3300050512 Bacteria 1820
1264 nmdc:mga0n895_265_c1 3300050512 Bacteria 34107
1265 nmdc:mga0n895_404_c1 3300050512 Bacteria 29050
1266 nmdc:mga0n895_4878_c1 3300050512 Bacteria 11111
1267 nmdc:mga0n895_61632_c1 3300050512 Bacteria 3704
1268 nmdc:mga0n895_64657_c1 3300050512 Bacteria 3619
1269 nmdc:mga0n895_78921_c1 3300050512 Bacteria 3277
1270 nmdc:mga0rr50_10550_c1 3300050513 Bacteria 5869
1271 nmdc:mga0rr50_173038_c1 3300050513 Bacteria 1761
1272 nmdc:mga0rr50_65104_c1 3300050513 Bacteria 2760
1273 nmdc:mga0rr50_97526_c1 3300050513 Bacteria 2302
1274 nmdc:mga0a205_105418_c1 3300050515 Bacteria 2718
1275 nmdc:mga0a205_114960_c1 3300050515 Bacteria 2589
1276 nmdc:mga0a205_146_c1 3300050515 Bacteria 45616
1277 nmdc:mga0a205_1877_c1 3300050515 Bacteria 18205
1278 nmdc:mga0a205_30042_c1 3300050515 Bacteria 5201
1279 nmdc:mga0a205_63974_c1 3300050515 Bacteria 3553
1280 nmdc:mga0a205_78738_c1 3300050515 Bacteria 3184
1281 nmdc:mga0sz30_155_c2 3300050516 Bacteria 13523
1282 Ga0495601_0000025 3300053077 Bacteria 127736
1283 Ga0495601_0002768 3300053077 Bacteria 9957
1284 Ga0495601_0002986 3300053077 Bacteria 9633
1285 Ga0495601_0014260 3300053077 Bacteria 4788
1286 Ga0495601_0029067 3300053077 Bacteria 3426
1287 Ga0495601_0056086 3300053077 Bacteria 2495
1288 Ga0495612_0000046 3300053078 Bacteria 59912
1289 Ga0495612_0006837 3300053078 Bacteria 4670
1290 Ga0495612_0018845 3300053078 Bacteria 2763
1291 Ga0495612_0033529 3300053078 Bacteria 2078
1292 Ga0500610_0056426 3300053079 Bacteria 2050
1293 Ga0495595_0000054 3300053084 Bacteria 59828
1294 Ga0495595_0000696 3300053084 Bacteria 12842
1295 Ga0495595_0002171 3300053084 Bacteria 7628
1296 Ga0495595_0008608 3300053084 Bacteria 4196
1297 Ga0495619_0000035 3300053085 Bacteria 126262
1298 Ga0495619_0000048 3300053085 Bacteria 102117
1299 Ga0495619_0000966 3300053085 Bacteria 18840
1300 Ga0495619_0001255 3300053085 Bacteria 16631
1301 Ga0495619_0004720 3300053085 Bacteria 8676
1302 Ga0495619_0006396 3300053085 Bacteria 7464
1303 Ga0495619_0033264 3300053085 Bacteria 3348
1304 Ga0495619_0047709 3300053085 Bacteria 2821
1305 Ga0500643_000019 3300053087 Bacteria 294301
1306 Ga0500643_001637 3300053087 Bacteria 12517
1307 Ga0500644_0000670 3300053088 Bacteria 12478
1308 Ga0500646_0001743 3300053090 Bacteria 5718
1309 Ga0500583_0008143 3300053092 Bacteria 3741
1310 Ga0500651_0019640 3300053093 Bacteria 4201
1311 Ga0500651_0099808 3300053093 Bacteria 1780
1312 Ga0500566_0001280 3300053094 Bacteria 14651
1313 Ga0500566_0024756 3300053094 Bacteria 3521
1314 Ga0500640_048834 3300053095 Bacteria 1854
1315 Ga0500641_0007284 3300053096 Bacteria 3943
1316 Ga0500554_002430 3300053102 Bacteria 3664
1317 Ga0500555_004780 3300053103 Bacteria 3844
1318 Ga0500557_000039 3300053105 Bacteria 66862
1319 Ga0500569_007080 3300053109 Bacteria 2499
1320 Ga0500572_000559 3300053111 Bacteria 12701
1321 Ga0500572_001849 3300053111 Bacteria 5366
1322 Ga0500592_006852 3300053116 Bacteria 1814
1323 Ga0500595_000003 3300053119 Bacteria 419332
1324 Ga0500595_023204 3300053119 Bacteria 2184
1325 Ga0500614_001873 3300053123 Bacteria 4850
1326 Ga0500618_000286 3300053125 Bacteria 38499
1327 Ga0500618_001413 3300053125 Bacteria 10762
1328 Ga0500642_0000285 3300053130 Bacteria 18457
1329 Ga0500642_0023818 3300053130 Bacteria 2464
1330 Ga0500642_0028020 3300053130 Bacteria 2319
1331 Ga0500642_0032814 3300053130 Bacteria 2182
1332 Ga0500642_0066964 3300053130 Bacteria 1626
1333 Ga0500658_0016238 3300053134 Bacteria 2772
1334 Ga0500559_0008368 3300053136 Bacteria 4538
1335 Ga0500559_0020926 3300053136 Bacteria 2768
1336 Ga0500559_0044275 3300053136 Bacteria 1946
1337 Ga0500568_0004264 3300053139 Bacteria 7684
1338 Ga0500573_0040300 3300053140 Bacteria 2697
1339 Ga0500603_000423 3300053150 Bacteria 10988
1340 Ga0500603_002454 3300053150 Bacteria 4058
1341 Ga0500604_0006398 3300053151 Bacteria 3114
1342 Ga0500616_0000002 3300053153 Bacteria 1611257
1343 Ga0500616_0003426 3300053153 Bacteria 12139
1344 Ga0500616_0047643 3300053153 Bacteria 2275
1345 Ga0500616_0068270 3300053153 Bacteria 1821
1346 Ga0500630_001193 3300053159 Bacteria 12207
1347 Ga0500639_000025 3300053163 Bacteria 84839
1348 Ga0500636_0000313 3300053177 Bacteria 26675
1349 Ga0500636_0029794 3300053177 Bacteria 3225
1350 Ga0500636_0030709 3300053177 Bacteria 3180
1351 Ga0500637_0000655 3300053178 Bacteria 13752
1352 Ga0500637_0008929 3300053178 Bacteria 5078
1353 Ga0500625_007580 3300053729 Bacteria 4729
1354 Ga0500645_000078 3300053730 Bacteria 76931
1355 Ga0500596_001197 3300053735 Bacteria 5242
1356 Ga0500596_004849 3300053735 Bacteria 2428
1357 Ga0500596_007040 3300053735 Bacteria 1860
1358 Ga0500599_002587 3300053736 Bacteria 2174
1359 Ga0500601_000643 3300053737 Bacteria 4818
1360 Ga0501084_0142571 3300054114 Bacteria 2018
1361 Ga0501084_0167955 3300054114 Bacteria 1852
1362 Ga0466962_0066665 3300061719 Bacteria 1719

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0000094 Ga0496121_0000094_200311_201657 383
2 3300048919 Ga0496116_0049570 Ga0496116_0049570_1377_2723 384
3 3300048922 Ga0496119_0016661 Ga0496119_0016661_1366_2712 384
4 3300048926 Ga0496123_0070311 Ga0496123_0070311_666_2012 384
5 3300048928 Ga0496125_0000363 Ga0496125_0000363_3349_4695 384
6 3300048925 Ga0496122_0000214 Ga0496122_0000214_107887_109257 385
7 3300048926 Ga0496123_0000187 Ga0496123_0000187_121755_123125 385
8 3300048928 Ga0496125_0028136 Ga0496125_0028136_360_1730 385
9 3300048919 Ga0496116_0006130 Ga0496116_0006130_657_2015 386
10 3300048929 Ga0496126_0118838 Ga0496126_0118838_350_1708 386
11 3300003203 JGI25406J46586_10001211 JGI25406J46586_100012111 397
12 3300005985 Ga0081539_10001010 Ga0081539_100010101 397
13 3300005445 Ga0070708_100005534 Ga0070708_1000055348 401
14 3300048929 Ga0496126_0143480 Ga0496126_0143480_482_1828 401
15 3300007076 Ga0075435_100056294 Ga0075435_1000562943 402
16 3300009147 Ga0114129_10178412 Ga0114129_101784121 402
17 3300048920 Ga0496117_0052341 Ga0496117_0052341_1399_2790 402
18 3300048923 Ga0496120_0020029 Ga0496120_0020029_949_2295 402
19 3300048927 Ga0496124_0069590 Ga0496124_0069590_972_2318 402
20 3300048928 Ga0496125_0030111 Ga0496125_0030111_2748_4178 402
21 3300005518 Ga0070699_100198807 Ga0070699_1001988071 406
22 3300006173 Ga0070716_100059932 Ga0070716_1000599322 406
23 3300050515 nmdc:mga0a205_105418_c1 nmdc:mga0a205_105418_c1_515_1810 406
24 3300037853 Ga0436364_0009978 Ga0436364_0009978_102_1553 407
25 3300006880 Ga0075429_100020211 Ga0075429_1000202114 411
26 3300009147 Ga0114129_10003194 Ga0114129_1000319418 411
27 3300050507 nmdc:mga05p37_1118_c3 nmdc:mga05p37_1118_c3_414_1718 411
28 3300050508 nmdc:mga09592_7025_c1 nmdc:mga09592_7025_c1_4595_5899 411
29 3300050510 nmdc:mga06r32_134364_c1 nmdc:mga06r32_134364_c1_1057_2361 411
30 3300005985 Ga0081539_10004951 Ga0081539_100049512 412
31 3300009147 Ga0114129_10002163 Ga0114129_1000216316 412
32 3300053125 Ga0500618_000286 Ga0500618_000286_28406_29803 413
33 3300031911 Ga0307412_10000335 Ga0307412_100003352 414
34 3300039447 Ga0436361_0536912 Ga0436361_0536912_35_1471 414
35 3300049742 Ga0501080_0090377 Ga0501080_0090377_841_2193 414
36 3300050510 nmdc:mga06r32_16885_c1 nmdc:mga06r32_16885_c1_2735_4123 418
37 3300025292 Ga0209676_1002143 Ga0209676_10021434 419
38 3300025298 Ga0209050_1000925 Ga0209050_10009256 419
39 3300050489 nmdc:mga03683_30513_c1 nmdc:mga03683_30513_c1_174_1490 419
40 3300048915 Ga0496112_0168066 Ga0496112_0168066_130_1542 420
41 3300010159 Ga0099796_10006609 Ga0099796_100066093 422
42 3300046512 Ga0495610_0011330 Ga0495610_0011330_2063_3442 422
43 3300047469 Ga0495673_0000008 Ga0495673_0000008_504651_506030 422
44 iso_pu_bacteria 2929199973 2929202432 422
45 iso_pu_bacteria 8055909800 8055915834 422
46 3300035171 Ga0373946_0057985 Ga0373946_0057985_90_1439 423
47 3300005468 Ga0070707_100003645 Ga0070707_10000364511 425
48 3300025922 Ga0207646_10007486 Ga0207646_100074862 425
49 3300027512 Ga0209179_1005548 Ga0209179_10055482 425
50 3300035725 Ga0373947_0075867 Ga0373947_0075867_64_1386 425
51 3300044712 Ga0453684_0017221 Ga0453684_0017221_1945_3279 425
52 3300005563 Ga0068855_100167406 Ga0068855_1001674062 426
53 3300006042 Ga0075368_10028649 Ga0075368_100286492 426
54 3300006177 Ga0075362_10009545 Ga0075362_100095454 426
55 3300006186 Ga0075369_10011401 Ga0075369_100114013 426
56 3300046454 Ga0495592_0022208 Ga0495592_0022208_591_2126 426
57 3300046511 Ga0495608_0061824 Ga0495608_0061824_187_1722 426
58 3300046533 Ga0495640_0075383 Ga0495640_0075383_10_1545 426
59 3300046559 Ga0495667_0059628 Ga0495667_0059628_232_1767 426
60 3300047317 Ga0495604_0005625 Ga0495604_0005625_4709_6244 426
61 3300047673 Ga0495593_0022456 Ga0495593_0022456_1892_3427 426
62 3300050492 nmdc:mga0yw44_12756_c1 nmdc:mga0yw44_12756_c1_2617_3987 426
63 3300053077 Ga0495601_0002768 Ga0495601_0002768_8369_9904 426
64 3300053078 Ga0495612_0033529 Ga0495612_0033529_294_1829 426
65 3300053084 Ga0495595_0002171 Ga0495595_0002171_4352_5887 426
66 3300053085 Ga0495619_0000048 Ga0495619_0000048_67781_69316 426
67 3300002705 JGI25156J39149_1000150 JGI25156J39149_100015026 427
68 3300002738 JGI25154J39366_1000165 JGI25154J39366_100016526 427
69 3300002741 JGI25157J39369_1000383 JGI25157J39369_10003839 427
70 3300003758 Ga0055532_1000097 Ga0055532_100009763 427
71 3300003761 Ga0055535_1003562 Ga0055535_10035621 427
72 3300005545 Ga0070695_100156811 Ga0070695_1001568111 427
73 3300025206 Ga0209435_100040 Ga0209435_10004021 427
74 3300025229 Ga0209147_100141 Ga0209147_10014178 427
75 3300025242 Ga0209258_100657 Ga0209258_10065718 427
76 3300025246 Ga0209646_1000253 Ga0209646_100025321 427
77 3300025250 Ga0209026_1000306 Ga0209026_100030628 427
78 3300025256 Ga0209759_1000398 Ga0209759_100039828 427
79 3300025302 Ga0207426_1006921 Ga0207426_10069213 428
80 iso_pu_bacteria 2941479691 2941484555 428
81 3300003792 Ga0055540_1002994 Ga0055540_10029946 429
82 3300003794 Ga0055531_10000152 Ga0055531_1000015277 429
83 3300025273 Ga0209673_1014952 Ga0209673_10149521 429
84 3300025303 Ga0209051_1000059 Ga0209051_1000059171 429
85 3300025304 Ga0209257_1000022 Ga0209257_1000022229 429
86 3300042876 Ga0451577_0039655 Ga0451577_0039655_2158_3501 429
87 3300044712 Ga0453684_0005314 Ga0453684_0005314_15947_17290 429
88 iso_pu_bacteria 2857542790 2857547413 429
89 iso_pu_bacteria 2928115317 2928115935 429
90 3300005331 Ga0070670_100113853 Ga0070670_1001138532 430
91 3300025291 Ga0209675_1003720 Ga0209675_10037206 430
92 3300044712 Ga0453684_0045710 Ga0453684_0045710_2717_4063 430
93 3300046519 Ga0495632_0005127 Ga0495632_0005127_6640_7986 430
94 3300053153 Ga0500616_0003426 Ga0500616_0003426_9804_11177 430
95 iso_pu_bacteria 2821131069 2821134904 430
96 iso_pu_bacteria 2894772417 2894775121 430
97 3300005329 Ga0070683_100075511 Ga0070683_1000755112 431
98 3300005937 Ga0081455_10000768 Ga0081455_1000076825 431
99 3300005983 Ga0081540_1000303 Ga0081540_100030313 431
100 3300009551 Ga0105238_10018690 Ga0105238_100186903 431
101 3300025924 Ga0207694_10014930 Ga0207694_100149306 431
102 3300025944 Ga0207661_10048530 Ga0207661_100485302 431
103 3300028577 Ga0265318_10002015 Ga0265318_1000201510 431
104 3300031235 Ga0265330_10020506 Ga0265330_100205062 431
105 3300031238 Ga0265332_10028029 Ga0265332_100280292 431
106 3300031240 Ga0265320_10009181 Ga0265320_100091812 431
107 3300031241 Ga0265325_10012239 Ga0265325_100122392 431
108 3300031242 Ga0265329_10008771 Ga0265329_100087712 431
109 3300031344 Ga0265316_10071014 Ga0265316_100710142 431
110 3300031711 Ga0265314_10026005 Ga0265314_100260052 431
111 3300031712 Ga0265342_10021271 Ga0265342_100212712 431
112 3300038443 Ga0395901_0051193 Ga0395901_0051193_69_1448 431
113 3300048924 Ga0496121_0158666 Ga0496121_0158666_298_1638 431
114 iso_pu_bacteria 2828305725 2828308236 431
115 3300003203 JGI25406J46586_10003889 JGI25406J46586_100038891 432
116 3300005985 Ga0081539_10002027 Ga0081539_1000202732 432
117 3300006051 Ga0075364_10001029 Ga0075364_1000102912 432
118 3300039437 Ga0436365_0355346 Ga0436365_0355346_2734_4116 432
119 3300044712 Ga0453684_0090641 Ga0453684_0090641_239_1594 432
120 3300050491 nmdc:mga00v17_6544_c1 nmdc:mga00v17_6544_c1_2639_3988 432
121 iso_pu_bacteria 2595698237 2596372893 432
122 iso_pu_bacteria 2599185292 2599907641 432
123 iso_pu_bacteria 2643221569 2643860940 432
124 iso_pu_bacteria 2643221594 2643981187 432
125 iso_pu_bacteria 2643221621 2644124239 432
126 iso_pu_bacteria 2808606395 2809035036 432
