F494690
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1546 | 715 | 1362 | 459 |
Family's Representative Sequence
| Representative Sequence | 3300048913|Ga0496110_0003778|Ga0496110_0003778_751_2397 |
| Length | 548 |
| Sequence | VGSAAFSPERDVPRSRRGNGRAAVPAFASICSKLQRLPNKQAINFGFHPPGADRRGKSRPLQTRGLXXXLLIRAPTPVLPAGTTPERAAMSTFDNPFDPERRLNRTGCSCGRHRSQAEHDAQLALQCAQIESEDKRYQGVVASAVMRAVFPKDAARRAFLKSVGASTALAALSQLFPLKTATDVFAQGGAIEKKDLKVGFIPITCATPIIMAHPMGFYSKHGLNVEVIKTAGWAVIRDKTLNKEYDAAHMLSPMPLAITLGAGSNPMPYTMPAVENINGQAITLATKHKDKNDPKVWKGFKFAVPFDYSMHNYLLRYYVAEHGIDPDQDIQIRAVPPPEMVANLRADNIDGFLGPDPFNQRAVYDGVGFIHILSKQLWEGHPCCAFAASKEFVTTMPNTYAALLKSIIDATAFAHKAENRKEIAAAIAPANYLNQPEIVLEQILTGTYADGLGNVKRDPNRIDFDPFPWQSFAVWILTQMKRWGQIKGDVDYKAVAEQVYLATDTAKLMKEVGLTPPTTSSKSFKVMGKEFDPAKPDDYLKSFAIKRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 7 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 8 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 9 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 10 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 18 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 19 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 20 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 24 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 25 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 26 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 27 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 28 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 29 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 30 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 31 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 32 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 33 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 34 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 35 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 36 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 37 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 38 | 2791355199 | |||
| 39 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 40 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 41 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 42 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 43 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 44 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 45 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 46 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 47 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 48 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 49 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 50 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 51 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 52 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 53 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 54 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 55 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 56 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 57 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 58 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 59 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 60 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 61 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 62 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 63 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 64 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 65 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 66 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 67 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 68 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 69 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 70 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 71 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 72 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 73 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 74 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 75 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 76 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 77 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 78 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 79 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 80 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 81 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 82 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 83 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 84 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 85 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 86 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 87 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 88 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 89 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 90 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 91 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 92 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 93 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 94 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 95 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 96 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 97 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 98 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 99 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 100 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 101 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 102 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 103 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 104 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 105 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 106 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 107 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 108 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 109 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 110 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 111 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 112 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 113 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 114 | 2904699407 | |||
| 115 | 2906610324 | |||
| 116 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 117 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 118 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 119 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 120 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 121 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 122 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 123 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 124 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 125 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 126 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 127 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 128 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 129 | 2922425934 | |||
| 130 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 131 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 132 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 133 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 134 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 135 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 136 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 137 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 138 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 139 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 140 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 141 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 142 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 143 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 144 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 145 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 146 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 147 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 148 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 149 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 150 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 151 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 152 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 153 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 154 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 155 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 156 | 2941479691 | |||
| 157 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 158 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 159 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 160 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 161 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 162 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 163 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 164 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 165 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 166 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 167 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 169 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 171 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 172 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 173 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 174 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 175 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 176 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 177 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 178 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 179 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 180 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 181 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 182 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 183 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 184 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 185 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 186 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 187 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 188 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 189 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 190 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 191 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 192 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 193 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 194 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 195 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 196 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 197 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 198 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 199 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 200 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 201 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 202 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 203 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 204 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 205 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 206 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 207 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 208 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 209 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 211 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 212 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 215 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 217 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 218 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 219 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 221 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 222 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 223 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 225 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 232 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 235 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 236 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 238 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 239 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 240 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 242 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 243 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 248 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 249 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 250 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 251 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 252 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 254 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 255 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 256 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 258 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 259 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 263 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 264 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 266 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 267 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 268 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 269 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 270 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 271 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 272 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 273 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 274 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 275 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 276 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 277 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 278 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 279 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 280 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 281 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 282 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 283 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 284 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 285 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 286 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 287 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 288 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 289 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 290 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 291 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 292 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 293 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 294 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 295 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 296 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 298 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 299 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 300 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 301 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 302 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 303 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 304 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 305 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 306 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 308 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 309 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 310 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 311 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 312 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 313 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 315 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 316 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 318 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 319 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 320 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 321 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 323 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 324 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 325 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 326 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 327 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 328 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 329 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 330 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 331 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 332 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 333 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 334 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 335 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 336 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 337 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 338 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 339 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 340 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 341 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 342 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 343 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 344 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 345 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 346 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 347 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 348 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 349 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 350 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 351 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 352 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 353 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 354 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 355 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 356 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 357 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 358 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 359 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 360 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 361 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 362 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 364 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 366 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 367 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 368 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 369 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 370 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 371 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 372 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 373 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 374 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 440 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 441 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 442 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 443 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 449 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 453 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 454 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 455 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 456 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 457 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 458 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 459 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 460 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 461 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 462 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 463 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 464 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 465 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 466 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 467 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 468 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 469 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 470 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 471 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 472 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 473 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 474 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 475 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 476 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 477 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 478 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 479 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 480 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 481 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 482 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 483 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 484 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 485 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 486 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 487 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 488 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 489 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 490 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 491 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 492 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 493 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 494 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 495 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 496 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 497 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 498 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 499 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 500 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 501 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 502 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 503 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 