127 iso_pu_bacteria 2842694124 2842697014 432
128 iso_pu_bacteria 2857537821 2857540373 432
129 iso_pu_bacteria 2857553236 2857558180 432
130 iso_pu_bacteria 2857558681 2857558841 432
131 iso_pu_bacteria 2928125067 2928125748 432
132 iso_pu_bacteria 8055225921 8055228327 432
133 3300005843 Ga0068860_100002390 Ga0068860_1000023904 433
134 3300028381 Ga0268264_10000035 Ga0268264_1000003526 433
135 3300028794 Ga0307515_10008473 Ga0307515_100084733 433
136 3300044712 Ga0453684_0000063 Ga0453684_0000063_242620_243975 433
137 3300048927 Ga0496124_0000004 Ga0496124_0000004_903125_904477 433
138 iso_pu_bacteria 2513237087 2513592131 433
139 iso_pu_bacteria 2522572158 2523102995 433
140 3300007265 Ga0099794_10009565 Ga0099794_100095652 434
141 3300009093 Ga0105240_10015980 Ga0105240_100159807 434
142 3300025913 Ga0207695_10017000 Ga0207695_100170003 434
143 3300027671 Ga0209588_1017593 Ga0209588_10175932 434
144 3300031344 Ga0265316_10122993 Ga0265316_101229931 434
145 3300044712 Ga0453684_0000063 Ga0453684_0000063_241218_242579 434
146 3300046660 Ga0495625_0054122 Ga0495625_0054122_907_2280 434
147 3300048924 Ga0496121_0033601 Ga0496121_0033601_772_2196 434
148 3300050491 nmdc:mga00v17_64616_c1 nmdc:mga00v17_64616_c1_637_1992 434
149 iso_pu_bacteria 2738541281 2738744126 434
150 iso_pu_bacteria 2738543032 2739353356 434
151 iso_pu_bacteria 2829745981 2829747715 434
152 iso_pu_bacteria 2842698319 2842699593 434
153 iso_pu_bacteria 2861691609 2861694133 434
154 iso_pu_bacteria 2917699015 2917705402 434
155 iso_pu_bacteria 8054002106 8054005745 434
156 3300002704 JGI25155J39150_1000538 JGI25155J39150_10005388 435
157 3300002738 JGI25154J39366_1000210 JGI25154J39366_100021025 435
158 3300005548 Ga0070665_100224776 Ga0070665_1002247761 435
159 3300006163 Ga0070715_10010703 Ga0070715_100107032 435
160 3300017792 Ga0163161_10019750 Ga0163161_100197503 435
161 3300025246 Ga0209646_1000204 Ga0209646_100020437 435
162 3300025256 Ga0209759_1000298 Ga0209759_100029837 435
163 3300025905 Ga0207685_10005926 Ga0207685_100059262 435
164 3300035086 Ga0373934_0009191 Ga0373934_0009191_1842_3227 435
165 3300037471 Ga0395905_0203419 Ga0395905_0203419_447_1823 435
166 3300046511 Ga0495608_0005335 Ga0495608_0005335_2078_3463 435
167 3300046680 Ga0495646_0031676 Ga0495646_0031676_1401_2786 435
168 3300047444 Ga0495675_0010844 Ga0495675_0010844_2564_3949 435
169 3300048918 Ga0496115_0007856 Ga0496115_0007856_2019_3467 435
170 3300050516 nmdc:mga0sz30_155_c2 nmdc:mga0sz30_155_c2_9554_10912 435
171 iso_pu_bacteria 2545555834 2545674442 435
172 iso_pu_bacteria 2738543013 2739250194 435
173 iso_pu_bacteria 3003665799 3003669389 435
174 iso_pu_bacteria 641522639 641644955 435
175 3300003215 JGI25153J46596_10014889 JGI25153J46596_100148892 436
176 3300005458 Ga0070681_10006215 Ga0070681_100062152 436
177 3300005544 Ga0070686_100153092 Ga0070686_1001530921 436
178 3300005981 Ga0081538_10000527 Ga0081538_1000052728 436
179 3300005985 Ga0081539_10039464 Ga0081539_100394641 436
180 3300006844 Ga0075428_100291397 Ga0075428_1002913972 436
181 3300006852 Ga0075433_10001540 Ga0075433_1000154011 436
182 3300006871 Ga0075434_100004709 Ga0075434_1000047092 436
183 3300006871 Ga0075434_100115829 Ga0075434_1001158292 436
184 3300007076 Ga0075435_100120272 Ga0075435_1001202722 436
185 3300007076 Ga0075435_100163692 Ga0075435_1001636922 436
186 3300009094 Ga0111539_10025207 Ga0111539_100252074 436
187 3300035121 Ga0373960_0016590 Ga0373960_0016590_269_1627 436
188 3300035695 Ga0373927_0132370 Ga0373927_0132370_47_1405 436
189 3300046507 Ga0495606_0002687 Ga0495606_0002687_16425_17810 436
190 3300046538 Ga0495609_0000650 Ga0495609_0000650_7556_8938 436
191 3300046810 Ga0495660_0024370 Ga0495660_0024370_1824_3206 436
192 3300047470 Ga0495681_0000922 Ga0495681_0000922_15775_17157 436
193 3300048911 Ga0496108_0067878 Ga0496108_0067878_718_2076 436
194 3300048914 Ga0496111_0140573 Ga0496111_0140573_349_1707 436
195 3300048915 Ga0496112_0000117 Ga0496112_0000117_37852_39303 436
196 3300048917 Ga0496114_0097793 Ga0496114_0097793_400_1755 436
197 3300048919 Ga0496116_0061093 Ga0496116_0061093_998_2380 436
198 3300048927 Ga0496124_0024007 Ga0496124_0024007_4009_5388 436
199 3300049459 Ga0495678_000012 Ga0495678_000012_332384_333766 436
200 3300050512 nmdc:mga0n895_4878_c1 nmdc:mga0n895_4878_c1_2391_3749 436
201 3300050513 nmdc:mga0rr50_97526_c1 nmdc:mga0rr50_97526_c1_345_1703 436
202 3300050515 nmdc:mga0a205_1877_c1 nmdc:mga0a205_1877_c1_9588_10946 436
203 3300001976 JGI24752J21851_1003222 JGI24752J21851_10032222 437
204 3300005290 Ga0065712_10084632 Ga0065712_100846322 437
205 3300005329 Ga0070683_100018296 Ga0070683_1000182962 437
206 3300005331 Ga0070670_100000081 Ga0070670_10000008113 437
207 3300005331 Ga0070670_100016676 Ga0070670_1000166764 437
208 3300005333 Ga0070677_10027474 Ga0070677_100274741 437
209 3300005338 Ga0068868_100060713 Ga0068868_1000607132 437
210 3300005344 Ga0070661_100100792 Ga0070661_1001007922 437
211 3300005354 Ga0070675_100005492 Ga0070675_1000054928 437
212 3300005355 Ga0070671_100011767 Ga0070671_1000117672 437
213 3300005356 Ga0070674_100021106 Ga0070674_1000211063 437
214 3300005366 Ga0070659_100146899 Ga0070659_1001468991 437
215 3300005367 Ga0070667_100001429 Ga0070667_10000142915 437
216 3300005439 Ga0070711_100185497 Ga0070711_1001854971 437
217 3300005441 Ga0070700_100038270 Ga0070700_1000382701 437
218 3300005444 Ga0070694_100114741 Ga0070694_1001147411 437
219 3300005445 Ga0070708_100137961 Ga0070708_1001379612 437
220 3300005456 Ga0070678_100033200 Ga0070678_1000332002 437
221 3300005459 Ga0068867_100073968 Ga0068867_1000739682 437
222 3300005468 Ga0070707_100059338 Ga0070707_1000593381 437
223 3300005471 Ga0070698_100002784 Ga0070698_10000278413 437
224 3300005518 Ga0070699_100010274 Ga0070699_1000102743 437
225 3300005535 Ga0070684_100090112 Ga0070684_1000901121 437
226 3300005536 Ga0070697_100111263 Ga0070697_1001112632 437
227 3300005543 Ga0070672_100037636 Ga0070672_1000376362 437
228 3300005548 Ga0070665_100332681 Ga0070665_1003326811 437
229 3300005578 Ga0068854_100066660 Ga0068854_1000666603 437
230 3300005616 Ga0068852_100020468 Ga0068852_1000204685 437
231 3300005617 Ga0068859_100153704 Ga0068859_1001537041 437
232 3300005618 Ga0068864_100000016 Ga0068864_10000001614 437
233 3300005618 Ga0068864_100030383 Ga0068864_1000303833 437
234 3300005618 Ga0068864_100033236 Ga0068864_1000332362 437
235 3300005618 Ga0068864_100084285 Ga0068864_1000842851 437
236 3300005719 Ga0068861_100161561 Ga0068861_1001615611 437
237 3300005834 Ga0068851_10077990 Ga0068851_100779902 437
238 3300005840 Ga0068870_10006935 Ga0068870_100069353 437
239 3300005841 Ga0068863_100001887 Ga0068863_10000188710 437
240 3300005841 Ga0068863_100218130 Ga0068863_1002181302 437
241 3300005842 Ga0068858_100167279 Ga0068858_1001672791 437
242 3300005844 Ga0068862_100000068 Ga0068862_10000006814 437
243 3300005983 Ga0081540_1000459 Ga0081540_100045929 437
244 3300006177 Ga0075362_10022812 Ga0075362_100228122 437
245 3300006178 Ga0075367_10038273 Ga0075367_100382732 437
246 3300006844 Ga0075428_100009742 Ga0075428_1000097423 437
247 3300006846 Ga0075430_100213323 Ga0075430_1002133231 437
248 3300006847 Ga0075431_100001293 Ga0075431_10000129310 437
249 3300006847 Ga0075431_100083102 Ga0075431_1000831022 437
250 3300006852 Ga0075433_10068973 Ga0075433_100689733 437
251 3300006931 Ga0097620_100153701 Ga0097620_1001537011 437
252 3300009011 Ga0105251_10002065 Ga0105251_100020654 437
253 3300009094 Ga0111539_10033030 Ga0111539_100330303 437
254 3300009098 Ga0105245_10189971 Ga0105245_101899712 437
255 3300009101 Ga0105247_10037800 Ga0105247_100378002 437
256 3300009147 Ga0114129_10233588 Ga0114129_102335882 437
257 3300009174 Ga0105241_10056744 Ga0105241_100567442 437
258 3300009177 Ga0105248_10095407 Ga0105248_100954073 437
259 3300009177 Ga0105248_10122502 Ga0105248_101225022 437
260 3300011119 Ga0105246_10034450 Ga0105246_100344503 437
261 3300013105 Ga0157369_10249398 Ga0157369_102493982 437
262 3300013296 Ga0157374_10003804 Ga0157374_100038047 437
263 3300013297 Ga0157378_10013539 Ga0157378_100135393 437
264 3300013297 Ga0157378_10079320 Ga0157378_100793203 437
265 3300014325 Ga0163163_10080858 Ga0163163_100808581 437
266 3300014325 Ga0163163_10099722 Ga0163163_100997222 437
267 3300014745 Ga0157377_10052389 Ga0157377_100523892 437
268 3300025315 Ga0207697_10029005 Ga0207697_100290051 437
269 3300025321 Ga0207656_10018123 Ga0207656_100181232 437
270 3300025735 Ga0207713_1002261 Ga0207713_10022612 437
271 3300025900 Ga0207710_10017532 Ga0207710_100175322 437
272 3300025900 Ga0207710_10018129 Ga0207710_100181292 437
273 3300025901 Ga0207688_10010399 Ga0207688_100103992 437
274 3300025901 Ga0207688_10061197 Ga0207688_100611971 437
275 3300025911 Ga0207654_10030110 Ga0207654_100301102 437
276 3300025917 Ga0207660_10180090 Ga0207660_101800901 437
277 3300025920 Ga0207649_10071124 Ga0207649_100711241 437
278 3300025923 Ga0207681_10040181 Ga0207681_100401813 437
279 3300025925 Ga0207650_10000288 Ga0207650_1000028847 437
280 3300025925 Ga0207650_10001712 Ga0207650_1000171212 437
281 3300025926 Ga0207659_10016654 Ga0207659_100166543 437
282 3300025927 Ga0207687_10124106 Ga0207687_101241062 437
283 3300025931 Ga0207644_10041902 Ga0207644_100419023 437
284 3300025933 Ga0207706_10014998 Ga0207706_100149984 437
285 3300025935 Ga0207709_10145261 Ga0207709_101452611 437
286 3300025937 Ga0207669_10159702 Ga0207669_101597021 437
287 3300025942 Ga0207689_10065521 Ga0207689_100655213 437
288 3300025944 Ga0207661_10060818 Ga0207661_100608182 437
289 3300025960 Ga0207651_10001703 Ga0207651_100017038 437
290 3300025981 Ga0207640_10061301 Ga0207640_100613012 437
291 3300025986 Ga0207658_10000466 Ga0207658_1000046628 437
292 3300026023 Ga0207677_10001053 Ga0207677_1000105315 437
293 3300026035 Ga0207703_10279628 Ga0207703_102796281 437
294 3300026075 Ga0207708_10002881 Ga0207708_1000288111 437
295 3300026088 Ga0207641_10000103 Ga0207641_1000010313 437
296 3300026088 Ga0207641_10079739 Ga0207641_100797392 437
297 3300026089 Ga0207648_10009796 Ga0207648_100097966 437
298 3300026089 Ga0207648_10108021 Ga0207648_101080212 437
299 3300026095 Ga0207676_10000044 Ga0207676_1000004413 437
300 3300026095 Ga0207676_10073921 Ga0207676_100739212 437
301 3300026116 Ga0207674_10047126 Ga0207674_100471264 437
302 3300026118 Ga0207675_100042588 Ga0207675_1000425882 437
303 3300026121 Ga0207683_10030958 Ga0207683_100309583 437
304 3300026142 Ga0207698_10000603 Ga0207698_1000060312 437
305 3300027907 Ga0207428_10030850 Ga0207428_100308504 437
306 3300028380 Ga0268265_10000142 Ga0268265_1000014213 437
307 3300028380 Ga0268265_10067166 Ga0268265_100671663 437
308 3300028573 Ga0265334_10026011 Ga0265334_100260112 437
309 3300046460 Ga0495638_0011979 Ga0495638_0011979_3409_4770 437
310 3300046501 Ga0495607_0022482 Ga0495607_0022482_1611_3008 437
311 3300046615 Ga0495656_0030882 Ga0495656_0030882_136_1533 437
312 3300048903 Ga0496100_0047368 Ga0496100_0047368_1348_2745 437
313 3300048904 Ga0496101_0035927 Ga0496101_0035927_1963_3336 437
314 3300048906 Ga0496103_0004038 Ga0496103_0004038_1729_3090 437
315 3300048907 Ga0496104_0005997 Ga0496104_0005997_6179_7540 437
316 3300048910 Ga0496107_0074425 Ga0496107_0074425_86_1447 437
317 3300048910 Ga0496107_0089038 Ga0496107_0089038_24_1421 437
318 3300048912 Ga0496109_0055117 Ga0496109_0055117_122_1483 437
319 3300048913 Ga0496110_0032897 Ga0496110_0032897_2770_4143 437
320 3300048915 Ga0496112_0094153 Ga0496112_0094153_1538_2899 437
321 3300048917 Ga0496114_0070632 Ga0496114_0070632_1363_2760 437
322 3300048918 Ga0496115_0040608 Ga0496115_0040608_1628_2989 437
323 3300048920 Ga0496117_0013767 Ga0496117_0013767_3777_5138 437
324 3300048921 Ga0496118_0001099 Ga0496118_0001099_9556_10917 437
325 3300050491 nmdc:mga00v17_30628_c1 nmdc:mga00v17_30628_c1_1792_3153 437
326 3300050493 nmdc:mga0k408_1761_c1 nmdc:mga0k408_1761_c1_9465_10841 437
327 3300050494 nmdc:mga06z11_45409_c1 nmdc:mga06z11_45409_c1_726_2087 437
328 3300050494 nmdc:mga06z11_8463_c1 nmdc:mga06z11_8463_c1_2801_4162 437
329 3300050507 nmdc:mga05p37_69744_c1 nmdc:mga05p37_69744_c1_2524_3885 437
330 3300050509 nmdc:mga0qj67_205141_c1 nmdc:mga0qj67_205141_c1_105_1466 437
331 3300050510 nmdc:mga06r32_201_c1 nmdc:mga06r32_201_c1_17524_18885 437
332 3300050511 nmdc:mga08y16_17978_c1 nmdc:mga08y16_17978_c1_2052_3413 437
333 3300050511 nmdc:mga08y16_62145_c1 nmdc:mga08y16_62145_c1_1565_2926 437