504 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 505 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 506 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 507 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 508 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 509 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 510 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 511 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 512 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 513 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 514 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 515 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 516 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 517 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 518 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 519 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 520 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 521 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 522 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 523 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 524 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 525 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 526 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 527 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 528 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 529 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 530 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 531 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 532 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 533 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 534 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 535 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 536 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 537 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 538 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 539 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 540 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 611 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 612 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 613 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 614 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 615 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 616 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 617 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 618 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 619 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 620 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 621 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 622 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 623 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 624 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 625 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 626 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 627 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 628 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 629 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 630 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 631 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 632 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 633 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 634 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 635 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 636 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 637 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 639 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 640 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 641 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 642 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 643 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 644 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 645 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 646 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 647 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 648 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 649 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 650 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 651 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 652 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 653 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 654 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 655 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 656 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 657 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 658 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 659 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 662 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 665 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 666 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 667 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 668 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 669 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 670 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 671 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 672 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 673 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 674 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 675 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 676 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 677 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 678 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 679 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 680 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 681 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 682 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 683 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 684 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 685 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 686 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 687 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 688 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 689 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 690 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 691 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 692 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 693 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 694 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 695 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 696 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 697 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 698 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 699 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 700 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 701 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 702 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 703 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 704 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 705 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 706 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 707 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 708 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 709 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 710 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 711 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 712 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 713 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 714 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 715 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.46 |
| Metatranscriptomes | 0 |
| Isolates | 11.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.77 |
| Nodule | 6.27 |
| Rhizoplane | 6.47 |
| Rhizosphere | 67.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214745205 | 2209111006 | Bacteria | 15596 |
| 2 | ARcpr5oldR_c000087 | 3300000041 | Bacteria | 16704 |
| 3 | ARSoilYngRDRAFT_c00048 | 3300000042 | Bacteria | 19122 |
| 4 | ARcpr5yngRDRAFT_c000112 | 3300000043 | Bacteria | 12890 |
| 5 | ARSoilOldRDRAFT_c000094 | 3300000044 | Bacteria | 16730 |
| 6 | ARCol0yngRDRAFT_1000121 | 3300000652 | Bacteria | 13929 |
| 7 | JGI24752J21851_1003222 | 3300001976 | Bacteria | 2152 |
| 8 | JGI24739J22299_10002910 | 3300001989 | Bacteria | 6562 |
| 9 | JGI24737J22298_10001520 | 3300001990 | Bacteria | 8263 |
| 10 | JGI24743J22301_10002453 | 3300001991 | Bacteria | 2796 |
| 11 | JGI24750J21931_1000426 | 3300002070 | Bacteria | 6876 |
| 12 | JGI24745J21846_1000426 | 3300002073 | Bacteria | 3746 |
| 13 | JGI24748J21848_1000786 | 3300002074 | Bacteria | 3432 |
| 14 | JGI24738J21930_10000707 | 3300002075 | Bacteria | 9630 |
| 15 | JGI24749J21850_1001137 | 3300002076 | Bacteria | 3773 |
| 16 | JGI24744J21845_10004543 | 3300002077 | Bacteria | 2868 |
| 17 | JGI24035J26624_1000282 | 3300002126 | Bacteria | 4781 |
| 18 | JGI24034J26672_10000879 | 3300002239 | Bacteria | 3908 |
| 19 | JGI24742J22300_10001239 | 3300002244 | Bacteria | 3999 |
| 20 | JGI24742J22300_10003139 | 3300002244 | Bacteria | 2672 |
| 21 | JGI24751J29686_10004754 | 3300002459 | Bacteria | 2760 |
| 22 | JGI25155J39150_1000538 | 3300002704 | Bacteria | 8785 |
| 23 | JGI25156J39149_1000150 | 3300002705 | Bacteria | 51558 |
| 24 | JGI25154J39366_1000165 | 3300002738 | Bacteria | 51558 |
| 25 | JGI25154J39366_1000210 | 3300002738 | Bacteria | 41877 |
| 26 | JGI25157J39369_1000383 | 3300002741 | Bacteria | 30452 |
| 27 | JGI25406J46586_10000801 | 3300003203 | Bacteria | 14848 |
| 28 | JGI25406J46586_10001211 | 3300003203 | Bacteria | 12134 |
| 29 | JGI25406J46586_10003389 | 3300003203 | Bacteria | 7501 |
| 30 | JGI25406J46586_10003524 | 3300003203 | Bacteria | 7347 |
| 31 | JGI25406J46586_10003889 | 3300003203 | Bacteria | 6980 |
| 32 | JGI25153J46596_10002222 | 3300003215 | Bacteria | 11325 |
| 33 | JGI25153J46596_10002589 | 3300003215 | Bacteria | 10366 |
| 34 | JGI25153J46596_10003283 | 3300003215 | Bacteria | 9084 |
| 35 | JGI25153J46596_10006877 | 3300003215 | Bacteria | 5680 |
| 36 | JGI25153J46596_10014889 | 3300003215 | Bacteria | 3204 |
| 37 | JGI25160J50197_1006259 | 3300003354 | Bacteria | 4838 |
| 38 | JGI25160J50197_1006800 | 3300003354 | Bacteria | 4580 |
| 39 | JGI25404J52841_10002956 | 3300003659 | Bacteria | 3298 |
| 40 | Ga0055538_1000054 | 3300003751 | Bacteria | 123566 |
| 41 | Ga0055539_1000066 | 3300003752 | Bacteria | 136557 |
| 42 | Ga0055533_1000076 | 3300003756 | Bacteria | 136557 |
| 43 | Ga0055532_1000097 | 3300003758 | Bacteria | 98781 |
| 44 | Ga0055525_1000098 | 3300003759 | Bacteria | 136557 |
| 45 | Ga0055535_1003562 | 3300003761 | Bacteria | 4319 |
| 46 | Ga0055540_1002994 | 3300003792 | Bacteria | 8459 |
| 47 | Ga0055531_10000152 | 3300003794 | Bacteria | 80208 |
| 48 | Ga0055531_10003706 | 3300003794 | Bacteria | 9615 |
| 49 | Ga0055541_1000056 | 3300003841 | Bacteria | 123566 |
| 50 | Ga0055543_1002979 | 3300004625 | Bacteria | 5254 |
| 51 | Ga0065165_1001284 | 3300005262 | Bacteria | 28344 |
| 52 | Ga0065165_1022456 | 3300005262 | Bacteria | 2162 |
| 53 | Ga0065704_10002258 | 3300005289 | Bacteria | 9242 |
| 54 | Ga0065712_10068851 | 3300005290 | Bacteria | 8789 |
| 55 | Ga0065712_10075439 | 3300005290 | Bacteria | 3861 |
| 56 | Ga0065712_10084632 | 3300005290 | Bacteria | 2749 |
| 57 | Ga0065715_10093263 | 3300005293 | Bacteria | 4731 |
| 58 | Ga0065715_10105949 | 3300005293 | Bacteria | 2861 |
| 59 | Ga0065715_10164299 | 3300005293 | Bacteria | 1600 |
| 60 | Ga0065707_10021875 | 3300005295 | Bacteria | 1759 |
| 61 | Ga0065707_10098445 | 3300005295 | Bacteria | 3085 |
| 62 | Ga0070676_10022543 | 3300005328 | Bacteria | 3531 |
| 63 | Ga0070676_10034566 | 3300005328 | Bacteria | 2902 |
| 64 | Ga0070683_100018296 | 3300005329 | Bacteria | 6203 |
| 65 | Ga0070683_100075511 | 3300005329 | Bacteria | 3149 |
| 66 | Ga0070683_100178315 | 3300005329 | Bacteria | 2017 |
| 67 | Ga0070690_100012396 | 3300005330 | Bacteria | 5017 |
| 68 | Ga0070690_100084812 | 3300005330 | Bacteria | 2077 |
| 69 | Ga0070670_100000081 | 3300005331 | Bacteria | 92043 |
| 70 | Ga0070670_100002578 | 3300005331 | Bacteria | 14984 |
| 71 | Ga0070670_100016676 | 3300005331 | Bacteria | 6304 |
| 72 | Ga0070670_100041518 | 3300005331 | Bacteria | 3954 |
| 73 | Ga0070670_100113853 | 3300005331 | Bacteria | 2332 |
| 74 | Ga0070677_10000893 | 3300005333 | Bacteria | 9811 |
| 75 | Ga0070677_10027474 | 3300005333 | Bacteria | 2143 |
| 76 | Ga0068869_100007674 | 3300005334 | Bacteria | 6908 |
| 77 | Ga0070666_10031431 | 3300005335 | Bacteria | 3505 |
| 78 | Ga0070680_100022312 | 3300005336 | Bacteria | 5040 |
| 79 | Ga0070682_100030025 | 3300005337 | Bacteria | 3277 |
| 80 | Ga0068868_100006926 | 3300005338 | Bacteria | 8053 |
| 81 | Ga0068868_100060713 | 3300005338 | Bacteria | 2994 |
| 82 | Ga0070660_100008270 | 3300005339 | Bacteria | 7271 |
| 83 | Ga0070660_100123502 | 3300005339 | Bacteria | 2067 |
| 84 | Ga0070689_100003410 | 3300005340 | Bacteria | 10568 |
| 85 | Ga0070689_100016937 | 3300005340 | Bacteria | 5343 |
| 86 | Ga0070691_10005653 | 3300005341 | Bacteria | 5700 |
| 87 | Ga0070687_100004982 | 3300005343 | Bacteria | 5344 |
| 88 | Ga0070661_100020584 | 3300005344 | Bacteria | 4707 |
| 89 | Ga0070661_100100792 | 3300005344 | Bacteria | 2147 |
| 90 | Ga0070692_10002117 | 3300005345 | Bacteria | 7588 |
| 91 | Ga0070668_100015686 | 3300005347 | Bacteria | 5666 |
| 92 | Ga0070668_100171527 | 3300005347 | Bacteria | 1766 |
| 93 | Ga0070669_100016043 | 3300005353 | Bacteria | 5345 |
| 94 | Ga0070669_100112005 | 3300005353 | Bacteria | 2072 |
| 95 | Ga0070675_100005492 | 3300005354 | Bacteria | 9707 |
| 96 | Ga0070675_100038825 | 3300005354 | Bacteria | 3883 |
| 97 | Ga0070675_100187170 | 3300005354 | Bacteria | 1792 |
| 98 | Ga0070671_100011767 | 3300005355 | Bacteria | 7038 |
| 99 | Ga0070671_100031211 | 3300005355 | Bacteria | 4400 |
| 100 | Ga0070671_100109138 | 3300005355 | Bacteria | 2324 |
| 101 | Ga0070674_100008724 | 3300005356 | Bacteria | 6047 |
| 102 | Ga0070674_100021106 | 3300005356 | Bacteria | 4175 |
| 103 | Ga0070674_100080008 | 3300005356 | Bacteria | 2332 |
| 104 | Ga0070674_100085197 | 3300005356 | Bacteria | 2267 |
| 105 | Ga0070673_100002682 | 3300005364 | Bacteria | 10899 |
| 106 | Ga0070688_100004383 | 3300005365 | Bacteria | 7340 |
| 107 | Ga0070659_100004732 | 3300005366 | Bacteria | 9722 |
| 108 | Ga0070659_100146899 | 3300005366 | Bacteria | 1921 |
| 109 | Ga0070667_100001429 | 3300005367 | Bacteria | 21397 |
| 110 | Ga0070667_100029364 | 3300005367 | Bacteria | 4580 |
| 111 | Ga0070667_100068653 | 3300005367 | Bacteria | 3016 |
| 112 | Ga0070667_100100389 | 3300005367 | Bacteria | 2499 |
| 113 | Ga0070703_10017295 | 3300005406 | Bacteria | 2076 |
| 114 | Ga0070709_10001642 | 3300005434 | Bacteria | 12118 |
| 115 | Ga0070709_10003602 | 3300005434 | Bacteria | 8319 |
| 116 | Ga0070709_10005467 | 3300005434 | Bacteria | 6884 |
| 117 | Ga0070714_100013820 | 3300005435 | Bacteria | 6473 |
| 118 | Ga0070714_100033661 | 3300005435 | Bacteria | 4286 |
| 119 | Ga0070713_100002130 | 3300005436 | Bacteria | 12807 |
| 120 | Ga0070713_100003091 | 3300005436 | Bacteria | 10950 |
| 121 | Ga0070713_100020726 | 3300005436 | Bacteria | 5045 |
| 122 | Ga0070713_100094960 | 3300005436 | Bacteria | 2571 |
| 123 | Ga0070713_100131037 | 3300005436 | Bacteria | 2211 |
| 124 | Ga0070713_100254603 | 3300005436 | Bacteria | 1602 |
| 125 | Ga0070710_10001132 | 3300005437 | Bacteria | 12626 |
| 126 | Ga0070710_10003655 | 3300005437 | Bacteria | 7275 |
| 127 | Ga0070710_10015367 | 3300005437 | Bacteria | 3873 |
| 128 | Ga0070710_10031412 | 3300005437 | Bacteria | 2867 |
| 129 | Ga0070701_10007846 | 3300005438 | Bacteria | 4588 |
| 130 | Ga0070711_100037088 | 3300005439 | Bacteria | 3269 |
| 131 | Ga0070711_100185497 | 3300005439 | Bacteria | 1595 |
| 132 | Ga0070700_100010970 | 3300005441 | Bacteria | 5010 |
| 133 | Ga0070700_100038270 | 3300005441 | Bacteria | 2922 |
| 134 | Ga0070694_100006993 | 3300005444 | Bacteria | 6860 |
| 135 | Ga0070694_100114741 | 3300005444 | Bacteria | 1924 |
| 136 | Ga0070708_100005534 | 3300005445 | Bacteria | 10011 |
| 137 | Ga0070708_100022450 | 3300005445 | Bacteria | 5353 |
| 138 | Ga0070708_100137961 | 3300005445 | Bacteria | 2260 |
| 139 | Ga0070663_100026359 | 3300005455 | Bacteria | 3937 |
| 140 | Ga0070663_100072320 | 3300005455 | Bacteria | 2512 |
| 141 | Ga0070678_100023744 | 3300005456 | Bacteria | 4092 |
| 142 | Ga0070678_100033200 | 3300005456 | Bacteria | 3581 |
| 143 | Ga0070678_100033206 | 3300005456 | Bacteria | 3580 |
| 144 | Ga0070662_100013871 | 3300005457 | Bacteria | 5367 |
| 145 | Ga0070662_100098404 | 3300005457 | Bacteria | 2209 |
| 146 | Ga0070681_10006215 | 3300005458 | Bacteria | 11606 |
| 147 | Ga0070681_10019127 | 3300005458 | Bacteria | 6854 |
| 148 | Ga0068867_100018968 | 3300005459 | Bacteria | 4896 |
| 149 | Ga0068867_100073968 | 3300005459 | Bacteria | 2553 |
| 150 | Ga0070685_10024114 | 3300005466 | Bacteria | 3338 |
| 151 | Ga0070685_10062627 | 3300005466 | Bacteria | 2181 |
| 152 | Ga0070707_100003645 | 3300005468 | Bacteria | 14522 |
| 153 | Ga0070707_100059338 | 3300005468 | Bacteria | 3671 |
| 154 | Ga0070707_100313543 | 3300005468 | Bacteria | 1524 |
| 155 | Ga0070698_100002784 | 3300005471 | Bacteria | 19250 |
| 156 | Ga0070698_100166882 | 3300005471 | Bacteria | 2144 |
| 157 | Ga0070699_100010274 | 3300005518 | Bacteria | 8095 |
| 158 | Ga0070699_100198807 | 3300005518 | Bacteria | 1782 |
| 159 | Ga0070679_100016263 | 3300005530 | Bacteria | 7168 |
| 160 | Ga0070684_100042489 | 3300005535 | Bacteria | 3924 |
| 161 | Ga0070684_100056596 | 3300005535 | Bacteria | 3423 |
| 162 | Ga0070684_100090112 | 3300005535 | Bacteria | 2726 |
| 163 | Ga0070697_100109945 | 3300005536 | Bacteria | 2296 |
| 164 | Ga0070697_100111263 | 3300005536 | Bacteria | 2283 |
| 165 | Ga0070672_100010094 | 3300005543 | Bacteria | 6539 |
| 166 | Ga0070672_100037636 | 3300005543 | Bacteria | 3692 |
| 167 | Ga0070672_100046964 | 3300005543 | Bacteria | 3348 |
| 168 | Ga0070672_100060655 | 3300005543 | Bacteria | 2979 |
| 169 | Ga0070686_100001845 | 3300005544 | Bacteria | 11820 |
| 170 | Ga0070686_100153092 | 3300005544 | Bacteria | 1617 |
| 171 | Ga0070695_100003597 | 3300005545 | Bacteria | 9050 |
| 172 | Ga0070695_100156811 | 3300005545 | Bacteria | 1594 |
| 173 | Ga0070696_100013188 | 3300005546 | Bacteria | 5545 |
| 174 | Ga0070696_100054561 | 3300005546 | Bacteria | 2785 |
| 175 | Ga0070693_100014637 | 3300005547 | Bacteria | 4023 |
| 176 | Ga0070693_100020390 | 3300005547 | Bacteria | 3495 |
| 177 | Ga0070693_100128699 | 3300005547 | Bacteria | 1580 |
| 178 | Ga0070665_100102801 | 3300005548 | Bacteria | 2861 |
| 179 | Ga0070665_100123475 | 3300005548 | Bacteria | 2591 |
| 180 | Ga0070665_100224776 | 3300005548 | Bacteria | 1877 |
| 181 | Ga0070665_100332681 | 3300005548 | Bacteria | 1523 |
| 182 | Ga0070704_100003777 | 3300005549 | Bacteria | 8716 |
| 183 | Ga0070704_100010479 | 3300005549 | Bacteria | 5642 |
| 184 | Ga0068855_100147013 | 3300005563 | Bacteria | 2682 |
| 185 | Ga0068855_100167406 | 3300005563 | Bacteria | 2491 |
| 186 | Ga0070664_100057460 | 3300005564 | Bacteria | 3307 |
| 187 | Ga0068857_100000825 | 3300005577 | Bacteria | 23201 |
| 188 | Ga0068857_100071409 | 3300005577 | Bacteria | 3093 |
| 189 | Ga0068854_100005746 | 3300005578 | Bacteria | 7847 |
| 190 | Ga0068854_100006416 | 3300005578 | Bacteria | 7482 |
| 191 | Ga0068854_100066660 | 3300005578 | Bacteria | 2620 |
| 192 | Ga0068856_100004702 | 3300005614 | Bacteria | 13558 |
| 193 | Ga0068856_100220812 | 3300005614 | Bacteria | 1910 |
| 194 | Ga0070702_100007181 | 3300005615 | Bacteria | 5320 |
| 195 | Ga0070702_100027848 | 3300005615 | Bacteria | 3054 |
| 196 | Ga0068852_100005334 | 3300005616 | Bacteria | 9180 |
| 197 | Ga0068852_100020468 | 3300005616 | Bacteria | 5263 |
| 198 | Ga0068852_100055070 | 3300005616 | Bacteria | 3431 |
| 199 | Ga0068859_100012382 | 3300005617 | Bacteria | 8581 |
| 200 | Ga0068859_100058039 | 3300005617 | Bacteria | 3898 |
| 201 | Ga0068859_100153704 | 3300005617 | Bacteria | 2377 |
| 202 | Ga0068864_100000016 | 3300005618 | Bacteria | 292454 |
| 203 | Ga0068864_100003085 | 3300005618 | Bacteria | 13757 |
| 204 | Ga0068864_100030383 | 3300005618 | Bacteria | 4578 |
| 205 | Ga0068864_100033236 | 3300005618 | Bacteria | 4385 |
| 206 | Ga0068864_100084285 | 3300005618 | Bacteria | 2792 |
| 207 | Ga0068864_100133971 | 3300005618 | Bacteria | 2229 |
| 208 | Ga0068866_10001247 | 3300005718 | Bacteria | 11006 |
| 209 | Ga0068861_100018109 | 3300005719 | Bacteria | 5010 |
| 210 | Ga0068861_100018613 | 3300005719 | Bacteria | 4949 |
| 211 | Ga0068861_100161561 | 3300005719 | Bacteria | 1848 |
| 212 | Ga0068851_10077990 | 3300005834 | Bacteria | 1725 |
| 213 | Ga0068870_10006935 | 3300005840 | Bacteria | 5024 |
| 214 | Ga0068870_10010077 | 3300005840 | Bacteria | 4324 |
| 215 | Ga0068870_10011056 | 3300005840 | Bacteria | 4170 |
| 216 | Ga0068863_100001887 | 3300005841 | Bacteria | 20811 |
| 217 | Ga0068863_100020493 | 3300005841 | Bacteria | 6319 |
| 218 | Ga0068863_100093151 | 3300005841 | Bacteria | 2859 |
| 219 | Ga0068863_100218130 | 3300005841 | Bacteria | 1837 |
| 220 | Ga0068858_100063302 | 3300005842 | Bacteria | 3422 |
| 221 | Ga0068858_100108934 | 3300005842 | Bacteria | 2586 |
| 222 | Ga0068858_100122130 | 3300005842 | Bacteria | 2436 |
| 223 | Ga0068858_100167279 | 3300005842 | Bacteria | 2072 |
| 224 | Ga0068860_100002390 | 3300005843 | Bacteria | 19702 |
| 225 | Ga0068860_100026283 | 3300005843 | Bacteria | 5612 |
| 226 | Ga0068860_100075903 | 3300005843 | Bacteria | 3196 |
| 227 | Ga0068860_100077921 | 3300005843 | Bacteria | 3152 |
| 228 | Ga0068862_100000068 | 3300005844 | Bacteria | 123535 |
| 229 | Ga0068862_100010699 | 3300005844 | Bacteria | 7576 |
| 230 | Ga0068862_100133755 | 3300005844 | Bacteria | 2196 |
| 231 | Ga0081455_10000200 | 3300005937 | Bacteria | 76013 |
| 232 | Ga0081455_10000768 | 3300005937 | Bacteria | 41613 |
| 233 | Ga0081455_10005811 | 3300005937 | Bacteria | 13435 |
| 234 | Ga0081455_10028316 | 3300005937 | Bacteria | 5120 |
| 235 | Ga0081455_10052106 | 3300005937 | Bacteria | 3506 |
| 236 | Ga0081455_10067882 | 3300005937 | Bacteria | 2970 |
| 237 | Ga0081538_10000527 | 3300005981 | Bacteria | 42416 |
| 238 | Ga0081538_10041924 | 3300005981 | Bacteria | 2897 |
| 239 | Ga0081538_10051173 | 3300005981 | Bacteria | 2484 |
| 240 | Ga0081540_1000303 | 3300005983 | Bacteria | 50969 |
| 241 | Ga0081540_1000459 | 3300005983 | Bacteria | 40435 |
| 242 | Ga0081540_1000726 | 3300005983 | Bacteria | 30344 |
| 243 | Ga0081540_1002649 | 3300005983 | Bacteria | 14558 |
| 244 | Ga0081540_1003830 | 3300005983 | Bacteria | 11775 |
| 245 | Ga0081540_1003910 | 3300005983 | Bacteria | 11604 |
| 246 | Ga0081540_1006666 | 3300005983 | Bacteria | 8358 |
| 247 | Ga0081540_1009787 | 3300005983 | Bacteria | 6562 |
| 248 | Ga0081540_1012946 | 3300005983 | Bacteria | 5450 |
| 249 | Ga0081540_1024563 | 3300005983 | Bacteria | 3495 |
| 250 | Ga0081540_1026854 | 3300005983 | Bacteria | 3276 |
| 251 | Ga0081540_1027228 | 3300005983 | Bacteria | 3243 |
| 252 | Ga0081540_1036114 | 3300005983 | Bacteria | 2640 |
| 253 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 254 | Ga0081539_10000747 | 3300005985 | Bacteria | 64612 |
| 255 | Ga0081539_10001010 | 3300005985 | Bacteria | 51943 |
| 256 | Ga0081539_10002027 | 3300005985 | Bacteria | 30522 |
| 257 | Ga0081539_10004951 | 3300005985 | Bacteria | 14150 |
| 258 | Ga0081539_10039464 | 3300005985 | Bacteria | 2785 |
| 259 | Ga0070717_10002186 | 3300006028 | Bacteria | 13725 |
| 260 | Ga0070717_10018588 | 3300006028 | Bacteria | 5431 |
| 261 | Ga0070717_10023179 | 3300006028 | Bacteria | 4915 |
| 262 | Ga0075365_10025380 | 3300006038 | Bacteria | 3751 |
| 263 | Ga0075365_10098867 | 3300006038 | Bacteria | 1996 |
| 264 | Ga0075368_10002361 | 3300006042 | Bacteria | 6139 |
| 265 | Ga0075368_10028649 | 3300006042 | Bacteria | 2152 |
| 266 | Ga0075364_10001029 | 3300006051 | Bacteria | 14811 |
| 267 | Ga0075364_10044728 | 3300006051 | Bacteria | 2880 |
| 268 | Ga0075432_10007773 | 3300006058 | Bacteria | 3654 |
| 269 | Ga0070715_10000320 | 3300006163 | Bacteria | 11866 |
| 270 | Ga0070715_10000420 | 3300006163 | Bacteria | 10819 |
| 271 | Ga0070715_10006169 | 3300006163 | Bacteria | 4057 |
| 272 | Ga0070715_10010703 | 3300006163 | Bacteria | 3277 |
| 273 | Ga0070715_10015703 | 3300006163 | Bacteria | 2830 |
| 274 | Ga0070716_100001867 | 3300006173 | Bacteria | 9562 |
| 275 | Ga0070716_100020203 | 3300006173 | Bacteria | 3493 |
| 276 | Ga0070716_100044394 | 3300006173 | Bacteria | 2490 |
| 277 | Ga0070716_100059932 | 3300006173 | Bacteria | 2196 |
| 278 | Ga0070712_100001878 | 3300006175 | Bacteria | 12816 |
| 279 | Ga0070712_100055421 | 3300006175 | Bacteria | 2777 |
| 280 | Ga0075362_10009545 | 3300006177 | Bacteria | 3756 |
| 281 | Ga0075362_10022812 | 3300006177 | Bacteria | 2641 |
| 282 | Ga0075367_10006118 | 3300006178 | Bacteria | 6051 |
| 283 | Ga0075367_10013796 | 3300006178 | Bacteria | 4357 |
| 284 | Ga0075367_10021373 | 3300006178 | Bacteria | 3616 |
| 285 | Ga0075367_10038273 | 3300006178 | Bacteria | 2791 |
| 286 | Ga0075369_10011401 | 3300006186 | Bacteria | 3497 |
| 287 | Ga0075366_10024479 | 3300006195 | Bacteria | 3521 |
| 288 | Ga0075366_10045627 | 3300006195 | Bacteria | 2597 |
| 289 | Ga0075366_10049192 | 3300006195 | Bacteria | 2502 |
| 290 | Ga0075366_10063442 | 3300006195 | Bacteria | 2196 |
| 291 | Ga0097621_100018375 | 3300006237 | Bacteria | 5338 |
| 292 | Ga0097621_100186922 | 3300006237 | Bacteria | 1792 |
| 293 | Ga0075370_10036524 | 3300006353 | Bacteria | 2759 |
| 294 | Ga0068871_100017948 | 3300006358 | Bacteria | 5367 |
| 295 | Ga0068871_100164342 | 3300006358 | Bacteria | 1899 |
| 296 | Ga0075428_100000103 | 3300006844 | Bacteria | 71205 |
| 297 | Ga0075428_100003399 | 3300006844 | Bacteria | 17407 |
| 298 | Ga0075428_100009742 | 3300006844 | Bacteria | 10673 |
| 299 | Ga0075428_100098353 | 3300006844 | Bacteria | 3190 |
| 300 | Ga0075428_100138048 | 3300006844 | Bacteria | 2651 |
| 301 | Ga0075428_100291397 | 3300006844 | Bacteria | 1755 |
| 302 | Ga0075430_100000133 | 3300006846 | Bacteria | 47377 |
| 303 | Ga0075430_100004771 | 3300006846 | Bacteria | 11408 |
| 304 | Ga0075430_100065258 | 3300006846 | Bacteria | 3058 |
| 305 | Ga0075430_100213323 | 3300006846 | Bacteria | 1602 |
| 306 | Ga0075431_100001293 | 3300006847 | Bacteria | 22854 |
| 307 | Ga0075431_100002259 | 3300006847 | Bacteria | 18467 |
| 308 | Ga0075431_100037647 | 3300006847 | Bacteria | 4981 |
| 309 | Ga0075431_100083102 | 3300006847 | Bacteria | 3306 |
| 310 | Ga0075431_100208278 | 3300006847 | Bacteria | 1998 |
| 311 | Ga0075433_10000506 | 3300006852 | Bacteria | 25421 |
| 312 | Ga0075433_10001540 | 3300006852 | Bacteria | 17038 |
| 313 | Ga0075433_10068973 | 3300006852 | Bacteria | 3104 |
| 314 | Ga0075433_10159343 | 3300006852 | Bacteria | 2008 |
| 315 | Ga0075434_100000472 | 3300006871 | Bacteria | 30053 |
| 316 | Ga0075434_100001125 | 3300006871 | Bacteria | 21994 |
| 317 | Ga0075434_100004709 | 3300006871 | Bacteria | 12330 |
| 318 | Ga0075434_100021009 | 3300006871 | Bacteria | 6341 |
| 319 | Ga0075434_100080376 | 3300006871 | Bacteria | 3256 |
| 320 | Ga0075434_100115829 | 3300006871 | Bacteria | 2693 |
| 321 | Ga0075434_100202054 | 3300006871 | Bacteria | 2007 |
| 322 | Ga0075429_100000163 | 3300006880 | Bacteria | 42270 |
| 323 | Ga0075429_100020211 | 3300006880 | Bacteria | 5774 |
| 324 | Ga0075429_100075942 | 3300006880 | Bacteria | 2926 |
| 325 | Ga0068865_100006160 | 3300006881 | Bacteria | 7310 |
| 326 | Ga0068865_100021323 | 3300006881 | Bacteria | 4211 |
| 327 | Ga0068865_100078669 | 3300006881 | Bacteria | 2359 |
| 328 | Ga0097620_100012381 | 3300006931 | Bacteria | 8581 |
| 329 | Ga0097620_100058038 | 3300006931 | Bacteria | 3898 |
| 330 | Ga0097620_100153701 | 3300006931 | Bacteria | 2377 |
| 331 | Ga0099824_1022507 | 3300006942 | Bacteria | 4141 |
| 332 | Ga0075435_100005547 | 3300007076 | Bacteria | 8828 |
| 333 | Ga0075435_100006632 | 3300007076 | Bacteria | 8201 |
| 334 | Ga0075435_100029304 | 3300007076 | Bacteria | 4319 |
| 335 | Ga0075435_100056294 | 3300007076 | Bacteria | 3178 |
| 336 | Ga0075435_100076789 | 3300007076 | Bacteria | 2738 |
| 337 | Ga0075435_100120272 | 3300007076 | Bacteria | 2191 |
| 338 | Ga0075435_100163692 | 3300007076 | Bacteria | 1875 |
| 339 | Ga0099794_10009565 | 3300007265 | Bacteria | 4083 |
| 340 | Ga0099795_10000216 | 3300007788 | Bacteria | 9967 |
| 341 | Ga0099795_10002853 | 3300007788 | Bacteria | 4177 |
| 342 | Ga0105251_10002065 | 3300009011 | Bacteria | 16214 |
| 343 | Ga0105240_10003119 | 3300009093 | Bacteria | 26094 |
| 344 | Ga0105240_10015980 | 3300009093 | Bacteria | 10175 |
| 345 | Ga0105240_10020880 | 3300009093 | Bacteria | 8723 |
| 346 | Ga0105240_10062547 | 3300009093 | Bacteria | 4634 |
| 347 | Ga0111539_10000389 | 3300009094 | Bacteria | 54333 |
| 348 | Ga0111539_10004544 | 3300009094 | Bacteria | 18148 |
| 349 | Ga0111539_10005030 | 3300009094 | Bacteria | 17186 |
| 350 | Ga0111539_10005183 | 3300009094 | Bacteria | 16889 |
| 351 | Ga0111539_10025207 | 3300009094 | Bacteria | 7290 |
| 352 | Ga0111539_10027318 | 3300009094 | Bacteria | 6969 |
| 353 | Ga0111539_10033030 | 3300009094 | Bacteria | 6283 |
| 354 | Ga0111539_10066357 | 3300009094 | Bacteria | 4262 |
| 355 | Ga0105245_10004886 | 3300009098 | Bacteria | 11794 |
| 356 | Ga0105245_10015633 | 3300009098 | Bacteria | 6619 |
| 357 | Ga0105245_10189971 | 3300009098 | Bacteria | 1967 |
| 358 | Ga0105247_10003705 | 3300009101 | Bacteria | 9922 |
| 359 | Ga0105247_10037800 | 3300009101 | Bacteria | 2945 |
| 360 | Ga0105247_10040980 | 3300009101 | Bacteria | 2832 |
| 361 | Ga0114129_10002163 | 3300009147 | Bacteria | 27081 |
| 362 | Ga0114129_10003194 | 3300009147 | Bacteria | 22994 |
| 363 | Ga0114129_10021030 | 3300009147 | Bacteria | 9267 |
| 364 | Ga0114129_10022094 | 3300009147 | Bacteria | 9028 |
| 365 | Ga0114129_10046959 | 3300009147 | Bacteria | 6068 |
| 366 | Ga0114129_10172096 | 3300009147 | Bacteria | 2951 |
| 367 | Ga0114129_10178412 | 3300009147 | Bacteria | 2892 |
| 368 | Ga0114129_10202623 | 3300009147 | Bacteria | 2686 |
| 369 | Ga0114129_10233588 | 3300009147 | Bacteria | 2476 |
| 370 | Ga0105243_10006915 | 3300009148 | Bacteria | 8742 |
| 371 | Ga0105243_10016177 | 3300009148 | Bacteria | 5644 |
| 372 | Ga0105243_10094100 | 3300009148 | Bacteria | 2474 |
| 373 | Ga0105241_10012907 | 3300009174 | Bacteria | 6130 |
| 374 | Ga0105241_10018500 | 3300009174 | Bacteria | 5125 |
| 375 | Ga0105241_10056744 | 3300009174 | Bacteria | 3003 |
| 376 | Ga0105242_10005843 | 3300009176 | Bacteria | 9482 |
| 377 | Ga0105248_10008593 | 3300009177 | Bacteria | 11215 |
| 378 | Ga0105248_10030646 | 3300009177 | Bacteria | 6007 |
| 379 | Ga0105248_10090547 | 3300009177 | Bacteria | 3445 |
| 380 | Ga0105248_10095407 | 3300009177 | Bacteria | 3349 |
| 381 | Ga0105248_10122502 | 3300009177 | Bacteria | 2933 |
| 382 | Ga0105248_10239281 | 3300009177 | Bacteria | 2043 |
| 383 | Ga0105237_10025782 | 3300009545 | Bacteria | 6011 |
| 384 | Ga0105237_10031793 | 3300009545 | Bacteria | 5346 |
| 385 | Ga0105237_10134246 | 3300009545 | Bacteria | 2469 |
| 386 | Ga0105237_10190843 | 3300009545 | Bacteria | 2049 |
| 387 | Ga0105238_10003628 | 3300009551 | Bacteria | 15389 |
| 388 | Ga0105238_10018690 | 3300009551 | Bacteria | 7059 |
| 389 | Ga0105238_10052431 | 3300009551 | Bacteria | 4101 |
| 390 | Ga0105249_10018756 | 3300009553 | Bacteria | 6163 |
| 391 | Ga0105249_10094744 | 3300009553 | Bacteria | 2799 |
| 392 | Ga0099796_10000421 | 3300010159 | Bacteria | 7021 |
| 393 | Ga0099796_10006609 | 3300010159 | Bacteria | 2981 |
| 394 | Ga0105239_10043580 | 3300010375 | Bacteria | 4919 |
| 395 | Ga0105239_10044826 | 3300010375 | Bacteria | 4847 |
| 396 | Ga0105239_10058713 | 3300010375 | Bacteria | 4222 |
| 397 | Ga0105239_10078857 | 3300010375 | Bacteria | 3624 |
| 398 | Ga0105239_10216347 | 3300010375 | Bacteria | 2148 |
| 399 | Ga0105246_10017018 | 3300011119 | Bacteria | 4617 |
| 400 | Ga0105246_10030521 | 3300011119 | Bacteria | 3561 |
| 401 | Ga0105246_10034450 | 3300011119 | Bacteria | 3375 |
| 402 | Ga0105246_10154825 | 3300011119 | Bacteria | 1740 |
| 403 | Ga0157373_10150890 | 3300013100 | Bacteria | 1635 |
| 404 | Ga0157371_10023732 | 3300013102 | Bacteria | 4484 |
| 405 | Ga0157369_10249398 | 3300013105 | Bacteria | 1853 |
| 406 | Ga0157374_10003804 | 3300013296 | Bacteria | 12691 |
| 407 | Ga0157374_10010540 | 3300013296 | Bacteria | 7955 |
| 408 | Ga0157374_10025104 | 3300013296 | Bacteria | 5346 |
| 409 | Ga0157378_10007681 | 3300013297 | Bacteria | 9410 |
| 410 | Ga0157378_10013539 | 3300013297 | Bacteria | 7135 |
| 411 | Ga0157378_10065470 | 3300013297 | Bacteria | 3253 |
| 412 | Ga0157378_10079320 | 3300013297 | Bacteria | 2964 |
| 413 | Ga0163162_10013059 | 3300013306 | Bacteria | 8105 |
| 414 | Ga0163162_10039006 | 3300013306 | Bacteria | 4743 |
| 415 | Ga0157372_10031288 | 3300013307 | Bacteria | 5826 |
| 416 | Ga0157375_10021128 | 3300013308 | Bacteria | 5962 |
| 417 | Ga0157375_10037929 | 3300013308 | Bacteria | 4623 |
| 418 | Ga0157375_10076771 | 3300013308 | Bacteria | 3369 |
| 419 | Ga0157375_10173210 | 3300013308 | Bacteria | 2307 |
| 420 | Ga0157375_10300125 | 3300013308 | Bacteria | 1770 |
| 421 | Ga0157375_10431132 | 3300013308 | Bacteria | 1484 |
| 422 | Ga0163163_10004872 | 3300014325 | Bacteria | 11539 |
| 423 | Ga0163163_10009467 | 3300014325 | Bacteria | 8699 |
| 424 | Ga0163163_10080858 | 3300014325 | Bacteria | 3250 |
| 425 | Ga0163163_10099722 | 3300014325 | Bacteria | 2926 |
| 426 | Ga0163163_10157549 | 3300014325 | Bacteria | 2315 |
| 427 | Ga0157380_10001774 | 3300014326 | Bacteria | 14253 |
| 428 | Ga0157377_10003064 | 3300014745 | Bacteria | 7499 |
| 429 | Ga0157377_10052389 | 3300014745 | Bacteria | 2304 |
| 430 | Ga0157377_10088694 | 3300014745 | Bacteria | 1822 |
| 431 | Ga0157379_10031492 | 3300014968 | Bacteria | 4725 |
| 432 | Ga0157379_10058893 | 3300014968 | Bacteria | 3435 |
| 433 | Ga0157379_10073604 | 3300014968 | Bacteria | 3058 |
| 434 | Ga0157376_10002959 | 3300014969 | Bacteria | 11657 |
| 435 | Ga0157376_10004003 | 3300014969 | Bacteria | 10189 |
| 436 | Ga0182006_1001196 | 3300015261 | Bacteria | 16214 |
| 437 | Ga0163161_10003456 | 3300017792 | Bacteria | 11069 |
| 438 | Ga0163161_10019750 | 3300017792 | Bacteria | 4726 |
| 439 | Ga0214544_1000020 | 3300021320 | Bacteria | 178560 |
| 440 | Ga0214542_1000024 | 3300021321 | Bacteria | 191218 |
| 441 | Ga0214545_1000011 | 3300021324 | Bacteria | 190550 |
| 442 | Ga0214545_1029344 | 3300021324 | Bacteria | 2491 |
| 443 | Ga0214543_1000033 | 3300021327 | Bacteria | 190419 |
| 444 | Ga0213872_10003584 | 3300021361 | Bacteria | 8540 |
| 445 | Ga0213872_10016312 | 3300021361 | Bacteria | 3449 |
| 446 | Ga0213872_10048178 | 3300021361 | Bacteria | 1937 |
| 447 | Ga0213876_10001998 | 3300021384 | Bacteria | 12203 |
| 448 | Ga0209435_100040 | 3300025206 | Bacteria | 115475 |
| 449 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 450 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 451 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 452 | Ga0209147_100141 | 3300025229 | Bacteria | 115466 |
| 453 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 454 | Ga0209563_101304 | 3300025230 | Bacteria | 6806 |
| 455 | Ga0209437_100229 | 3300025233 | Bacteria | 95900 |
| 456 | Ga0209258_100657 | 3300025242 | Bacteria | 25150 |
| 457 | Ga0207425_1009865 | 3300025245 | Bacteria | 2352 |
| 458 | Ga0209646_1000204 | 3300025246 | Bacteria | 69552 |
| 459 | Ga0209646_1000253 | 3300025246 | Bacteria | 53522 |
| 460 | Ga0209026_1000306 | 3300025250 | Bacteria | 53524 |
| 461 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 462 | Ga0209677_102281 | 3300025253 | Bacteria | 7406 |
| 463 | Ga0209677_102285 | 3300025253 | Bacteria | 7388 |
| 464 | Ga0209759_1000298 | 3300025256 | Bacteria | 68472 |
| 465 | Ga0209759_1000398 | 3300025256 | Bacteria | 53628 |
| 466 | Ga0209233_1001066 | 3300025261 | Bacteria | 11357 |
| 467 | Ga0209233_1004907 | 3300025261 | Bacteria | 4499 |
| 468 | Ga0209233_1005718 | 3300025261 | Bacteria | 4099 |
| 469 | Ga0207666_1000077 | 3300025271 | Bacteria | 16262 |
| 470 | Ga0209673_1014952 | 3300025273 | Bacteria | 2976 |
| 471 | Ga0207673_1000891 | 3300025290 | Bacteria | 3206 |
| 472 | Ga0209675_1003720 | 3300025291 | Bacteria | 7091 |
| 473 | Ga0209676_1002143 | 3300025292 | Bacteria | 14987 |
| 474 | Ga0209564_1014473 | 3300025295 | Bacteria | 3278 |
| 475 | Ga0209758_1000294 | 3300025297 | Bacteria | 98618 |
| 476 | Ga0209758_1000407 | 3300025297 | Bacteria | 73945 |
| 477 | Ga0209758_1000952 | 3300025297 | Bacteria | 39040 |
| 478 | Ga0209758_1001983 | 3300025297 | Bacteria | 22130 |
| 479 | Ga0209758_1002883 | 3300025297 | Bacteria | 16636 |
| 480 | Ga0209758_1008305 | 3300025297 | Bacteria | 6775 |
| 481 | Ga0209758_1032704 | 3300025297 | Bacteria | 2105 |
| 482 | Ga0209050_1000925 | 3300025298 | Bacteria | 38696 |
| 483 | Ga0209256_1000545 | 3300025299 | Bacteria | 54076 |
| 484 | Ga0209256_1006969 | 3300025299 | Bacteria | 5755 |
| 485 | Ga0207426_1001388 | 3300025302 | Bacteria | 20462 |
| 486 | Ga0207426_1006921 | 3300025302 | Bacteria | 4821 |
| 487 | Ga0207426_1031258 | 3300025302 | Bacteria | 1738 |
| 488 | Ga0209051_1000059 | 3300025303 | Bacteria | 260307 |
| 489 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 490 | Ga0209257_1001136 | 3300025304 | Bacteria | 34058 |
| 491 | Ga0207697_10001615 | 3300025315 | Bacteria | 12170 |
| 492 | Ga0207697_10029005 | 3300025315 | Bacteria | 2264 |
| 493 | Ga0207697_10031871 | 3300025315 | Bacteria | 2157 |
| 494 | Ga0207656_10018123 | 3300025321 | Bacteria | 2767 |
| 495 | Ga0207713_1002261 | 3300025735 | Bacteria | 14219 |
| 496 | Ga0207682_10000009 | 3300025893 | Bacteria | 86366 |
| 497 | Ga0207682_10007879 | 3300025893 | Bacteria | 4230 |
| 498 | Ga0207682_10008819 | 3300025893 | Bacteria | 3988 |
| 499 | Ga0207692_10007013 | 3300025898 | Bacteria | 4600 |
| 500 | Ga0207692_10008475 | 3300025898 | Bacteria | 4253 |
| 501 | Ga0207642_10011334 | 3300025899 | Bacteria | 3176 |
| 502 | Ga0207642_10089442 | 3300025899 | Bacteria | 1517 |
| 503 | Ga0207710_10017532 | 3300025900 | Bacteria | 3038 |
| 504 | Ga0207710_10018129 | 3300025900 | Bacteria | 2992 |
| 505 | Ga0207710_10018417 | 3300025900 | Bacteria | 2969 |
| 506 | Ga0207710_10023791 | 3300025900 | Bacteria | 2633 |
| 507 | Ga0207688_10001372 | 3300025901 | Bacteria | 12640 |
| 508 | Ga0207688_10010399 | 3300025901 | Bacteria | 5064 |
| 509 | Ga0207688_10015227 | 3300025901 | Bacteria | 4173 |
| 510 | Ga0207688_10058016 | 3300025901 | Bacteria | 2178 |
| 511 | Ga0207688_10061197 | 3300025901 | Bacteria | 2122 |
| 512 | Ga0207680_10055095 | 3300025903 | Bacteria | 2395 |
| 513 | Ga0207647_10006480 | 3300025904 | Bacteria | 8506 |
| 514 | Ga0207647_10035209 | 3300025904 | Bacteria | 3192 |
| 515 | Ga0207685_10005926 | 3300025905 | Bacteria | 3277 |
| 516 | Ga0207699_10001319 | 3300025906 | Bacteria | 11796 |
| 517 | Ga0207699_10002443 | 3300025906 | Bacteria | 8765 |
| 518 | Ga0207699_10049238 | 3300025906 | Bacteria | 2480 |
| 519 | Ga0207645_10002502 | 3300025907 | Bacteria | 14418 |
| 520 | Ga0207645_10018918 | 3300025907 | Bacteria | 4524 |
| 521 | Ga0207643_10000292 | 3300025908 | Bacteria | 34914 |
| 522 | Ga0207643_10000418 | 3300025908 | Bacteria | 28078 |
| 523 | Ga0207643_10040888 | 3300025908 | Bacteria | 2611 |
| 524 | Ga0207643_10064491 | 3300025908 | Bacteria | 2096 |
| 525 | Ga0207654_10015148 | 3300025911 | Bacteria | 3995 |
| 526 | Ga0207654_10017669 | 3300025911 | Bacteria | 3734 |
| 527 | Ga0207654_10030110 | 3300025911 | Bacteria | 2977 |
| 528 | Ga0207707_10002931 | 3300025912 | Bacteria | 15207 |
| 529 | Ga0207695_10001540 | 3300025913 | Bacteria | 37977 |
| 530 | Ga0207695_10017000 | 3300025913 | Bacteria | 8486 |
| 531 | Ga0207695_10023519 | 3300025913 | Bacteria | 6958 |
| 532 | Ga0207671_10032015 | 3300025914 | Bacteria | 3915 |
| 533 | Ga0207671_10066825 | 3300025914 | Bacteria | 2677 |
| 534 | Ga0207671_10139691 | 3300025914 | Bacteria | 1866 |
| 535 | Ga0207671_10175033 | 3300025914 | Bacteria | 1668 |
| 536 | Ga0207693_10001385 | 3300025915 | Bacteria | 21487 |
| 537 | Ga0207693_10001566 | 3300025915 | Bacteria | 20200 |
| 538 | Ga0207693_10011746 | 3300025915 | Bacteria | 7079 |
| 539 | Ga0207693_10013334 | 3300025915 | Bacteria | 6626 |
| 540 | Ga0207693_10064329 | 3300025915 | Bacteria | 2873 |
| 541 | Ga0207663_10000136 | 3300025916 | Bacteria | 34085 |
| 542 | Ga0207663_10006786 | 3300025916 | Bacteria | 5893 |
| 543 | Ga0207660_10000893 | 3300025917 | Bacteria | 19637 |
| 544 | Ga0207660_10180090 | 3300025917 | Bacteria | 1641 |
| 545 | Ga0207662_10000861 | 3300025918 | Bacteria | 13998 |
| 546 | Ga0207662_10064505 | 3300025918 | Bacteria | 2204 |
| 547 | Ga0207657_10003725 | 3300025919 | Bacteria | 16199 |
| 548 | Ga0207657_10012700 | 3300025919 | Bacteria | 8299 |
| 549 | Ga0207657_10036461 | 3300025919 | Bacteria | 4401 |
| 550 | Ga0207649_10004064 | 3300025920 | Bacteria | 7965 |
| 551 | Ga0207649_10071124 | 3300025920 | Bacteria | 2221 |
| 552 | Ga0207652_10002516 | 3300025921 | Bacteria | 15403 |
| 553 | Ga0207646_10007486 | 3300025922 | Bacteria | 11082 |
| 554 | Ga0207681_10008223 | 3300025923 | Bacteria | 6379 |
| 555 | Ga0207681_10014965 | 3300025923 | Bacteria | 4833 |
| 556 | Ga0207681_10040181 | 3300025923 | Bacteria | 3111 |
| 557 | Ga0207694_10014930 | 3300025924 | Bacteria | 5857 |
| 558 | Ga0207694_10035008 | 3300025924 | Bacteria | 3851 |
| 559 | Ga0207650_10000288 | 3300025925 | Bacteria | 51267 |
| 560 | Ga0207650_10001712 | 3300025925 | Bacteria | 15568 |
| 561 | Ga0207650_10001829 | 3300025925 | Bacteria | 15043 |
| 562 | Ga0207650_10002115 | 3300025925 | Bacteria | 13878 |
| 563 | Ga0207650_10045906 | 3300025925 | Bacteria | 3215 |
| 564 | Ga0207659_10001554 | 3300025926 | Bacteria | 13628 |
| 565 | Ga0207659_10016654 | 3300025926 | Bacteria | 4789 |
| 566 | Ga0207659_10116180 | 3300025926 | Bacteria | 2042 |
| 567 | Ga0207687_10001197 | 3300025927 | Bacteria | 17741 |
| 568 | Ga0207687_10006940 | 3300025927 | Bacteria | 7460 |
| 569 | Ga0207687_10013222 | 3300025927 | Bacteria | 5391 |
| 570 | Ga0207687_10124106 | 3300025927 | Bacteria | 1936 |
| 571 | Ga0207700_10006688 | 3300025928 | Bacteria | 6994 |
| 572 | Ga0207700_10023730 | 3300025928 | Bacteria | 4236 |
| 573 | Ga0207700_10032460 | 3300025928 | Bacteria | 3724 |
| 574 | Ga0207700_10041044 | 3300025928 | Bacteria | 3382 |
| 575 | Ga0207664_10013549 | 3300025929 | Bacteria | 5857 |
| 576 | Ga0207664_10060688 | 3300025929 | Bacteria | 3014 |
| 577 | Ga0207664_10068985 | 3300025929 | Bacteria | 2842 |
| 578 | Ga0207664_10079804 | 3300025929 | Bacteria | 2658 |
| 579 | Ga0207644_10001963 | 3300025931 | Bacteria | 13295 |
| 580 | Ga0207644_10014948 | 3300025931 | Bacteria | 5204 |
| 581 | Ga0207644_10041902 | 3300025931 | Bacteria | 3241 |
| 582 | Ga0207644_10104521 | 3300025931 | Bacteria | 2132 |
| 583 | Ga0207690_10005575 | 3300025932 | Bacteria | 7436 |
| 584 | Ga0207706_10002827 | 3300025933 | Bacteria | 16841 |
| 585 | Ga0207706_10014998 | 3300025933 | Bacteria | 7015 |
| 586 | Ga0207706_10024198 | 3300025933 | Bacteria | 5444 |
| 587 | Ga0207706_10095387 | 3300025933 | Bacteria | 2616 |
| 588 | Ga0207686_10001310 | 3300025934 | Bacteria | 14258 |
| 589 | Ga0207686_10001988 | 3300025934 | Bacteria | 11265 |
| 590 | Ga0207709_10002910 | 3300025935 | Bacteria | 10449 |
| 591 | Ga0207709_10009749 | 3300025935 | Bacteria | 5293 |
| 592 | Ga0207709_10016042 | 3300025935 | Bacteria | 4158 |
| 593 | Ga0207709_10145261 | 3300025935 | Bacteria | 1636 |
| 594 | Ga0207670_10002928 | 3300025936 | Bacteria | 9025 |
| 595 | Ga0207670_10010411 | 3300025936 | Bacteria | 5356 |
| 596 | Ga0207669_10000909 | 3300025937 | Bacteria | 12533 |
| 597 | Ga0207669_10159702 | 3300025937 | Bacteria | 1590 |
| 598 | Ga0207704_10004639 | 3300025938 | Bacteria | 6300 |
| 599 | Ga0207704_10006693 | 3300025938 | Bacteria | 5397 |
| 600 | Ga0207665_10000064 | 3300025939 | Bacteria | 68931 |
| 601 | Ga0207665_10001510 | 3300025939 | Bacteria | 15663 |
| 602 | Ga0207665_10002822 | 3300025939 | Bacteria | 11647 |
| 603 | Ga0207665_10008638 | 3300025939 | Bacteria | 6706 |
| 604 | Ga0207665_10049190 | 3300025939 | Bacteria | 2832 |
| 605 | Ga0207691_10005519 | 3300025940 | Bacteria | 12220 |
| 606 | Ga0207691_10025609 | 3300025940 | Bacteria | 5537 |
| 607 | Ga0207691_10061618 | 3300025940 | Bacteria | 3407 |
| 608 | Ga0207691_10091423 | 3300025940 | Bacteria | 2727 |
| 609 | Ga0207691_10137905 | 3300025940 | Bacteria | 2151 |
| 610 | Ga0207691_10198351 | 3300025940 | Bacteria | 1748 |
| 611 | Ga0207691_10243719 | 3300025940 | Bacteria | 1553 |