334 3300050515 nmdc:mga0a205_30042_c1 nmdc:mga0a205_30042_c1_1395_2756 437
335 iso_pu_bacteria 2513237139 2513878038 437
336 3300003751 Ga0055538_1000054 Ga0055538_100005465 438
337 3300003752 Ga0055539_1000066 Ga0055539_100006665 438
338 3300003756 Ga0055533_1000076 Ga0055533_100007665 438
339 3300003759 Ga0055525_1000098 Ga0055525_100009865 438
340 3300003841 Ga0055541_1000056 Ga0055541_100005665 438
341 3300005616 Ga0068852_100055070 Ga0068852_1000550703 438
342 3300006038 Ga0075365_10025380 Ga0075365_100253802 438
343 3300009093 Ga0105240_10003119 Ga0105240_1000311913 438
344 3300009094 Ga0111539_10027318 Ga0111539_100273185 438
345 3300009551 Ga0105238_10052431 Ga0105238_100524313 438
346 3300021361 Ga0213872_10003584 Ga0213872_100035849 438
347 3300025224 Ga0209784_100002 Ga0209784_1000021552 438
348 3300025225 Ga0209566_100003 Ga0209566_1000031552 438
349 3300025226 Ga0209674_100004 Ga0209674_1000041552 438
350 3300025230 Ga0209563_100006 Ga0209563_1000061552 438
351 3300025253 Ga0209677_100003 Ga0209677_1000031552 438
352 3300025297 Ga0209758_1002883 Ga0209758_10028836 438
353 3300025913 Ga0207695_10023519 Ga0207695_100235193 438
354 3300025924 Ga0207694_10035008 Ga0207694_100350083 438
355 3300026142 Ga0207698_10033824 Ga0207698_100338243 438
356 3300030521 Ga0307511_10000948 Ga0307511_100009482 438
357 3300031251 Ga0265327_10021443 Ga0265327_100214434 438
358 3300033179 Ga0307507_10098971 Ga0307507_100989712 438
359 3300039447 Ga0436361_0053786 Ga0436361_0053786_17639_19036 438
360 3300046538 Ga0495609_0053131 Ga0495609_0053131_306_1706 438
361 3300046660 Ga0495625_0000657 Ga0495625_0000657_34935_36332 438
362 3300047319 Ga0495674_0239130 Ga0495674_0239130_15_1376 438
363 3300048919 Ga0496116_0003967 Ga0496116_0003967_10977_12374 438
364 3300048919 Ga0496116_0058030 Ga0496116_0058030_424_1821 438
365 3300048921 Ga0496118_0056535 Ga0496118_0056535_861_2258 438
366 3300048925 Ga0496122_0000693 Ga0496122_0000693_36698_38095 438
367 3300048926 Ga0496123_0000433 Ga0496123_0000433_44942_46339 438
368 3300050492 nmdc:mga0yw44_23299_c1 nmdc:mga0yw44_23299_c1_1590_2975 438
369 3300050492 nmdc:mga0yw44_95507_c1 nmdc:mga0yw44_95507_c1_170_1555 438
370 3300053090 Ga0500646_0001743 Ga0500646_0001743_3867_5252 438
371 3300053092 Ga0500583_0008143 Ga0500583_0008143_511_1896 438
372 3300053130 Ga0500642_0032814 Ga0500642_0032814_350_1735 438
373 3300053151 Ga0500604_0006398 Ga0500604_0006398_1263_2648 438
374 iso_pu_bacteria 2548876994 2550693791 438
375 iso_pu_bacteria 2765235838 2765568569 438
376 iso_pu_bacteria 2808606386 2808981294 438
377 iso_pu_bacteria 2808606415 2809128880 438
378 iso_pu_bacteria 2808606419 2809148501 438
379 iso_pu_bacteria 2839094727 2839096551 438
380 iso_pu_bacteria 2852618963 2852621035 438
381 iso_pu_bacteria 2884811622 2884814940 438
382 iso_pu_bacteria 2884836552 2884836774 438
383 iso_pu_bacteria 2884852848 2884853065 438
384 iso_pu_bacteria 2896154374 2896155817 438
385 iso_pu_bacteria 2919046199 2919048137 438
386 3300005328 Ga0070676_10034566 Ga0070676_100345661 439
387 3300005354 Ga0070675_100187170 Ga0070675_1001871702 439
388 3300005367 Ga0070667_100068653 Ga0070667_1000686533 439
389 3300005543 Ga0070672_100046964 Ga0070672_1000469642 439
390 3300005618 Ga0068864_100133971 Ga0068864_1001339712 439
391 3300005840 Ga0068870_10010077 Ga0068870_100100771 439
392 3300005937 Ga0081455_10005811 Ga0081455_1000581112 439
393 3300006237 Ga0097621_100186922 Ga0097621_1001869222 439
394 3300006358 Ga0068871_100164342 Ga0068871_1001643422 439
395 3300006844 Ga0075428_100000103 Ga0075428_10000010313 439
396 3300006881 Ga0068865_100021323 Ga0068865_1000213234 439
397 3300009094 Ga0111539_10005030 Ga0111539_1000503013 439
398 3300013297 Ga0157378_10065470 Ga0157378_100654702 439
399 3300013308 Ga0157375_10300125 Ga0157375_103001252 439
400 3300014325 Ga0163163_10157549 Ga0163163_101575493 439
401 3300014968 Ga0157379_10073604 Ga0157379_100736042 439
402 3300025893 Ga0207682_10008819 Ga0207682_100088193 439
403 3300025908 Ga0207643_10040888 Ga0207643_100408883 439
404 3300025925 Ga0207650_10002115 Ga0207650_100021159 439
405 3300025940 Ga0207691_10243719 Ga0207691_102437191 439
406 3300025942 Ga0207689_10019790 Ga0207689_100197905 439
407 3300026035 Ga0207703_10084827 Ga0207703_100848272 439
408 3300026088 Ga0207641_10008745 Ga0207641_1000874510 439
409 3300026089 Ga0207648_10074823 Ga0207648_100748232 439
410 3300026095 Ga0207676_10052284 Ga0207676_100522841 439
411 3300026118 Ga0207675_100029224 Ga0207675_1000292244 439
412 3300026121 Ga0207683_10185100 Ga0207683_101851002 439
413 3300028577 Ga0265318_10002586 Ga0265318_100025865 439
414 3300031238 Ga0265332_10007484 Ga0265332_100074843 439
415 3300031239 Ga0265328_10003748 Ga0265328_100037487 439
416 3300031240 Ga0265320_10038913 Ga0265320_100389132 439
417 3300031242 Ga0265329_10008995 Ga0265329_100089953 439
418 3300031250 Ga0265331_10000945 Ga0265331_1000094510 439
419 3300031456 Ga0307513_10091203 Ga0307513_100912032 439
420 3300031711 Ga0265314_10000220 Ga0265314_1000022017 439
421 3300031712 Ga0265342_10006047 Ga0265342_100060474 439
422 3300050508 nmdc:mga09592_11500_c1 nmdc:mga09592_11500_c1_676_2043 439
423 3300050511 nmdc:mga08y16_86448_c1 nmdc:mga08y16_86448_c1_518_2098 439
424 3300050515 nmdc:mga0a205_114960_c1 nmdc:mga0a205_114960_c1_602_2128 439
425 iso_pu_bacteria 2617270735 2617352560 439
426 iso_pu_bacteria 2802429603 2805919998 439
427 iso_pu_bacteria 2824696289 2824698542 439
428 iso_pu_bacteria 2824773399 2824778197 439
429 iso_pu_bacteria 2841974524 2841982093 439
430 iso_pu_bacteria 2847939898 2847945043 439
431 iso_pu_bacteria 2849076700 2849080761 439
432 iso_pu_bacteria 2874628541 2874636120 439
433 3300005578 Ga0068854_100006416 Ga0068854_1000064163 440
434 3300009093 Ga0105240_10062547 Ga0105240_100625472 440
435 3300009551 Ga0105238_10003628 Ga0105238_1000362810 440
436 3300010375 Ga0105239_10078857 Ga0105239_100788573 440
437 3300015261 Ga0182006_1001196 Ga0182006_10011968 440
438 3300025913 Ga0207695_10001540 Ga0207695_1000154048 440
439 3300025914 Ga0207671_10032015 Ga0207671_100320155 440
440 3300025949 Ga0207667_10111248 Ga0207667_101112482 440
441 3300025981 Ga0207640_10008114 Ga0207640_100081142 440
442 3300026075 Ga0207708_10038305 Ga0207708_100383053 440
443 3300026116 Ga0207674_10154307 Ga0207674_101543072 440
444 3300035724 Ga0373933_0113081 Ga0373933_0113081_280_1647 440
445 3300039437 Ga0436365_0729222 Ga0436365_0729222_1547_2977 440
446 3300053125 Ga0500618_001413 Ga0500618_001413_3213_4751 440
447 iso_pu_bacteria 2507262055 2507510103 440
448 iso_pu_bacteria 2508501009 2508544105 440
449 iso_pu_bacteria 2508501042 2508697955 440
450 iso_pu_bacteria 2508501128 2509153533 440
451 iso_pu_bacteria 2511231028 2511400834 440
452 iso_pu_bacteria 2513237092 2513628335 440
453 iso_pu_bacteria 2513237095 2513648929 440
454 iso_pu_bacteria 2513237161 2514012665 440
455 iso_pu_bacteria 2517093001 2517105161 440
456 iso_pu_bacteria 2521172590 2521559258 440
457 iso_pu_bacteria 2617270741 2617379030 440
458 iso_pu_bacteria 2816332527 2818241667 440
459 iso_pu_bacteria 2818991449 2819615763 440
460 iso_pu_bacteria 2824671348 2824674262 440
461 iso_pu_bacteria 2824679649 2824682547 440
462 iso_pu_bacteria 2824687955 2824690884 440
463 iso_pu_bacteria 2824732956 2824737810 440
464 iso_pu_bacteria 2824746037 2824749968 440
465 iso_pu_bacteria 2838122688 2838127449 440
466 iso_pu_bacteria 2841949485 2841952386 440
467 iso_pu_bacteria 2841957949 2841959407 440
468 iso_pu_bacteria 2841966195 2841967743 440
469 iso_pu_bacteria 2841983080 2841986410 440
470 iso_pu_bacteria 2842038055 2842038178 440
471 iso_pu_bacteria 2842045827 2842048876 440
472 iso_pu_bacteria 2857509624 2857509874 440
473 iso_pu_bacteria 2874612657 2874618147 440
474 iso_pu_bacteria 2874620515 2874623140 440
475 iso_pu_bacteria 2881665667 2881670896 440
476 iso_pu_bacteria 2885366525 2885368857 440
477 iso_pu_bacteria 2888378607 2888382382 440
478 iso_pu_bacteria 2888388044 2888388310 440
479 iso_pu_bacteria 2904439833 2904443635 440
480 iso_pu_bacteria 2904530477 2904532552 440
481 iso_pu_bacteria 2904584206 2904585021 440
482 iso_pu_bacteria 2904589729 2904593370 440
483 iso_pu_bacteria 2904601388 2904605564 440
484 iso_pu_bacteria 2904666416 2904669960 440
485 iso_pu_bacteria 2908775508 2908778629 440
486 iso_pu_bacteria 2919079590 2919081337 440
487 iso_pu_bacteria 2922393267 2922394902 440
488 iso_pu_bacteria 2935608549 2935610991 440
489 iso_pu_bacteria 2935648319 2935648423 440
490 iso_pu_bacteria 2935656913 2935657589 440
491 iso_pu_bacteria 2935819856 2935820476 440
492 iso_pu_bacteria 2935847175 2935849515 440
493 iso_pu_bacteria 2935908558 2935911712 440
494 iso_pu_bacteria 2935916978 2935919367 440
495 iso_pu_bacteria 2935926038 2935928741 440
496 iso_pu_bacteria 2935934488 2935938386 440
497 iso_pu_bacteria 2935942939 2935945722 440
498 iso_pu_bacteria 2935951376 2935954671 440
499 iso_pu_bacteria 2935967501 2935970558 440
500 iso_pu_bacteria 2935984226 2935987782 440
501 iso_pu_bacteria 2936011229 2936011333 440
502 iso_pu_bacteria 2936019824 2936019928 440
503 iso_pu_bacteria 2936028420 2936028524 440
504 iso_pu_bacteria 2936046547 2936046651 440
505 iso_pu_bacteria 2936055302 2936062344 440
506 iso_pu_bacteria 3005483717 3005487860 440
507 iso_pu_bacteria 3005587118 3005589359 440
508 iso_pu_bacteria 3005594810 3005597395 440
509 iso_pu_bacteria 3005710791 3005713420 440
510 iso_pu_bacteria 8016630954 8016632662 440
511 iso_pu_bacteria 8019687851 8019688358 440
512 3300003215 JGI25153J46596_10002222 JGI25153J46596_100022226 441
513 3300005436 Ga0070713_100254603 Ga0070713_1002546031 441
514 3300005546 Ga0070696_100054561 Ga0070696_1000545612 441
515 3300006028 Ga0070717_10023179 Ga0070717_100231794 441
516 3300006847 Ga0075431_100208278 Ga0075431_1002082782 441
517 3300009553 Ga0105249_10018756 Ga0105249_100187561 441
518 3300025233 Ga0209437_100229 Ga0209437_1002297 441
519 3300025297 Ga0209758_1000294 Ga0209758_100029482 441
520 3300025299 Ga0209256_1000545 Ga0209256_100054528 441
521 3300025929 Ga0207664_10060688 Ga0207664_100606882 441
522 3300025939 Ga0207665_10002822 Ga0207665_1000282211 441
523 3300048904 Ga0496101_0005103 Ga0496101_0005103_6693_8069 441
524 3300048905 Ga0496102_0002260 Ga0496102_0002260_5204_6580 441
525 3300048907 Ga0496104_0054467 Ga0496104_0054467_1897_3339 441
526 3300048908 Ga0496105_0025947 Ga0496105_0025947_2089_3465 441
527 3300048909 Ga0496106_0000262 Ga0496106_0000262_15101_16477 441
528 3300048910 Ga0496107_0088582 Ga0496107_0088582_14_1390 441
529 3300048911 Ga0496108_0018407 Ga0496108_0018407_2912_4288 441
530 3300048911 Ga0496108_0029729 Ga0496108_0029729_706_2148 441
531 3300048912 Ga0496109_0002394 Ga0496109_0002394_11147_12523 441
532 3300048912 Ga0496109_0048639 Ga0496109_0048639_995_2437 441
533 3300048913 Ga0496110_0000205 Ga0496110_0000205_22606_23982 441
534 3300048913 Ga0496110_0003980 Ga0496110_0003980_6899_8341 441
535 3300048914 Ga0496111_0040066 Ga0496111_0040066_288_1730 441
536 3300048915 Ga0496112_0014600 Ga0496112_0014600_5188_6630 441
537 3300048917 Ga0496114_0127142 Ga0496114_0127142_319_1695 441
538 3300048918 Ga0496115_0042767 Ga0496115_0042767_56_1432 441
539 3300049572 Ga0501036_0138972 Ga0501036_0138972_129_1502 441
540 3300049574 Ga0501038_0075199 Ga0501038_0075199_1073_2446 441
541 iso_pu_bacteria 2513237098 2513676462 441
542 iso_pu_bacteria 2513237101 2513697014 441
543 iso_pu_bacteria 2513237141 2513892003 441
544 iso_pu_bacteria 2721755755 2723846458 441
545 iso_pu_bacteria 2721755755 2723846462 441
546 iso_pu_bacteria 2791355196 2793059915 441
547 iso_pu_bacteria 2791355199 2793076881 441
548 iso_pu_bacteria 2824617872 2824622788 441
549 iso_pu_bacteria 2824626560 2824632379 441
550 iso_pu_bacteria 2824635225 2824640398 441
551 iso_pu_bacteria 2824644064 2824647387 441
552 iso_pu_bacteria 2824714736 2824718918 441
553 iso_pu_bacteria 2824723954 2824729422 441
554 iso_pu_bacteria 2847930680 2847934448 441
555 iso_pu_bacteria 2857524615 2857528893 441
556 iso_pu_bacteria 2874604998 2874610576 441
557 iso_pu_bacteria 2879083081 2879089641 441
558 iso_pu_bacteria 2881364244 2881367672 441
559 iso_pu_bacteria 2885383462 2885390201 441
560 iso_pu_bacteria 2889033259 2889039027 441
561 iso_pu_bacteria 2893066018 2893069090 441
562 iso_pu_bacteria 2903748898 2903751924 441
563 iso_pu_bacteria 2903768456 2903771705 441
564 iso_pu_bacteria 2904690495 2904693431 441
565 iso_pu_bacteria 2906626472 2906634818 441
566 iso_pu_bacteria 2906643746 2906646681 441
567 iso_pu_bacteria 2908756301 2908761756 441
568 iso_pu_bacteria 2919073203 2919079317 441
569 iso_pu_bacteria 2922361189 2922362271 441
570 iso_pu_bacteria 2922386360 2922387976 441
571 iso_pu_bacteria 2932794094 2932797247 441
572 iso_pu_bacteria 2932801729 2932804868 441
573 iso_pu_bacteria 2935883170 2935884896 441
574 iso_pu_bacteria 2935959822 2935963271 441
575 iso_pu_bacteria 3005506211 3005508823 441
576 iso_pu_bacteria 8006926726 8006928509 441
577 iso_pu_bacteria 8006964411 8006964845 441
578 iso_pu_bacteria 8006984368 8006991759 441
579 iso_pu_bacteria 8006994254 8006995580 441
580 iso_pu_bacteria 8056673599 8056676372 441
581 iso_pu_bacteria 8056681323 8056685046 441
582 3300005436 Ga0070713_100094960 Ga0070713_1000949602 442
583 3300005468 Ga0070707_100313543 Ga0070707_1003135431 442
584 3300005983 Ga0081540_1024563 Ga0081540_10245632 442
585 3300007076 Ga0075435_100029304 Ga0075435_1000293041 442
586 3300007788 Ga0099795_10002853 Ga0099795_100028532 442
587 3300021361 Ga0213872_10016312 Ga0213872_100163121 442
588 3300025929 Ga0207664_10068985 Ga0207664_100689852 442
589 3300025939 Ga0207665_10049190 Ga0207665_100491901 442
590 3300039447 Ga0436361_0671651 Ga0436361_0671651_3605_5026 442
591 3300048913 Ga0496110_0003778 Ga0496110_0003778_751_2397 442
592 3300050515 nmdc:mga0a205_63974_c1 nmdc:mga0a205_63974_c1_355_2001 442
593 3300053153 Ga0500616_0047643 Ga0500616_0047643_606_1994 442
594 iso_pu_bacteria 2511231003 2511252132 442
595 iso_pu_bacteria 2524023210 2524467068 442
596 iso_pu_bacteria 2818991445 2819595072 442
597 iso_pu_bacteria 2876808645 2876810065 442
598 iso_pu_bacteria 2879110137 2879118634 442
599 iso_pu_bacteria 2904699407 2904700664 442
600 iso_pu_bacteria 2906610324 2906610807 442
601 iso_pu_bacteria 2906635258 2906635967 442
602 iso_pu_bacteria 2906660503 2906663934 442
603 iso_pu_bacteria 2922425934 2922428520 442
604 iso_pu_bacteria 2935630451 2935634500 442
605 iso_pu_bacteria 2941507105 2941508986 442
606 iso_pu_bacteria 2941515067 2941516815 442
607 iso_pu_bacteria 2941523033 2941525090 442
608 3300005330 Ga0070690_100084812 Ga0070690_1000848122 443
609 3300005331 Ga0070670_100002578 Ga0070670_10000257813 443
610 3300006844 Ga0075428_100138048 Ga0075428_1001380482 443
611 3300006871 Ga0075434_100202054 Ga0075434_1002020543 443
612 3300006880 Ga0075429_100075942 Ga0075429_1000759422 443
613 3300009098 Ga0105245_10015633 Ga0105245_100156335 443
614 3300009147 Ga0114129_10202623 Ga0114129_102026232 443
615 3300021361 Ga0213872_10048178 Ga0213872_100481781 443
616 3300025925 Ga0207650_10001829 Ga0207650_1000182913 443
617 3300025927 Ga0207687_10013222 Ga0207687_100132225 443
618 3300025940 Ga0207691_10198351 Ga0207691_101983512 443
619 3300026035 Ga0207703_10097711 Ga0207703_100977112 443
620 3300031249 Ga0265339_10021009 Ga0265339_100210094 443
621 3300031712 Ga0265342_10011954 Ga0265342_100119542 443
622 3300035113 Ga0373936_0002231 Ga0373936_0002231_1670_3049 443
623 3300035116 Ga0373945_0013753 Ga0373945_0013753_296_1720 443
624 3300035117 Ga0373953_0002952 Ga0373953_0002952_3619_4998 443
625 3300035118 Ga0373954_0007519 Ga0373954_0007519_3328_4707 443
626 3300035170 Ga0373943_0004323 Ga0373943_0004323_1221_2600 443
627 3300035172 Ga0373955_0000643 Ga0373955_0000643_6069_7448 443
628 3300035692 Ga0373935_0000075 Ga0373935_0000075_18003_19382 443
629 3300035724 Ga0373933_0015393 Ga0373933_0015393_2761_4140 443
630 3300035725 Ga0373947_0000138 Ga0373947_0000138_28725_30104 443
631 3300036401 Ga0373937_0000057 Ga0373937_0000057_87694_89073 443
632 3300037068 Ga0373925_0000078 Ga0373925_0000078_30279_31658 443
633 3300039437 Ga0436365_1709207 Ga0436365_1709207_285_1664 443
634 3300039447 Ga0436361_0356069 Ga0436361_0356069_156_1532 443
635 3300044658 Ga0466972_0000371 Ga0466972_0000371_8316_9692 443
636 3300044684 Ga0466966_0001015 Ga0466966_0001015_85_1461 443
637 3300044693 Ga0466961_0003875 Ga0466961_0003875_5200_6576 443
638 3300045049 Ga0466959_0008411 Ga0466959_0008411_2491_3867 443
639 3300046454 Ga0495592_0000233 Ga0495592_0000233_17229_18608 443
640 3300046455 Ga0495603_0041698 Ga0495603_0041698_880_2304 443
641 3300046459 Ga0495629_0003366 Ga0495629_0003366_5945_7324 443
642 3300046462 Ga0495651_0002019 Ga0495651_0002019_5960_7339 443
643 3300046463 Ga0495653_0000464 Ga0495653_0000464_29919_31298 443
644 3300046476 Ga0495662_0001193 Ga0495662_0001193_1512_2891 443
645 3300046476 Ga0495662_0037215 Ga0495662_0037215_15_1412 443
646 3300046477 Ga0495664_0000023 Ga0495664_0000023_29135_30514 443
647 3300046511 Ga0495608_0000030 Ga0495608_0000030_28856_30235 443
648 3300046514 Ga0495618_0000585 Ga0495618_0000585_168_1547 443
649 3300046516 Ga0495628_0000027 Ga0495628_0000027_96271_97650 443
650 3300046517 Ga0495630_0006673 Ga0495630_0006673_71_1450 443
651 3300046529 Ga0495652_0000041 Ga0495652_0000041_28847_30226 443
652 3300046533 Ga0495640_0000056 Ga0495640_0000056_31702_33081 443
653 3300046536 Ga0495587_0000025 Ga0495587_0000025_115871_117250 443
654 3300046543 Ga0495645_0000001 Ga0495645_0000001_627710_629089 443
655 3300046559 Ga0495667_0000001 Ga0495667_0000001_736635_738014 443
656 3300046615 Ga0495656_0059799 Ga0495656_0059799_122_1546 443
657 3300046642 Ga0495634_0001485 Ga0495634_0001485_18145_19524 443
658 3300046663 Ga0495635_0000077 Ga0495635_0000077_30046_31425 443
659 3300046674 Ga0495588_0104312 Ga0495588_0104312_18_1415 443
660 3300046675 Ga0495657_0000390 Ga0495657_0000390_24842_26221 443
661 3300046678 Ga0495599_0000021 Ga0495599_0000021_96818_98197 443
662 3300046679 Ga0495623_0000141 Ga0495623_0000141_12610_13989 443
663 3300046680 Ga0495646_0000051 Ga0495646_0000051_27879_29258 443
664 3300046690 Ga0495624_0005832 Ga0495624_0005832_5695_7119 443
665 3300046809 Ga0495600_0000114 Ga0495600_0000114_14504_15883 443
666 3300047317 Ga0495604_0000036 Ga0495604_0000036_96289_97668 443
667 3300047319 Ga0495674_0000102 Ga0495674_0000102_31228_32607 443
668 3300047321 Ga0495676_0037239 Ga0495676_0037239_1237_2634 443
669 3300047322 Ga0495680_0001061 Ga0495680_0001061_28932_30311 443
670 3300047444 Ga0495675_0000148 Ga0495675_0000148_20181_21560 443
671 3300047471 Ga0495684_0000025 Ga0495684_0000025_29365_30744 443
672 3300047673 Ga0495593_0000682 Ga0495593_0000682_17985_19364 443
673 3300048088 Ga0495602_0000311 Ga0495602_0000311_14749_16128 443
674 3300048906 Ga0496103_0021711 Ga0496103_0021711_2002_3426 443
675 3300048907 Ga0496104_0002505 Ga0496104_0002505_5885_7309 443
676 3300048910 Ga0496107_0063265 Ga0496107_0063265_1062_2486 443
677 3300048911 Ga0496108_0000357 Ga0496108_0000357_8639_10063 443
678 3300048912 Ga0496109_0002224 Ga0496109_0002224_12866_14290 443
679 3300048913 Ga0496110_0052971 Ga0496110_0052971_680_2104 443
680 3300048914 Ga0496111_0000632 Ga0496111_0000632_14205_15629 443
681 3300048915 Ga0496112_0006469 Ga0496112_0006469_4446_5870 443
682 3300050507 nmdc:mga05p37_225993_c1 nmdc:mga05p37_225993_c1_136_1560 443
683 3300050512 nmdc:mga0n895_61632_c1 nmdc:mga0n895_61632_c1_283_1707 443
684 3300053077 Ga0495601_0000025 Ga0495601_0000025_96272_97651 443
685 3300053078 Ga0495612_0000046 Ga0495612_0000046_28953_30332 443
686 3300053084 Ga0495595_0000054 Ga0495595_0000054_29010_30389 443
687 3300053085 Ga0495619_0000035 Ga0495619_0000035_96294_97673 443
688 3300053737 Ga0500601_000643 Ga0500601_000643_3299_4675 443
689 3300003215 JGI25153J46596_10002589 JGI25153J46596_100025896 444
690 3300003215 JGI25153J46596_10003283 JGI25153J46596_100032832 444
691 3300003215 JGI25153J46596_10006877 JGI25153J46596_100068776 444
692 3300003354 JGI25160J50197_1006259 JGI25160J50197_10062592 444
693 3300003354 JGI25160J50197_1006800 JGI25160J50197_10068002 444
694 3300003794 Ga0055531_10003706 Ga0055531_100037062 444
695 3300004625 Ga0055543_1002979 Ga0055543_10029795 444
696 3300005262 Ga0065165_1001284 Ga0065165_100128414 444
697 3300005262 Ga0065165_1022456 Ga0065165_10224561 444
698 3300005340 Ga0070689_100003410 Ga0070689_1000034107 444
699 3300005353 Ga0070669_100112005 Ga0070669_1001120051 444
700 3300005355 Ga0070671_100109138 Ga0070671_1001091382 444
701 3300005434 Ga0070709_10003602 Ga0070709_100036022 444
702 3300005436 Ga0070713_100003091 Ga0070713_1000030919 444
703 3300005437 Ga0070710_10001132 Ga0070710_1000113212 444
704 3300005455 Ga0070663_100072320 Ga0070663_1000723201 444
705 3300005547 Ga0070693_100128699 Ga0070693_1001286991 444
706 3300005614 Ga0068856_100220812 Ga0068856_1002208121 444
707 3300005617 Ga0068859_100058039 Ga0068859_1000580392 444
708 3300005842 Ga0068858_100108934 Ga0068858_1001089342 444
709 3300005842 Ga0068858_100122130 Ga0068858_1001221302 444
710 3300005844 Ga0068862_100133755 Ga0068862_1001337552 444
711 3300006038 Ga0075365_10098867 Ga0075365_100988672 444
712 3300006042 Ga0075368_10002361 Ga0075368_100023618 444
713 3300006051 Ga0075364_10044728 Ga0075364_100447282 444
714 3300006163 Ga0070715_10015703 Ga0070715_100157032 444
715 3300006173 Ga0070716_100044394 Ga0070716_1000443942 444
716 3300006195 Ga0075366_10045627 Ga0075366_100456272 444
717 3300006195 Ga0075366_10063442 Ga0075366_100634422 444
718 3300006881 Ga0068865_100078669 Ga0068865_1000786692 444
719 3300006931 Ga0097620_100058038 Ga0097620_1000580382 444
720 3300006942 Ga0099824_1022507 Ga0099824_10225071 444
721 3300009545 Ga0105237_10190843 Ga0105237_101908432 444
722 3300021320 Ga0214544_1000020 Ga0214544_100002084 444
723 3300021321 Ga0214542_1000024 Ga0214542_100002495 444
724 3300021324 Ga0214545_1000011 Ga0214545_100001195 444
725 3300021324 Ga0214545_1029344 Ga0214545_10293442 444
726 3300021327 Ga0214543_1000033 Ga0214543_1000033109 444
727 3300021384 Ga0213876_10001998 Ga0213876_100019988 444
728 3300025230 Ga0209563_101304 Ga0209563_1013046 444
729 3300025245 Ga0207425_1009865 Ga0207425_10098651 444
730 3300025253 Ga0209677_102281 Ga0209677_1022814 444
731 3300025253 Ga0209677_102285 Ga0209677_1022852 444
732 3300025261 Ga0209233_1001066 Ga0209233_10010663 444
733 3300025261 Ga0209233_1005718 Ga0209233_10057183 444
734 3300025295 Ga0209564_1014473 Ga0209564_10144732 444
735 3300025297 Ga0209758_1000407 Ga0209758_100040761 444
736 3300025297 Ga0209758_1000952 Ga0209758_100095237 444
737 3300025297 Ga0209758_1001983 Ga0209758_10019832 444
738 3300025297 Ga0209758_1008305 Ga0209758_10083052 444
739 3300025297 Ga0209758_1032704 Ga0209758_10327041 444
740 3300025299 Ga0209256_1006969 Ga0209256_10069696 444
741 3300025302 Ga0207426_1001388 Ga0207426_10013888 444
742 3300025302 Ga0207426_1031258 Ga0207426_10312582 444
743 3300025304 Ga0209257_1001136 Ga0209257_100113627 444
744 3300025315 Ga0207697_10031871 Ga0207697_100318712 444
745 3300025899 Ga0207642_10089442 Ga0207642_100894421 444
746 3300025904 Ga0207647_10035209 Ga0207647_100352092 444
747 3300025906 Ga0207699_10001319 Ga0207699_1000131912 444
748 3300025914 Ga0207671_10175033 Ga0207671_101750331 444
749 3300025915 Ga0207693_10001566 Ga0207693_100015662 444
750 3300025916 Ga0207663_10006786 Ga0207663_100067865 444
751 3300025928 Ga0207700_10006688 Ga0207700_100066886 444
752 3300025931 Ga0207644_10104521 Ga0207644_101045212 444
753 3300025936 Ga0207670_10002928 Ga0207670_100029287 444
754 3300025938 Ga0207704_10006693 Ga0207704_100066932 444
755 3300027296 Ga0209389_1000424 Ga0209389_10004249 444
756 3300027357 Ga0209589_1004180 Ga0209589_10041809 444
757 3300027361 Ga0209489_104563 Ga0209489_10456310 444
758 3300028380 Ga0268265_10157663 Ga0268265_101576631 444
759 3300031824 Ga0307413_10072121 Ga0307413_100721212 444
760 3300031911 Ga0307412_10131089 Ga0307412_101310891 444
761 3300032005 Ga0307411_10053158 Ga0307411_100531582 444
762 3300033180 Ga0307510_10072820 Ga0307510_100728202 444
763 3300035084 Ga0373928_0014812 Ga0373928_0014812_152_1531 444
764 3300039437 Ga0436365_0240210 Ga0436365_0240210_13402_14781 444
765 3300039438 Ga0436360_0811388 Ga0436360_0811388_115_1494 444
766 3300039438 Ga0436360_0930029 Ga0436360_0930029_691_2070 444
767 3300039453 Ga0436362_0837923 Ga0436362_0837923_67_1446 444
768 3300046616 Ga0495668_0037116 Ga0495668_0037116_269_1648 444
769 3300046648 Ga0495611_0031594 Ga0495611_0031594_492_1871 444
770 3300047443 Ga0495687_004001 Ga0495687_004001_8310_9689 444
771 3300048088 Ga0495602_0165611 Ga0495602_0165611_278_1657 444
772 3300048905 Ga0496102_0097665 Ga0496102_0097665_442_1821 444
773 3300048906 Ga0496103_0027506 Ga0496103_0027506_15_1394 444