| 612 | Ga0207711_10001144 | 3300025941 | Bacteria | 25260 |
| 613 | Ga0207711_10037712 | 3300025941 | Bacteria | 4107 |
| 614 | Ga0207711_10043321 | 3300025941 | Bacteria | 3838 |
| 615 | Ga0207689_10001448 | 3300025942 | Bacteria | 22699 |
| 616 | Ga0207689_10019790 | 3300025942 | Bacteria | 5669 |
| 617 | Ga0207689_10039992 | 3300025942 | Bacteria | 3882 |
| 618 | Ga0207689_10065521 | 3300025942 | Bacteria | 2988 |
| 619 | Ga0207661_10002433 | 3300025944 | Bacteria | 12827 |
| 620 | Ga0207661_10048530 | 3300025944 | Bacteria | 3375 |
| 621 | Ga0207661_10060818 | 3300025944 | Bacteria | 3050 |
| 622 | Ga0207679_10003604 | 3300025945 | Bacteria | 9607 |
| 623 | Ga0207679_10075413 | 3300025945 | Bacteria | 2559 |
| 624 | Ga0207667_10111248 | 3300025949 | Bacteria | 2825 |
| 625 | Ga0207651_10001703 | 3300025960 | Bacteria | 10145 |
| 626 | Ga0207651_10047471 | 3300025960 | Bacteria | 2895 |
| 627 | Ga0207712_10003650 | 3300025961 | Bacteria | 9700 |
| 628 | Ga0207668_10001981 | 3300025972 | Bacteria | 11973 |
| 629 | Ga0207640_10003763 | 3300025981 | Bacteria | 8180 |
| 630 | Ga0207640_10008114 | 3300025981 | Bacteria | 5812 |
| 631 | Ga0207640_10061301 | 3300025981 | Bacteria | 2491 |
| 632 | Ga0207658_10000466 | 3300025986 | Bacteria | 37801 |
| 633 | Ga0207658_10031138 | 3300025986 | Bacteria | 3785 |
| 634 | Ga0207677_10001053 | 3300026023 | Bacteria | 15130 |
| 635 | Ga0207677_10029878 | 3300026023 | Bacteria | 3470 |
| 636 | Ga0207677_10219604 | 3300026023 | Bacteria | 1524 |
| 637 | Ga0207703_10017302 | 3300026035 | Bacteria | 5627 |
| 638 | Ga0207703_10023676 | 3300026035 | Bacteria | 4829 |
| 639 | Ga0207703_10031824 | 3300026035 | Bacteria | 4173 |
| 640 | Ga0207703_10084827 | 3300026035 | Bacteria | 2649 |
| 641 | Ga0207703_10097711 | 3300026035 | Bacteria | 2482 |
| 642 | Ga0207703_10279628 | 3300026035 | Bacteria | 1515 |
| 643 | Ga0207639_10040853 | 3300026041 | Bacteria | 3465 |
| 644 | Ga0207639_10051630 | 3300026041 | Bacteria | 3128 |
| 645 | Ga0207678_10002714 | 3300026067 | Bacteria | 16050 |
| 646 | Ga0207678_10006709 | 3300026067 | Bacteria | 10210 |
| 647 | Ga0207678_10030296 | 3300026067 | Bacteria | 4724 |
| 648 | Ga0207708_10002881 | 3300026075 | Bacteria | 12675 |
| 649 | Ga0207708_10003108 | 3300026075 | Bacteria | 12219 |
| 650 | Ga0207708_10038305 | 3300026075 | Bacteria | 3652 |
| 651 | Ga0207708_10102100 | 3300026075 | Bacteria | 2220 |
| 652 | Ga0207641_10000103 | 3300026088 | Bacteria | 122350 |
| 653 | Ga0207641_10008745 | 3300026088 | Bacteria | 8365 |
| 654 | Ga0207641_10009054 | 3300026088 | Bacteria | 8223 |
| 655 | Ga0207641_10079739 | 3300026088 | Bacteria | 2839 |
| 656 | Ga0207648_10003666 | 3300026089 | Bacteria | 16077 |
| 657 | Ga0207648_10006999 | 3300026089 | Bacteria | 11151 |
| 658 | Ga0207648_10009796 | 3300026089 | Bacteria | 9155 |
| 659 | Ga0207648_10074823 | 3300026089 | Bacteria | 2952 |
| 660 | Ga0207648_10108021 | 3300026089 | Bacteria | 2442 |
| 661 | Ga0207676_10000044 | 3300026095 | Bacteria | 161679 |
| 662 | Ga0207676_10010622 | 3300026095 | Bacteria | 6563 |
| 663 | Ga0207676_10016879 | 3300026095 | Bacteria | 5285 |
| 664 | Ga0207676_10052284 | 3300026095 | Bacteria | 3192 |
| 665 | Ga0207676_10073921 | 3300026095 | Bacteria | 2744 |
| 666 | Ga0207674_10024031 | 3300026116 | Bacteria | 6517 |
| 667 | Ga0207674_10047126 | 3300026116 | Bacteria | 4421 |
| 668 | Ga0207674_10151319 | 3300026116 | Bacteria | 2278 |
| 669 | Ga0207674_10154307 | 3300026116 | Bacteria | 2252 |
| 670 | Ga0207674_10258133 | 3300026116 | Bacteria | 1690 |
| 671 | Ga0207675_100005413 | 3300026118 | Bacteria | 12230 |
| 672 | Ga0207675_100029224 | 3300026118 | Bacteria | 5137 |
| 673 | Ga0207675_100039892 | 3300026118 | Bacteria | 4381 |
| 674 | Ga0207675_100042588 | 3300026118 | Bacteria | 4239 |
| 675 | Ga0207683_10000782 | 3300026121 | Bacteria | 29001 |
| 676 | Ga0207683_10001222 | 3300026121 | Bacteria | 23313 |
| 677 | Ga0207683_10014258 | 3300026121 | Bacteria | 6772 |
| 678 | Ga0207683_10030958 | 3300026121 | Bacteria | 4641 |
| 679 | Ga0207683_10185100 | 3300026121 | Bacteria | 1889 |
| 680 | Ga0207698_10000603 | 3300026142 | Bacteria | 21081 |
| 681 | Ga0207698_10033824 | 3300026142 | Bacteria | 3719 |
| 682 | Ga0207698_10045774 | 3300026142 | Bacteria | 3298 |
| 683 | Ga0207698_10154018 | 3300026142 | Bacteria | 1999 |
| 684 | Ga0209389_1000011 | 3300027296 | Bacteria | 223265 |
| 685 | Ga0209389_1000424 | 3300027296 | Bacteria | 25082 |
| 686 | Ga0209589_1004180 | 3300027357 | Bacteria | 25082 |
| 687 | Ga0209489_100017 | 3300027361 | Bacteria | 223265 |
| 688 | Ga0209489_104563 | 3300027361 | Bacteria | 25351 |
| 689 | Ga0209700_100027 | 3300027363 | Bacteria | 223462 |
| 690 | Ga0209179_1005548 | 3300027512 | Bacteria | 1982 |
| 691 | Ga0210002_1003574 | 3300027617 | Bacteria | 2295 |
| 692 | Ga0209588_1017593 | 3300027671 | Bacteria | 2217 |
| 693 | Ga0209998_10001207 | 3300027717 | Bacteria | 6346 |
| 694 | Ga0209998_10006448 | 3300027717 | Bacteria | 2437 |
| 695 | Ga0209974_10001210 | 3300027876 | Bacteria | 9241 |
| 696 | Ga0209974_10020357 | 3300027876 | Bacteria | 2199 |
| 697 | Ga0207428_10000164 | 3300027907 | Bacteria | 91968 |
| 698 | Ga0207428_10000391 | 3300027907 | Bacteria | 54825 |
| 699 | Ga0207428_10002684 | 3300027907 | Bacteria | 17726 |
| 700 | Ga0207428_10030850 | 3300027907 | Bacteria | 4428 |
| 701 | Ga0207428_10033735 | 3300027907 | Bacteria | 4200 |
| 702 | Ga0207428_10157801 | 3300027907 | Bacteria | 1724 |
| 703 | Ga0268266_10003117 | 3300028379 | Bacteria | 16871 |
| 704 | Ga0268266_10005300 | 3300028379 | Bacteria | 12094 |
| 705 | Ga0268266_10137128 | 3300028379 | Bacteria | 2192 |
| 706 | Ga0268266_10245286 | 3300028379 | Bacteria | 1655 |
| 707 | Ga0268265_10000142 | 3300028380 | Bacteria | 91165 |
| 708 | Ga0268265_10067166 | 3300028380 | Bacteria | 2775 |
| 709 | Ga0268265_10157663 | 3300028380 | Bacteria | 1923 |
| 710 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 711 | Ga0268264_10007183 | 3300028381 | Bacteria | 9329 |
| 712 | Ga0268264_10124929 | 3300028381 | Bacteria | 2273 |
| 713 | Ga0265337_1019331 | 3300028556 | Bacteria | 2148 |
| 714 | Ga0265319_1001186 | 3300028563 | Bacteria | 16109 |
| 715 | Ga0265334_10004555 | 3300028573 | Bacteria | 6143 |
| 716 | Ga0265334_10026011 | 3300028573 | Bacteria | 2365 |
| 717 | Ga0265318_10002015 | 3300028577 | Bacteria | 11243 |
| 718 | Ga0265318_10002315 | 3300028577 | Bacteria | 10231 |
| 719 | Ga0265318_10002586 | 3300028577 | Bacteria | 9581 |
| 720 | Ga0265323_10000768 | 3300028653 | Bacteria | 17199 |
| 721 | Ga0265322_10003636 | 3300028654 | Bacteria | 4638 |
| 722 | Ga0265336_10000106 | 3300028666 | Bacteria | 63839 |
| 723 | Ga0307517_10000049 | 3300028786 | Bacteria | 160368 |
| 724 | Ga0307515_10008473 | 3300028794 | Bacteria | 20029 |
| 725 | Ga0265338_10000065 | 3300028800 | Bacteria | 188966 |
| 726 | Ga0265324_10001808 | 3300029957 | Bacteria | 11615 |
| 727 | Ga0307511_10000948 | 3300030521 | Bacteria | 30775 |
| 728 | Ga0265330_10013442 | 3300031235 | Bacteria | 3814 |
| 729 | Ga0265330_10020506 | 3300031235 | Bacteria | 3020 |
| 730 | Ga0265332_10007484 | 3300031238 | Bacteria | 4937 |
| 731 | Ga0265332_10028029 | 3300031238 | Bacteria | 2466 |
| 732 | Ga0265328_10003748 | 3300031239 | Bacteria | 6699 |
| 733 | Ga0265320_10009181 | 3300031240 | Bacteria | 5983 |
| 734 | Ga0265320_10038913 | 3300031240 | Bacteria | 2381 |
| 735 | Ga0265325_10012239 | 3300031241 | Bacteria | 4909 |
| 736 | Ga0265325_10023047 | 3300031241 | Bacteria | 3405 |
| 737 | Ga0265329_10008771 | 3300031242 | Bacteria | 3813 |
| 738 | Ga0265329_10008995 | 3300031242 | Bacteria | 3753 |
| 739 | Ga0265339_10021009 | 3300031249 | Bacteria | 3807 |
| 740 | Ga0265331_10000945 | 3300031250 | Bacteria | 23156 |
| 741 | Ga0265331_10025683 | 3300031250 | Bacteria | 2970 |
| 742 | Ga0265327_10021443 | 3300031251 | Bacteria | 3898 |
| 743 | Ga0265316_10071014 | 3300031344 | Bacteria | 2684 |
| 744 | Ga0265316_10109432 | 3300031344 | Bacteria | 2094 |
| 745 | Ga0265316_10122993 | 3300031344 | Bacteria | 1959 |
| 746 | Ga0307513_10091203 | 3300031456 | Bacteria | 3106 |
| 747 | Ga0307509_10029697 | 3300031507 | Bacteria | 6062 |
| 748 | Ga0307509_10083377 | 3300031507 | Bacteria | 3295 |
| 749 | Ga0307408_100018764 | 3300031548 | Bacteria | 4648 |
| 750 | Ga0307508_10000090 | 3300031616 | Bacteria | 106893 |
| 751 | Ga0265314_10000220 | 3300031711 | Bacteria | 84921 |
| 752 | Ga0265314_10026005 | 3300031711 | Bacteria | 4404 |
| 753 | Ga0265314_10127697 | 3300031711 | Bacteria | 1590 |
| 754 | Ga0265342_10006047 | 3300031712 | Bacteria | 9083 |
| 755 | Ga0265342_10011954 | 3300031712 | Bacteria | 5900 |
| 756 | Ga0265342_10021271 | 3300031712 | Bacteria | 4146 |
| 757 | Ga0307516_10006682 | 3300031730 | Bacteria | 13475 |
| 758 | Ga0307516_10103897 | 3300031730 | Bacteria | 2654 |
| 759 | Ga0307413_10072121 | 3300031824 | Bacteria | 2179 |
| 760 | Ga0307412_10000335 | 3300031911 | Bacteria | 29669 |
| 761 | Ga0307412_10131089 | 3300031911 | Bacteria | 1821 |
| 762 | Ga0307411_10053158 | 3300032005 | Bacteria | 2652 |
| 763 | Ga0307507_10098971 | 3300033179 | Bacteria | 2452 |
| 764 | Ga0307510_10019318 | 3300033180 | Bacteria | 7995 |
| 765 | Ga0307510_10031887 | 3300033180 | Bacteria | 5944 |
| 766 | Ga0307510_10044427 | 3300033180 | Bacteria | 4812 |
| 767 | Ga0307510_10072820 | 3300033180 | Bacteria | 3410 |
| 768 | Ga0315911_1000011 | 3300033442 | Bacteria | 264678 |
| 769 | Ga0373950_0000340 | 3300034818 | Bacteria | 5861 |
| 770 | Ga0373958_0000223 | 3300034819 | Bacteria | 6705 |
| 771 | Ga0373959_0000418 | 3300034820 | Bacteria | 8131 |
| 772 | Ga0373938_0000580 | 3300034957 | Bacteria | 5903 |
| 773 | Ga0373928_0000151 | 3300035084 | Bacteria | 13297 |
| 774 | Ga0373928_0014812 | 3300035084 | Bacteria | 1581 |
| 775 | Ga0373929_0001036 | 3300035085 | Bacteria | 5391 |
| 776 | Ga0373934_0009191 | 3300035086 | Bacteria | 3701 |
| 777 | Ga0373940_0003150 | 3300035088 | Bacteria | 3328 |
| 778 | Ga0373949_0001703 | 3300035090 | Bacteria | 6102 |
| 779 | Ga0373951_0000232 | 3300035091 | Bacteria | 19022 |
| 780 | Ga0373952_0000567 | 3300035092 | Bacteria | 6518 |
| 781 | Ga0373923_0000595 | 3300035111 | Bacteria | 8982 |
| 782 | Ga0373923_0003802 | 3300035111 | Bacteria | 4905 |
| 783 | Ga0373932_0000366 | 3300035112 | Bacteria | 13946 |
| 784 | Ga0373936_0002231 | 3300035113 | Bacteria | 7235 |
| 785 | Ga0373936_0028657 | 3300035113 | Bacteria | 2190 |
| 786 | Ga0373939_0000753 | 3300035114 | Bacteria | 7981 |
| 787 | Ga0373939_0006530 | 3300035114 | Bacteria | 2813 |
| 788 | Ga0373941_0001679 | 3300035115 | Bacteria | 4740 |
| 789 | Ga0373945_0013753 | 3300035116 | Bacteria | 2704 |
| 790 | Ga0373953_0002952 | 3300035117 | Bacteria | 5199 |
| 791 | Ga0373953_0005683 | 3300035117 | Bacteria | 4065 |
| 792 | Ga0373954_0000951 | 3300035118 | Bacteria | 11318 |
| 793 | Ga0373954_0007519 | 3300035118 | Bacteria | 4768 |
| 794 | Ga0373954_0010242 | 3300035118 | Bacteria | 4134 |
| 795 | Ga0373960_0016590 | 3300035121 | Bacteria | 1898 |
| 796 | Ga0373943_0004323 | 3300035170 | Bacteria | 6444 |
| 797 | Ga0373943_0008124 | 3300035170 | Bacteria | 4708 |
| 798 | Ga0373943_0066244 | 3300035170 | Bacteria | 1818 |
| 799 | Ga0373946_0018323 | 3300035171 | Bacteria | 2687 |
| 800 | Ga0373946_0043539 | 3300035171 | Bacteria | 1850 |
| 801 | Ga0373946_0057985 | 3300035171 | Bacteria | 1639 |
| 802 | Ga0373955_0000360 | 3300035172 | Bacteria | 19140 |
| 803 | Ga0373955_0000643 | 3300035172 | Bacteria | 14950 |
| 804 | Ga0373955_0030797 | 3300035172 | Bacteria | 2805 |
| 805 | Ga0373942_0000780 | 3300035207 | Bacteria | 8788 |
| 806 | Ga0373961_0004799 | 3300035241 | Bacteria | 3250 |
| 807 | Ga0373961_0020487 | 3300035241 | Bacteria | 1750 |
| 808 | Ga0373962_0001878 | 3300035242 | Bacteria | 5009 |
| 809 | Ga0373924_0002747 | 3300035410 | Bacteria | 5940 |
| 810 | Ga0373924_0030057 | 3300035410 | Bacteria | 2175 |
| 811 | Ga0373931_0002260 | 3300035691 | Bacteria | 8511 |
| 812 | Ga0373931_0006487 | 3300035691 | Bacteria | 5467 |
| 813 | Ga0373931_0010679 | 3300035691 | Bacteria | 4418 |
| 814 | Ga0373931_0010912 | 3300035691 | Bacteria | 4374 |
| 815 | Ga0373931_0113141 | 3300035691 | Bacteria | 1542 |
| 816 | Ga0373935_0000075 | 3300035692 | Bacteria | 42723 |
| 817 | Ga0373935_0002949 | 3300035692 | Bacteria | 9803 |
| 818 | Ga0373935_0019417 | 3300035692 | Bacteria | 4144 |
| 819 | Ga0373927_0000950 | 3300035695 | Bacteria | 22071 |
| 820 | Ga0373927_0007183 | 3300035695 | Bacteria | 7558 |
| 821 | Ga0373927_0014279 | 3300035695 | Bacteria | 5262 |
| 822 | Ga0373927_0132370 | 3300035695 | Bacteria | 1630 |
| 823 | Ga0373933_0002546 | 3300035724 | Bacteria | 10225 |
| 824 | Ga0373933_0002722 | 3300035724 | Bacteria | 9888 |
| 825 | Ga0373933_0003920 | 3300035724 | Bacteria | 8208 |
| 826 | Ga0373933_0015393 | 3300035724 | Bacteria | 4261 |
| 827 | Ga0373933_0113081 | 3300035724 | Bacteria | 1695 |
| 828 | Ga0373947_0000138 | 3300035725 | Bacteria | 37713 |
| 829 | Ga0373947_0003025 | 3300035725 | Bacteria | 10019 |
| 830 | Ga0373947_0040432 | 3300035725 | Bacteria | 2777 |
| 831 | Ga0373947_0063903 | 3300035725 | Bacteria | 2243 |
| 832 | Ga0373947_0075867 | 3300035725 | Bacteria | 2071 |
| 833 | Ga0373937_0000057 | 3300036401 | Bacteria | 99491 |
| 834 | Ga0373937_0008436 | 3300036401 | Bacteria | 8955 |
| 835 | Ga0373937_0031959 | 3300036401 | Bacteria | 4772 |
| 836 | Ga0373937_0116753 | 3300036401 | Bacteria | 2485 |
| 837 | Ga0373925_0000078 | 3300037068 | Bacteria | 105238 |
| 838 | Ga0373925_0007900 | 3300037068 | Bacteria | 7745 |
| 839 | Ga0373925_0016899 | 3300037068 | Bacteria | 5282 |
| 840 | Ga0373925_0023694 | 3300037068 | Bacteria | 4479 |
| 841 | Ga0395900_0152680 | 3300037418 | Bacteria | 2359 |
| 842 | Ga0395905_0039879 | 3300037471 | Bacteria | 4405 |
| 843 | Ga0395905_0188380 | 3300037471 | Bacteria | 1936 |
| 844 | Ga0395905_0203419 | 3300037471 | Bacteria | 1856 |
| 845 | Ga0436364_0009978 | 3300037853 | Bacteria | 2047 |
| 846 | Ga0436364_0810480 | 3300037853 | Bacteria | 2901 |
| 847 | Ga0395901_0051193 | 3300038443 | Bacteria | 4293 |
| 848 | Ga0395901_0073367 | 3300038443 | Bacteria | 3569 |
| 849 | Ga0436365_0240210 | 3300039437 | Bacteria | 20191 |
| 850 | Ga0436365_0355346 | 3300039437 | Bacteria | 16712 |
| 851 | Ga0436365_0642532 | 3300039437 | Bacteria | 3284 |
| 852 | Ga0436365_0729222 | 3300039437 | Bacteria | 5511 |
| 853 | Ga0436365_1709207 | 3300039437 | Bacteria | 1942 |
| 854 | Ga0436360_0811388 | 3300039438 | Bacteria | 3964 |
| 855 | Ga0436360_0930029 | 3300039438 | Bacteria | 2601 |
| 856 | Ga0436360_0953856 | 3300039438 | Bacteria | 1958 |
| 857 | Ga0436361_0053786 | 3300039447 | Bacteria | 27680 |
| 858 | Ga0436361_0356069 | 3300039447 | Bacteria | 2837 |
| 859 | Ga0436361_0536912 | 3300039447 | Bacteria | 2398 |
| 860 | Ga0436361_0671651 | 3300039447 | Bacteria | 7640 |
| 861 | Ga0436362_0837923 | 3300039453 | Bacteria | 4261 |
| 862 | Ga0439450_006325 | 3300042008 | Bacteria | 2128 |
| 863 | Ga0439455_0011932 | 3300042012 | Bacteria | 1941 |
| 864 | Ga0439435_0001852 | 3300042436 | Bacteria | 4040 |
| 865 | Ga0439464_0016409 | 3300042439 | Bacteria | 2001 |
| 866 | Ga0451577_0039655 | 3300042876 | Bacteria | 4232 |
| 867 | Ga0466972_0000371 | 3300044658 | Bacteria | 24281 |
| 868 | Ga0466966_0001015 | 3300044684 | Bacteria | 17896 |
| 869 | Ga0466961_0003875 | 3300044693 | Bacteria | 9345 |
| 870 | Ga0453684_0000063 | 3300044712 | Bacteria | 486079 |
| 871 | Ga0453684_0005314 | 3300044712 | Bacteria | 25677 |
| 872 | Ga0453684_0017221 | 3300044712 | Bacteria | 11217 |
| 873 | Ga0453684_0045710 | 3300044712 | Bacteria | 5835 |
| 874 | Ga0453684_0090641 | 3300044712 | Bacteria | 3777 |
| 875 | Ga0466959_0008411 | 3300045049 | Bacteria | 7295 |
| 876 | Ga0466959_0092197 | 3300045049 | Bacteria | 2175 |
| 877 | Ga0451576_0017298 | 3300045051 | Bacteria | 7933 |
| 878 | Ga0495592_0000233 | 3300046454 | Bacteria | 48027 |
| 879 | Ga0495592_0006322 | 3300046454 | Bacteria | 8817 |
| 880 | Ga0495592_0009069 | 3300046454 | Bacteria | 7481 |
| 881 | Ga0495592_0022208 | 3300046454 | Bacteria | 4827 |
| 882 | Ga0495592_0026673 | 3300046454 | Bacteria | 4379 |
| 883 | Ga0495592_0133728 | 3300046454 | Bacteria | 1732 |
| 884 | Ga0495603_0000200 | 3300046455 | Bacteria | 31435 |
| 885 | Ga0495603_0004845 | 3300046455 | Bacteria | 8045 |
| 886 | Ga0495603_0013905 | 3300046455 | Bacteria | 4869 |
| 887 | Ga0495603_0021588 | 3300046455 | Bacteria | 3899 |
| 888 | Ga0495603_0033822 | 3300046455 | Bacteria | 3075 |
| 889 | Ga0495603_0035297 | 3300046455 | Bacteria | 3004 |
| 890 | Ga0495603_0041698 | 3300046455 | Bacteria | 2744 |
| 891 | Ga0495629_0000139 | 3300046459 | Bacteria | 63649 |
| 892 | Ga0495629_0002535 | 3300046459 | Bacteria | 14008 |
| 893 | Ga0495629_0003366 | 3300046459 | Bacteria | 12077 |
| 894 | Ga0495629_0010260 | 3300046459 | Bacteria | 6822 |
| 895 | Ga0495638_0004444 | 3300046460 | Bacteria | 10621 |
| 896 | Ga0495638_0011979 | 3300046460 | Bacteria | 5961 |
| 897 | Ga0495638_0054119 | 3300046460 | Bacteria | 2496 |
| 898 | Ga0495641_0007101 | 3300046461 | Bacteria | 7084 |
| 899 | Ga0495641_0008896 | 3300046461 | Bacteria | 6042 |
| 900 | Ga0495641_0011896 | 3300046461 | Bacteria | 4913 |
| 901 | Ga0495651_0002019 | 3300046462 | Bacteria | 15670 |
| 902 | Ga0495651_0002101 | 3300046462 | Bacteria | 15375 |
| 903 | Ga0495651_0027827 | 3300046462 | Bacteria | 4405 |
| 904 | Ga0495653_0000464 | 3300046463 | Bacteria | 31572 |
| 905 | Ga0495653_0001070 | 3300046463 | Bacteria | 21097 |
| 906 | Ga0495653_0001537 | 3300046463 | Bacteria | 18040 |
| 907 | Ga0495653_0028701 | 3300046463 | Bacteria | 4448 |
| 908 | Ga0495580_0002104 | 3300046472 | Bacteria | 17472 |
| 909 | Ga0495580_0034637 | 3300046472 | Bacteria | 3634 |
| 910 | Ga0495582_0000354 | 3300046473 | Bacteria | 25130 |
| 911 | Ga0495582_0100804 | 3300046473 | Bacteria | 1617 |
| 912 | Ga0495639_0005177 | 3300046475 | Bacteria | 5601 |
| 913 | Ga0495662_0001193 | 3300046476 | Bacteria | 12825 |
| 914 | Ga0495662_0037215 | 3300046476 | Bacteria | 2350 |
| 915 | Ga0495664_0000023 | 3300046477 | Bacteria | 126807 |
| 916 | Ga0495664_0000915 | 3300046477 | Bacteria | 15177 |
| 917 | Ga0495664_0008000 | 3300046477 | Bacteria | 5886 |
| 918 | Ga0495664_0009369 | 3300046477 | Bacteria | 5477 |
| 919 | Ga0495664_0074724 | 3300046477 | Bacteria | 2028 |
| 920 | Ga0495584_0001897 | 3300046491 | Bacteria | 12061 |
| 921 | Ga0495585_0094128 | 3300046492 | Bacteria | 1610 |
| 922 | Ga0495594_0001396 | 3300046499 | Bacteria | 12540 |
| 923 | Ga0495594_0020533 | 3300046499 | Bacteria | 3518 |
| 924 | Ga0495607_0006400 | 3300046501 | Bacteria | 8294 |
| 925 | Ga0495607_0022482 | 3300046501 | Bacteria | 3960 |
| 926 | Ga0495606_0002687 | 3300046507 | Bacteria | 20107 |
| 927 | Ga0495608_0000030 | 3300046511 | Bacteria | 145828 |
| 928 | Ga0495608_0000832 | 3300046511 | Bacteria | 21541 |
| 929 | Ga0495608_0005335 | 3300046511 | Bacteria | 9184 |
| 930 | Ga0495608_0019297 | 3300046511 | Bacteria | 4694 |
| 931 | Ga0495608_0042381 | 3300046511 | Bacteria | 3044 |
| 932 | Ga0495608_0061824 | 3300046511 | Bacteria | 2462 |
| 933 | Ga0495610_0011330 | 3300046512 | Bacteria | 5458 |
| 934 | Ga0495618_0000585 | 3300046514 | Bacteria | 25962 |
| 935 | Ga0495618_0019644 | 3300046514 | Bacteria | 4158 |
| 936 | Ga0495618_0061547 | 3300046514 | Bacteria | 2381 |
| 937 | Ga0495628_0000027 | 3300046516 | Bacteria | 126537 |
| 938 | Ga0495628_0014573 | 3300046516 | Bacteria | 6584 |
| 939 | Ga0495628_0067228 | 3300046516 | Bacteria | 2799 |
| 940 | Ga0495630_0006673 | 3300046517 | Bacteria | 8227 |
| 941 | Ga0495630_0018196 | 3300046517 | Bacteria | 5159 |
| 942 | Ga0495630_0030591 | 3300046517 | Bacteria | 4006 |
| 943 | Ga0495632_0005127 | 3300046519 | Bacteria | 8747 |
| 944 | Ga0495637_0015591 | 3300046520 | Bacteria | 3565 |
| 945 | Ga0495648_0008413 | 3300046524 | Bacteria | 8123 |
| 946 | Ga0495652_0000041 | 3300046529 | Bacteria | 126519 |
| 947 | Ga0495652_0006363 | 3300046529 | Bacteria | 10997 |
| 948 | Ga0495652_0017901 | 3300046529 | Bacteria | 6323 |
| 949 | Ga0495652_0023871 | 3300046529 | Bacteria | 5416 |
| 950 | Ga0495652_0040925 | 3300046529 | Bacteria | 4003 |
| 951 | Ga0495652_0074114 | 3300046529 | Bacteria | 2832 |
| 952 | Ga0495665_0002145 | 3300046531 | Bacteria | 10679 |
| 953 | Ga0495665_0002572 | 3300046531 | Bacteria | 9795 |
| 954 | Ga0495640_0000056 | 3300046533 | Bacteria | 62074 |
| 955 | Ga0495640_0017266 | 3300046533 | Bacteria | 5381 |
| 956 | Ga0495640_0021984 | 3300046533 | Bacteria | 4671 |
| 957 | Ga0495640_0030764 | 3300046533 | Bacteria | 3840 |
| 958 | Ga0495640_0075383 | 3300046533 | Bacteria | 2253 |
| 959 | Ga0495640_0094870 | 3300046533 | Bacteria | 1964 |
| 960 | Ga0495586_0052757 | 3300046535 | Bacteria | 2202 |
| 961 | Ga0495587_0000025 | 3300046536 | Bacteria | 147974 |
| 962 | Ga0495587_0014270 | 3300046536 | Bacteria | 4985 |
| 963 | Ga0495587_0017630 | 3300046536 | Bacteria | 4434 |
| 964 | Ga0495587_0024566 | 3300046536 | Bacteria | 3691 |
| 965 | Ga0495609_0000650 | 3300046538 | Bacteria | 27040 |
| 966 | Ga0495609_0053131 | 3300046538 | Bacteria | 1802 |
| 967 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 968 | Ga0495645_0002752 | 3300046543 | Bacteria | 11949 |
| 969 | Ga0495645_0087492 | 3300046543 | Bacteria | 2229 |
| 970 | Ga0495622_0073150 | 3300046557 | Bacteria | 1581 |
| 971 | Ga0495633_0002146 | 3300046558 | Bacteria | 14137 |
| 972 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 973 | Ga0495667_0003082 | 3300046559 | Bacteria | 11183 |
| 974 | Ga0495667_0005379 | 3300046559 | Bacteria | 8657 |
| 975 | Ga0495667_0014365 | 3300046559 | Bacteria | 5349 |
| 976 | Ga0495667_0029156 | 3300046559 | Bacteria | 3714 |
| 977 | Ga0495667_0037964 | 3300046559 | Bacteria | 3208 |
| 978 | Ga0495667_0059628 | 3300046559 | Bacteria | 2504 |
| 979 | Ga0495656_0000091 | 3300046615 | Bacteria | 38995 |
| 980 | Ga0495656_0030882 | 3300046615 | Bacteria | 2168 |
| 981 | Ga0495656_0059799 | 3300046615 | Bacteria | 1659 |
| 982 | Ga0495668_0037116 | 3300046616 | Bacteria | 2728 |
| 983 | Ga0495634_0001485 | 3300046642 | Bacteria | 20743 |
| 984 | Ga0495634_0003609 | 3300046642 | Bacteria | 12362 |
| 985 | Ga0495634_0006837 | 3300046642 | Bacteria | 8630 |
| 986 | Ga0495634_0035941 | 3300046642 | Bacteria | 3390 |
| 987 | Ga0495611_0031594 | 3300046648 | Bacteria | 2331 |
| 988 | Ga0495625_0000657 | 3300046660 | Bacteria | 49342 |
| 989 | Ga0495625_0054122 | 3300046660 | Bacteria | 2867 |