774 3300048908 Ga0496105_0128423 Ga0496105_0128423_452_1831 444
775 3300048911 Ga0496108_0098085 Ga0496108_0098085_949_2328 444
776 3300048912 Ga0496109_0060680 Ga0496109_0060680_437_1816 444
777 3300048918 Ga0496115_0146166 Ga0496115_0146166_305_1693 444
778 3300048922 Ga0496119_0033910 Ga0496119_0033910_1474_2853 444
779 3300048923 Ga0496120_0104179 Ga0496120_0104179_89_1468 444
780 3300048929 Ga0496126_0018230 Ga0496126_0018230_1701_3086 444
781 3300048929 Ga0496126_0172212 Ga0496126_0172212_356_1744 444
782 3300050490 nmdc:mga03n38_39900_c1 nmdc:mga03n38_39900_c1_463_1842 444
783 3300050492 nmdc:mga0yw44_5661_c1 nmdc:mga0yw44_5661_c1_4109_5488 444
784 3300050492 nmdc:mga0yw44_59421_c1 nmdc:mga0yw44_59421_c1_501_1880 444
785 3300050494 nmdc:mga06z11_68184_c1 nmdc:mga06z11_68184_c1_166_1545 444
786 3300050496 nmdc:mga07m45_9639_c1 nmdc:mga07m45_9639_c1_2051_3430 444
787 3300050507 nmdc:mga05p37_13202_c1 nmdc:mga05p37_13202_c1_3754_5151 444
788 3300053077 Ga0495601_0014260 Ga0495601_0014260_2583_3962 444
789 3300053085 Ga0495619_0004720 Ga0495619_0004720_4724_6103 444
790 3300053087 Ga0500643_000019 Ga0500643_000019_165527_166906 444
791 3300053103 Ga0500555_004780 Ga0500555_004780_2071_3450 444
792 3300053109 Ga0500569_007080 Ga0500569_007080_906_2285 444
793 3300053111 Ga0500572_001849 Ga0500572_001849_1162_2616 444
794 3300053116 Ga0500592_006852 Ga0500592_006852_41_1420 444
795 3300053119 Ga0500595_023204 Ga0500595_023204_59_1438 444
796 3300053130 Ga0500642_0028020 Ga0500642_0028020_309_1688 444
797 3300053136 Ga0500559_0020926 Ga0500559_0020926_225_1679 444
798 3300053139 Ga0500568_0004264 Ga0500568_0004264_2494_3873 444
799 3300053177 Ga0500636_0000313 Ga0500636_0000313_5690_7069 444
800 3300053177 Ga0500636_0030709 Ga0500636_0030709_731_2113 444
801 3300053735 Ga0500596_004849 Ga0500596_004849_963_2345 444
802 3300053736 Ga0500599_002587 Ga0500599_002587_81_1460 444
803 iso_pu_bacteria 2524023228 2524540686 444
804 iso_pu_bacteria 8006933436 8006942716 444
805 iso_pu_bacteria 8006973647 8006982439 444
806 3300002244 JGI24742J22300_10003139 JGI24742J22300_100031392 445
807 3300005293 Ga0065715_10164299 Ga0065715_101642991 445
808 3300005295 Ga0065707_10021875 Ga0065707_100218751 445
809 3300005329 Ga0070683_100178315 Ga0070683_1001783151 445
810 3300005347 Ga0070668_100171527 Ga0070668_1001715272 445
811 3300005435 Ga0070714_100033661 Ga0070714_1000336612 445
812 3300005436 Ga0070713_100131037 Ga0070713_1001310371 445
813 3300005437 Ga0070710_10031412 Ga0070710_100314122 445
814 3300005439 Ga0070711_100037088 Ga0070711_1000370881 445
815 3300005843 Ga0068860_100075903 Ga0068860_1000759033 445
816 3300005983 Ga0081540_1006666 Ga0081540_10066666 445
817 3300005983 Ga0081540_1012946 Ga0081540_10129465 445
818 3300005983 Ga0081540_1026854 Ga0081540_10268542 445
819 3300006163 Ga0070715_10006169 Ga0070715_100061692 445
820 3300006173 Ga0070716_100020203 Ga0070716_1000202032 445
821 3300006175 Ga0070712_100001878 Ga0070712_10000187813 445
822 3300006175 Ga0070712_100055421 Ga0070712_1000554212 445
823 3300006195 Ga0075366_10024479 Ga0075366_100244792 445
824 3300006871 Ga0075434_100021009 Ga0075434_1000210092 445
825 3300009094 Ga0111539_10066357 Ga0111539_100663572 445
826 3300009147 Ga0114129_10022094 Ga0114129_1002209410 445
827 3300009147 Ga0114129_10172096 Ga0114129_101720962 445
828 3300009148 Ga0105243_10094100 Ga0105243_100941001 445
829 3300010375 Ga0105239_10044826 Ga0105239_100448262 445
830 3300011119 Ga0105246_10154825 Ga0105246_101548251 445
831 3300013308 Ga0157375_10173210 Ga0157375_101732102 445
832 3300014745 Ga0157377_10088694 Ga0157377_100886941 445
833 3300025898 Ga0207692_10008475 Ga0207692_100084752 445
834 3300025900 Ga0207710_10018417 Ga0207710_100184172 445
835 3300025906 Ga0207699_10049238 Ga0207699_100492382 445
836 3300025908 Ga0207643_10000418 Ga0207643_1000041822 445
837 3300025908 Ga0207643_10064491 Ga0207643_100644912 445
838 3300025915 Ga0207693_10011746 Ga0207693_100117467 445
839 3300025915 Ga0207693_10013334 Ga0207693_100133343 445
840 3300025919 Ga0207657_10012700 Ga0207657_100127003 445
841 3300025926 Ga0207659_10116180 Ga0207659_101161802 445
842 3300025929 Ga0207664_10079804 Ga0207664_100798041 445
843 3300025939 Ga0207665_10001510 Ga0207665_100015108 445
844 3300025942 Ga0207689_10039992 Ga0207689_100399923 445
845 3300026023 Ga0207677_10219604 Ga0207677_102196041 445
846 3300026067 Ga0207678_10030296 Ga0207678_100302963 445
847 3300026116 Ga0207674_10258133 Ga0207674_102581331 445
848 3300026121 Ga0207683_10014258 Ga0207683_100142583 445
849 3300027296 Ga0209389_1000011 Ga0209389_1000011120 445
850 3300027361 Ga0209489_100017 Ga0209489_100017114 445
851 3300027363 Ga0209700_100027 Ga0209700_100027120 445
852 3300027907 Ga0207428_10033735 Ga0207428_100337352 445
853 3300027907 Ga0207428_10157801 Ga0207428_101578011 445
854 3300028556 Ga0265337_1019331 Ga0265337_10193311 445
855 3300028563 Ga0265319_1001186 Ga0265319_10011866 445
856 3300028573 Ga0265334_10004555 Ga0265334_100045555 445
857 3300028577 Ga0265318_10002315 Ga0265318_100023158 445
858 3300028653 Ga0265323_10000768 Ga0265323_100007689 445
859 3300028654 Ga0265322_10003636 Ga0265322_100036365 445
860 3300028666 Ga0265336_10000106 Ga0265336_1000010621 445
861 3300028786 Ga0307517_10000049 Ga0307517_1000004937 445
862 3300028800 Ga0265338_10000065 Ga0265338_10000065112 445
863 3300029957 Ga0265324_10001808 Ga0265324_100018089 445
864 3300031507 Ga0307509_10029697 Ga0307509_100296974 445
865 3300031616 Ga0307508_10000090 Ga0307508_1000009083 445
866 3300031730 Ga0307516_10006682 Ga0307516_100066822 445
867 3300031730 Ga0307516_10103897 Ga0307516_101038972 445
868 3300035695 Ga0373927_0007183 Ga0373927_0007183_5228_6637 445
869 3300035724 Ga0373933_0002722 Ga0373933_0002722_693_2075 445
870 3300037068 Ga0373925_0023694 Ga0373925_0023694_2357_3766 445
871 3300037418 Ga0395900_0152680 Ga0395900_0152680_676_2085 445
872 3300037471 Ga0395905_0039879 Ga0395905_0039879_2444_3826 445
873 3300037471 Ga0395905_0188380 Ga0395905_0188380_38_1420 445
874 3300038443 Ga0395901_0073367 Ga0395901_0073367_867_2303 445
875 3300039438 Ga0436360_0953856 Ga0436360_0953856_167_1549 445
876 3300046454 Ga0495592_0026673 Ga0495592_0026673_374_1756 445
877 3300046462 Ga0495651_0002101 Ga0495651_0002101_10380_11762 445
878 3300046463 Ga0495653_0028701 Ga0495653_0028701_1645_3027 445
879 3300046511 Ga0495608_0019297 Ga0495608_0019297_2361_3743 445
880 3300046516 Ga0495628_0014573 Ga0495628_0014573_3540_4922 445
881 3300046529 Ga0495652_0006363 Ga0495652_0006363_5213_6595 445
882 3300046533 Ga0495640_0030764 Ga0495640_0030764_906_2294 445
883 3300046536 Ga0495587_0024566 Ga0495587_0024566_101_1483 445
884 3300046543 Ga0495645_0002752 Ga0495645_0002752_10138_11520 445
885 3300046559 Ga0495667_0014365 Ga0495667_0014365_428_1810 445
886 3300046642 Ga0495634_0035941 Ga0495634_0035941_652_2034 445
887 3300046675 Ga0495657_0002643 Ga0495657_0002643_9406_10788 445
888 3300046678 Ga0495599_0031977 Ga0495599_0031977_1796_3178 445
889 3300046683 Ga0495658_0077884 Ga0495658_0077884_40_1449 445
890 3300046809 Ga0495600_0028768 Ga0495600_0028768_1464_2846 445
891 3300047317 Ga0495604_0005569 Ga0495604_0005569_3851_5233 445
892 3300047319 Ga0495674_0073584 Ga0495674_0073584_1214_2596 445
893 3300047322 Ga0495680_0007181 Ga0495680_0007181_3831_5213 445
894 3300047471 Ga0495684_0051054 Ga0495684_0051054_18_1400 445
895 3300048088 Ga0495602_0002010 Ga0495602_0002010_11489_12871 445
896 3300048090 Ga0495615_0017359 Ga0495615_0017359_73_1455 445
897 3300048903 Ga0496100_0072896 Ga0496100_0072896_136_1545 445
898 3300048908 Ga0496105_0102078 Ga0496105_0102078_872_2269 445
899 3300048909 Ga0496106_0046597 Ga0496106_0046597_412_1794 445
900 3300048918 Ga0496115_0106870 Ga0496115_0106870_600_2009 445
901 3300048921 Ga0496118_0013843 Ga0496118_0013843_4580_5962 445
902 3300048924 Ga0496121_0034449 Ga0496121_0034449_1753_3135 445
903 3300048925 Ga0496122_0049843 Ga0496122_0049843_1765_3147 445
904 3300048928 Ga0496125_0074343 Ga0496125_0074343_396_1781 445
905 3300048929 Ga0496126_0026719 Ga0496126_0026719_3395_4777 445
906 3300049588 Ga0501072_0004057 Ga0501072_0004057_506_1909 445
907 3300049592 Ga0501076_0111397 Ga0501076_0111397_631_2010 445
908 3300050510 nmdc:mga06r32_134961_c1 nmdc:mga06r32_134961_c1_86_1522 445
909 3300050512 nmdc:mga0n895_151330_c1 nmdc:mga0n895_151330_c1_26_1483 445
910 3300050512 nmdc:mga0n895_78921_c1 nmdc:mga0n895_78921_c1_570_1979 445
911 3300053077 Ga0495601_0029067 Ga0495601_0029067_1442_2830 445
912 3300053087 Ga0500643_001637 Ga0500643_001637_1408_2793 445
913 3300053088 Ga0500644_0000670 Ga0500644_0000670_3475_4860 445
914 3300053093 Ga0500651_0099808 Ga0500651_0099808_42_1427 445
915 3300053094 Ga0500566_0024756 Ga0500566_0024756_666_2051 445
916 3300053105 Ga0500557_000039 Ga0500557_000039_37395_38777 445
917 3300053119 Ga0500595_000003 Ga0500595_000003_119336_120721 445
918 3300053130 Ga0500642_0000285 Ga0500642_0000285_5291_6673 445
919 3300053136 Ga0500559_0044275 Ga0500559_0044275_251_1633 445
920 3300053140 Ga0500573_0040300 Ga0500573_0040300_29_1411 445
921 3300053153 Ga0500616_0000002 Ga0500616_0000002_1306080_1307465 445
922 3300053177 Ga0500636_0029794 Ga0500636_0029794_336_1718 445
923 3300053729 Ga0500625_007580 Ga0500625_007580_3123_4505 445
924 3300053730 Ga0500645_000078 Ga0500645_000078_36346_37731 445
925 3300053735 Ga0500596_007040 Ga0500596_007040_233_1615 445
926 3300054114 Ga0501084_0142571 Ga0501084_0142571_515_1912 445
927 3300003203 JGI25406J46586_10000801 JGI25406J46586_100008011 446
928 3300003203 JGI25406J46586_10003389 JGI25406J46586_100033896 446
929 3300003203 JGI25406J46586_10003524 JGI25406J46586_100035246 446
930 3300005356 Ga0070674_100080008 Ga0070674_1000800082 446
931 3300005434 Ga0070709_10001642 Ga0070709_100016424 446
932 3300005435 Ga0070714_100013820 Ga0070714_1000138204 446
933 3300005436 Ga0070713_100020726 Ga0070713_1000207262 446
934 3300005437 Ga0070710_10003655 Ga0070710_100036554 446
935 3300005457 Ga0070662_100098404 Ga0070662_1000984042 446
936 3300005471 Ga0070698_100166882 Ga0070698_1001668822 446
937 3300005536 Ga0070697_100109945 Ga0070697_1001099451 446
938 3300005548 Ga0070665_100123475 Ga0070665_1001234752 446
939 3300005577 Ga0068857_100071409 Ga0068857_1000714092 446
940 3300005937 Ga0081455_10028316 Ga0081455_100283163 446
941 3300005937 Ga0081455_10052106 Ga0081455_100521063 446
942 3300005981 Ga0081538_10041924 Ga0081538_100419241 446
943 3300005981 Ga0081538_10051173 Ga0081538_100511732 446
944 3300005983 Ga0081540_1002649 Ga0081540_10026498 446
945 3300005983 Ga0081540_1003830 Ga0081540_100383014 446
946 3300005983 Ga0081540_1003910 Ga0081540_100391011 446
947 3300005983 Ga0081540_1027228 Ga0081540_10272282 446
948 3300005983 Ga0081540_1036114 Ga0081540_10361142 446
949 3300005985 Ga0081539_10000008 Ga0081539_10000008441 446
950 3300005985 Ga0081539_10000747 Ga0081539_1000074776 446
951 3300006028 Ga0070717_10018588 Ga0070717_100185884 446
952 3300006163 Ga0070715_10000320 Ga0070715_1000032010 446
953 3300006173 Ga0070716_100001867 Ga0070716_1000018677 446
954 3300006178 Ga0075367_10006118 Ga0075367_100061185 446
955 3300006844 Ga0075428_100098353 Ga0075428_1000983532 446
956 3300006846 Ga0075430_100004771 Ga0075430_1000047711 446
957 3300006846 Ga0075430_100065258 Ga0075430_1000652582 446
958 3300006847 Ga0075431_100037647 Ga0075431_1000376474 446
959 3300009174 Ga0105241_10012907 Ga0105241_100129074 446
960 3300009177 Ga0105248_10090547 Ga0105248_100905473 446
961 3300009177 Ga0105248_10239281 Ga0105248_102392812 446
962 3300010375 Ga0105239_10043580 Ga0105239_100435804 446
963 3300013296 Ga0157374_10025104 Ga0157374_100251043 446
964 3300013306 Ga0163162_10013059 Ga0163162_100130591 446
965 3300013308 Ga0157375_10021128 Ga0157375_100211284 446
966 3300014969 Ga0157376_10002959 Ga0157376_100029598 446
967 3300025261 Ga0209233_1004907 Ga0209233_10049073 446
968 3300025898 Ga0207692_10007013 Ga0207692_100070135 446
969 3300025901 Ga0207688_10058016 Ga0207688_100580162 446
970 3300025906 Ga0207699_10002443 Ga0207699_1000244310 446
971 3300025907 Ga0207645_10018918 Ga0207645_100189185 446
972 3300025911 Ga0207654_10017669 Ga0207654_100176692 446
973 3300025914 Ga0207671_10139691 Ga0207671_101396912 446
974 3300025915 Ga0207693_10001385 Ga0207693_100013856 446
975 3300025915 Ga0207693_10064329 Ga0207693_100643291 446
976 3300025916 Ga0207663_10000136 Ga0207663_100001363 446