| 990 | Ga0495635_0000077 | 3300046663 | Bacteria | 60215 |
| 991 | Ga0495635_0001348 | 3300046663 | Bacteria | 16335 |
| 992 | Ga0495635_0001667 | 3300046663 | Bacteria | 14944 |
| 993 | Ga0495635_0005923 | 3300046663 | Bacteria | 8529 |
| 994 | Ga0495635_0014408 | 3300046663 | Bacteria | 5531 |
| 995 | Ga0495635_0026385 | 3300046663 | Bacteria | 4043 |
| 996 | Ga0495659_0003716 | 3300046664 | Bacteria | 4852 |
| 997 | Ga0495659_0013930 | 3300046664 | Bacteria | 2624 |
| 998 | Ga0495588_0007030 | 3300046674 | Bacteria | 5102 |
| 999 | Ga0495588_0026608 | 3300046674 | Bacteria | 2889 |
| 1000 | Ga0495588_0104312 | 3300046674 | Bacteria | 1491 |
| 1001 | Ga0495657_0000390 | 3300046675 | Bacteria | 40745 |
| 1002 | Ga0495657_0002643 | 3300046675 | Bacteria | 14975 |
| 1003 | Ga0495657_0033520 | 3300046675 | Bacteria | 3574 |
| 1004 | Ga0495657_0044165 | 3300046675 | Bacteria | 3033 |
| 1005 | Ga0495599_0000021 | 3300046678 | Bacteria | 127591 |
| 1006 | Ga0495599_0006501 | 3300046678 | Bacteria | 7052 |
| 1007 | Ga0495599_0031977 | 3300046678 | Bacteria | 3303 |
| 1008 | Ga0495599_0035992 | 3300046678 | Bacteria | 3107 |
| 1009 | Ga0495623_0000141 | 3300046679 | Bacteria | 44491 |
| 1010 | Ga0495623_0007128 | 3300046679 | Bacteria | 7258 |
| 1011 | Ga0495646_0000051 | 3300046680 | Bacteria | 60085 |
| 1012 | Ga0495646_0002199 | 3300046680 | Bacteria | 11877 |
| 1013 | Ga0495646_0010792 | 3300046680 | Bacteria | 5803 |
| 1014 | Ga0495646_0031676 | 3300046680 | Bacteria | 3294 |
| 1015 | Ga0495646_0081565 | 3300046680 | Bacteria | 1884 |
| 1016 | Ga0495658_0000065 | 3300046683 | Bacteria | 52835 |
| 1017 | Ga0495658_0062648 | 3300046683 | Bacteria | 2138 |
| 1018 | Ga0495658_0077884 | 3300046683 | Bacteria | 1939 |
| 1019 | Ga0495669_0035333 | 3300046684 | Bacteria | 2206 |
| 1020 | Ga0495613_0002672 | 3300046689 | Bacteria | 13380 |
| 1021 | Ga0495624_0001939 | 3300046690 | Bacteria | 15749 |
| 1022 | Ga0495624_0002275 | 3300046690 | Bacteria | 14611 |
| 1023 | Ga0495624_0005832 | 3300046690 | Bacteria | 8812 |
| 1024 | Ga0495624_0049899 | 3300046690 | Bacteria | 2653 |
| 1025 | Ga0495670_0000199 | 3300046691 | Bacteria | 26898 |
| 1026 | Ga0495589_0061358 | 3300046794 | Bacteria | 1846 |
| 1027 | Ga0495600_0000114 | 3300046809 | Bacteria | 44972 |
| 1028 | Ga0495600_0005269 | 3300046809 | Bacteria | 7784 |
| 1029 | Ga0495600_0028768 | 3300046809 | Bacteria | 3597 |
| 1030 | Ga0495600_0071798 | 3300046809 | Bacteria | 2261 |
| 1031 | Ga0495600_0076891 | 3300046809 | Bacteria | 2180 |
| 1032 | Ga0495660_0024370 | 3300046810 | Bacteria | 3447 |
| 1033 | Ga0495581_0000851 | 3300047315 | Bacteria | 16242 |
| 1034 | Ga0495581_0005368 | 3300047315 | Bacteria | 7416 |
| 1035 | Ga0495581_0009905 | 3300047315 | Bacteria | 5512 |
| 1036 | Ga0495604_0000036 | 3300047317 | Bacteria | 126707 |
| 1037 | Ga0495604_0005569 | 3300047317 | Bacteria | 9982 |
| 1038 | Ga0495604_0005625 | 3300047317 | Bacteria | 9939 |
| 1039 | Ga0495604_0008438 | 3300047317 | Bacteria | 8136 |
| 1040 | Ga0495604_0084461 | 3300047317 | Bacteria | 2370 |
| 1041 | Ga0495674_0000102 | 3300047319 | Bacteria | 62602 |
| 1042 | Ga0495674_0000559 | 3300047319 | Bacteria | 34585 |
| 1043 | Ga0495674_0073584 | 3300047319 | Bacteria | 2945 |
| 1044 | Ga0495674_0073683 | 3300047319 | Bacteria | 2942 |
| 1045 | Ga0495674_0239130 | 3300047319 | Bacteria | 1497 |
| 1046 | Ga0495672_0100931 | 3300047320 | Bacteria | 1565 |
| 1047 | Ga0495676_0037239 | 3300047321 | Bacteria | 4051 |
| 1048 | Ga0495680_0001061 | 3300047322 | Bacteria | 30436 |
| 1049 | Ga0495680_0007181 | 3300047322 | Bacteria | 10259 |
| 1050 | Ga0495680_0016879 | 3300047322 | Bacteria | 6253 |
| 1051 | Ga0495680_0036826 | 3300047322 | Bacteria | 3923 |
| 1052 | Ga0495687_004001 | 3300047443 | Bacteria | 10251 |
| 1053 | Ga0495675_0000148 | 3300047444 | Bacteria | 49201 |
| 1054 | Ga0495675_0010844 | 3300047444 | Bacteria | 5711 |
| 1055 | Ga0495675_0024047 | 3300047444 | Bacteria | 3881 |
| 1056 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 1057 | Ga0495681_0000922 | 3300047470 | Bacteria | 22658 |
| 1058 | Ga0495684_0000025 | 3300047471 | Bacteria | 127037 |
| 1059 | Ga0495684_0001073 | 3300047471 | Bacteria | 22129 |
| 1060 | Ga0495684_0005198 | 3300047471 | Bacteria | 10142 |
| 1061 | Ga0495684_0051054 | 3300047471 | Bacteria | 3157 |
| 1062 | Ga0495593_0000606 | 3300047673 | Bacteria | 20452 |
| 1063 | Ga0495593_0000682 | 3300047673 | Bacteria | 19575 |
| 1064 | Ga0495593_0000953 | 3300047673 | Bacteria | 16903 |
| 1065 | Ga0495593_0002018 | 3300047673 | Bacteria | 12102 |
| 1066 | Ga0495593_0022456 | 3300047673 | Bacteria | 3515 |
| 1067 | Ga0495602_0000311 | 3300048088 | Bacteria | 44943 |
| 1068 | Ga0495602_0002010 | 3300048088 | Bacteria | 20455 |
| 1069 | Ga0495602_0117562 | 3300048088 | Bacteria | 2146 |
| 1070 | Ga0495602_0165611 | 3300048088 | Bacteria | 1721 |
| 1071 | Ga0495614_0011184 | 3300048089 | Bacteria | 3949 |
| 1072 | Ga0495615_0017359 | 3300048090 | Bacteria | 1567 |
| 1073 | Ga0496100_0001531 | 3300048903 | Bacteria | 11342 |
| 1074 | Ga0496100_0009429 | 3300048903 | Bacteria | 5488 |
| 1075 | Ga0496100_0047368 | 3300048903 | Bacteria | 2769 |
| 1076 | Ga0496100_0072896 | 3300048903 | Bacteria | 2297 |
| 1077 | Ga0496101_0002275 | 3300048904 | Bacteria | 11728 |
| 1078 | Ga0496101_0005103 | 3300048904 | Bacteria | 8348 |
| 1079 | Ga0496101_0015686 | 3300048904 | Bacteria | 5112 |
| 1080 | Ga0496101_0023426 | 3300048904 | Bacteria | 4265 |
| 1081 | Ga0496101_0035927 | 3300048904 | Bacteria | 3507 |
| 1082 | Ga0496102_0002260 | 3300048905 | Bacteria | 16503 |
| 1083 | Ga0496102_0004237 | 3300048905 | Bacteria | 12125 |
| 1084 | Ga0496102_0009466 | 3300048905 | Bacteria | 8373 |
| 1085 | Ga0496102_0072006 | 3300048905 | Bacteria | 3175 |
| 1086 | Ga0496102_0097665 | 3300048905 | Bacteria | 2724 |
| 1087 | Ga0496102_0167526 | 3300048905 | Bacteria | 2068 |
| 1088 | Ga0496103_0004038 | 3300048906 | Bacteria | 8917 |
| 1089 | Ga0496103_0021711 | 3300048906 | Bacteria | 3863 |
| 1090 | Ga0496103_0027506 | 3300048906 | Bacteria | 3446 |
| 1091 | Ga0496103_0032074 | 3300048906 | Bacteria | 3205 |
| 1092 | Ga0496104_0002505 | 3300048907 | Bacteria | 15804 |
| 1093 | Ga0496104_0003501 | 3300048907 | Bacteria | 13541 |
| 1094 | Ga0496104_0005997 | 3300048907 | Bacteria | 10649 |
| 1095 | Ga0496104_0009306 | 3300048907 | Bacteria | 8737 |
| 1096 | Ga0496104_0013196 | 3300048907 | Bacteria | 7447 |
| 1097 | Ga0496104_0054467 | 3300048907 | Bacteria | 3781 |
| 1098 | Ga0496104_0115067 | 3300048907 | Bacteria | 2580 |
| 1099 | Ga0496105_0019841 | 3300048908 | Bacteria | 5424 |
| 1100 | Ga0496105_0025947 | 3300048908 | Bacteria | 4775 |
| 1101 | Ga0496105_0102078 | 3300048908 | Bacteria | 2368 |
| 1102 | Ga0496105_0128423 | 3300048908 | Bacteria | 2090 |
| 1103 | Ga0496106_0000262 | 3300048909 | Bacteria | 36919 |
| 1104 | Ga0496106_0015208 | 3300048909 | Bacteria | 5694 |
| 1105 | Ga0496106_0046597 | 3300048909 | Bacteria | 3260 |
| 1106 | Ga0496106_0075706 | 3300048909 | Bacteria | 2578 |
| 1107 | Ga0496107_0001922 | 3300048910 | Bacteria | 13186 |
| 1108 | Ga0496107_0005227 | 3300048910 | Bacteria | 8861 |
| 1109 | Ga0496107_0063265 | 3300048910 | Bacteria | 2681 |
| 1110 | Ga0496107_0074425 | 3300048910 | Bacteria | 2471 |
| 1111 | Ga0496107_0088582 | 3300048910 | Bacteria | 2259 |
| 1112 | Ga0496107_0089038 | 3300048910 | Bacteria | 2253 |
| 1113 | Ga0496108_0000357 | 3300048911 | Bacteria | 38614 |
| 1114 | Ga0496108_0018407 | 3300048911 | Bacteria | 5718 |
| 1115 | Ga0496108_0029729 | 3300048911 | Bacteria | 4527 |
| 1116 | Ga0496108_0032499 | 3300048911 | Bacteria | 4334 |
| 1117 | Ga0496108_0057939 | 3300048911 | Bacteria | 3255 |
| 1118 | Ga0496108_0059583 | 3300048911 | Bacteria | 3210 |
| 1119 | Ga0496108_0067878 | 3300048911 | Bacteria | 3008 |
| 1120 | Ga0496108_0097387 | 3300048911 | Bacteria | 2506 |
| 1121 | Ga0496108_0098085 | 3300048911 | Bacteria | 2497 |
| 1122 | Ga0496109_0002224 | 3300048912 | Bacteria | 16103 |
| 1123 | Ga0496109_0002394 | 3300048912 | Bacteria | 15685 |
| 1124 | Ga0496109_0008633 | 3300048912 | Bacteria | 8673 |
| 1125 | Ga0496109_0035557 | 3300048912 | Bacteria | 4495 |
| 1126 | Ga0496109_0048639 | 3300048912 | Bacteria | 3858 |
| 1127 | Ga0496109_0055117 | 3300048912 | Bacteria | 3627 |
| 1128 | Ga0496109_0060680 | 3300048912 | Bacteria | 3456 |
| 1129 | Ga0496109_0083342 | 3300048912 | Bacteria | 2948 |
| 1130 | Ga0496109_0262605 | 3300048912 | Bacteria | 1626 |
| 1131 | Ga0496110_0000205 | 3300048913 | Bacteria | 37706 |
| 1132 | Ga0496110_0003778 | 3300048913 | Bacteria | 11663 |
| 1133 | Ga0496110_0003980 | 3300048913 | Bacteria | 11375 |
| 1134 | Ga0496110_0005741 | 3300048913 | Bacteria | 9749 |
| 1135 | Ga0496110_0032897 | 3300048913 | Bacteria | 4483 |
| 1136 | Ga0496110_0039631 | 3300048913 | Bacteria | 4103 |
| 1137 | Ga0496110_0052971 | 3300048913 | Bacteria | 3565 |
| 1138 | Ga0496110_0073614 | 3300048913 | Bacteria | 3031 |
| 1139 | Ga0496110_0075322 | 3300048913 | Bacteria | 2998 |
| 1140 | Ga0496111_0000632 | 3300048914 | Bacteria | 18585 |
| 1141 | Ga0496111_0009563 | 3300048914 | Bacteria | 6477 |
| 1142 | Ga0496111_0035729 | 3300048914 | Bacteria | 3553 |
| 1143 | Ga0496111_0040066 | 3300048914 | Bacteria | 3360 |
| 1144 | Ga0496111_0078761 | 3300048914 | Bacteria | 2403 |
| 1145 | Ga0496111_0103383 | 3300048914 | Bacteria | 2095 |
| 1146 | Ga0496111_0140573 | 3300048914 | Bacteria | 1789 |
| 1147 | Ga0496112_0000117 | 3300048915 | Bacteria | 49274 |
| 1148 | Ga0496112_0006469 | 3300048915 | Bacteria | 10288 |
| 1149 | Ga0496112_0014600 | 3300048915 | Bacteria | 7297 |
| 1150 | Ga0496112_0034574 | 3300048915 | Bacteria | 4918 |
| 1151 | Ga0496112_0067283 | 3300048915 | Bacteria | 3535 |
| 1152 | Ga0496112_0094153 | 3300048915 | Bacteria | 2966 |
| 1153 | Ga0496112_0095342 | 3300048915 | Bacteria | 2946 |
| 1154 | Ga0496112_0096518 | 3300048915 | Bacteria | 2926 |
| 1155 | Ga0496112_0168066 | 3300048915 | Bacteria | 2159 |
| 1156 | Ga0496113_0012280 | 3300048916 | Bacteria | 5751 |
| 1157 | Ga0496113_0074000 | 3300048916 | Bacteria | 2597 |
| 1158 | Ga0496114_0003638 | 3300048917 | Bacteria | 11856 |
| 1159 | Ga0496114_0070632 | 3300048917 | Bacteria | 2933 |
| 1160 | Ga0496114_0097793 | 3300048917 | Bacteria | 2501 |
| 1161 | Ga0496114_0127142 | 3300048917 | Bacteria | 2198 |
| 1162 | Ga0496114_0127904 | 3300048917 | Bacteria | 2191 |
| 1163 | Ga0496115_0002584 | 3300048918 | Bacteria | 12996 |
| 1164 | Ga0496115_0007856 | 3300048918 | Bacteria | 7867 |
| 1165 | Ga0496115_0013022 | 3300048918 | Bacteria | 6279 |
| 1166 | Ga0496115_0027835 | 3300048918 | Bacteria | 4425 |
| 1167 | Ga0496115_0031895 | 3300048918 | Bacteria | 4154 |
| 1168 | Ga0496115_0040608 | 3300048918 | Bacteria | 3699 |
| 1169 | Ga0496115_0042767 | 3300048918 | Bacteria | 3611 |
| 1170 | Ga0496115_0106870 | 3300048918 | Bacteria | 2297 |
| 1171 | Ga0496115_0146166 | 3300048918 | Bacteria | 1951 |
| 1172 | Ga0496116_0003967 | 3300048919 | Bacteria | 14367 |
| 1173 | Ga0496116_0006130 | 3300048919 | Bacteria | 10995 |
| 1174 | Ga0496116_0049570 | 3300048919 | Bacteria | 2806 |
| 1175 | Ga0496116_0058030 | 3300048919 | Bacteria | 2526 |
| 1176 | Ga0496116_0061093 | 3300048919 | Bacteria | 2441 |
| 1177 | Ga0496117_0013767 | 3300048920 | Bacteria | 7025 |
| 1178 | Ga0496117_0052341 | 3300048920 | Bacteria | 2877 |
| 1179 | Ga0496117_0110843 | 3300048920 | Bacteria | 1710 |
| 1180 | Ga0496118_0001099 | 3300048921 | Bacteria | 42066 |
| 1181 | Ga0496118_0013843 | 3300048921 | Bacteria | 7594 |
| 1182 | Ga0496118_0056535 | 3300048921 | Bacteria | 2949 |
| 1183 | Ga0496119_0016661 | 3300048922 | Bacteria | 5577 |
| 1184 | Ga0496119_0033910 | 3300048922 | Bacteria | 3374 |
| 1185 | Ga0496120_0020029 | 3300048923 | Bacteria | 4262 |
| 1186 | Ga0496120_0104179 | 3300048923 | Bacteria | 1493 |
| 1187 | Ga0496121_0000094 | 3300048924 | Bacteria | 212726 |
| 1188 | Ga0496121_0001006 | 3300048924 | Bacteria | 50348 |
| 1189 | Ga0496121_0003460 | 3300048924 | Bacteria | 22502 |
| 1190 | Ga0496121_0033601 | 3300048924 | Bacteria | 4637 |
| 1191 | Ga0496121_0034449 | 3300048924 | Bacteria | 4557 |
| 1192 | Ga0496121_0158666 | 3300048924 | Bacteria | 1657 |
| 1193 | Ga0496122_0000214 | 3300048925 | Bacteria | 129132 |
| 1194 | Ga0496122_0000693 | 3300048925 | Bacteria | 67068 |
| 1195 | Ga0496122_0049843 | 3300048925 | Bacteria | 3200 |
| 1196 | Ga0496123_0000187 | 3300048926 | Bacteria | 125396 |
| 1197 | Ga0496123_0000433 | 3300048926 | Bacteria | 75427 |
| 1198 | Ga0496123_0070311 | 3300048926 | Bacteria | 2191 |
| 1199 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 1200 | Ga0496124_0024007 | 3300048927 | Bacteria | 5551 |
| 1201 | Ga0496124_0069590 | 3300048927 | Bacteria | 2921 |
| 1202 | Ga0496125_0000363 | 3300048928 | Bacteria | 85601 |
| 1203 | Ga0496125_0028136 | 3300048928 | Bacteria | 5082 |
| 1204 | Ga0496125_0030111 | 3300048928 | Bacteria | 4862 |
| 1205 | Ga0496125_0074343 | 3300048928 | Bacteria | 2635 |
| 1206 | Ga0496126_0018230 | 3300048929 | Bacteria | 6965 |
| 1207 | Ga0496126_0026719 | 3300048929 | Bacteria | 5527 |
| 1208 | Ga0496126_0118838 | 3300048929 | Bacteria | 2294 |
| 1209 | Ga0496126_0143480 | 3300048929 | Bacteria | 2053 |
| 1210 | Ga0496126_0172212 | 3300048929 | Bacteria | 1843 |
| 1211 | Ga0495678_000012 | 3300049459 | Bacteria | 333905 |
| 1212 | Ga0495678_018166 | 3300049459 | Bacteria | 3168 |
| 1213 | Ga0501036_0138972 | 3300049572 | Bacteria | 2050 |
| 1214 | Ga0501038_0075199 | 3300049574 | Bacteria | 2855 |
| 1215 | Ga0501072_0004057 | 3300049588 | Bacteria | 11086 |
| 1216 | Ga0501076_0111397 | 3300049592 | Bacteria | 2212 |
| 1217 | Ga0501080_0090377 | 3300049742 | Bacteria | 2845 |
| 1218 | nmdc:mga03683_30513_c1 | 3300050489 | Bacteria | 2157 |
| 1219 | nmdc:mga03n38_1633_c1 | 3300050490 | Bacteria | 6559 |
| 1220 | nmdc:mga03n38_39900_c1 | 3300050490 | Bacteria | 2038 |
| 1221 | nmdc:mga00v17_30628_c1 | 3300050491 | Bacteria | 3166 |
| 1222 | nmdc:mga00v17_64616_c1 | 3300050491 | Bacteria | 2255 |
| 1223 | nmdc:mga00v17_6544_c1 | 3300050491 | Bacteria | 6184 |
| 1224 | nmdc:mga0yw44_12756_c1 | 3300050492 | Bacteria | 4394 |
| 1225 | nmdc:mga0yw44_23299_c1 | 3300050492 | Bacteria | 3486 |
| 1226 | nmdc:mga0yw44_5661_c1 | 3300050492 | Bacteria | 5946 |
| 1227 | nmdc:mga0yw44_59421_c1 | 3300050492 | Bacteria | 2339 |
| 1228 | nmdc:mga0yw44_95507_c1 | 3300050492 | Bacteria | 1886 |
| 1229 | nmdc:mga0k408_1761_c1 | 3300050493 | Bacteria | 11603 |
| 1230 | nmdc:mga0k408_48540_c1 | 3300050493 | Bacteria | 2456 |
| 1231 | nmdc:mga06z11_110024_c1 | 3300050494 | Bacteria | 1524 |
| 1232 | nmdc:mga06z11_45409_c1 | 3300050494 | Bacteria | 2221 |
| 1233 | nmdc:mga06z11_68184_c1 | 3300050494 | Bacteria | 1875 |
| 1234 | nmdc:mga06z11_72698_c1 | 3300050494 | Bacteria | 1824 |
| 1235 | nmdc:mga06z11_8463_c1 | 3300050494 | Bacteria | 4291 |
| 1236 | nmdc:mga07m45_13314_c1 | 3300050496 | Bacteria | 4362 |
| 1237 | nmdc:mga07m45_61814_c1 | 3300050496 | Bacteria | 2122 |
| 1238 | nmdc:mga07m45_9639_c1 | 3300050496 | Bacteria | 5019 |
| 1239 | nmdc:mga05p37_1118_c3 | 3300050507 | Bacteria | 2050 |
| 1240 | nmdc:mga05p37_13202_c1 | 3300050507 | Bacteria | 9887 |
| 1241 | nmdc:mga05p37_151_c1 | 3300050507 | Bacteria | 65585 |
| 1242 | nmdc:mga05p37_225993_c1 | 3300050507 | Bacteria | 2257 |
| 1243 | nmdc:mga05p37_69744_c1 | 3300050507 | Bacteria | 4324 |
| 1244 | nmdc:mga05p37_80496_c1 | 3300050507 | Bacteria | 4012 |
| 1245 | nmdc:mga05p37_9089_c1 | 3300050507 | Bacteria | 11745 |
| 1246 | nmdc:mga09592_11500_c1 | 3300050508 | Bacteria | 6607 |
| 1247 | nmdc:mga09592_1771_c1 | 3300050508 | Bacteria | 17345 |
| 1248 | nmdc:mga09592_7025_c1 | 3300050508 | Bacteria | 9151 |
| 1249 | nmdc:mga0qj67_205141_c1 | 3300050509 | Bacteria | 1601 |
| 1250 | nmdc:mga0qj67_3588_c1 | 3300050509 | Bacteria | 11199 |
| 1251 | nmdc:mga0qj67_56258_c1 | 3300050509 | Bacteria | 3118 |
| 1252 | nmdc:mga0qj67_933_c1 | 3300050509 | Bacteria | 20130 |
| 1253 | nmdc:mga06r32_134364_c1 | 3300050510 | Bacteria | 2448 |
| 1254 | nmdc:mga06r32_134961_c1 | 3300050510 | Bacteria | 2442 |
| 1255 | nmdc:mga06r32_16885_c1 | 3300050510 | Bacteria | 6659 |
| 1256 | nmdc:mga06r32_201_c1 | 3300050510 | Bacteria | 26944 |
| 1257 | nmdc:mga08y16_108_c1 | 3300050511 | Bacteria | 69804 |
| 1258 | nmdc:mga08y16_17978_c1 | 3300050511 | Bacteria | 7448 |
| 1259 | nmdc:mga08y16_193529_c1 | 3300050511 | Bacteria | 2109 |
| 1260 | nmdc:mga08y16_62145_c1 | 3300050511 | Bacteria | 3900 |
| 1261 | nmdc:mga08y16_86448_c1 | 3300050511 | Bacteria | 3268 |
| 1262 | nmdc:mga0n895_151330_c1 | 3300050512 | Bacteria | 2351 |
| 1263 | nmdc:mga0n895_244857_c1 | 3300050512 | Bacteria | 1820 |
| 1264 | nmdc:mga0n895_265_c1 | 3300050512 | Bacteria | 34107 |
| 1265 | nmdc:mga0n895_404_c1 | 3300050512 | Bacteria | 29050 |
| 1266 | nmdc:mga0n895_4878_c1 | 3300050512 | Bacteria | 11111 |
| 1267 | nmdc:mga0n895_61632_c1 | 3300050512 | Bacteria | 3704 |
| 1268 | nmdc:mga0n895_64657_c1 | 3300050512 | Bacteria | 3619 |
| 1269 | nmdc:mga0n895_78921_c1 | 3300050512 | Bacteria | 3277 |
| 1270 | nmdc:mga0rr50_10550_c1 | 3300050513 | Bacteria | 5869 |
| 1271 | nmdc:mga0rr50_173038_c1 | 3300050513 | Bacteria | 1761 |
| 1272 | nmdc:mga0rr50_65104_c1 | 3300050513 | Bacteria | 2760 |
| 1273 | nmdc:mga0rr50_97526_c1 | 3300050513 | Bacteria | 2302 |
| 1274 | nmdc:mga0a205_105418_c1 | 3300050515 | Bacteria | 2718 |
| 1275 | nmdc:mga0a205_114960_c1 | 3300050515 | Bacteria | 2589 |
| 1276 | nmdc:mga0a205_146_c1 | 3300050515 | Bacteria | 45616 |
| 1277 | nmdc:mga0a205_1877_c1 | 3300050515 | Bacteria | 18205 |
| 1278 | nmdc:mga0a205_30042_c1 | 3300050515 | Bacteria | 5201 |
| 1279 | nmdc:mga0a205_63974_c1 | 3300050515 | Bacteria | 3553 |
| 1280 | nmdc:mga0a205_78738_c1 | 3300050515 | Bacteria | 3184 |
| 1281 | nmdc:mga0sz30_155_c2 | 3300050516 | Bacteria | 13523 |
| 1282 | Ga0495601_0000025 | 3300053077 | Bacteria | 127736 |
| 1283 | Ga0495601_0002768 | 3300053077 | Bacteria | 9957 |
| 1284 | Ga0495601_0002986 | 3300053077 | Bacteria | 9633 |
| 1285 | Ga0495601_0014260 | 3300053077 | Bacteria | 4788 |
| 1286 | Ga0495601_0029067 | 3300053077 | Bacteria | 3426 |
| 1287 | Ga0495601_0056086 | 3300053077 | Bacteria | 2495 |
| 1288 | Ga0495612_0000046 | 3300053078 | Bacteria | 59912 |
| 1289 | Ga0495612_0006837 | 3300053078 | Bacteria | 4670 |
| 1290 | Ga0495612_0018845 | 3300053078 | Bacteria | 2763 |
| 1291 | Ga0495612_0033529 | 3300053078 | Bacteria | 2078 |
| 1292 | Ga0500610_0056426 | 3300053079 | Bacteria | 2050 |
| 1293 | Ga0495595_0000054 | 3300053084 | Bacteria | 59828 |
| 1294 | Ga0495595_0000696 | 3300053084 | Bacteria | 12842 |
| 1295 | Ga0495595_0002171 | 3300053084 | Bacteria | 7628 |
| 1296 | Ga0495595_0008608 | 3300053084 | Bacteria | 4196 |
| 1297 | Ga0495619_0000035 | 3300053085 | Bacteria | 126262 |
| 1298 | Ga0495619_0000048 | 3300053085 | Bacteria | 102117 |
| 1299 | Ga0495619_0000966 | 3300053085 | Bacteria | 18840 |
| 1300 | Ga0495619_0001255 | 3300053085 | Bacteria | 16631 |
| 1301 | Ga0495619_0004720 | 3300053085 | Bacteria | 8676 |
| 1302 | Ga0495619_0006396 | 3300053085 | Bacteria | 7464 |
| 1303 | Ga0495619_0033264 | 3300053085 | Bacteria | 3348 |
| 1304 | Ga0495619_0047709 | 3300053085 | Bacteria | 2821 |
| 1305 | Ga0500643_000019 | 3300053087 | Bacteria | 294301 |
| 1306 | Ga0500643_001637 | 3300053087 | Bacteria | 12517 |
| 1307 | Ga0500644_0000670 | 3300053088 | Bacteria | 12478 |
| 1308 | Ga0500646_0001743 | 3300053090 | Bacteria | 5718 |
| 1309 | Ga0500583_0008143 | 3300053092 | Bacteria | 3741 |
| 1310 | Ga0500651_0019640 | 3300053093 | Bacteria | 4201 |
| 1311 | Ga0500651_0099808 | 3300053093 | Bacteria | 1780 |
| 1312 | Ga0500566_0001280 | 3300053094 | Bacteria | 14651 |
| 1313 | Ga0500566_0024756 | 3300053094 | Bacteria | 3521 |
| 1314 | Ga0500640_048834 | 3300053095 | Bacteria | 1854 |
| 1315 | Ga0500641_0007284 | 3300053096 | Bacteria | 3943 |
| 1316 | Ga0500554_002430 | 3300053102 | Bacteria | 3664 |
| 1317 | Ga0500555_004780 | 3300053103 | Bacteria | 3844 |
| 1318 | Ga0500557_000039 | 3300053105 | Bacteria | 66862 |
| 1319 | Ga0500569_007080 | 3300053109 | Bacteria | 2499 |
| 1320 | Ga0500572_000559 | 3300053111 | Bacteria | 12701 |
| 1321 | Ga0500572_001849 | 3300053111 | Bacteria | 5366 |
| 1322 | Ga0500592_006852 | 3300053116 | Bacteria | 1814 |
| 1323 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 1324 | Ga0500595_023204 | 3300053119 | Bacteria | 2184 |
| 1325 | Ga0500614_001873 | 3300053123 | Bacteria | 4850 |
| 1326 | Ga0500618_000286 | 3300053125 | Bacteria | 38499 |
| 1327 | Ga0500618_001413 | 3300053125 | Bacteria | 10762 |
| 1328 | Ga0500642_0000285 | 3300053130 | Bacteria | 18457 |
| 1329 | Ga0500642_0023818 | 3300053130 | Bacteria | 2464 |
| 1330 | Ga0500642_0028020 | 3300053130 | Bacteria | 2319 |
| 1331 | Ga0500642_0032814 | 3300053130 | Bacteria | 2182 |
| 1332 | Ga0500642_0066964 | 3300053130 | Bacteria | 1626 |
| 1333 | Ga0500658_0016238 | 3300053134 | Bacteria | 2772 |
| 1334 | Ga0500559_0008368 | 3300053136 | Bacteria | 4538 |
| 1335 | Ga0500559_0020926 | 3300053136 | Bacteria | 2768 |
| 1336 | Ga0500559_0044275 | 3300053136 | Bacteria | 1946 |
| 1337 | Ga0500568_0004264 | 3300053139 | Bacteria | 7684 |
| 1338 | Ga0500573_0040300 | 3300053140 | Bacteria | 2697 |
| 1339 | Ga0500603_000423 | 3300053150 | Bacteria | 10988 |
| 1340 | Ga0500603_002454 | 3300053150 | Bacteria | 4058 |
| 1341 | Ga0500604_0006398 | 3300053151 | Bacteria | 3114 |
| 1342 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1343 | Ga0500616_0003426 | 3300053153 | Bacteria | 12139 |
| 1344 | Ga0500616_0047643 | 3300053153 | Bacteria | 2275 |
| 1345 | Ga0500616_0068270 | 3300053153 | Bacteria | 1821 |
| 1346 | Ga0500630_001193 | 3300053159 | Bacteria | 12207 |
| 1347 | Ga0500639_000025 | 3300053163 | Bacteria | 84839 |
| 1348 | Ga0500636_0000313 | 3300053177 | Bacteria | 26675 |
| 1349 | Ga0500636_0029794 | 3300053177 | Bacteria | 3225 |
| 1350 | Ga0500636_0030709 | 3300053177 | Bacteria | 3180 |
| 1351 | Ga0500637_0000655 | 3300053178 | Bacteria | 13752 |
| 1352 | Ga0500637_0008929 | 3300053178 | Bacteria | 5078 |
| 1353 | Ga0500625_007580 | 3300053729 | Bacteria | 4729 |
| 1354 | Ga0500645_000078 | 3300053730 | Bacteria | 76931 |
| 1355 | Ga0500596_001197 | 3300053735 | Bacteria | 5242 |
| 1356 | Ga0500596_004849 | 3300053735 | Bacteria | 2428 |
| 1357 | Ga0500596_007040 | 3300053735 | Bacteria | 1860 |
| 1358 | Ga0500599_002587 | 3300053736 | Bacteria | 2174 |
| 1359 | Ga0500601_000643 | 3300053737 | Bacteria | 4818 |