977 3300025928 Ga0207700_10032460 Ga0207700_100324602 446
978 3300025928 Ga0207700_10041044 Ga0207700_100410444 446
979 3300025929 Ga0207664_10013549 Ga0207664_100135495 446
980 3300025939 Ga0207665_10000064 Ga0207665_1000006469 446
981 3300025940 Ga0207691_10061618 Ga0207691_100616182 446
982 3300025940 Ga0207691_10091423 Ga0207691_100914231 446
983 3300025940 Ga0207691_10137905 Ga0207691_101379051 446
984 3300025941 Ga0207711_10043321 Ga0207711_100433213 446
985 3300026023 Ga0207677_10029878 Ga0207677_100298783 446
986 3300026075 Ga0207708_10102100 Ga0207708_101021002 446
987 3300026089 Ga0207648_10006999 Ga0207648_100069998 446
988 3300026116 Ga0207674_10151319 Ga0207674_101513192 446
989 3300026142 Ga0207698_10154018 Ga0207698_101540182 446
990 3300027717 Ga0209998_10006448 Ga0209998_100064482 446
991 3300028379 Ga0268266_10003117 Ga0268266_100031172 446
992 3300028379 Ga0268266_10137128 Ga0268266_101371282 446
993 3300028379 Ga0268266_10245286 Ga0268266_102452861 446
994 3300031235 Ga0265330_10013442 Ga0265330_100134422 446
995 3300031241 Ga0265325_10023047 Ga0265325_100230472 446
996 3300031507 Ga0307509_10083377 Ga0307509_100833771 446
997 3300031548 Ga0307408_100018764 Ga0307408_1000187642 446
998 3300033180 Ga0307510_10019318 Ga0307510_100193183 446
999 3300033180 Ga0307510_10031887 Ga0307510_100318875 446
1000 3300033180 Ga0307510_10044427 Ga0307510_100444274 446
1001 3300033442 Ga0315911_1000011 Ga0315911_1000011106 446
1002 3300035111 Ga0373923_0003802 Ga0373923_0003802_2370_3836 446
1003 3300035118 Ga0373954_0010242 Ga0373954_0010242_997_2463 446
1004 3300035170 Ga0373943_0008124 Ga0373943_0008124_499_1941 446
1005 3300035171 Ga0373946_0043539 Ga0373946_0043539_136_1521 446
1006 3300035172 Ga0373955_0000360 Ga0373955_0000360_2499_3965 446
1007 3300035241 Ga0373961_0020487 Ga0373961_0020487_223_1614 446
1008 3300035410 Ga0373924_0002747 Ga0373924_0002747_4109_5575 446
1009 3300035691 Ga0373931_0002260 Ga0373931_0002260_889_2274 446
1010 3300035691 Ga0373931_0006487 Ga0373931_0006487_3916_5307 446
1011 3300035692 Ga0373935_0002949 Ga0373935_0002949_2856_4298 446
1012 3300035695 Ga0373927_0000950 Ga0373927_0000950_9716_11158 446
1013 3300035724 Ga0373933_0003920 Ga0373933_0003920_5150_6616 446
1014 3300035725 Ga0373947_0003025 Ga0373947_0003025_314_1756 446
1015 3300036401 Ga0373937_0008436 Ga0373937_0008436_1466_2932 446
1016 3300036401 Ga0373937_0031959 Ga0373937_0031959_1403_2845 446
1017 3300037068 Ga0373925_0016899 Ga0373925_0016899_121_1506 446
1018 3300037853 Ga0436364_0810480 Ga0436364_0810480_870_2255 446
1019 3300039437 Ga0436365_0642532 Ga0436365_0642532_1390_2874 446
1020 3300042008 Ga0439450_006325 Ga0439450_006325_83_1468 446
1021 3300042012 Ga0439455_0011932 Ga0439455_0011932_335_1720 446
1022 3300042439 Ga0439464_0016409 Ga0439464_0016409_108_1493 446
1023 3300045049 Ga0466959_0092197 Ga0466959_0092197_29_1411 446
1024 3300046454 Ga0495592_0009069 Ga0495592_0009069_5974_7440 446
1025 3300046454 Ga0495592_0133728 Ga0495592_0133728_18_1460 446
1026 3300046455 Ga0495603_0000200 Ga0495603_0000200_14870_16312 446
1027 3300046455 Ga0495603_0004845 Ga0495603_0004845_3533_4918 446
1028 3300046455 Ga0495603_0013905 Ga0495603_0013905_2629_4101 446
1029 3300046455 Ga0495603_0035297 Ga0495603_0035297_1485_2870 446
1030 3300046459 Ga0495629_0002535 Ga0495629_0002535_2994_4436 446
1031 3300046459 Ga0495629_0010260 Ga0495629_0010260_583_2049 446
1032 3300046460 Ga0495638_0004444 Ga0495638_0004444_8024_9409 446
1033 3300046461 Ga0495641_0008896 Ga0495641_0008896_4449_5891 446
1034 3300046462 Ga0495651_0027827 Ga0495651_0027827_1601_2986 446
1035 3300046463 Ga0495653_0001070 Ga0495653_0001070_9186_10652 446
1036 3300046472 Ga0495580_0002104 Ga0495580_0002104_14930_16372 446
1037 3300046473 Ga0495582_0000354 Ga0495582_0000354_3484_4926 446
1038 3300046473 Ga0495582_0100804 Ga0495582_0100804_172_1566 446
1039 3300046475 Ga0495639_0005177 Ga0495639_0005177_923_2308 446
1040 3300046477 Ga0495664_0008000 Ga0495664_0008000_4275_5717 446
1041 3300046477 Ga0495664_0074724 Ga0495664_0074724_583_1968 446
1042 3300046499 Ga0495594_0001396 Ga0495594_0001396_9798_11240 446
1043 3300046511 Ga0495608_0000832 Ga0495608_0000832_6293_7759 446
1044 3300046514 Ga0495618_0019644 Ga0495618_0019644_639_2105 446
1045 3300046516 Ga0495628_0067228 Ga0495628_0067228_747_2213 446
1046 3300046517 Ga0495630_0030591 Ga0495630_0030591_1192_2634 446
1047 3300046524 Ga0495648_0008413 Ga0495648_0008413_6403_7788 446
1048 3300046529 Ga0495652_0023871 Ga0495652_0023871_933_2399 446
1049 3300046529 Ga0495652_0074114 Ga0495652_0074114_1219_2661 446
1050 3300046531 Ga0495665_0002572 Ga0495665_0002572_3680_5122 446
1051 3300046533 Ga0495640_0021984 Ga0495640_0021984_692_2077 446
1052 3300046535 Ga0495586_0052757 Ga0495586_0052757_562_1947 446
1053 3300046536 Ga0495587_0014270 Ga0495587_0014270_2630_4096 446
1054 3300046557 Ga0495622_0073150 Ga0495622_0073150_78_1520 446
1055 3300046559 Ga0495667_0003082 Ga0495667_0003082_9309_10775 446
1056 3300046559 Ga0495667_0005379 Ga0495667_0005379_408_1850 446
1057 3300046559 Ga0495667_0029156 Ga0495667_0029156_1683_3068 446
1058 3300046642 Ga0495634_0003609 Ga0495634_0003609_8155_9597 446
1059 3300046642 Ga0495634_0006837 Ga0495634_0006837_2506_3972 446
1060 3300046663 Ga0495635_0001348 Ga0495635_0001348_2129_3571 446
1061 3300046663 Ga0495635_0001667 Ga0495635_0001667_12942_14408 446
1062 3300046663 Ga0495635_0014408 Ga0495635_0014408_614_1999 446
1063 3300046663 Ga0495635_0026385 Ga0495635_0026385_2430_3815 446
1064 3300046664 Ga0495659_0013930 Ga0495659_0013930_477_1862 446
1065 3300046674 Ga0495588_0026608 Ga0495588_0026608_1092_2534 446
1066 3300046675 Ga0495657_0033520 Ga0495657_0033520_1700_3166 446
1067 3300046675 Ga0495657_0044165 Ga0495657_0044165_1249_2634 446
1068 3300046678 Ga0495599_0006501 Ga0495599_0006501_4121_5587 446
1069 3300046679 Ga0495623_0007128 Ga0495623_0007128_685_2151 446
1070 3300046680 Ga0495646_0010792 Ga0495646_0010792_846_2312 446
1071 3300046680 Ga0495646_0081565 Ga0495646_0081565_426_1868 446
1072 3300046690 Ga0495624_0002275 Ga0495624_0002275_10489_11931 446
1073 3300046809 Ga0495600_0071798 Ga0495600_0071798_259_1725 446
1074 3300047315 Ga0495581_0000851 Ga0495581_0000851_11944_13386 446
1075 3300047315 Ga0495581_0005368 Ga0495581_0005368_3043_4428 446
1076 3300047317 Ga0495604_0008438 Ga0495604_0008438_2805_4190 446
1077 3300047317 Ga0495604_0084461 Ga0495604_0084461_811_2277 446
1078 3300047319 Ga0495674_0000559 Ga0495674_0000559_12752_14194 446
1079 3300047320 Ga0495672_0100931 Ga0495672_0100931_162_1544 446
1080 3300047322 Ga0495680_0036826 Ga0495680_0036826_1498_2964 446
1081 3300047444 Ga0495675_0024047 Ga0495675_0024047_950_2416 446
1082 3300047471 Ga0495684_0005198 Ga0495684_0005198_409_1875 446
1083 3300047673 Ga0495593_0000606 Ga0495593_0000606_14907_16349 446
1084 3300047673 Ga0495593_0000953 Ga0495593_0000953_4365_5831 446
1085 3300048089 Ga0495614_0011184 Ga0495614_0011184_1243_2685 446
1086 3300048903 Ga0496100_0009429 Ga0496100_0009429_1107_2492 446
1087 3300048904 Ga0496101_0023426 Ga0496101_0023426_127_1512 446
1088 3300048905 Ga0496102_0167526 Ga0496102_0167526_327_1712 446
1089 3300048907 Ga0496104_0003501 Ga0496104_0003501_1395_2780 446
1090 3300048907 Ga0496104_0009306 Ga0496104_0009306_2232_3629 446
1091 3300048907 Ga0496104_0013196 Ga0496104_0013196_4835_6232 446
1092 3300048908 Ga0496105_0019841 Ga0496105_0019841_3162_4559 446
1093 3300048909 Ga0496106_0075706 Ga0496106_0075706_1109_2536 446
1094 3300048910 Ga0496107_0001922 Ga0496107_0001922_2758_4185 446
1095 3300048911 Ga0496108_0032499 Ga0496108_0032499_289_1674 446
1096 3300048911 Ga0496108_0097387 Ga0496108_0097387_566_1993 446
1097 3300048912 Ga0496109_0035557 Ga0496109_0035557_2878_4263 446
1098 3300048912 Ga0496109_0262605 Ga0496109_0262605_66_1451 446
1099 3300048913 Ga0496110_0005741 Ga0496110_0005741_7899_9284 446
1100 3300048913 Ga0496110_0039631 Ga0496110_0039631_342_1727 446
1101 3300048913 Ga0496110_0075322 Ga0496110_0075322_24_1409 446
1102 3300048914 Ga0496111_0035729 Ga0496111_0035729_135_1520 446
1103 3300048914 Ga0496111_0078761 Ga0496111_0078761_870_2255 446
1104 3300048914 Ga0496111_0103383 Ga0496111_0103383_484_1911 446
1105 3300048915 Ga0496112_0034574 Ga0496112_0034574_2625_4010 446
1106 3300048915 Ga0496112_0067283 Ga0496112_0067283_1213_2598 446
1107 3300048915 Ga0496112_0095342 Ga0496112_0095342_1175_2572 446
1108 3300048915 Ga0496112_0096518 Ga0496112_0096518_437_1828 446
1109 3300048916 Ga0496113_0074000 Ga0496113_0074000_741_2138 446
1110 3300048917 Ga0496114_0003638 Ga0496114_0003638_1641_3026 446
1111 3300048918 Ga0496115_0002584 Ga0496115_0002584_686_2113 446
1112 3300048918 Ga0496115_0031895 Ga0496115_0031895_101_1498 446
1113 3300048920 Ga0496117_0110843 Ga0496117_0110843_230_1615 446
1114 3300048924 Ga0496121_0001006 Ga0496121_0001006_38169_39554 446
1115 3300049459 Ga0495678_018166 Ga0495678_018166_269_1654 446
1116 3300050490 nmdc:mga03n38_1633_c1 nmdc:mga03n38_1633_c1_1915_3300 446
1117 3300050494 nmdc:mga06z11_110024_c1 nmdc:mga06z11_110024_c1_98_1483 446
1118 3300050496 nmdc:mga07m45_61814_c1 nmdc:mga07m45_61814_c1_262_1647 446
1119 3300050507 nmdc:mga05p37_80496_c1 nmdc:mga05p37_80496_c1_1753_3135 446
1120 3300050509 nmdc:mga0qj67_56258_c1 nmdc:mga0qj67_56258_c1_898_2298 446
1121 3300050509 nmdc:mga0qj67_933_c1 nmdc:mga0qj67_933_c1_11432_12814 446
1122 3300050512 nmdc:mga0n895_64657_c1 nmdc:mga0n895_64657_c1_654_2051 446
1123 3300053077 Ga0495601_0056086 Ga0495601_0056086_20_1414 446
1124 3300053079 Ga0500610_0056426 Ga0500610_0056426_15_1463 446
1125 3300053084 Ga0495595_0000696 Ga0495595_0000696_3462_4928 446
1126 3300053085 Ga0495619_0000966 Ga0495619_0000966_9187_10653 446
1127 3300053085 Ga0495619_0033264 Ga0495619_0033264_749_2134 446
1128 3300053094 Ga0500566_0001280 Ga0500566_0001280_13010_14407 446
1129 3300053095 Ga0500640_048834 Ga0500640_048834_416_1813 446
1130 3300053096 Ga0500641_0007284 Ga0500641_0007284_1812_3197 446
1131 3300053102 Ga0500554_002430 Ga0500554_002430_2003_3388 446
1132 3300053111 Ga0500572_000559 Ga0500572_000559_180_1577 446
1133 3300053123 Ga0500614_001873 Ga0500614_001873_207_1604 446
1134 3300053130 Ga0500642_0066964 Ga0500642_0066964_26_1411 446
1135 3300053134 Ga0500658_0016238 Ga0500658_0016238_905_2290 446
1136 3300053136 Ga0500559_0008368 Ga0500559_0008368_323_1720 446
1137 3300053150 Ga0500603_000423 Ga0500603_000423_9513_10910 446
1138 3300053150 Ga0500603_002454 Ga0500603_002454_624_2009 446
1139 3300053159 Ga0500630_001193 Ga0500630_001193_10631_12028 446
1140 3300053163 Ga0500639_000025 Ga0500639_000025_83257_84654 446
1141 3300053178 Ga0500637_0000655 Ga0500637_0000655_10884_12275 446
1142 3300053178 Ga0500637_0008929 Ga0500637_0008929_336_1721 446
1143 3300053735 Ga0500596_001197 Ga0500596_001197_10_1407 446
1144 3300054114 Ga0501084_0167955 Ga0501084_0167955_444_1829 446
1145 3300061719 Ga0466962_0066665 Ga0466962_0066665_221_1603 446
1146 iso_pu_bacteria 2513237137 2513858194 446
1147 iso_pu_bacteria 2517572143 2517893917 446
1148 iso_pu_bacteria 3005474847 3005478648 446
1149 iso_pu_bacteria 8019555841 8019558477 446
1150 iso_pu_bacteria 8019565922 8019566820 446
1151 2209111006 2214745205 2213754696 447
1152 3300000041 ARcpr5oldR_c000087 ARcpr5oldR_00008712 447
1153 3300000042 ARSoilYngRDRAFT_c00048 ARSoilYngRDRAFT_000486 447
1154 3300000043 ARcpr5yngRDRAFT_c000112 ARcpr5yngRDRAFT_0001123 447
1155 3300000044 ARSoilOldRDRAFT_c000094 ARSoilOldRDRAFT_00009412 447
1156 3300000652 ARCol0yngRDRAFT_1000121 ARCol0yngRDRAFT_100012110 447
1157 3300001989 JGI24739J22299_10002910 JGI24739J22299_100029102 447
1158 3300001990 JGI24737J22298_10001520 JGI24737J22298_100015205 447
1159 3300001991 JGI24743J22301_10002453 JGI24743J22301_100024533 447
1160 3300002070 JGI24750J21931_1000426 JGI24750J21931_10004262 447
1161 3300002073 JGI24745J21846_1000426 JGI24745J21846_10004262 447
1162 3300002074 JGI24748J21848_1000786 JGI24748J21848_10007863 447
1163 3300002075 JGI24738J21930_10000707 JGI24738J21930_100007076 447
1164 3300002076 JGI24749J21850_1001137 JGI24749J21850_10011373 447
1165 3300002077 JGI24744J21845_10004543 JGI24744J21845_100045432 447
1166 3300002126 JGI24035J26624_1000282 JGI24035J26624_10002822 447
1167 3300002239 JGI24034J26672_10000879 JGI24034J26672_100008792 447
1168 3300002244 JGI24742J22300_10001239 JGI24742J22300_100012392 447