| 1360 | Ga0501084_0142571 | 3300054114 | Bacteria | 2018 |
| 1361 | Ga0501084_0167955 | 3300054114 | Bacteria | 1852 |
| 1362 | Ga0466962_0066665 | 3300061719 | Bacteria | 1719 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048924 | Ga0496121_0000094 | Ga0496121_0000094_200311_201657 | 383 |
| 2 | 3300048919 | Ga0496116_0049570 | Ga0496116_0049570_1377_2723 | 384 |
| 3 | 3300048922 | Ga0496119_0016661 | Ga0496119_0016661_1366_2712 | 384 |
| 4 | 3300048926 | Ga0496123_0070311 | Ga0496123_0070311_666_2012 | 384 |
| 5 | 3300048928 | Ga0496125_0000363 | Ga0496125_0000363_3349_4695 | 384 |
| 6 | 3300048925 | Ga0496122_0000214 | Ga0496122_0000214_107887_109257 | 385 |
| 7 | 3300048926 | Ga0496123_0000187 | Ga0496123_0000187_121755_123125 | 385 |
| 8 | 3300048928 | Ga0496125_0028136 | Ga0496125_0028136_360_1730 | 385 |
| 9 | 3300048919 | Ga0496116_0006130 | Ga0496116_0006130_657_2015 | 386 |
| 10 | 3300048929 | Ga0496126_0118838 | Ga0496126_0118838_350_1708 | 386 |
| 11 | 3300003203 | JGI25406J46586_10001211 | JGI25406J46586_100012111 | 397 |
| 12 | 3300005985 | Ga0081539_10001010 | Ga0081539_100010101 | 397 |
| 13 | 3300005445 | Ga0070708_100005534 | Ga0070708_1000055348 | 401 |
| 14 | 3300048929 | Ga0496126_0143480 | Ga0496126_0143480_482_1828 | 401 |
| 15 | 3300007076 | Ga0075435_100056294 | Ga0075435_1000562943 | 402 |
| 16 | 3300009147 | Ga0114129_10178412 | Ga0114129_101784121 | 402 |
| 17 | 3300048920 | Ga0496117_0052341 | Ga0496117_0052341_1399_2790 | 402 |
| 18 | 3300048923 | Ga0496120_0020029 | Ga0496120_0020029_949_2295 | 402 |
| 19 | 3300048927 | Ga0496124_0069590 | Ga0496124_0069590_972_2318 | 402 |
| 20 | 3300048928 | Ga0496125_0030111 | Ga0496125_0030111_2748_4178 | 402 |
| 21 | 3300005518 | Ga0070699_100198807 | Ga0070699_1001988071 | 406 |
| 22 | 3300006173 | Ga0070716_100059932 | Ga0070716_1000599322 | 406 |
| 23 | 3300050515 | nmdc:mga0a205_105418_c1 | nmdc:mga0a205_105418_c1_515_1810 | 406 |
| 24 | 3300037853 | Ga0436364_0009978 | Ga0436364_0009978_102_1553 | 407 |
| 25 | 3300006880 | Ga0075429_100020211 | Ga0075429_1000202114 | 411 |
| 26 | 3300009147 | Ga0114129_10003194 | Ga0114129_1000319418 | 411 |
| 27 | 3300050507 | nmdc:mga05p37_1118_c3 | nmdc:mga05p37_1118_c3_414_1718 | 411 |
| 28 | 3300050508 | nmdc:mga09592_7025_c1 | nmdc:mga09592_7025_c1_4595_5899 | 411 |
| 29 | 3300050510 | nmdc:mga06r32_134364_c1 | nmdc:mga06r32_134364_c1_1057_2361 | 411 |
| 30 | 3300005985 | Ga0081539_10004951 | Ga0081539_100049512 | 412 |
| 31 | 3300009147 | Ga0114129_10002163 | Ga0114129_1000216316 | 412 |
| 32 | 3300053125 | Ga0500618_000286 | Ga0500618_000286_28406_29803 | 413 |
| 33 | 3300031911 | Ga0307412_10000335 | Ga0307412_100003352 | 414 |
| 34 | 3300039447 | Ga0436361_0536912 | Ga0436361_0536912_35_1471 | 414 |
| 35 | 3300049742 | Ga0501080_0090377 | Ga0501080_0090377_841_2193 | 414 |
| 36 | 3300050510 | nmdc:mga06r32_16885_c1 | nmdc:mga06r32_16885_c1_2735_4123 | 418 |
| 37 | 3300025292 | Ga0209676_1002143 | Ga0209676_10021434 | 419 |
| 38 | 3300025298 | Ga0209050_1000925 | Ga0209050_10009256 | 419 |
| 39 | 3300050489 | nmdc:mga03683_30513_c1 | nmdc:mga03683_30513_c1_174_1490 | 419 |
| 40 | 3300048915 | Ga0496112_0168066 | Ga0496112_0168066_130_1542 | 420 |
| 41 | 3300010159 | Ga0099796_10006609 | Ga0099796_100066093 | 422 |
| 42 | 3300046512 | Ga0495610_0011330 | Ga0495610_0011330_2063_3442 | 422 |
| 43 | 3300047469 | Ga0495673_0000008 | Ga0495673_0000008_504651_506030 | 422 |
| 44 | iso_pu_bacteria | 2929199973 | 2929202432 | 422 |
| 45 | iso_pu_bacteria | 8055909800 | 8055915834 | 422 |
| 46 | 3300035171 | Ga0373946_0057985 | Ga0373946_0057985_90_1439 | 423 |
| 47 | 3300005468 | Ga0070707_100003645 | Ga0070707_10000364511 | 425 |
| 48 | 3300025922 | Ga0207646_10007486 | Ga0207646_100074862 | 425 |
| 49 | 3300027512 | Ga0209179_1005548 | Ga0209179_10055482 | 425 |
| 50 | 3300035725 | Ga0373947_0075867 | Ga0373947_0075867_64_1386 | 425 |
| 51 | 3300044712 | Ga0453684_0017221 | Ga0453684_0017221_1945_3279 | 425 |
| 52 | 3300005563 | Ga0068855_100167406 | Ga0068855_1001674062 | 426 |
| 53 | 3300006042 | Ga0075368_10028649 | Ga0075368_100286492 | 426 |
| 54 | 3300006177 | Ga0075362_10009545 | Ga0075362_100095454 | 426 |
| 55 | 3300006186 | Ga0075369_10011401 | Ga0075369_100114013 | 426 |
| 56 | 3300046454 | Ga0495592_0022208 | Ga0495592_0022208_591_2126 | 426 |
| 57 | 3300046511 | Ga0495608_0061824 | Ga0495608_0061824_187_1722 | 426 |
| 58 | 3300046533 | Ga0495640_0075383 | Ga0495640_0075383_10_1545 | 426 |
| 59 | 3300046559 | Ga0495667_0059628 | Ga0495667_0059628_232_1767 | 426 |
| 60 | 3300047317 | Ga0495604_0005625 | Ga0495604_0005625_4709_6244 | 426 |
| 61 | 3300047673 | Ga0495593_0022456 | Ga0495593_0022456_1892_3427 | 426 |
| 62 | 3300050492 | nmdc:mga0yw44_12756_c1 | nmdc:mga0yw44_12756_c1_2617_3987 | 426 |
| 63 | 3300053077 | Ga0495601_0002768 | Ga0495601_0002768_8369_9904 | 426 |
| 64 | 3300053078 | Ga0495612_0033529 | Ga0495612_0033529_294_1829 | 426 |
| 65 | 3300053084 | Ga0495595_0002171 | Ga0495595_0002171_4352_5887 | 426 |
| 66 | 3300053085 | Ga0495619_0000048 | Ga0495619_0000048_67781_69316 | 426 |
| 67 | 3300002705 | JGI25156J39149_1000150 | JGI25156J39149_100015026 | 427 |
| 68 | 3300002738 | JGI25154J39366_1000165 | JGI25154J39366_100016526 | 427 |
| 69 | 3300002741 | JGI25157J39369_1000383 | JGI25157J39369_10003839 | 427 |
| 70 | 3300003758 | Ga0055532_1000097 | Ga0055532_100009763 | 427 |
| 71 | 3300003761 | Ga0055535_1003562 | Ga0055535_10035621 | 427 |
| 72 | 3300005545 | Ga0070695_100156811 | Ga0070695_1001568111 | 427 |
| 73 | 3300025206 | Ga0209435_100040 | Ga0209435_10004021 | 427 |
| 74 | 3300025229 | Ga0209147_100141 | Ga0209147_10014178 | 427 |
| 75 | 3300025242 | Ga0209258_100657 | Ga0209258_10065718 | 427 |
| 76 | 3300025246 | Ga0209646_1000253 | Ga0209646_100025321 | 427 |
| 77 | 3300025250 | Ga0209026_1000306 | Ga0209026_100030628 | 427 |
| 78 | 3300025256 | Ga0209759_1000398 | Ga0209759_100039828 | 427 |
| 79 | 3300025302 | Ga0207426_1006921 | Ga0207426_10069213 | 428 |
| 80 | iso_pu_bacteria | 2941479691 | 2941484555 | 428 |
| 81 | 3300003792 | Ga0055540_1002994 | Ga0055540_10029946 | 429 |
| 82 | 3300003794 | Ga0055531_10000152 | Ga0055531_1000015277 | 429 |
| 83 | 3300025273 | Ga0209673_1014952 | Ga0209673_10149521 | 429 |
| 84 | 3300025303 | Ga0209051_1000059 | Ga0209051_1000059171 | 429 |
| 85 | 3300025304 | Ga0209257_1000022 | Ga0209257_1000022229 | 429 |
| 86 | 3300042876 | Ga0451577_0039655 | Ga0451577_0039655_2158_3501 | 429 |
| 87 | 3300044712 | Ga0453684_0005314 | Ga0453684_0005314_15947_17290 | 429 |
| 88 | iso_pu_bacteria | 2857542790 | 2857547413 | 429 |
| 89 | iso_pu_bacteria | 2928115317 | 2928115935 | 429 |
| 90 | 3300005331 | Ga0070670_100113853 | Ga0070670_1001138532 | 430 |
| 91 | 3300025291 | Ga0209675_1003720 | Ga0209675_10037206 | 430 |
| 92 | 3300044712 | Ga0453684_0045710 | Ga0453684_0045710_2717_4063 | 430 |
| 93 | 3300046519 | Ga0495632_0005127 | Ga0495632_0005127_6640_7986 | 430 |
| 94 | 3300053153 | Ga0500616_0003426 | Ga0500616_0003426_9804_11177 | 430 |
| 95 | iso_pu_bacteria | 2821131069 | 2821134904 | 430 |
| 96 | iso_pu_bacteria | 2894772417 | 2894775121 | 430 |
| 97 | 3300005329 | Ga0070683_100075511 | Ga0070683_1000755112 | 431 |
| 98 | 3300005937 | Ga0081455_10000768 | Ga0081455_1000076825 | 431 |
| 99 | 3300005983 | Ga0081540_1000303 | Ga0081540_100030313 | 431 |
| 100 | 3300009551 | Ga0105238_10018690 | Ga0105238_100186903 | 431 |
| 101 | 3300025924 | Ga0207694_10014930 | Ga0207694_100149306 | 431 |
| 102 | 3300025944 | Ga0207661_10048530 | Ga0207661_100485302 | 431 |
| 103 | 3300028577 | Ga0265318_10002015 | Ga0265318_1000201510 | 431 |
| 104 | 3300031235 | Ga0265330_10020506 | Ga0265330_100205062 | 431 |
| 105 | 3300031238 | Ga0265332_10028029 | Ga0265332_100280292 | 431 |
| 106 | 3300031240 | Ga0265320_10009181 | Ga0265320_100091812 | 431 |
| 107 | 3300031241 | Ga0265325_10012239 | Ga0265325_100122392 | 431 |
| 108 | 3300031242 | Ga0265329_10008771 | Ga0265329_100087712 | 431 |
| 109 | 3300031344 | Ga0265316_10071014 | Ga0265316_100710142 | 431 |
| 110 | 3300031711 | Ga0265314_10026005 | Ga0265314_100260052 | 431 |
| 111 | 3300031712 | Ga0265342_10021271 | Ga0265342_100212712 | 431 |
| 112 | 3300038443 | Ga0395901_0051193 | Ga0395901_0051193_69_1448 | 431 |
| 113 | 3300048924 | Ga0496121_0158666 | Ga0496121_0158666_298_1638 | 431 |
| 114 | iso_pu_bacteria | 2828305725 | 2828308236 | 431 |
| 115 | 3300003203 | JGI25406J46586_10003889 | JGI25406J46586_100038891 | 432 |
| 116 | 3300005985 | Ga0081539_10002027 | Ga0081539_1000202732 | 432 |
| 117 | 3300006051 | Ga0075364_10001029 | Ga0075364_1000102912 | 432 |
| 118 | 3300039437 | Ga0436365_0355346 | Ga0436365_0355346_2734_4116 | 432 |
| 119 | 3300044712 | Ga0453684_0090641 | Ga0453684_0090641_239_1594 | 432 |
| 120 | 3300050491 | nmdc:mga00v17_6544_c1 | nmdc:mga00v17_6544_c1_2639_3988 | 432 |
| 121 | iso_pu_bacteria | 2595698237 | 2596372893 | 432 |
| 122 | iso_pu_bacteria | 2599185292 | 2599907641 | 432 |
| 123 | iso_pu_bacteria | 2643221569 | 2643860940 | 432 |
| 124 | iso_pu_bacteria | 2643221594 | 2643981187 | 432 |
| 125 | iso_pu_bacteria | 2643221621 | 2644124239 | 432 |
| 126 | iso_pu_bacteria | 2808606395 | 2809035036 | 432 |
| 127 | iso_pu_bacteria | 2842694124 | 2842697014 | 432 |
| 128 | iso_pu_bacteria | 2857537821 | 2857540373 | 432 |
| 129 | iso_pu_bacteria | 2857553236 | 2857558180 | 432 |
| 130 | iso_pu_bacteria | 2857558681 | 2857558841 | 432 |
| 131 | iso_pu_bacteria | 2928125067 | 2928125748 | 432 |
| 132 | iso_pu_bacteria | 8055225921 | 8055228327 | 432 |
| 133 | 3300005843 | Ga0068860_100002390 | Ga0068860_1000023904 | 433 |
| 134 | 3300028381 | Ga0268264_10000035 | Ga0268264_1000003526 | 433 |
| 135 | 3300028794 | Ga0307515_10008473 | Ga0307515_100084733 | 433 |
| 136 | 3300044712 | Ga0453684_0000063 | Ga0453684_0000063_242620_243975 | 433 |
| 137 | 3300048927 | Ga0496124_0000004 | Ga0496124_0000004_903125_904477 | 433 |
| 138 | iso_pu_bacteria | 2513237087 | 2513592131 | 433 |
| 139 | iso_pu_bacteria | 2522572158 | 2523102995 | 433 |
| 140 | 3300007265 | Ga0099794_10009565 | Ga0099794_100095652 | 434 |
| 141 | 3300009093 | Ga0105240_10015980 | Ga0105240_100159807 | 434 |
| 142 | 3300025913 | Ga0207695_10017000 | Ga0207695_100170003 | 434 |
| 143 | 3300027671 | Ga0209588_1017593 | Ga0209588_10175932 | 434 |
| 144 | 3300031344 | Ga0265316_10122993 | Ga0265316_101229931 | 434 |
| 145 | 3300044712 | Ga0453684_0000063 | Ga0453684_0000063_241218_242579 | 434 |
| 146 | 3300046660 | Ga0495625_0054122 | Ga0495625_0054122_907_2280 | 434 |
| 147 | 3300048924 | Ga0496121_0033601 | Ga0496121_0033601_772_2196 | 434 |
| 148 | 3300050491 | nmdc:mga00v17_64616_c1 | nmdc:mga00v17_64616_c1_637_1992 | 434 |
| 149 | iso_pu_bacteria | 2738541281 | 2738744126 | 434 |
| 150 | iso_pu_bacteria | 2738543032 | 2739353356 | 434 |
| 151 | iso_pu_bacteria | 2829745981 | 2829747715 | 434 |
| 152 | iso_pu_bacteria | 2842698319 | 2842699593 | 434 |
| 153 | iso_pu_bacteria | 2861691609 | 2861694133 | 434 |
| 154 | iso_pu_bacteria | 2917699015 | 2917705402 | 434 |
| 155 | iso_pu_bacteria | 8054002106 | 8054005745 | 434 |
| 156 | 3300002704 | JGI25155J39150_1000538 | JGI25155J39150_10005388 | 435 |
| 157 | 3300002738 | JGI25154J39366_1000210 | JGI25154J39366_100021025 | 435 |
| 158 | 3300005548 | Ga0070665_100224776 | Ga0070665_1002247761 | 435 |
| 159 | 3300006163 | Ga0070715_10010703 | Ga0070715_100107032 | 435 |
| 160 | 3300017792 | Ga0163161_10019750 | Ga0163161_100197503 | 435 |
| 161 | 3300025246 | Ga0209646_1000204 | Ga0209646_100020437 | 435 |
| 162 | 3300025256 | Ga0209759_1000298 | Ga0209759_100029837 | 435 |
| 163 | 3300025905 | Ga0207685_10005926 | Ga0207685_100059262 | 435 |
| 164 | 3300035086 | Ga0373934_0009191 | Ga0373934_0009191_1842_3227 | 435 |
| 165 | 3300037471 | Ga0395905_0203419 | Ga0395905_0203419_447_1823 | 435 |
| 166 | 3300046511 | Ga0495608_0005335 | Ga0495608_0005335_2078_3463 | 435 |
| 167 | 3300046680 | Ga0495646_0031676 | Ga0495646_0031676_1401_2786 | 435 |
| 168 | 3300047444 | Ga0495675_0010844 | Ga0495675_0010844_2564_3949 | 435 |
| 169 | 3300048918 | Ga0496115_0007856 | Ga0496115_0007856_2019_3467 | 435 |
| 170 | 3300050516 | nmdc:mga0sz30_155_c2 | nmdc:mga0sz30_155_c2_9554_10912 | 435 |
| 171 | iso_pu_bacteria | 2545555834 | 2545674442 | 435 |
| 172 | iso_pu_bacteria | 2738543013 | 2739250194 | 435 |
| 173 | iso_pu_bacteria | 3003665799 | 3003669389 | 435 |
| 174 | iso_pu_bacteria | 641522639 | 641644955 | 435 |
| 175 | 3300003215 | JGI25153J46596_10014889 | JGI25153J46596_100148892 | 436 |
| 176 | 3300005458 | Ga0070681_10006215 | Ga0070681_100062152 | 436 |
| 177 | 3300005544 | Ga0070686_100153092 | Ga0070686_1001530921 | 436 |
| 178 | 3300005981 | Ga0081538_10000527 | Ga0081538_1000052728 | 436 |
| 179 | 3300005985 | Ga0081539_10039464 | Ga0081539_100394641 | 436 |
| 180 | 3300006844 | Ga0075428_100291397 | Ga0075428_1002913972 | 436 |
| 181 | 3300006852 | Ga0075433_10001540 | Ga0075433_1000154011 | 436 |
| 182 | 3300006871 | Ga0075434_100004709 | Ga0075434_1000047092 | 436 |
| 183 | 3300006871 | Ga0075434_100115829 | Ga0075434_1001158292 | 436 |
| 184 | 3300007076 | Ga0075435_100120272 | Ga0075435_1001202722 | 436 |
| 185 | 3300007076 | Ga0075435_100163692 | Ga0075435_1001636922 | 436 |
| 186 | 3300009094 | Ga0111539_10025207 | Ga0111539_100252074 | 436 |
| 187 | 3300035121 | Ga0373960_0016590 | Ga0373960_0016590_269_1627 | 436 |
| 188 | 3300035695 | Ga0373927_0132370 | Ga0373927_0132370_47_1405 | 436 |
| 189 | 3300046507 | Ga0495606_0002687 | Ga0495606_0002687_16425_17810 | 436 |
| 190 | 3300046538 | Ga0495609_0000650 | Ga0495609_0000650_7556_8938 | 436 |
| 191 | 3300046810 | Ga0495660_0024370 | Ga0495660_0024370_1824_3206 | 436 |
| 192 | 3300047470 | Ga0495681_0000922 | Ga0495681_0000922_15775_17157 | 436 |
| 193 | 3300048911 | Ga0496108_0067878 | Ga0496108_0067878_718_2076 | 436 |
| 194 | 3300048914 | Ga0496111_0140573 | Ga0496111_0140573_349_1707 | 436 |
| 195 | 3300048915 | Ga0496112_0000117 | Ga0496112_0000117_37852_39303 | 436 |
| 196 | 3300048917 | Ga0496114_0097793 | Ga0496114_0097793_400_1755 | 436 |
| 197 | 3300048919 | Ga0496116_0061093 | Ga0496116_0061093_998_2380 | 436 |
| 198 | 3300048927 | Ga0496124_0024007 | Ga0496124_0024007_4009_5388 | 436 |
| 199 | 3300049459 | Ga0495678_000012 | Ga0495678_000012_332384_333766 | 436 |
| 200 | 3300050512 | nmdc:mga0n895_4878_c1 | nmdc:mga0n895_4878_c1_2391_3749 | 436 |
| 201 | 3300050513 | nmdc:mga0rr50_97526_c1 | nmdc:mga0rr50_97526_c1_345_1703 | 436 |
| 202 | 3300050515 | nmdc:mga0a205_1877_c1 | nmdc:mga0a205_1877_c1_9588_10946 | 436 |
| 203 | 3300001976 | JGI24752J21851_1003222 | JGI24752J21851_10032222 | 437 |
| 204 | 3300005290 | Ga0065712_10084632 | Ga0065712_100846322 | 437 |
| 205 | 3300005329 | Ga0070683_100018296 | Ga0070683_1000182962 | 437 |
| 206 | 3300005331 | Ga0070670_100000081 | Ga0070670_10000008113 | 437 |
| 207 | 3300005331 | Ga0070670_100016676 | Ga0070670_1000166764 | 437 |
| 208 | 3300005333 | Ga0070677_10027474 | Ga0070677_100274741 | 437 |
| 209 | 3300005338 | Ga0068868_100060713 | Ga0068868_1000607132 | 437 |
| 210 | 3300005344 | Ga0070661_100100792 | Ga0070661_1001007922 | 437 |
| 211 | 3300005354 | Ga0070675_100005492 | Ga0070675_1000054928 | 437 |
| 212 | 3300005355 | Ga0070671_100011767 | Ga0070671_1000117672 | 437 |
| 213 | 3300005356 | Ga0070674_100021106 | Ga0070674_1000211063 | 437 |
| 214 | 3300005366 | Ga0070659_100146899 | Ga0070659_1001468991 | 437 |
| 215 | 3300005367 | Ga0070667_100001429 | Ga0070667_10000142915 | 437 |
| 216 | 3300005439 | Ga0070711_100185497 | Ga0070711_1001854971 | 437 |
| 217 | 3300005441 | Ga0070700_100038270 | Ga0070700_1000382701 | 437 |
| 218 | 3300005444 | Ga0070694_100114741 | Ga0070694_1001147411 | 437 |
| 219 | 3300005445 | Ga0070708_100137961 | Ga0070708_1001379612 | 437 |
| 220 | 3300005456 | Ga0070678_100033200 | Ga0070678_1000332002 | 437 |
| 221 | 3300005459 | Ga0068867_100073968 | Ga0068867_1000739682 | 437 |
| 222 | 3300005468 | Ga0070707_100059338 | Ga0070707_1000593381 | 437 |
| 223 | 3300005471 | Ga0070698_100002784 | Ga0070698_10000278413 | 437 |
| 224 | 3300005518 | Ga0070699_100010274 | Ga0070699_1000102743 | 437 |
| 225 | 3300005535 | Ga0070684_100090112 | Ga0070684_1000901121 | 437 |
| 226 | 3300005536 | Ga0070697_100111263 | Ga0070697_1001112632 | 437 |
| 227 | 3300005543 | Ga0070672_100037636 | Ga0070672_1000376362 | 437 |
| 228 | 3300005548 | Ga0070665_100332681 | Ga0070665_1003326811 | 437 |
| 229 | 3300005578 | Ga0068854_100066660 | Ga0068854_1000666603 | 437 |
| 230 | 3300005616 | Ga0068852_100020468 | Ga0068852_1000204685 | 437 |
| 231 | 3300005617 | Ga0068859_100153704 | Ga0068859_1001537041 | 437 |
| 232 | 3300005618 | Ga0068864_100000016 | Ga0068864_10000001614 | 437 |
| 233 | 3300005618 | Ga0068864_100030383 | Ga0068864_1000303833 | 437 |
| 234 | 3300005618 | Ga0068864_100033236 | Ga0068864_1000332362 | 437 |
| 235 | 3300005618 | Ga0068864_100084285 | Ga0068864_1000842851 | 437 |
| 236 | 3300005719 | Ga0068861_100161561 | Ga0068861_1001615611 | 437 |
| 237 | 3300005834 | Ga0068851_10077990 | Ga0068851_100779902 | 437 |
| 238 | 3300005840 | Ga0068870_10006935 | Ga0068870_100069353 | 437 |
| 239 | 3300005841 | Ga0068863_100001887 | Ga0068863_10000188710 | 437 |
| 240 | 3300005841 | Ga0068863_100218130 | Ga0068863_1002181302 | 437 |
| 241 | 3300005842 | Ga0068858_100167279 | Ga0068858_1001672791 | 437 |
| 242 | 3300005844 | Ga0068862_100000068 | Ga0068862_10000006814 | 437 |
| 243 | 3300005983 | Ga0081540_1000459 | Ga0081540_100045929 | 437 |
| 244 | 3300006177 | Ga0075362_10022812 | Ga0075362_100228122 | 437 |
| 245 | 3300006178 | Ga0075367_10038273 | Ga0075367_100382732 | 437 |
| 246 | 3300006844 | Ga0075428_100009742 | Ga0075428_1000097423 | 437 |
| 247 | 3300006846 | Ga0075430_100213323 | Ga0075430_1002133231 | 437 |
| 248 | 3300006847 | Ga0075431_100001293 | Ga0075431_10000129310 | 437 |
| 249 | 3300006847 | Ga0075431_100083102 | Ga0075431_1000831022 | 437 |
| 250 | 3300006852 | Ga0075433_10068973 | Ga0075433_100689733 | 437 |
| 251 | 3300006931 | Ga0097620_100153701 | Ga0097620_1001537011 | 437 |
| 252 | 3300009011 | Ga0105251_10002065 | Ga0105251_100020654 | 437 |
| 253 | 3300009094 | Ga0111539_10033030 | Ga0111539_100330303 | 437 |
| 254 | 3300009098 | Ga0105245_10189971 | Ga0105245_101899712 | 437 |
| 255 | 3300009101 | Ga0105247_10037800 | Ga0105247_100378002 | 437 |
| 256 | 3300009147 | Ga0114129_10233588 | Ga0114129_102335882 | 437 |
| 257 | 3300009174 | Ga0105241_10056744 | Ga0105241_100567442 | 437 |
| 258 | 3300009177 | Ga0105248_10095407 | Ga0105248_100954073 | 437 |
| 259 | 3300009177 | Ga0105248_10122502 | Ga0105248_101225022 | 437 |
| 260 | 3300011119 | Ga0105246_10034450 | Ga0105246_100344503 | 437 |
| 261 | 3300013105 | Ga0157369_10249398 | Ga0157369_102493982 | 437 |
| 262 | 3300013296 | Ga0157374_10003804 | Ga0157374_100038047 | 437 |
| 263 | 3300013297 | Ga0157378_10013539 | Ga0157378_100135393 | 437 |
| 264 | 3300013297 | Ga0157378_10079320 | Ga0157378_100793203 | 437 |
| 265 | 3300014325 | Ga0163163_10080858 | Ga0163163_100808581 | 437 |
| 266 | 3300014325 | Ga0163163_10099722 | Ga0163163_100997222 | 437 |
| 267 | 3300014745 | Ga0157377_10052389 | Ga0157377_100523892 | 437 |
| 268 | 3300025315 | Ga0207697_10029005 | Ga0207697_100290051 | 437 |
| 269 | 3300025321 | Ga0207656_10018123 | Ga0207656_100181232 | 437 |
| 270 | 3300025735 | Ga0207713_1002261 | Ga0207713_10022612 | 437 |
| 271 | 3300025900 | Ga0207710_10017532 | Ga0207710_100175322 | 437 |
| 272 | 3300025900 | Ga0207710_10018129 | Ga0207710_100181292 | 437 |
| 273 | 3300025901 | Ga0207688_10010399 | Ga0207688_100103992 | 437 |
| 274 | 3300025901 | Ga0207688_10061197 | Ga0207688_100611971 | 437 |
| 275 | 3300025911 | Ga0207654_10030110 | Ga0207654_100301102 | 437 |
| 276 | 3300025917 | Ga0207660_10180090 | Ga0207660_101800901 | 437 |
| 277 | 3300025920 | Ga0207649_10071124 | Ga0207649_100711241 | 437 |
| 278 | 3300025923 | Ga0207681_10040181 | Ga0207681_100401813 | 437 |
| 279 | 3300025925 | Ga0207650_10000288 | Ga0207650_1000028847 | 437 |
| 280 | 3300025925 | Ga0207650_10001712 | Ga0207650_1000171212 | 437 |
| 281 | 3300025926 | Ga0207659_10016654 | Ga0207659_100166543 | 437 |
| 282 | 3300025927 | Ga0207687_10124106 | Ga0207687_101241062 | 437 |
| 283 | 3300025931 | Ga0207644_10041902 | Ga0207644_100419023 | 437 |
| 284 | 3300025933 | Ga0207706_10014998 | Ga0207706_100149984 | 437 |
| 285 | 3300025935 | Ga0207709_10145261 | Ga0207709_101452611 | 437 |
| 286 | 3300025937 | Ga0207669_10159702 | Ga0207669_101597021 | 437 |
| 287 | 3300025942 | Ga0207689_10065521 | Ga0207689_100655213 | 437 |
| 288 | 3300025944 | Ga0207661_10060818 | Ga0207661_100608182 | 437 |
| 289 | 3300025960 | Ga0207651_10001703 | Ga0207651_100017038 | 437 |
| 290 | 3300025981 | Ga0207640_10061301 | Ga0207640_100613012 | 437 |
| 291 | 3300025986 | Ga0207658_10000466 | Ga0207658_1000046628 | 437 |
| 292 | 3300026023 | Ga0207677_10001053 | Ga0207677_1000105315 | 437 |
| 293 | 3300026035 | Ga0207703_10279628 | Ga0207703_102796281 | 437 |
| 294 | 3300026075 | Ga0207708_10002881 | Ga0207708_1000288111 | 437 |
| 295 | 3300026088 | Ga0207641_10000103 | Ga0207641_1000010313 | 437 |
| 296 | 3300026088 | Ga0207641_10079739 | Ga0207641_100797392 | 437 |
| 297 | 3300026089 | Ga0207648_10009796 | Ga0207648_100097966 | 437 |
| 298 | 3300026089 | Ga0207648_10108021 | Ga0207648_101080212 | 437 |
| 299 | 3300026095 | Ga0207676_10000044 | Ga0207676_1000004413 | 437 |
| 300 | 3300026095 | Ga0207676_10073921 | Ga0207676_100739212 | 437 |
| 301 | 3300026116 | Ga0207674_10047126 | Ga0207674_100471264 | 437 |
| 302 | 3300026118 | Ga0207675_100042588 | Ga0207675_1000425882 | 437 |
| 303 | 3300026121 | Ga0207683_10030958 | Ga0207683_100309583 | 437 |
| 304 | 3300026142 | Ga0207698_10000603 | Ga0207698_1000060312 | 437 |
| 305 | 3300027907 | Ga0207428_10030850 | Ga0207428_100308504 | 437 |
| 306 | 3300028380 | Ga0268265_10000142 | Ga0268265_1000014213 | 437 |
| 307 | 3300028380 | Ga0268265_10067166 | Ga0268265_100671663 | 437 |
| 308 | 3300028573 | Ga0265334_10026011 | Ga0265334_100260112 | 437 |
| 309 | 3300046460 | Ga0495638_0011979 | Ga0495638_0011979_3409_4770 | 437 |
| 310 | 3300046501 | Ga0495607_0022482 | Ga0495607_0022482_1611_3008 | 437 |
| 311 | 3300046615 | Ga0495656_0030882 | Ga0495656_0030882_136_1533 | 437 |
| 312 | 3300048903 | Ga0496100_0047368 | Ga0496100_0047368_1348_2745 | 437 |
| 313 | 3300048904 | Ga0496101_0035927 | Ga0496101_0035927_1963_3336 | 437 |