1169 3300002459 JGI24751J29686_10004754 JGI24751J29686_100047542 447
1170 3300003659 JGI25404J52841_10002956 JGI25404J52841_100029562 447
1171 3300005289 Ga0065704_10002258 Ga0065704_100022587 447
1172 3300005290 Ga0065712_10068851 Ga0065712_100688512 447
1173 3300005290 Ga0065712_10075439 Ga0065712_100754393 447
1174 3300005293 Ga0065715_10093263 Ga0065715_100932635 447
1175 3300005293 Ga0065715_10105949 Ga0065715_101059492 447
1176 3300005295 Ga0065707_10098445 Ga0065707_100984453 447
1177 3300005328 Ga0070676_10022543 Ga0070676_100225432 447
1178 3300005330 Ga0070690_100012396 Ga0070690_1000123962 447
1179 3300005331 Ga0070670_100041518 Ga0070670_1000415183 447
1180 3300005333 Ga0070677_10000893 Ga0070677_100008936 447
1181 3300005334 Ga0068869_100007674 Ga0068869_1000076742 447
1182 3300005335 Ga0070666_10031431 Ga0070666_100314312 447
1183 3300005336 Ga0070680_100022312 Ga0070680_1000223125 447
1184 3300005337 Ga0070682_100030025 Ga0070682_1000300252 447
1185 3300005338 Ga0068868_100006926 Ga0068868_1000069266 447
1186 3300005339 Ga0070660_100008270 Ga0070660_1000082706 447
1187 3300005339 Ga0070660_100123502 Ga0070660_1001235022 447
1188 3300005340 Ga0070689_100016937 Ga0070689_1000169375 447
1189 3300005341 Ga0070691_10005653 Ga0070691_100056535 447
1190 3300005343 Ga0070687_100004982 Ga0070687_1000049825 447
1191 3300005344 Ga0070661_100020584 Ga0070661_1000205844 447
1192 3300005345 Ga0070692_10002117 Ga0070692_100021176 447
1193 3300005347 Ga0070668_100015686 Ga0070668_1000156865 447
1194 3300005353 Ga0070669_100016043 Ga0070669_1000160434 447
1195 3300005354 Ga0070675_100038825 Ga0070675_1000388253 447
1196 3300005355 Ga0070671_100031211 Ga0070671_1000312115 447
1197 3300005356 Ga0070674_100008724 Ga0070674_1000087243 447
1198 3300005356 Ga0070674_100085197 Ga0070674_1000851971 447
1199 3300005364 Ga0070673_100002682 Ga0070673_1000026822 447
1200 3300005365 Ga0070688_100004383 Ga0070688_1000043835 447
1201 3300005366 Ga0070659_100004732 Ga0070659_1000047326 447
1202 3300005367 Ga0070667_100029364 Ga0070667_1000293644 447
1203 3300005367 Ga0070667_100100389 Ga0070667_1001003892 447
1204 3300005406 Ga0070703_10017295 Ga0070703_100172952 447
1205 3300005434 Ga0070709_10005467 Ga0070709_100054676 447
1206 3300005436 Ga0070713_100002130 Ga0070713_1000021305 447
1207 3300005437 Ga0070710_10015367 Ga0070710_100153671 447
1208 3300005438 Ga0070701_10007846 Ga0070701_100078462 447
1209 3300005441 Ga0070700_100010970 Ga0070700_1000109704 447
1210 3300005444 Ga0070694_100006993 Ga0070694_1000069936 447
1211 3300005445 Ga0070708_100022450 Ga0070708_1000224502 447
1212 3300005455 Ga0070663_100026359 Ga0070663_1000263593 447
1213 3300005456 Ga0070678_100023744 Ga0070678_1000237445 447
1214 3300005456 Ga0070678_100033206 Ga0070678_1000332062 447
1215 3300005457 Ga0070662_100013871 Ga0070662_1000138713 447
1216 3300005458 Ga0070681_10019127 Ga0070681_100191276 447
1217 3300005459 Ga0068867_100018968 Ga0068867_1000189682 447
1218 3300005466 Ga0070685_10024114 Ga0070685_100241143 447
1219 3300005466 Ga0070685_10062627 Ga0070685_100626271 447
1220 3300005530 Ga0070679_100016263 Ga0070679_1000162634 447
1221 3300005535 Ga0070684_100042489 Ga0070684_1000424892 447
1222 3300005535 Ga0070684_100056596 Ga0070684_1000565963 447
1223 3300005543 Ga0070672_100010094 Ga0070672_1000100943 447
1224 3300005543 Ga0070672_100060655 Ga0070672_1000606551 447
1225 3300005544 Ga0070686_100001845 Ga0070686_1000018459 447
1226 3300005545 Ga0070695_100003597 Ga0070695_1000035975 447
1227 3300005546 Ga0070696_100013188 Ga0070696_1000131883 447
1228 3300005547 Ga0070693_100014637 Ga0070693_1000146373 447
1229 3300005547 Ga0070693_100020390 Ga0070693_1000203902 447
1230 3300005548 Ga0070665_100102801 Ga0070665_1001028013 447
1231 3300005549 Ga0070704_100003777 Ga0070704_1000037777 447
1232 3300005549 Ga0070704_100010479 Ga0070704_1000104792 447
1233 3300005563 Ga0068855_100147013 Ga0068855_1001470132 447
1234 3300005564 Ga0070664_100057460 Ga0070664_1000574603 447
1235 3300005577 Ga0068857_100000825 Ga0068857_1000008256 447
1236 3300005578 Ga0068854_100005746 Ga0068854_1000057465 447
1237 3300005614 Ga0068856_100004702 Ga0068856_1000047025 447
1238 3300005615 Ga0070702_100007181 Ga0070702_1000071812 447
1239 3300005615 Ga0070702_100027848 Ga0070702_1000278482 447
1240 3300005616 Ga0068852_100005334 Ga0068852_1000053345 447
1241 3300005617 Ga0068859_100012382 Ga0068859_1000123825 447
1242 3300005618 Ga0068864_100003085 Ga0068864_1000030856 447
1243 3300005718 Ga0068866_10001247 Ga0068866_100012479 447
1244 3300005719 Ga0068861_100018109 Ga0068861_1000181092 447
1245 3300005719 Ga0068861_100018613 Ga0068861_1000186133 447
1246 3300005840 Ga0068870_10011056 Ga0068870_100110563 447
1247 3300005841 Ga0068863_100020493 Ga0068863_1000204932 447
1248 3300005841 Ga0068863_100093151 Ga0068863_1000931512 447
1249 3300005842 Ga0068858_100063302 Ga0068858_1000633023 447
1250 3300005843 Ga0068860_100026283 Ga0068860_1000262835 447
1251 3300005843 Ga0068860_100077921 Ga0068860_1000779212 447
1252 3300005844 Ga0068862_100010699 Ga0068862_1000106994 447
1253 3300005937 Ga0081455_10000200 Ga0081455_1000020062 447
1254 3300005937 Ga0081455_10067882 Ga0081455_100678821 447
1255 3300005983 Ga0081540_1000726 Ga0081540_10007266 447
1256 3300005983 Ga0081540_1009787 Ga0081540_10097872 447
1257 3300006028 Ga0070717_10002186 Ga0070717_100021864 447
1258 3300006058 Ga0075432_10007773 Ga0075432_100077731 447
1259 3300006163 Ga0070715_10000420 Ga0070715_100004203 447
1260 3300006178 Ga0075367_10013796 Ga0075367_100137963 447
1261 3300006178 Ga0075367_10021373 Ga0075367_100213734 447
1262 3300006195 Ga0075366_10049192 Ga0075366_100491922 447
1263 3300006237 Ga0097621_100018375 Ga0097621_1000183754 447
1264 3300006353 Ga0075370_10036524 Ga0075370_100365242 447
1265 3300006358 Ga0068871_100017948 Ga0068871_1000179484 447
1266 3300006844 Ga0075428_100003399 Ga0075428_10000339910 447
1267 3300006846 Ga0075430_100000133 Ga0075430_10000013312 447
1268 3300006847 Ga0075431_100002259 Ga0075431_1000022597 447
1269 3300006852 Ga0075433_10000506 Ga0075433_1000050615 447
1270 3300006852 Ga0075433_10159343 Ga0075433_101593431 447
1271 3300006871 Ga0075434_100000472 Ga0075434_10000047214 447
1272 3300006871 Ga0075434_100001125 Ga0075434_10000112515 447
1273 3300006871 Ga0075434_100080376 Ga0075434_1000803762 447
1274 3300006880 Ga0075429_100000163 Ga0075429_10000016312 447
1275 3300006881 Ga0068865_100006160 Ga0068865_1000061606 447
1276 3300006931 Ga0097620_100012381 Ga0097620_1000123815 447
1277 3300007076 Ga0075435_100005547 Ga0075435_1000055475 447
1278 3300007076 Ga0075435_100006632 Ga0075435_1000066326 447
1279 3300007076 Ga0075435_100076789 Ga0075435_1000767893 447
1280 3300007788 Ga0099795_10000216 Ga0099795_100002165 447
1281 3300009093 Ga0105240_10020880 Ga0105240_100208803 447
1282 3300009094 Ga0111539_10000389 Ga0111539_1000038938 447
1283 3300009094 Ga0111539_10004544 Ga0111539_100045449 447
1284 3300009094 Ga0111539_10005183 Ga0111539_100051839 447
1285 3300009098 Ga0105245_10004886 Ga0105245_100048862 447
1286 3300009101 Ga0105247_10003705 Ga0105247_100037052 447
1287 3300009101 Ga0105247_10040980 Ga0105247_100409803 447
1288 3300009147 Ga0114129_10021030 Ga0114129_100210308 447
1289 3300009147 Ga0114129_10046959 Ga0114129_100469594 447
1290 3300009148 Ga0105243_10006915 Ga0105243_100069152 447
1291 3300009148 Ga0105243_10016177 Ga0105243_100161775 447
1292 3300009174 Ga0105241_10018500 Ga0105241_100185002 447
1293 3300009176 Ga0105242_10005843 Ga0105242_100058438 447
1294 3300009177 Ga0105248_10008593 Ga0105248_100085933 447
1295 3300009177 Ga0105248_10030646 Ga0105248_100306466 447
1296 3300009545 Ga0105237_10025782 Ga0105237_100257826 447
1297 3300009545 Ga0105237_10031793 Ga0105237_100317935 447
1298 3300009545 Ga0105237_10134246 Ga0105237_101342462 447
1299 3300009553 Ga0105249_10094744 Ga0105249_100947441 447
1300 3300010159 Ga0099796_10000421 Ga0099796_100004211 447
1301 3300010375 Ga0105239_10058713 Ga0105239_100587131 447
1302 3300010375 Ga0105239_10216347 Ga0105239_102163472 447
1303 3300011119 Ga0105246_10017018 Ga0105246_100170184 447
1304 3300011119 Ga0105246_10030521 Ga0105246_100305213 447
1305 3300013100 Ga0157373_10150890 Ga0157373_101508902 447
1306 3300013102 Ga0157371_10023732 Ga0157371_100237322 447
1307 3300013296 Ga0157374_10010540 Ga0157374_100105402 447
1308 3300013297 Ga0157378_10007681 Ga0157378_100076812 447
1309 3300013306 Ga0163162_10039006 Ga0163162_100390062 447
1310 3300013307 Ga0157372_10031288 Ga0157372_100312885 447
1311 3300013308 Ga0157375_10037929 Ga0157375_100379292 447
1312 3300013308 Ga0157375_10076771 Ga0157375_100767712 447
1313 3300013308 Ga0157375_10431132 Ga0157375_104311321 447
1314 3300014325 Ga0163163_10004872 Ga0163163_100048725 447
1315 3300014325 Ga0163163_10009467 Ga0163163_100094676 447
1316 3300014326 Ga0157380_10001774 Ga0157380_100017749 447
1317 3300014745 Ga0157377_10003064 Ga0157377_100030646 447
1318 3300014968 Ga0157379_10031492 Ga0157379_100314923 447
1319 3300014968 Ga0157379_10058893 Ga0157379_100588932 447
1320 3300014969 Ga0157376_10004003 Ga0157376_100040039 447
1321 3300017792 Ga0163161_10003456 Ga0163161_100034566 447
1322 3300025271 Ga0207666_1000077 Ga0207666_10000776 447
1323 3300025290 Ga0207673_1000891 Ga0207673_10008912 447
1324 3300025315 Ga0207697_10001615 Ga0207697_100016153 447
1325 3300025893 Ga0207682_10000009 Ga0207682_1000000974 447
1326 3300025893 Ga0207682_10007879 Ga0207682_100078793 447
1327 3300025899 Ga0207642_10011334 Ga0207642_100113343 447
1328 3300025900 Ga0207710_10023791 Ga0207710_100237912 447
1329 3300025901 Ga0207688_10001372 Ga0207688_100013726 447
1330 3300025901 Ga0207688_10015227 Ga0207688_100152273 447
1331 3300025903 Ga0207680_10055095 Ga0207680_100550952 447
1332 3300025904 Ga0207647_10006480 Ga0207647_100064806 447
1333 3300025907 Ga0207645_10002502 Ga0207645_100025029 447
1334 3300025908 Ga0207643_10000292 Ga0207643_1000029237 447
1335 3300025911 Ga0207654_10015148 Ga0207654_100151483 447
1336 3300025912 Ga0207707_10002931 Ga0207707_100029316 447
1337 3300025914 Ga0207671_10066825 Ga0207671_100668253 447
1338 3300025917 Ga0207660_10000893 Ga0207660_100008936 447
1339 3300025918 Ga0207662_10000861 Ga0207662_100008617 447
1340 3300025918 Ga0207662_10064505 Ga0207662_100645052 447
1341 3300025919 Ga0207657_10003725 Ga0207657_100037259 447
1342 3300025919 Ga0207657_10036461 Ga0207657_100364612 447
1343 3300025920 Ga0207649_10004064 Ga0207649_100040646 447
1344 3300025921 Ga0207652_10002516 Ga0207652_100025165 447
1345 3300025923 Ga0207681_10008223 Ga0207681_100082232 447
1346 3300025923 Ga0207681_10014965 Ga0207681_100149653 447
1347 3300025925 Ga0207650_10045906 Ga0207650_100459061 447
1348 3300025926 Ga0207659_10001554 Ga0207659_100015546 447
1349 3300025927 Ga0207687_10001197 Ga0207687_100011978 447
1350 3300025927 Ga0207687_10006940 Ga0207687_100069406 447
1351 3300025928 Ga0207700_10023730 Ga0207700_100237305 447
1352 3300025931 Ga0207644_10001963 Ga0207644_1000196310 447
1353 3300025931 Ga0207644_10014948 Ga0207644_100149483 447
1354 3300025932 Ga0207690_10005575 Ga0207690_100055757 447
1355 3300025933 Ga0207706_10002827 Ga0207706_100028279 447
1356 3300025933 Ga0207706_10024198 Ga0207706_100241983 447
1357 3300025933 Ga0207706_10095387 Ga0207706_100953872 447
1358 3300025934 Ga0207686_10001310 Ga0207686_100013109 447
1359 3300025934 Ga0207686_10001988 Ga0207686_100019888 447
1360 3300025935 Ga0207709_10002910 Ga0207709_100029104 447
1361 3300025935 Ga0207709_10009749 Ga0207709_100097494 447
1362 3300025935 Ga0207709_10016042 Ga0207709_100160424 447
1363 3300025936 Ga0207670_10010411 Ga0207670_100104115 447
1364 3300025937 Ga0207669_10000909 Ga0207669_100009097 447
1365 3300025938 Ga0207704_10004639 Ga0207704_100046396 447
1366 3300025939 Ga0207665_10008638 Ga0207665_100086383 447
1367 3300025940 Ga0207691_10005519 Ga0207691_100055199 447
1368 3300025940 Ga0207691_10025609 Ga0207691_100256094 447
1369 3300025941 Ga0207711_10001144 Ga0207711_100011445 447
1370 3300025941 Ga0207711_10037712 Ga0207711_100377123 447
1371 3300025942 Ga0207689_10001448 Ga0207689_100014486 447
1372 3300025944 Ga0207661_10002433 Ga0207661_100024335 447
1373 3300025945 Ga0207679_10003604 Ga0207679_100036042 447
1374 3300025945 Ga0207679_10075413 Ga0207679_100754132 447
1375 3300025960 Ga0207651_10047471 Ga0207651_100474713 447
1376 3300025961 Ga0207712_10003650 Ga0207712_100036506 447
1377 3300025972 Ga0207668_10001981 Ga0207668_100019819 447
1378 3300025981 Ga0207640_10003763 Ga0207640_100037636 447
1379 3300025986 Ga0207658_10031138 Ga0207658_100311383 447
1380 3300026035 Ga0207703_10017302 Ga0207703_100173024 447
1381 3300026035 Ga0207703_10023676 Ga0207703_100236765 447
1382 3300026035 Ga0207703_10031824 Ga0207703_100318242 447
1383 3300026041 Ga0207639_10040853 Ga0207639_100408532 447
1384 3300026041 Ga0207639_10051630 Ga0207639_100516303 447
1385 3300026067 Ga0207678_10002714 Ga0207678_100027146 447
1386 3300026067 Ga0207678_10006709 Ga0207678_100067094 447
1387 3300026075 Ga0207708_10003108 Ga0207708_100031089 447
1388 3300026088 Ga0207641_10009054 Ga0207641_100090544 447
1389 3300026089 Ga0207648_10003666 Ga0207648_100036669 447
1390 3300026095 Ga0207676_10010622 Ga0207676_100106224 447
1391 3300026095 Ga0207676_10016879 Ga0207676_100168791 447
1392 3300026116 Ga0207674_10024031 Ga0207674_100240312 447
1393 3300026118 Ga0207675_100005413 Ga0207675_1000054133 447
1394 3300026118 Ga0207675_100039892 Ga0207675_1000398924 447
1395 3300026121 Ga0207683_10000782 Ga0207683_1000078213 447
1396 3300026121 Ga0207683_10001222 Ga0207683_100012226 447
1397 3300026142 Ga0207698_10045774 Ga0207698_100457743 447
1398 3300027617 Ga0210002_1003574 Ga0210002_10035741 447
1399 3300027717 Ga0209998_10001207 Ga0209998_100012075 447
1400 3300027876 Ga0209974_10001210 Ga0209974_100012105 447
1401 3300027876 Ga0209974_10020357 Ga0209974_100203572 447
1402 3300027907 Ga0207428_10000164 Ga0207428_1000016437 447
1403 3300027907 Ga0207428_10000391 Ga0207428_1000039138 447
1404 3300027907 Ga0207428_10002684 Ga0207428_100026847 447
1405 3300028379 Ga0268266_10005300 Ga0268266_1000530010 447
1406 3300028381 Ga0268264_10007183 Ga0268264_100071836 447
1407 3300028381 Ga0268264_10124929 Ga0268264_101249291 447
1408 3300028794 Ga0307515_10008473 Ga0307515_1000847315 447
1409 3300031250 Ga0265331_10025683 Ga0265331_100256832 447
1410 3300031344 Ga0265316_10109432 Ga0265316_101094322 447
1411 3300031711 Ga0265314_10127697 Ga0265314_101276971 447
1412 3300034818 Ga0373950_0000340 Ga0373950_0000340_2439_3824 447
1413 3300034819 Ga0373958_0000223 Ga0373958_0000223_4617_6002 447
1414 3300034820 Ga0373959_0000418 Ga0373959_0000418_2550_3935 447
1415 3300034957 Ga0373938_0000580 Ga0373938_0000580_2778_4163 447
1416 3300035084 Ga0373928_0000151 Ga0373928_0000151_3175_4560 447
1417 3300035085 Ga0373929_0001036 Ga0373929_0001036_433_1818 447
1418 3300035088 Ga0373940_0003150 Ga0373940_0003150_258_1643 447
1419 3300035090 Ga0373949_0001703 Ga0373949_0001703_689_2074 447
1420 3300035091 Ga0373951_0000232 Ga0373951_0000232_5618_7003 447
1421 3300035092 Ga0373952_0000567 Ga0373952_0000567_26_1411 447
1422 3300035111 Ga0373923_0000595 Ga0373923_0000595_5646_7034 447
1423 3300035112 Ga0373932_0000366 Ga0373932_0000366_1572_2957 447
1424 3300035113 Ga0373936_0028657 Ga0373936_0028657_45_1433 447
1425 3300035114 Ga0373939_0000753 Ga0373939_0000753_4610_5995 447
1426 3300035114 Ga0373939_0006530 Ga0373939_0006530_1018_2403 447
1427 3300035115 Ga0373941_0001679 Ga0373941_0001679_2493_3878 447
1428 3300035117 Ga0373953_0005683 Ga0373953_0005683_2203_3591 447
1429 3300035118 Ga0373954_0000951 Ga0373954_0000951_1219_2607 447
1430 3300035170 Ga0373943_0066244 Ga0373943_0066244_359_1747 447
1431 3300035171 Ga0373946_0018323 Ga0373946_0018323_584_1972 447
1432 3300035172 Ga0373955_0030797 Ga0373955_0030797_1192_2580 447
1433 3300035207 Ga0373942_0000780 Ga0373942_0000780_7228_8613 447
1434 3300035241 Ga0373961_0004799 Ga0373961_0004799_1723_3111 447
1435 3300035242 Ga0373962_0001878 Ga0373962_0001878_3515_4900 447
1436 3300035410 Ga0373924_0030057 Ga0373924_0030057_31_1419 447
1437 3300035691 Ga0373931_0010679 Ga0373931_0010679_2130_3515 447
1438 3300035691 Ga0373931_0010912 Ga0373931_0010912_699_2084 447
1439 3300035691 Ga0373931_0113141 Ga0373931_0113141_69_1457 447
1440 3300035692 Ga0373935_0019417 Ga0373935_0019417_1831_3219 447
1441 3300035695 Ga0373927_0014279 Ga0373927_0014279_2361_3749 447
1442 3300035724 Ga0373933_0002546 Ga0373933_0002546_3181_4569 447
1443 3300035725 Ga0373947_0040432 Ga0373947_0040432_451_1839 447
1444 3300035725 Ga0373947_0063903 Ga0373947_0063903_537_1925 447
1445 3300036401 Ga0373937_0116753 Ga0373937_0116753_295_1683 447
1446 3300037068 Ga0373925_0007900 Ga0373925_0007900_1662_3050 447
1447 3300042436 Ga0439435_0001852 Ga0439435_0001852_2554_3951 447
1448 3300045051 Ga0451576_0017298 Ga0451576_0017298_4055_5440 447
1449 3300046454 Ga0495592_0006322 Ga0495592_0006322_2310_3698 447
1450 3300046455 Ga0495603_0021588 Ga0495603_0021588_410_1798 447
1451 3300046455 Ga0495603_0033822 Ga0495603_0033822_1281_2669 447
1452 3300046459 Ga0495629_0000139 Ga0495629_0000139_24012_25400 447
1453 3300046460 Ga0495638_0054119 Ga0495638_0054119_547_1941 447
1454 3300046461 Ga0495641_0007101 Ga0495641_0007101_5682_7070 447
1455 3300046461 Ga0495641_0011896 Ga0495641_0011896_3416_4804 447
1456 3300046463 Ga0495653_0001537 Ga0495653_0001537_8329_9717 447
1457 3300046472 Ga0495580_0034637 Ga0495580_0034637_1027_2415 447
1458 3300046477 Ga0495664_0000915 Ga0495664_0000915_8555_9943 447
1459 3300046477 Ga0495664_0009369 Ga0495664_0009369_3790_5178 447
1460 3300046491 Ga0495584_0001897 Ga0495584_0001897_105_1493 447
1461 3300046492 Ga0495585_0094128 Ga0495585_0094128_103_1491 447
1462 3300046499 Ga0495594_0020533 Ga0495594_0020533_335_1723 447
1463 3300046501 Ga0495607_0006400 Ga0495607_0006400_12_1400 447
1464 3300046511 Ga0495608_0042381 Ga0495608_0042381_437_1825 447
1465 3300046514 Ga0495618_0061547 Ga0495618_0061547_136_1524 447
1466 3300046517 Ga0495630_0018196 Ga0495630_0018196_3278_4666 447
1467 3300046520 Ga0495637_0015591 Ga0495637_0015591_1450_2838 447
1468 3300046529 Ga0495652_0017901 Ga0495652_0017901_4563_5951 447
1469 3300046529 Ga0495652_0040925 Ga0495652_0040925_76_1464 447
1470 3300046531 Ga0495665_0002145 Ga0495665_0002145_6246_7634 447
1471 3300046533 Ga0495640_0017266 Ga0495640_0017266_1216_2604 447
1472 3300046533 Ga0495640_0094870 Ga0495640_0094870_209_1597 447
1473 3300046536 Ga0495587_0017630 Ga0495587_0017630_3005_4393 447
1474 3300046543 Ga0495645_0087492 Ga0495645_0087492_370_1758 447
1475 3300046558 Ga0495633_0002146 Ga0495633_0002146_6342_7730 447
1476 3300046559 Ga0495667_0037964 Ga0495667_0037964_321_1709 447
1477 3300046615 Ga0495656_0000091 Ga0495656_0000091_12812_14200 447
1478 3300046663 Ga0495635_0005923 Ga0495635_0005923_2879_4267 447
1479 3300046664 Ga0495659_0003716 Ga0495659_0003716_200_1588 447
1480 3300046674 Ga0495588_0007030 Ga0495588_0007030_61_1449 447
1481 3300046678 Ga0495599_0035992 Ga0495599_0035992_386_1774 447
1482 3300046680 Ga0495646_0002199 Ga0495646_0002199_5386_6774 447
1483 3300046683 Ga0495658_0000065 Ga0495658_0000065_14040_15428 447
1484 3300046683 Ga0495658_0062648 Ga0495658_0062648_655_2043 447
1485 3300046684 Ga0495669_0035333 Ga0495669_0035333_24_1409 447
1486 3300046689 Ga0495613_0002672 Ga0495613_0002672_493_1881 447
1487 3300046690 Ga0495624_0001939 Ga0495624_0001939_8252_9640 447
1488 3300046690 Ga0495624_0049899 Ga0495624_0049899_1182_2570 447
1489 3300046691 Ga0495670_0000199 Ga0495670_0000199_16019_17407 447
1490 3300046794 Ga0495589_0061358 Ga0495589_0061358_106_1494 447
1491 3300046809 Ga0495600_0005269 Ga0495600_0005269_209_1597 447
1492 3300046809 Ga0495600_0076891 Ga0495600_0076891_446_1834 447
1493 3300047315 Ga0495581_0009905 Ga0495581_0009905_3970_5358 447
1494 3300047319 Ga0495674_0073683 Ga0495674_0073683_1500_2888 447
1495 3300047322 Ga0495680_0016879 Ga0495680_0016879_449_1837 447
1496 3300047471 Ga0495684_0001073 Ga0495684_0001073_2518_3906 447
1497 3300047673 Ga0495593_0002018 Ga0495593_0002018_1814_3202 447
1498 3300048088 Ga0495602_0117562 Ga0495602_0117562_658_2046 447
1499 3300048903 Ga0496100_0001531 Ga0496100_0001531_5563_6948 447
1500 3300048904 Ga0496101_0002275 Ga0496101_0002275_9645_11030 447
1501 3300048904 Ga0496101_0015686 Ga0496101_0015686_2590_3978 447
1502 3300048905 Ga0496102_0004237 Ga0496102_0004237_521_1906 447
1503 3300048905 Ga0496102_0009466 Ga0496102_0009466_71_1459 447
1504 3300048905 Ga0496102_0072006 Ga0496102_0072006_883_2268 447
1505 3300048906 Ga0496103_0032074 Ga0496103_0032074_22_1407 447
1506 3300048907 Ga0496104_0115067 Ga0496104_0115067_1130_2518 447
1507 3300048909 Ga0496106_0015208 Ga0496106_0015208_1845_3233 447
1508 3300048910 Ga0496107_0005227 Ga0496107_0005227_198_1583 447
1509 3300048911 Ga0496108_0057939 Ga0496108_0057939_1857_3242 447
1510 3300048911 Ga0496108_0059583 Ga0496108_0059583_1278_2663 447
1511 3300048912 Ga0496109_0008633 Ga0496109_0008633_5440_6825 447
1512 3300048912 Ga0496109_0083342 Ga0496109_0083342_1157_2545 447
1513 3300048913 Ga0496110_0073614 Ga0496110_0073614_1061_2449 447
1514 3300048914 Ga0496111_0009563 Ga0496111_0009563_1523_2908 447
1515 3300048916 Ga0496113_0012280 Ga0496113_0012280_2956_4341 447
1516 3300048917 Ga0496114_0127904 Ga0496114_0127904_733_2121 447
1517 3300048918 Ga0496115_0013022 Ga0496115_0013022_3864_5252 447
1518 3300048918 Ga0496115_0027835 Ga0496115_0027835_2246_3631 447
1519 3300048924 Ga0496121_0003460 Ga0496121_0003460_374_1762 447
1520 3300050493 nmdc:mga0k408_48540_c1 nmdc:mga0k408_48540_c1_561_2078 447
1521 3300050494 nmdc:mga06z11_72698_c1 nmdc:mga06z11_72698_c1_36_1553 447
1522 3300050496 nmdc:mga07m45_13314_c1 nmdc:mga07m45_13314_c1_506_2023 447
1523 3300050507 nmdc:mga05p37_151_c1 nmdc:mga05p37_151_c1_44822_46210 447
1524 3300050507 nmdc:mga05p37_9089_c1 nmdc:mga05p37_9089_c1_3081_4469 447
1525 3300050508 nmdc:mga09592_1771_c1 nmdc:mga09592_1771_c1_9948_11336 447
1526 3300050509 nmdc:mga0qj67_3588_c1 nmdc:mga0qj67_3588_c1_1749_3137 447
1527 3300050511 nmdc:mga08y16_108_c1 nmdc:mga08y16_108_c1_62216_63601 447
1528 3300050511 nmdc:mga08y16_193529_c1 nmdc:mga08y16_193529_c1_23_1411 447
1529 3300050512 nmdc:mga0n895_244857_c1 nmdc:mga0n895_244857_c1_77_1465 447
1530 3300050512 nmdc:mga0n895_265_c1 nmdc:mga0n895_265_c1_10837_12225 447
1531 3300050512 nmdc:mga0n895_404_c1 nmdc:mga0n895_404_c1_20626_22011 447
1532 3300050513 nmdc:mga0rr50_10550_c1 nmdc:mga0rr50_10550_c1_3784_5172 447
1533 3300050513 nmdc:mga0rr50_173038_c1 nmdc:mga0rr50_173038_c1_196_1584 447
1534 3300050513 nmdc:mga0rr50_65104_c1 nmdc:mga0rr50_65104_c1_202_1587 447
1535 3300050515 nmdc:mga0a205_146_c1 nmdc:mga0a205_146_c1_31308_32696 447
1536 3300050515 nmdc:mga0a205_78738_c1 nmdc:mga0a205_78738_c1_116_1501 447
1537 3300053077 Ga0495601_0002986 Ga0495601_0002986_2833_4221 447
1538 3300053078 Ga0495612_0006837 Ga0495612_0006837_593_1981 447
1539 3300053078 Ga0495612_0018845 Ga0495612_0018845_209_1597 447
1540 3300053084 Ga0495595_0008608 Ga0495595_0008608_484_1872 447
1541 3300053085 Ga0495619_0001255 Ga0495619_0001255_4498_5886 447
1542 3300053085 Ga0495619_0006396 Ga0495619_0006396_3254_4642 447
1543 3300053085 Ga0495619_0047709 Ga0495619_0047709_209_1597 447
1544 3300053093 Ga0500651_0019640 Ga0500651_0019640_1934_3322 447
1545 3300053130 Ga0500642_0023818 Ga0500642_0023818_74_1462 447
1546 3300053153 Ga0500616_0068270 Ga0500616_0068270_356_1753 447

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

189

428

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.9628 87 443
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.9276 90 446
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.8922 87 443
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8883 91 406
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8768 91 406
ID Description Score Start End Superfamily
2g29A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9245 176 273 3.40.190.10
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8803 87 426 3.40.190.10
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8737 87 426 3.40.190.10
3qslB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8691 178 268 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8661 175 271 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2W5IAF3-F1-model_v4 deleted 0.9868 148 446
AF-A0A352IQL9-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9852 120 446 GO:0005886
GO:0012505
AF-A0A149VCP2-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9849 84 432 GO:0005886
GO:0012505
AF-A0A352IQL9-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9822 120 446 GO:0005886
GO:0012505
AF-A0A2W5IAF3-F1-model_v4 deleted 0.9803 148 446

Feature Viewer

pLDDT pTM Quality
85.85 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map