| 314 | 3300048906 | Ga0496103_0004038 | Ga0496103_0004038_1729_3090 | 437 |
| 315 | 3300048907 | Ga0496104_0005997 | Ga0496104_0005997_6179_7540 | 437 |
| 316 | 3300048910 | Ga0496107_0074425 | Ga0496107_0074425_86_1447 | 437 |
| 317 | 3300048910 | Ga0496107_0089038 | Ga0496107_0089038_24_1421 | 437 |
| 318 | 3300048912 | Ga0496109_0055117 | Ga0496109_0055117_122_1483 | 437 |
| 319 | 3300048913 | Ga0496110_0032897 | Ga0496110_0032897_2770_4143 | 437 |
| 320 | 3300048915 | Ga0496112_0094153 | Ga0496112_0094153_1538_2899 | 437 |
| 321 | 3300048917 | Ga0496114_0070632 | Ga0496114_0070632_1363_2760 | 437 |
| 322 | 3300048918 | Ga0496115_0040608 | Ga0496115_0040608_1628_2989 | 437 |
| 323 | 3300048920 | Ga0496117_0013767 | Ga0496117_0013767_3777_5138 | 437 |
| 324 | 3300048921 | Ga0496118_0001099 | Ga0496118_0001099_9556_10917 | 437 |
| 325 | 3300050491 | nmdc:mga00v17_30628_c1 | nmdc:mga00v17_30628_c1_1792_3153 | 437 |
| 326 | 3300050493 | nmdc:mga0k408_1761_c1 | nmdc:mga0k408_1761_c1_9465_10841 | 437 |
| 327 | 3300050494 | nmdc:mga06z11_45409_c1 | nmdc:mga06z11_45409_c1_726_2087 | 437 |
| 328 | 3300050494 | nmdc:mga06z11_8463_c1 | nmdc:mga06z11_8463_c1_2801_4162 | 437 |
| 329 | 3300050507 | nmdc:mga05p37_69744_c1 | nmdc:mga05p37_69744_c1_2524_3885 | 437 |
| 330 | 3300050509 | nmdc:mga0qj67_205141_c1 | nmdc:mga0qj67_205141_c1_105_1466 | 437 |
| 331 | 3300050510 | nmdc:mga06r32_201_c1 | nmdc:mga06r32_201_c1_17524_18885 | 437 |
| 332 | 3300050511 | nmdc:mga08y16_17978_c1 | nmdc:mga08y16_17978_c1_2052_3413 | 437 |
| 333 | 3300050511 | nmdc:mga08y16_62145_c1 | nmdc:mga08y16_62145_c1_1565_2926 | 437 |
| 334 | 3300050515 | nmdc:mga0a205_30042_c1 | nmdc:mga0a205_30042_c1_1395_2756 | 437 |
| 335 | iso_pu_bacteria | 2513237139 | 2513878038 | 437 |
| 336 | 3300003751 | Ga0055538_1000054 | Ga0055538_100005465 | 438 |
| 337 | 3300003752 | Ga0055539_1000066 | Ga0055539_100006665 | 438 |
| 338 | 3300003756 | Ga0055533_1000076 | Ga0055533_100007665 | 438 |
| 339 | 3300003759 | Ga0055525_1000098 | Ga0055525_100009865 | 438 |
| 340 | 3300003841 | Ga0055541_1000056 | Ga0055541_100005665 | 438 |
| 341 | 3300005616 | Ga0068852_100055070 | Ga0068852_1000550703 | 438 |
| 342 | 3300006038 | Ga0075365_10025380 | Ga0075365_100253802 | 438 |
| 343 | 3300009093 | Ga0105240_10003119 | Ga0105240_1000311913 | 438 |
| 344 | 3300009094 | Ga0111539_10027318 | Ga0111539_100273185 | 438 |
| 345 | 3300009551 | Ga0105238_10052431 | Ga0105238_100524313 | 438 |
| 346 | 3300021361 | Ga0213872_10003584 | Ga0213872_100035849 | 438 |
| 347 | 3300025224 | Ga0209784_100002 | Ga0209784_1000021552 | 438 |
| 348 | 3300025225 | Ga0209566_100003 | Ga0209566_1000031552 | 438 |
| 349 | 3300025226 | Ga0209674_100004 | Ga0209674_1000041552 | 438 |
| 350 | 3300025230 | Ga0209563_100006 | Ga0209563_1000061552 | 438 |
| 351 | 3300025253 | Ga0209677_100003 | Ga0209677_1000031552 | 438 |
| 352 | 3300025297 | Ga0209758_1002883 | Ga0209758_10028836 | 438 |
| 353 | 3300025913 | Ga0207695_10023519 | Ga0207695_100235193 | 438 |
| 354 | 3300025924 | Ga0207694_10035008 | Ga0207694_100350083 | 438 |
| 355 | 3300026142 | Ga0207698_10033824 | Ga0207698_100338243 | 438 |
| 356 | 3300030521 | Ga0307511_10000948 | Ga0307511_100009482 | 438 |
| 357 | 3300031251 | Ga0265327_10021443 | Ga0265327_100214434 | 438 |
| 358 | 3300033179 | Ga0307507_10098971 | Ga0307507_100989712 | 438 |
| 359 | 3300039447 | Ga0436361_0053786 | Ga0436361_0053786_17639_19036 | 438 |
| 360 | 3300046538 | Ga0495609_0053131 | Ga0495609_0053131_306_1706 | 438 |
| 361 | 3300046660 | Ga0495625_0000657 | Ga0495625_0000657_34935_36332 | 438 |
| 362 | 3300047319 | Ga0495674_0239130 | Ga0495674_0239130_15_1376 | 438 |
| 363 | 3300048919 | Ga0496116_0003967 | Ga0496116_0003967_10977_12374 | 438 |
| 364 | 3300048919 | Ga0496116_0058030 | Ga0496116_0058030_424_1821 | 438 |
| 365 | 3300048921 | Ga0496118_0056535 | Ga0496118_0056535_861_2258 | 438 |
| 366 | 3300048925 | Ga0496122_0000693 | Ga0496122_0000693_36698_38095 | 438 |
| 367 | 3300048926 | Ga0496123_0000433 | Ga0496123_0000433_44942_46339 | 438 |
| 368 | 3300050492 | nmdc:mga0yw44_23299_c1 | nmdc:mga0yw44_23299_c1_1590_2975 | 438 |
| 369 | 3300050492 | nmdc:mga0yw44_95507_c1 | nmdc:mga0yw44_95507_c1_170_1555 | 438 |
| 370 | 3300053090 | Ga0500646_0001743 | Ga0500646_0001743_3867_5252 | 438 |
| 371 | 3300053092 | Ga0500583_0008143 | Ga0500583_0008143_511_1896 | 438 |
| 372 | 3300053130 | Ga0500642_0032814 | Ga0500642_0032814_350_1735 | 438 |
| 373 | 3300053151 | Ga0500604_0006398 | Ga0500604_0006398_1263_2648 | 438 |
| 374 | iso_pu_bacteria | 2548876994 | 2550693791 | 438 |
| 375 | iso_pu_bacteria | 2765235838 | 2765568569 | 438 |
| 376 | iso_pu_bacteria | 2808606386 | 2808981294 | 438 |
| 377 | iso_pu_bacteria | 2808606415 | 2809128880 | 438 |
| 378 | iso_pu_bacteria | 2808606419 | 2809148501 | 438 |
| 379 | iso_pu_bacteria | 2839094727 | 2839096551 | 438 |
| 380 | iso_pu_bacteria | 2852618963 | 2852621035 | 438 |
| 381 | iso_pu_bacteria | 2884811622 | 2884814940 | 438 |
| 382 | iso_pu_bacteria | 2884836552 | 2884836774 | 438 |
| 383 | iso_pu_bacteria | 2884852848 | 2884853065 | 438 |
| 384 | iso_pu_bacteria | 2896154374 | 2896155817 | 438 |
| 385 | iso_pu_bacteria | 2919046199 | 2919048137 | 438 |
| 386 | 3300005328 | Ga0070676_10034566 | Ga0070676_100345661 | 439 |
| 387 | 3300005354 | Ga0070675_100187170 | Ga0070675_1001871702 | 439 |
| 388 | 3300005367 | Ga0070667_100068653 | Ga0070667_1000686533 | 439 |
| 389 | 3300005543 | Ga0070672_100046964 | Ga0070672_1000469642 | 439 |
| 390 | 3300005618 | Ga0068864_100133971 | Ga0068864_1001339712 | 439 |
| 391 | 3300005840 | Ga0068870_10010077 | Ga0068870_100100771 | 439 |
| 392 | 3300005937 | Ga0081455_10005811 | Ga0081455_1000581112 | 439 |
| 393 | 3300006237 | Ga0097621_100186922 | Ga0097621_1001869222 | 439 |
| 394 | 3300006358 | Ga0068871_100164342 | Ga0068871_1001643422 | 439 |
| 395 | 3300006844 | Ga0075428_100000103 | Ga0075428_10000010313 | 439 |
| 396 | 3300006881 | Ga0068865_100021323 | Ga0068865_1000213234 | 439 |
| 397 | 3300009094 | Ga0111539_10005030 | Ga0111539_1000503013 | 439 |
| 398 | 3300013297 | Ga0157378_10065470 | Ga0157378_100654702 | 439 |
| 399 | 3300013308 | Ga0157375_10300125 | Ga0157375_103001252 | 439 |
| 400 | 3300014325 | Ga0163163_10157549 | Ga0163163_101575493 | 439 |
| 401 | 3300014968 | Ga0157379_10073604 | Ga0157379_100736042 | 439 |
| 402 | 3300025893 | Ga0207682_10008819 | Ga0207682_100088193 | 439 |
| 403 | 3300025908 | Ga0207643_10040888 | Ga0207643_100408883 | 439 |
| 404 | 3300025925 | Ga0207650_10002115 | Ga0207650_100021159 | 439 |
| 405 | 3300025940 | Ga0207691_10243719 | Ga0207691_102437191 | 439 |
| 406 | 3300025942 | Ga0207689_10019790 | Ga0207689_100197905 | 439 |
| 407 | 3300026035 | Ga0207703_10084827 | Ga0207703_100848272 | 439 |
| 408 | 3300026088 | Ga0207641_10008745 | Ga0207641_1000874510 | 439 |
| 409 | 3300026089 | Ga0207648_10074823 | Ga0207648_100748232 | 439 |
| 410 | 3300026095 | Ga0207676_10052284 | Ga0207676_100522841 | 439 |
| 411 | 3300026118 | Ga0207675_100029224 | Ga0207675_1000292244 | 439 |
| 412 | 3300026121 | Ga0207683_10185100 | Ga0207683_101851002 | 439 |
| 413 | 3300028577 | Ga0265318_10002586 | Ga0265318_100025865 | 439 |
| 414 | 3300031238 | Ga0265332_10007484 | Ga0265332_100074843 | 439 |
| 415 | 3300031239 | Ga0265328_10003748 | Ga0265328_100037487 | 439 |
| 416 | 3300031240 | Ga0265320_10038913 | Ga0265320_100389132 | 439 |
| 417 | 3300031242 | Ga0265329_10008995 | Ga0265329_100089953 | 439 |
| 418 | 3300031250 | Ga0265331_10000945 | Ga0265331_1000094510 | 439 |
| 419 | 3300031456 | Ga0307513_10091203 | Ga0307513_100912032 | 439 |
| 420 | 3300031711 | Ga0265314_10000220 | Ga0265314_1000022017 | 439 |
| 421 | 3300031712 | Ga0265342_10006047 | Ga0265342_100060474 | 439 |
| 422 | 3300050508 | nmdc:mga09592_11500_c1 | nmdc:mga09592_11500_c1_676_2043 | 439 |
| 423 | 3300050511 | nmdc:mga08y16_86448_c1 | nmdc:mga08y16_86448_c1_518_2098 | 439 |
| 424 | 3300050515 | nmdc:mga0a205_114960_c1 | nmdc:mga0a205_114960_c1_602_2128 | 439 |
| 425 | iso_pu_bacteria | 2617270735 | 2617352560 | 439 |
| 426 | iso_pu_bacteria | 2802429603 | 2805919998 | 439 |
| 427 | iso_pu_bacteria | 2824696289 | 2824698542 | 439 |
| 428 | iso_pu_bacteria | 2824773399 | 2824778197 | 439 |
| 429 | iso_pu_bacteria | 2841974524 | 2841982093 | 439 |
| 430 | iso_pu_bacteria | 2847939898 | 2847945043 | 439 |
| 431 | iso_pu_bacteria | 2849076700 | 2849080761 | 439 |
| 432 | iso_pu_bacteria | 2874628541 | 2874636120 | 439 |
| 433 | 3300005578 | Ga0068854_100006416 | Ga0068854_1000064163 | 440 |
| 434 | 3300009093 | Ga0105240_10062547 | Ga0105240_100625472 | 440 |
| 435 | 3300009551 | Ga0105238_10003628 | Ga0105238_1000362810 | 440 |
| 436 | 3300010375 | Ga0105239_10078857 | Ga0105239_100788573 | 440 |
| 437 | 3300015261 | Ga0182006_1001196 | Ga0182006_10011968 | 440 |
| 438 | 3300025913 | Ga0207695_10001540 | Ga0207695_1000154048 | 440 |
| 439 | 3300025914 | Ga0207671_10032015 | Ga0207671_100320155 | 440 |
| 440 | 3300025949 | Ga0207667_10111248 | Ga0207667_101112482 | 440 |
| 441 | 3300025981 | Ga0207640_10008114 | Ga0207640_100081142 | 440 |
| 442 | 3300026075 | Ga0207708_10038305 | Ga0207708_100383053 | 440 |
| 443 | 3300026116 | Ga0207674_10154307 | Ga0207674_101543072 | 440 |
| 444 | 3300035724 | Ga0373933_0113081 | Ga0373933_0113081_280_1647 | 440 |
| 445 | 3300039437 | Ga0436365_0729222 | Ga0436365_0729222_1547_2977 | 440 |
| 446 | 3300053125 | Ga0500618_001413 | Ga0500618_001413_3213_4751 | 440 |
| 447 | iso_pu_bacteria | 2507262055 | 2507510103 | 440 |
| 448 | iso_pu_bacteria | 2508501009 | 2508544105 | 440 |
| 449 | iso_pu_bacteria | 2508501042 | 2508697955 | 440 |
| 450 | iso_pu_bacteria | 2508501128 | 2509153533 | 440 |
| 451 | iso_pu_bacteria | 2511231028 | 2511400834 | 440 |
| 452 | iso_pu_bacteria | 2513237092 | 2513628335 | 440 |
| 453 | iso_pu_bacteria | 2513237095 | 2513648929 | 440 |
| 454 | iso_pu_bacteria | 2513237161 | 2514012665 | 440 |
| 455 | iso_pu_bacteria | 2517093001 | 2517105161 | 440 |
| 456 | iso_pu_bacteria | 2521172590 | 2521559258 | 440 |
| 457 | iso_pu_bacteria | 2617270741 | 2617379030 | 440 |
| 458 | iso_pu_bacteria | 2816332527 | 2818241667 | 440 |
| 459 | iso_pu_bacteria | 2818991449 | 2819615763 | 440 |
| 460 | iso_pu_bacteria | 2824671348 | 2824674262 | 440 |
| 461 | iso_pu_bacteria | 2824679649 | 2824682547 | 440 |
| 462 | iso_pu_bacteria | 2824687955 | 2824690884 | 440 |
| 463 | iso_pu_bacteria | 2824732956 | 2824737810 | 440 |
| 464 | iso_pu_bacteria | 2824746037 | 2824749968 | 440 |
| 465 | iso_pu_bacteria | 2838122688 | 2838127449 | 440 |
| 466 | iso_pu_bacteria | 2841949485 | 2841952386 | 440 |
| 467 | iso_pu_bacteria | 2841957949 | 2841959407 | 440 |
| 468 | iso_pu_bacteria | 2841966195 | 2841967743 | 440 |
| 469 | iso_pu_bacteria | 2841983080 | 2841986410 | 440 |
| 470 | iso_pu_bacteria | 2842038055 | 2842038178 | 440 |
| 471 | iso_pu_bacteria | 2842045827 | 2842048876 | 440 |
| 472 | iso_pu_bacteria | 2857509624 | 2857509874 | 440 |
| 473 | iso_pu_bacteria | 2874612657 | 2874618147 | 440 |
| 474 | iso_pu_bacteria | 2874620515 | 2874623140 | 440 |
| 475 | iso_pu_bacteria | 2881665667 | 2881670896 | 440 |
| 476 | iso_pu_bacteria | 2885366525 | 2885368857 | 440 |
| 477 | iso_pu_bacteria | 2888378607 | 2888382382 | 440 |
| 478 | iso_pu_bacteria | 2888388044 | 2888388310 | 440 |
| 479 | iso_pu_bacteria | 2904439833 | 2904443635 | 440 |
| 480 | iso_pu_bacteria | 2904530477 | 2904532552 | 440 |
| 481 | iso_pu_bacteria | 2904584206 | 2904585021 | 440 |
| 482 | iso_pu_bacteria | 2904589729 | 2904593370 | 440 |
| 483 | iso_pu_bacteria | 2904601388 | 2904605564 | 440 |
| 484 | iso_pu_bacteria | 2904666416 | 2904669960 | 440 |
| 485 | iso_pu_bacteria | 2908775508 | 2908778629 | 440 |
| 486 | iso_pu_bacteria | 2919079590 | 2919081337 | 440 |
| 487 | iso_pu_bacteria | 2922393267 | 2922394902 | 440 |
| 488 | iso_pu_bacteria | 2935608549 | 2935610991 | 440 |
| 489 | iso_pu_bacteria | 2935648319 | 2935648423 | 440 |
| 490 | iso_pu_bacteria | 2935656913 | 2935657589 | 440 |
| 491 | iso_pu_bacteria | 2935819856 | 2935820476 | 440 |
| 492 | iso_pu_bacteria | 2935847175 | 2935849515 | 440 |
| 493 | iso_pu_bacteria | 2935908558 | 2935911712 | 440 |
| 494 | iso_pu_bacteria | 2935916978 | 2935919367 | 440 |
| 495 | iso_pu_bacteria | 2935926038 | 2935928741 | 440 |
| 496 | iso_pu_bacteria | 2935934488 | 2935938386 | 440 |
| 497 | iso_pu_bacteria | 2935942939 | 2935945722 | 440 |
| 498 | iso_pu_bacteria | 2935951376 | 2935954671 | 440 |
| 499 | iso_pu_bacteria | 2935967501 | 2935970558 | 440 |
| 500 | iso_pu_bacteria | 2935984226 | 2935987782 | 440 |
| 501 | iso_pu_bacteria | 2936011229 | 2936011333 | 440 |
| 502 | iso_pu_bacteria | 2936019824 | 2936019928 | 440 |
| 503 | iso_pu_bacteria | 2936028420 | 2936028524 | 440 |
| 504 | iso_pu_bacteria | 2936046547 | 2936046651 | 440 |
| 505 | iso_pu_bacteria | 2936055302 | 2936062344 | 440 |
| 506 | iso_pu_bacteria | 3005483717 | 3005487860 | 440 |
| 507 | iso_pu_bacteria | 3005587118 | 3005589359 | 440 |
| 508 | iso_pu_bacteria | 3005594810 | 3005597395 | 440 |
| 509 | iso_pu_bacteria | 3005710791 | 3005713420 | 440 |
| 510 | iso_pu_bacteria | 8016630954 | 8016632662 | 440 |
| 511 | iso_pu_bacteria | 8019687851 | 8019688358 | 440 |
| 512 | 3300003215 | JGI25153J46596_10002222 | JGI25153J46596_100022226 | 441 |
| 513 | 3300005436 | Ga0070713_100254603 | Ga0070713_1002546031 | 441 |
| 514 | 3300005546 | Ga0070696_100054561 | Ga0070696_1000545612 | 441 |
| 515 | 3300006028 | Ga0070717_10023179 | Ga0070717_100231794 | 441 |
| 516 | 3300006847 | Ga0075431_100208278 | Ga0075431_1002082782 | 441 |
| 517 | 3300009553 | Ga0105249_10018756 | Ga0105249_100187561 | 441 |
| 518 | 3300025233 | Ga0209437_100229 | Ga0209437_1002297 | 441 |
| 519 | 3300025297 | Ga0209758_1000294 | Ga0209758_100029482 | 441 |
| 520 | 3300025299 | Ga0209256_1000545 | Ga0209256_100054528 | 441 |
| 521 | 3300025929 | Ga0207664_10060688 | Ga0207664_100606882 | 441 |
| 522 | 3300025939 | Ga0207665_10002822 | Ga0207665_1000282211 | 441 |
| 523 | 3300048904 | Ga0496101_0005103 | Ga0496101_0005103_6693_8069 | 441 |
| 524 | 3300048905 | Ga0496102_0002260 | Ga0496102_0002260_5204_6580 | 441 |
| 525 | 3300048907 | Ga0496104_0054467 | Ga0496104_0054467_1897_3339 | 441 |
| 526 | 3300048908 | Ga0496105_0025947 | Ga0496105_0025947_2089_3465 | 441 |
| 527 | 3300048909 | Ga0496106_0000262 | Ga0496106_0000262_15101_16477 | 441 |
| 528 | 3300048910 | Ga0496107_0088582 | Ga0496107_0088582_14_1390 | 441 |
| 529 | 3300048911 | Ga0496108_0018407 | Ga0496108_0018407_2912_4288 | 441 |
| 530 | 3300048911 | Ga0496108_0029729 | Ga0496108_0029729_706_2148 | 441 |
| 531 | 3300048912 | Ga0496109_0002394 | Ga0496109_0002394_11147_12523 | 441 |
| 532 | 3300048912 | Ga0496109_0048639 | Ga0496109_0048639_995_2437 | 441 |
| 533 | 3300048913 | Ga0496110_0000205 | Ga0496110_0000205_22606_23982 | 441 |
| 534 | 3300048913 | Ga0496110_0003980 | Ga0496110_0003980_6899_8341 | 441 |
| 535 | 3300048914 | Ga0496111_0040066 | Ga0496111_0040066_288_1730 | 441 |
| 536 | 3300048915 | Ga0496112_0014600 | Ga0496112_0014600_5188_6630 | 441 |
| 537 | 3300048917 | Ga0496114_0127142 | Ga0496114_0127142_319_1695 | 441 |
| 538 | 3300048918 | Ga0496115_0042767 | Ga0496115_0042767_56_1432 | 441 |
| 539 | 3300049572 | Ga0501036_0138972 | Ga0501036_0138972_129_1502 | 441 |
| 540 | 3300049574 | Ga0501038_0075199 | Ga0501038_0075199_1073_2446 | 441 |
| 541 | iso_pu_bacteria | 2513237098 | 2513676462 | 441 |
| 542 | iso_pu_bacteria | 2513237101 | 2513697014 | 441 |
| 543 | iso_pu_bacteria | 2513237141 | 2513892003 | 441 |
| 544 | iso_pu_bacteria | 2721755755 | 2723846458 | 441 |
| 545 | iso_pu_bacteria | 2721755755 | 2723846462 | 441 |
| 546 | iso_pu_bacteria | 2791355196 | 2793059915 | 441 |
| 547 | iso_pu_bacteria | 2791355199 | 2793076881 | 441 |
| 548 | iso_pu_bacteria | 2824617872 | 2824622788 | 441 |
| 549 | iso_pu_bacteria | 2824626560 | 2824632379 | 441 |
| 550 | iso_pu_bacteria | 2824635225 | 2824640398 | 441 |
| 551 | iso_pu_bacteria | 2824644064 | 2824647387 | 441 |
| 552 | iso_pu_bacteria | 2824714736 | 2824718918 | 441 |
| 553 | iso_pu_bacteria | 2824723954 | 2824729422 | 441 |
| 554 | iso_pu_bacteria | 2847930680 | 2847934448 | 441 |
| 555 | iso_pu_bacteria | 2857524615 | 2857528893 | 441 |
| 556 | iso_pu_bacteria | 2874604998 | 2874610576 | 441 |
| 557 | iso_pu_bacteria | 2879083081 | 2879089641 | 441 |
| 558 | iso_pu_bacteria | 2881364244 | 2881367672 | 441 |
| 559 | iso_pu_bacteria | 2885383462 | 2885390201 | 441 |
| 560 | iso_pu_bacteria | 2889033259 | 2889039027 | 441 |
| 561 | iso_pu_bacteria | 2893066018 | 2893069090 | 441 |
| 562 | iso_pu_bacteria | 2903748898 | 2903751924 | 441 |
| 563 | iso_pu_bacteria | 2903768456 | 2903771705 | 441 |
| 564 | iso_pu_bacteria | 2904690495 | 2904693431 | 441 |
| 565 | iso_pu_bacteria | 2906626472 | 2906634818 | 441 |
| 566 | iso_pu_bacteria | 2906643746 | 2906646681 | 441 |
| 567 | iso_pu_bacteria | 2908756301 | 2908761756 | 441 |
| 568 | iso_pu_bacteria | 2919073203 | 2919079317 | 441 |
| 569 | iso_pu_bacteria | 2922361189 | 2922362271 | 441 |
| 570 | iso_pu_bacteria | 2922386360 | 2922387976 | 441 |
| 571 | iso_pu_bacteria | 2932794094 | 2932797247 | 441 |
| 572 | iso_pu_bacteria | 2932801729 | 2932804868 | 441 |
| 573 | iso_pu_bacteria | 2935883170 | 2935884896 | 441 |
| 574 | iso_pu_bacteria | 2935959822 | 2935963271 | 441 |
| 575 | iso_pu_bacteria | 3005506211 | 3005508823 | 441 |
| 576 | iso_pu_bacteria | 8006926726 | 8006928509 | 441 |
| 577 | iso_pu_bacteria | 8006964411 | 8006964845 | 441 |
| 578 | iso_pu_bacteria | 8006984368 | 8006991759 | 441 |
| 579 | iso_pu_bacteria | 8006994254 | 8006995580 | 441 |
| 580 | iso_pu_bacteria | 8056673599 | 8056676372 | 441 |
| 581 | iso_pu_bacteria | 8056681323 | 8056685046 | 441 |
| 582 | 3300005436 | Ga0070713_100094960 | Ga0070713_1000949602 | 442 |
| 583 | 3300005468 | Ga0070707_100313543 | Ga0070707_1003135431 | 442 |
| 584 | 3300005983 | Ga0081540_1024563 | Ga0081540_10245632 | 442 |
| 585 | 3300007076 | Ga0075435_100029304 | Ga0075435_1000293041 | 442 |
| 586 | 3300007788 | Ga0099795_10002853 | Ga0099795_100028532 | 442 |
| 587 | 3300021361 | Ga0213872_10016312 | Ga0213872_100163121 | 442 |
| 588 | 3300025929 | Ga0207664_10068985 | Ga0207664_100689852 | 442 |
| 589 | 3300025939 | Ga0207665_10049190 | Ga0207665_100491901 | 442 |
| 590 | 3300039447 | Ga0436361_0671651 | Ga0436361_0671651_3605_5026 | 442 |
| 591 | 3300048913 | Ga0496110_0003778 | Ga0496110_0003778_751_2397 | 442 |
| 592 | 3300050515 | nmdc:mga0a205_63974_c1 | nmdc:mga0a205_63974_c1_355_2001 | 442 |
| 593 | 3300053153 | Ga0500616_0047643 | Ga0500616_0047643_606_1994 | 442 |
| 594 | iso_pu_bacteria | 2511231003 | 2511252132 | 442 |
| 595 | iso_pu_bacteria | 2524023210 | 2524467068 | 442 |
| 596 | iso_pu_bacteria | 2818991445 | 2819595072 | 442 |
| 597 | iso_pu_bacteria | 2876808645 | 2876810065 | 442 |
| 598 | iso_pu_bacteria | 2879110137 | 2879118634 | 442 |
| 599 | iso_pu_bacteria | 2904699407 | 2904700664 | 442 |
| 600 | iso_pu_bacteria | 2906610324 | 2906610807 | 442 |
| 601 | iso_pu_bacteria | 2906635258 | 2906635967 | 442 |
| 602 | iso_pu_bacteria | 2906660503 | 2906663934 | 442 |
| 603 | iso_pu_bacteria | 2922425934 | 2922428520 | 442 |
| 604 | iso_pu_bacteria | 2935630451 | 2935634500 | 442 |
| 605 | iso_pu_bacteria | 2941507105 | 2941508986 | 442 |
| 606 | iso_pu_bacteria | 2941515067 | 2941516815 | 442 |
| 607 | iso_pu_bacteria | 2941523033 | 2941525090 | 442 |
| 608 | 3300005330 | Ga0070690_100084812 | Ga0070690_1000848122 | 443 |
| 609 | 3300005331 | Ga0070670_100002578 | Ga0070670_10000257813 | 443 |
| 610 | 3300006844 | Ga0075428_100138048 | Ga0075428_1001380482 | 443 |
| 611 | 3300006871 | Ga0075434_100202054 | Ga0075434_1002020543 | 443 |
| 612 | 3300006880 | Ga0075429_100075942 | Ga0075429_1000759422 | 443 |
| 613 | 3300009098 | Ga0105245_10015633 | Ga0105245_100156335 | 443 |
| 614 | 3300009147 | Ga0114129_10202623 | Ga0114129_102026232 | 443 |
| 615 | 3300021361 | Ga0213872_10048178 | Ga0213872_100481781 | 443 |
| 616 | 3300025925 | Ga0207650_10001829 | Ga0207650_1000182913 | 443 |
| 617 | 3300025927 | Ga0207687_10013222 | Ga0207687_100132225 | 443 |
| 618 | 3300025940 | Ga0207691_10198351 | Ga0207691_101983512 | 443 |
| 619 | 3300026035 | Ga0207703_10097711 | Ga0207703_100977112 | 443 |
| 620 | 3300031249 | Ga0265339_10021009 | Ga0265339_100210094 | 443 |
| 621 | 3300031712 | Ga0265342_10011954 | Ga0265342_100119542 | 443 |
| 622 | 3300035113 | Ga0373936_0002231 | Ga0373936_0002231_1670_3049 | 443 |
| 623 | 3300035116 | Ga0373945_0013753 | Ga0373945_0013753_296_1720 | 443 |
| 624 | 3300035117 | Ga0373953_0002952 | Ga0373953_0002952_3619_4998 | 443 |
| 625 | 3300035118 | Ga0373954_0007519 | Ga0373954_0007519_3328_4707 | 443 |
| 626 | 3300035170 | Ga0373943_0004323 | Ga0373943_0004323_1221_2600 | 443 |
| 627 | 3300035172 | Ga0373955_0000643 | Ga0373955_0000643_6069_7448 | 443 |
| 628 | 3300035692 | Ga0373935_0000075 | Ga0373935_0000075_18003_19382 | 443 |
| 629 | 3300035724 | Ga0373933_0015393 | Ga0373933_0015393_2761_4140 | 443 |
| 630 | 3300035725 | Ga0373947_0000138 | Ga0373947_0000138_28725_30104 | 443 |
| 631 | 3300036401 | Ga0373937_0000057 | Ga0373937_0000057_87694_89073 | 443 |
| 632 | 3300037068 | Ga0373925_0000078 | Ga0373925_0000078_30279_31658 | 443 |
| 633 | 3300039437 | Ga0436365_1709207 | Ga0436365_1709207_285_1664 | 443 |
| 634 | 3300039447 | Ga0436361_0356069 | Ga0436361_0356069_156_1532 | 443 |
| 635 | 3300044658 | Ga0466972_0000371 | Ga0466972_0000371_8316_9692 | 443 |
| 636 | 3300044684 | Ga0466966_0001015 | Ga0466966_0001015_85_1461 | 443 |
| 637 | 3300044693 | Ga0466961_0003875 | Ga0466961_0003875_5200_6576 | 443 |
| 638 | 3300045049 | Ga0466959_0008411 | Ga0466959_0008411_2491_3867 | 443 |
| 639 | 3300046454 | Ga0495592_0000233 | Ga0495592_0000233_17229_18608 | 443 |
| 640 | 3300046455 | Ga0495603_0041698 | Ga0495603_0041698_880_2304 | 443 |
| 641 | 3300046459 | Ga0495629_0003366 | Ga0495629_0003366_5945_7324 | 443 |
| 642 | 3300046462 | Ga0495651_0002019 | Ga0495651_0002019_5960_7339 | 443 |
| 643 | 3300046463 | Ga0495653_0000464 | Ga0495653_0000464_29919_31298 | 443 |
| 644 | 3300046476 | Ga0495662_0001193 | Ga0495662_0001193_1512_2891 | 443 |
| 645 | 3300046476 | Ga0495662_0037215 | Ga0495662_0037215_15_1412 | 443 |
| 646 | 3300046477 | Ga0495664_0000023 | Ga0495664_0000023_29135_30514 | 443 |
| 647 | 3300046511 | Ga0495608_0000030 | Ga0495608_0000030_28856_30235 | 443 |
| 648 | 3300046514 | Ga0495618_0000585 | Ga0495618_0000585_168_1547 | 443 |
| 649 | 3300046516 | Ga0495628_0000027 | Ga0495628_0000027_96271_97650 | 443 |
| 650 | 3300046517 | Ga0495630_0006673 | Ga0495630_0006673_71_1450 | 443 |
| 651 | 3300046529 | Ga0495652_0000041 | Ga0495652_0000041_28847_30226 | 443 |
| 652 | 3300046533 | Ga0495640_0000056 | Ga0495640_0000056_31702_33081 | 443 |
| 653 | 3300046536 | Ga0495587_0000025 | Ga0495587_0000025_115871_117250 | 443 |
| 654 | 3300046543 | Ga0495645_0000001 | Ga0495645_0000001_627710_629089 | 443 |
| 655 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_736635_738014 | 443 |
| 656 | 3300046615 | Ga0495656_0059799 | Ga0495656_0059799_122_1546 | 443 |
| 657 | 3300046642 | Ga0495634_0001485 | Ga0495634_0001485_18145_19524 | 443 |
| 658 | 3300046663 | Ga0495635_0000077 | Ga0495635_0000077_30046_31425 | 443 |
| 659 | 3300046674 | Ga0495588_0104312 | Ga0495588_0104312_18_1415 | 443 |
| 660 | 3300046675 | Ga0495657_0000390 | Ga0495657_0000390_24842_26221 | 443 |
| 661 | 3300046678 | Ga0495599_0000021 | Ga0495599_0000021_96818_98197 | 443 |
| 662 | 3300046679 | Ga0495623_0000141 | Ga0495623_0000141_12610_13989 | 443 |
| 663 | 3300046680 | Ga0495646_0000051 | Ga0495646_0000051_27879_29258 | 443 |
| 664 | 3300046690 | Ga0495624_0005832 | Ga0495624_0005832_5695_7119 | 443 |
| 665 | 3300046809 | Ga0495600_0000114 | Ga0495600_0000114_14504_15883 | 443 |
| 666 | 3300047317 | Ga0495604_0000036 | Ga0495604_0000036_96289_97668 | 443 |
| 667 | 3300047319 | Ga0495674_0000102 | Ga0495674_0000102_31228_32607 | 443 |
| 668 | 3300047321 | Ga0495676_0037239 | Ga0495676_0037239_1237_2634 | 443 |
| 669 | 3300047322 | Ga0495680_0001061 | Ga0495680_0001061_28932_30311 | 443 |
| 670 | 3300047444 | Ga0495675_0000148 | Ga0495675_0000148_20181_21560 | 443 |
| 671 | 3300047471 | Ga0495684_0000025 | Ga0495684_0000025_29365_30744 | 443 |
| 672 | 3300047673 | Ga0495593_0000682 | Ga0495593_0000682_17985_19364 | 443 |
| 673 | 3300048088 | Ga0495602_0000311 | Ga0495602_0000311_14749_16128 | 443 |
| 674 | 3300048906 | Ga0496103_0021711 | Ga0496103_0021711_2002_3426 | 443 |
| 675 | 3300048907 | Ga0496104_0002505 | Ga0496104_0002505_5885_7309 | 443 |
| 676 | 3300048910 | Ga0496107_0063265 | Ga0496107_0063265_1062_2486 | 443 |
| 677 | 3300048911 | Ga0496108_0000357 | Ga0496108_0000357_8639_10063 | 443 |
| 678 | 3300048912 | Ga0496109_0002224 | Ga0496109_0002224_12866_14290 | 443 |
| 679 | 3300048913 | Ga0496110_0052971 | Ga0496110_0052971_680_2104 | 443 |
| 680 | 3300048914 | Ga0496111_0000632 | Ga0496111_0000632_14205_15629 | 443 |
| 681 | 3300048915 | Ga0496112_0006469 | Ga0496112_0006469_4446_5870 | 443 |
| 682 | 3300050507 | nmdc:mga05p37_225993_c1 | nmdc:mga05p37_225993_c1_136_1560 | 443 |
| 683 | 3300050512 | nmdc:mga0n895_61632_c1 | nmdc:mga0n895_61632_c1_283_1707 | 443 |
| 684 | 3300053077 | Ga0495601_0000025 | Ga0495601_0000025_96272_97651 | 443 |
| 685 | 3300053078 | Ga0495612_0000046 | Ga0495612_0000046_28953_30332 | 443 |
| 686 | 3300053084 | Ga0495595_0000054 | Ga0495595_0000054_29010_30389 | 443 |
| 687 | 3300053085 | Ga0495619_0000035 | Ga0495619_0000035_96294_97673 | 443 |
| 688 | 3300053737 | Ga0500601_000643 | Ga0500601_000643_3299_4675 | 443 |
| 689 | 3300003215 | JGI25153J46596_10002589 | JGI25153J46596_100025896 | 444 |
| 690 | 3300003215 | JGI25153J46596_10003283 | JGI25153J46596_100032832 | 444 |
| 691 | 3300003215 | JGI25153J46596_10006877 | JGI25153J46596_100068776 | 444 |
| 692 | 3300003354 | JGI25160J50197_1006259 | JGI25160J50197_10062592 | 444 |
| 693 | 3300003354 | JGI25160J50197_1006800 | JGI25160J50197_10068002 | 444 |
| 694 | 3300003794 | Ga0055531_10003706 | Ga0055531_100037062 | 444 |
| 695 | 3300004625 | Ga0055543_1002979 | Ga0055543_10029795 | 444 |
| 696 | 3300005262 | Ga0065165_1001284 | Ga0065165_100128414 | 444 |
| 697 | 3300005262 | Ga0065165_1022456 | Ga0065165_10224561 | 444 |
| 698 | 3300005340 | Ga0070689_100003410 | Ga0070689_1000034107 | 444 |
| 699 | 3300005353 | Ga0070669_100112005 | Ga0070669_1001120051 | 444 |
| 700 | 3300005355 | Ga0070671_100109138 | Ga0070671_1001091382 | 444 |
| 701 | 3300005434 | Ga0070709_10003602 | Ga0070709_100036022 | 444 |
| 702 | 3300005436 | Ga0070713_100003091 | Ga0070713_1000030919 | 444 |
| 703 | 3300005437 | Ga0070710_10001132 | Ga0070710_1000113212 | 444 |
| 704 | 3300005455 | Ga0070663_100072320 | Ga0070663_1000723201 | 444 |
| 705 | 3300005547 | Ga0070693_100128699 | Ga0070693_1001286991 | 444 |
| 706 | 3300005614 | Ga0068856_100220812 | Ga0068856_1002208121 | 444 |
| 707 | 3300005617 | Ga0068859_100058039 | Ga0068859_1000580392 | 444 |
| 708 | 3300005842 | Ga0068858_100108934 | Ga0068858_1001089342 | 444 |
| 709 | 3300005842 | Ga0068858_100122130 | Ga0068858_1001221302 | 444 |
| 710 | 3300005844 | Ga0068862_100133755 | Ga0068862_1001337552 | 444 |
| 711 | 3300006038 | Ga0075365_10098867 | Ga0075365_100988672 | 444 |
| 712 | 3300006042 | Ga0075368_10002361 | Ga0075368_100023618 | 444 |
| 713 | 3300006051 | Ga0075364_10044728 | Ga0075364_100447282 | 444 |
| 714 | 3300006163 | Ga0070715_10015703 | Ga0070715_100157032 | 444 |
| 715 | 3300006173 | Ga0070716_100044394 | Ga0070716_1000443942 | 444 |
| 716 | 3300006195 | Ga0075366_10045627 | Ga0075366_100456272 | 444 |
| 717 | 3300006195 | Ga0075366_10063442 | Ga0075366_100634422 | 444 |
| 718 | 3300006881 | Ga0068865_100078669 | Ga0068865_1000786692 | 444 |
| 719 | 3300006931 | Ga0097620_100058038 | Ga0097620_1000580382 | 444 |
| 720 | 3300006942 | Ga0099824_1022507 | Ga0099824_10225071 | 444 |
| 721 | 3300009545 | Ga0105237_10190843 | Ga0105237_101908432 | 444 |
| 722 | 3300021320 | Ga0214544_1000020 | Ga0214544_100002084 | 444 |
| 723 | 3300021321 | Ga0214542_1000024 | Ga0214542_100002495 | 444 |
| 724 | 3300021324 | Ga0214545_1000011 | Ga0214545_100001195 | 444 |
| 725 | 3300021324 | Ga0214545_1029344 | Ga0214545_10293442 | 444 |
| 726 | 3300021327 | Ga0214543_1000033 | Ga0214543_1000033109 | 444 |
| 727 | 3300021384 | Ga0213876_10001998 | Ga0213876_100019988 | 444 |
| 728 | 3300025230 | Ga0209563_101304 | Ga0209563_1013046 | 444 |
| 729 | 3300025245 | Ga0207425_1009865 | Ga0207425_10098651 | 444 |
| 730 | 3300025253 | Ga0209677_102281 | Ga0209677_1022814 | 444 |
| 731 | 3300025253 | Ga0209677_102285 | Ga0209677_1022852 | 444 |
| 732 | 3300025261 | Ga0209233_1001066 | Ga0209233_10010663 | 444 |
| 733 | 3300025261 | Ga0209233_1005718 | Ga0209233_10057183 | 444 |
| 734 | 3300025295 | Ga0209564_1014473 | Ga0209564_10144732 | 444 |
| 735 | 3300025297 | Ga0209758_1000407 | Ga0209758_100040761 | 444 |
| 736 | 3300025297 | Ga0209758_1000952 | Ga0209758_100095237 | 444 |
| 737 | 3300025297 | Ga0209758_1001983 | Ga0209758_10019832 | 444 |
| 738 | 3300025297 | Ga0209758_1008305 | Ga0209758_10083052 | 444 |
| 739 | 3300025297 | Ga0209758_1032704 | Ga0209758_10327041 | 444 |
| 740 | 3300025299 | Ga0209256_1006969 | Ga0209256_10069696 | 444 |
| 741 | 3300025302 | Ga0207426_1001388 | Ga0207426_10013888 | 444 |
| 742 | 3300025302 | Ga0207426_1031258 | Ga0207426_10312582 | 444 |
| 743 | 3300025304 | Ga0209257_1001136 | Ga0209257_100113627 | 444 |
| 744 | 3300025315 | Ga0207697_10031871 | Ga0207697_100318712 | 444 |
| 745 | 3300025899 | Ga0207642_10089442 | Ga0207642_100894421 | 444 |
| 746 | 3300025904 | Ga0207647_10035209 | Ga0207647_100352092 | 444 |
| 747 | 3300025906 | Ga0207699_10001319 | Ga0207699_1000131912 | 444 |
| 748 | 3300025914 | Ga0207671_10175033 | Ga0207671_101750331 | 444 |
| 749 | 3300025915 | Ga0207693_10001566 | Ga0207693_100015662 | 444 |
| 750 | 3300025916 | Ga0207663_10006786 | Ga0207663_100067865 | 444 |
| 751 | 3300025928 | Ga0207700_10006688 | Ga0207700_100066886 | 444 |
| 752 | 3300025931 | Ga0207644_10104521 | Ga0207644_101045212 | 444 |
| 753 | 3300025936 | Ga0207670_10002928 | Ga0207670_100029287 | 444 |
| 754 | 3300025938 | Ga0207704_10006693 | Ga0207704_100066932 | 444 |
| 755 | 3300027296 | Ga0209389_1000424 | Ga0209389_10004249 | 444 |
| 756 | 3300027357 | Ga0209589_1004180 | Ga0209589_10041809 | 444 |
| 757 | 3300027361 | Ga0209489_104563 | Ga0209489_10456310 | 444 |
| 758 | 3300028380 | Ga0268265_10157663 | Ga0268265_101576631 | 444 |
| 759 | 3300031824 | Ga0307413_10072121 | Ga0307413_100721212 | 444 |
| 760 | 3300031911 | Ga0307412_10131089 | Ga0307412_101310891 | 444 |
| 761 | 3300032005 | Ga0307411_10053158 | Ga0307411_100531582 | 444 |
| 762 | 3300033180 | Ga0307510_10072820 | Ga0307510_100728202 | 444 |
| 763 | 3300035084 | Ga0373928_0014812 | Ga0373928_0014812_152_1531 | 444 |
| 764 | 3300039437 | Ga0436365_0240210 | Ga0436365_0240210_13402_14781 | 444 |
| 765 | 3300039438 | Ga0436360_0811388 | Ga0436360_0811388_115_1494 | 444 |
| 766 | 3300039438 | Ga0436360_0930029 | Ga0436360_0930029_691_2070 | 444 |
| 767 | 3300039453 | Ga0436362_0837923 | Ga0436362_0837923_67_1446 | 444 |
| 768 | 3300046616 | Ga0495668_0037116 | Ga0495668_0037116_269_1648 | 444 |
| 769 | 3300046648 | Ga0495611_0031594 | Ga0495611_0031594_492_1871 | 444 |
| 770 | 3300047443 | Ga0495687_004001 | Ga0495687_004001_8310_9689 | 444 |
| 771 | 3300048088 | Ga0495602_0165611 | Ga0495602_0165611_278_1657 | 444 |
| 772 | 3300048905 | Ga0496102_0097665 | Ga0496102_0097665_442_1821 | 444 |
| 773 | 3300048906 | Ga0496103_0027506 | Ga0496103_0027506_15_1394 | 444 |
| 774 | 3300048908 | Ga0496105_0128423 | Ga0496105_0128423_452_1831 | 444 |
| 775 | 3300048911 | Ga0496108_0098085 | Ga0496108_0098085_949_2328 | 444 |
| 776 | 3300048912 | Ga0496109_0060680 | Ga0496109_0060680_437_1816 | 444 |
| 777 | 3300048918 | Ga0496115_0146166 | Ga0496115_0146166_305_1693 | 444 |
| 778 | 3300048922 | Ga0496119_0033910 | Ga0496119_0033910_1474_2853 | 444 |
| 779 | 3300048923 | Ga0496120_0104179 | Ga0496120_0104179_89_1468 | 444 |
| 780 | 3300048929 | Ga0496126_0018230 | Ga0496126_0018230_1701_3086 | 444 |
| 781 | 3300048929 | Ga0496126_0172212 | Ga0496126_0172212_356_1744 | 444 |
| 782 | 3300050490 | nmdc:mga03n38_39900_c1 | nmdc:mga03n38_39900_c1_463_1842 | 444 |
| 783 | 3300050492 | nmdc:mga0yw44_5661_c1 | nmdc:mga0yw44_5661_c1_4109_5488 | 444 |
| 784 | 3300050492 | nmdc:mga0yw44_59421_c1 | nmdc:mga0yw44_59421_c1_501_1880 | 444 |
| 785 | 3300050494 | nmdc:mga06z11_68184_c1 | nmdc:mga06z11_68184_c1_166_1545 | 444 |
| 786 | 3300050496 | nmdc:mga07m45_9639_c1 | nmdc:mga07m45_9639_c1_2051_3430 | 444 |
| 787 | 3300050507 | nmdc:mga05p37_13202_c1 | nmdc:mga05p37_13202_c1_3754_5151 | 444 |
| 788 | 3300053077 | Ga0495601_0014260 | Ga0495601_0014260_2583_3962 | 444 |
| 789 | 3300053085 | Ga0495619_0004720 | Ga0495619_0004720_4724_6103 | 444 |
| 790 | 3300053087 | Ga0500643_000019 | Ga0500643_000019_165527_166906 | 444 |
| 791 | 3300053103 | Ga0500555_004780 | Ga0500555_004780_2071_3450 | 444 |
| 792 | 3300053109 | Ga0500569_007080 | Ga0500569_007080_906_2285 | 444 |
| 793 | 3300053111 | Ga0500572_001849 | Ga0500572_001849_1162_2616 | 444 |
| 794 | 3300053116 | Ga0500592_006852 | Ga0500592_006852_41_1420 | 444 |
| 795 | 3300053119 | Ga0500595_023204 | Ga0500595_023204_59_1438 | 444 |
| 796 | 3300053130 | Ga0500642_0028020 | Ga0500642_0028020_309_1688 | 444 |
| 797 | 3300053136 | Ga0500559_0020926 | Ga0500559_0020926_225_1679 | 444 |
| 798 | 3300053139 | Ga0500568_0004264 | Ga0500568_0004264_2494_3873 | 444 |
| 799 | 3300053177 | Ga0500636_0000313 | Ga0500636_0000313_5690_7069 | 444 |
| 800 | 3300053177 | Ga0500636_0030709 | Ga0500636_0030709_731_2113 | 444 |
| 801 | 3300053735 | Ga0500596_004849 | Ga0500596_004849_963_2345 | 444 |
| 802 | 3300053736 | Ga0500599_002587 | Ga0500599_002587_81_1460 | 444 |
| 803 | iso_pu_bacteria | 2524023228 | 2524540686 | 444 |
| 804 | iso_pu_bacteria | 8006933436 | 8006942716 | 444 |
| 805 | iso_pu_bacteria | 8006973647 | 8006982439 | 444 |
| 806 | 3300002244 | JGI24742J22300_10003139 | JGI24742J22300_100031392 | 445 |
| 807 | 3300005293 | Ga0065715_10164299 | Ga0065715_101642991 | 445 |
| 808 | 3300005295 | Ga0065707_10021875 | Ga0065707_100218751 | 445 |
| 809 | 3300005329 | Ga0070683_100178315 | Ga0070683_1001783151 | 445 |
| 810 | 3300005347 | Ga0070668_100171527 | Ga0070668_1001715272 | 445 |
| 811 | 3300005435 | Ga0070714_100033661 | Ga0070714_1000336612 | 445 |
| 812 | 3300005436 | Ga0070713_100131037 | Ga0070713_1001310371 | 445 |
| 813 | 3300005437 | Ga0070710_10031412 | Ga0070710_100314122 | 445 |
| 814 | 3300005439 | Ga0070711_100037088 | Ga0070711_1000370881 | 445 |
| 815 | 3300005843 | Ga0068860_100075903 | Ga0068860_1000759033 | 445 |
| 816 | 3300005983 | Ga0081540_1006666 | Ga0081540_10066666 | 445 |
| 817 | 3300005983 | Ga0081540_1012946 | Ga0081540_10129465 | 445 |
| 818 | 3300005983 | Ga0081540_1026854 | Ga0081540_10268542 | 445 |
| 819 | 3300006163 | Ga0070715_10006169 | Ga0070715_100061692 | 445 |
| 820 | 3300006173 | Ga0070716_100020203 | Ga0070716_1000202032 | 445 |
| 821 | 3300006175 | Ga0070712_100001878 | Ga0070712_10000187813 | 445 |
| 822 | 3300006175 | Ga0070712_100055421 | Ga0070712_1000554212 | 445 |
| 823 | 3300006195 | Ga0075366_10024479 | Ga0075366_100244792 | 445 |
| 824 | 3300006871 | Ga0075434_100021009 | Ga0075434_1000210092 | 445 |
| 825 | 3300009094 | Ga0111539_10066357 | Ga0111539_100663572 | 445 |
| 826 | 3300009147 | Ga0114129_10022094 | Ga0114129_1002209410 | 445 |
| 827 | 3300009147 | Ga0114129_10172096 | Ga0114129_101720962 | 445 |
| 828 | 3300009148 | Ga0105243_10094100 | Ga0105243_100941001 | 445 |
| 829 | 3300010375 | Ga0105239_10044826 | Ga0105239_100448262 | 445 |
| 830 | 3300011119 | Ga0105246_10154825 | Ga0105246_101548251 | 445 |
| 831 | 3300013308 | Ga0157375_10173210 | Ga0157375_101732102 | 445 |
| 832 | 3300014745 | Ga0157377_10088694 | Ga0157377_100886941 | 445 |
| 833 | 3300025898 | Ga0207692_10008475 | Ga0207692_100084752 | 445 |
| 834 | 3300025900 | Ga0207710_10018417 | Ga0207710_100184172 | 445 |
| 835 | 3300025906 | Ga0207699_10049238 | Ga0207699_100492382 | 445 |
| 836 | 3300025908 | Ga0207643_10000418 | Ga0207643_1000041822 | 445 |
| 837 | 3300025908 | Ga0207643_10064491 | Ga0207643_100644912 | 445 |
| 838 | 3300025915 | Ga0207693_10011746 | Ga0207693_100117467 | 445 |
| 839 | 3300025915 | Ga0207693_10013334 | Ga0207693_100133343 | 445 |
| 840 | 3300025919 | Ga0207657_10012700 | Ga0207657_100127003 | 445 |
| 841 | 3300025926 | Ga0207659_10116180 | Ga0207659_101161802 | 445 |
| 842 | 3300025929 | Ga0207664_10079804 | Ga0207664_100798041 | 445 |
| 843 | 3300025939 | Ga0207665_10001510 | Ga0207665_100015108 | 445 |
| 844 | 3300025942 | Ga0207689_10039992 | Ga0207689_100399923 | 445 |
| 845 | 3300026023 | Ga0207677_10219604 | Ga0207677_102196041 | 445 |
| 846 | 3300026067 | Ga0207678_10030296 | Ga0207678_100302963 | 445 |
| 847 | 3300026116 | Ga0207674_10258133 | Ga0207674_102581331 | 445 |
| 848 | 3300026121 | Ga0207683_10014258 | Ga0207683_100142583 | 445 |
| 849 | 3300027296 | Ga0209389_1000011 | Ga0209389_1000011120 | 445 |
| 850 | 3300027361 | Ga0209489_100017 | Ga0209489_100017114 | 445 |
| 851 | 3300027363 | Ga0209700_100027 | Ga0209700_100027120 | 445 |
| 852 | 3300027907 | Ga0207428_10033735 | Ga0207428_100337352 | 445 |
| 853 | 3300027907 | Ga0207428_10157801 | Ga0207428_101578011 | 445 |
| 854 | 3300028556 | Ga0265337_1019331 | Ga0265337_10193311 | 445 |
| 855 | 3300028563 | Ga0265319_1001186 | Ga0265319_10011866 | 445 |
| 856 | 3300028573 | Ga0265334_10004555 | Ga0265334_100045555 | 445 |
| 857 | 3300028577 | Ga0265318_10002315 | Ga0265318_100023158 | 445 |
| 858 | 3300028653 | Ga0265323_10000768 | Ga0265323_100007689 | 445 |
| 859 | 3300028654 | Ga0265322_10003636 | Ga0265322_100036365 | 445 |
| 860 | 3300028666 | Ga0265336_10000106 | Ga0265336_1000010621 | 445 |
| 861 | 3300028786 | Ga0307517_10000049 | Ga0307517_1000004937 | 445 |
| 862 | 3300028800 | Ga0265338_10000065 | Ga0265338_10000065112 | 445 |
| 863 | 3300029957 | Ga0265324_10001808 | Ga0265324_100018089 | 445 |
| 864 | 3300031507 | Ga0307509_10029697 | Ga0307509_100296974 | 445 |
| 865 | 3300031616 | Ga0307508_10000090 | Ga0307508_1000009083 | 445 |
| 866 | 3300031730 | Ga0307516_10006682 | Ga0307516_100066822 | 445 |
| 867 | 3300031730 | Ga0307516_10103897 | Ga0307516_101038972 | 445 |
| 868 | 3300035695 | Ga0373927_0007183 | Ga0373927_0007183_5228_6637 | 445 |
| 869 | 3300035724 | Ga0373933_0002722 | Ga0373933_0002722_693_2075 | 445 |
| 870 | 3300037068 | Ga0373925_0023694 | Ga0373925_0023694_2357_3766 | 445 |
| 871 | 3300037418 | Ga0395900_0152680 | Ga0395900_0152680_676_2085 | 445 |
| 872 | 3300037471 | Ga0395905_0039879 | Ga0395905_0039879_2444_3826 | 445 |
| 873 | 3300037471 | Ga0395905_0188380 | Ga0395905_0188380_38_1420 | 445 |
| 874 | 3300038443 | Ga0395901_0073367 | Ga0395901_0073367_867_2303 | 445 |
| 875 | 3300039438 | Ga0436360_0953856 | Ga0436360_0953856_167_1549 | 445 |
| 876 | 3300046454 | Ga0495592_0026673 | Ga0495592_0026673_374_1756 | 445 |
| 877 | 3300046462 | Ga0495651_0002101 | Ga0495651_0002101_10380_11762 | 445 |
| 878 | 3300046463 | Ga0495653_0028701 | Ga0495653_0028701_1645_3027 | 445 |
| 879 | 3300046511 | Ga0495608_0019297 | Ga0495608_0019297_2361_3743 | 445 |
| 880 | 3300046516 | Ga0495628_0014573 | Ga0495628_0014573_3540_4922 | 445 |
| 881 | 3300046529 | Ga0495652_0006363 | Ga0495652_0006363_5213_6595 | 445 |
| 882 | 3300046533 | Ga0495640_0030764 | Ga0495640_0030764_906_2294 | 445 |
| 883 | 3300046536 | Ga0495587_0024566 | Ga0495587_0024566_101_1483 | 445 |
| 884 | 3300046543 | Ga0495645_0002752 | Ga0495645_0002752_10138_11520 | 445 |
| 885 | 3300046559 | Ga0495667_0014365 | Ga0495667_0014365_428_1810 | 445 |
| 886 | 3300046642 | Ga0495634_0035941 | Ga0495634_0035941_652_2034 | 445 |
| 887 | 3300046675 | Ga0495657_0002643 | Ga0495657_0002643_9406_10788 | 445 |
| 888 | 3300046678 | Ga0495599_0031977 | Ga0495599_0031977_1796_3178 | 445 |
| 889 | 3300046683 | Ga0495658_0077884 | Ga0495658_0077884_40_1449 | 445 |
| 890 | 3300046809 | Ga0495600_0028768 | Ga0495600_0028768_1464_2846 | 445 |
| 891 | 3300047317 | Ga0495604_0005569 | Ga0495604_0005569_3851_5233 | 445 |
| 892 | 3300047319 | Ga0495674_0073584 | Ga0495674_0073584_1214_2596 | 445 |
| 893 | 3300047322 | Ga0495680_0007181 | Ga0495680_0007181_3831_5213 | 445 |
| 894 | 3300047471 | Ga0495684_0051054 | Ga0495684_0051054_18_1400 | 445 |
| 895 | 3300048088 | Ga0495602_0002010 | Ga0495602_0002010_11489_12871 | 445 |
| 896 | 3300048090 | Ga0495615_0017359 | Ga0495615_0017359_73_1455 | 445 |
| 897 | 3300048903 | Ga0496100_0072896 | Ga0496100_0072896_136_1545 | 445 |
| 898 | 3300048908 | Ga0496105_0102078 | Ga0496105_0102078_872_2269 | 445 |
| 899 | 3300048909 | Ga0496106_0046597 | Ga0496106_0046597_412_1794 | 445 |
| 900 | 3300048918 | Ga0496115_0106870 | Ga0496115_0106870_600_2009 | 445 |
| 901 | 3300048921 | Ga0496118_0013843 | Ga0496118_0013843_4580_5962 | 445 |
| 902 | 3300048924 | Ga0496121_0034449 | Ga0496121_0034449_1753_3135 | 445 |
| 903 | 3300048925 | Ga0496122_0049843 | Ga0496122_0049843_1765_3147 | 445 |
| 904 | 3300048928 | Ga0496125_0074343 | Ga0496125_0074343_396_1781 | 445 |
| 905 | 3300048929 | Ga0496126_0026719 | Ga0496126_0026719_3395_4777 | 445 |
| 906 | 3300049588 | Ga0501072_0004057 | Ga0501072_0004057_506_1909 | 445 |
| 907 | 3300049592 | Ga0501076_0111397 | Ga0501076_0111397_631_2010 | 445 |
| 908 | 3300050510 | nmdc:mga06r32_134961_c1 | nmdc:mga06r32_134961_c1_86_1522 | 445 |
| 909 | 3300050512 | nmdc:mga0n895_151330_c1 | nmdc:mga0n895_151330_c1_26_1483 | 445 |
| 910 | 3300050512 | nmdc:mga0n895_78921_c1 | nmdc:mga0n895_78921_c1_570_1979 | 445 |
| 911 | 3300053077 | Ga0495601_0029067 | Ga0495601_0029067_1442_2830 | 445 |
| 912 | 3300053087 | Ga0500643_001637 | Ga0500643_001637_1408_2793 | 445 |
| 913 | 3300053088 | Ga0500644_0000670 | Ga0500644_0000670_3475_4860 | 445 |
| 914 | 3300053093 | Ga0500651_0099808 | Ga0500651_0099808_42_1427 | 445 |
| 915 | 3300053094 | Ga0500566_0024756 | Ga0500566_0024756_666_2051 | 445 |
| 916 | 3300053105 | Ga0500557_000039 | Ga0500557_000039_37395_38777 | 445 |
| 917 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_119336_120721 | 445 |
| 918 | 3300053130 | Ga0500642_0000285 | Ga0500642_0000285_5291_6673 | 445 |
| 919 | 3300053136 | Ga0500559_0044275 | Ga0500559_0044275_251_1633 | 445 |
| 920 | 3300053140 | Ga0500573_0040300 | Ga0500573_0040300_29_1411 | 445 |
| 921 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1306080_1307465 | 445 |
| 922 | 3300053177 | Ga0500636_0029794 | Ga0500636_0029794_336_1718 | 445 |
| 923 | 3300053729 | Ga0500625_007580 | Ga0500625_007580_3123_4505 | 445 |
| 924 | 3300053730 | Ga0500645_000078 | Ga0500645_000078_36346_37731 | 445 |
| 925 | 3300053735 | Ga0500596_007040 | Ga0500596_007040_233_1615 | 445 |
| 926 | 3300054114 | Ga0501084_0142571 | Ga0501084_0142571_515_1912 | 445 |
| 927 | 3300003203 | JGI25406J46586_10000801 | JGI25406J46586_100008011 | 446 |
| 928 | 3300003203 | JGI25406J46586_10003389 | JGI25406J46586_100033896 | 446 |
| 929 | 3300003203 | JGI25406J46586_10003524 | JGI25406J46586_100035246 | 446 |
| 930 | 3300005356 | Ga0070674_100080008 | Ga0070674_1000800082 | 446 |
| 931 | 3300005434 | Ga0070709_10001642 | Ga0070709_100016424 | 446 |
| 932 | 3300005435 | Ga0070714_100013820 | Ga0070714_1000138204 | 446 |
| 933 | 3300005436 | Ga0070713_100020726 | Ga0070713_1000207262 | 446 |
| 934 | 3300005437 | Ga0070710_10003655 | Ga0070710_100036554 | 446 |
| 935 | 3300005457 | Ga0070662_100098404 | Ga0070662_1000984042 | 446 |
| 936 | 3300005471 | Ga0070698_100166882 | Ga0070698_1001668822 | 446 |
| 937 | 3300005536 | Ga0070697_100109945 | Ga0070697_1001099451 | 446 |
| 938 | 3300005548 | Ga0070665_100123475 | Ga0070665_1001234752 | 446 |
| 939 | 3300005577 | Ga0068857_100071409 | Ga0068857_1000714092 | 446 |
| 940 | 3300005937 | Ga0081455_10028316 | Ga0081455_100283163 | 446 |
| 941 | 3300005937 | Ga0081455_10052106 | Ga0081455_100521063 | 446 |
| 942 | 3300005981 | Ga0081538_10041924 | Ga0081538_100419241 | 446 |
| 943 | 3300005981 | Ga0081538_10051173 | Ga0081538_100511732 | 446 |
| 944 | 3300005983 | Ga0081540_1002649 | Ga0081540_10026498 | 446 |
| 945 | 3300005983 | Ga0081540_1003830 | Ga0081540_100383014 | 446 |
| 946 | 3300005983 | Ga0081540_1003910 | Ga0081540_100391011 | 446 |
| 947 | 3300005983 | Ga0081540_1027228 | Ga0081540_10272282 | 446 |
| 948 | 3300005983 | Ga0081540_1036114 | Ga0081540_10361142 | 446 |
| 949 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008441 | 446 |
| 950 | 3300005985 | Ga0081539_10000747 | Ga0081539_1000074776 | 446 |
| 951 | 3300006028 | Ga0070717_10018588 | Ga0070717_100185884 | 446 |
| 952 | 3300006163 | Ga0070715_10000320 | Ga0070715_1000032010 | 446 |
| 953 | 3300006173 | Ga0070716_100001867 | Ga0070716_1000018677 | 446 |
| 954 | 3300006178 | Ga0075367_10006118 | Ga0075367_100061185 | 446 |
| 955 | 3300006844 | Ga0075428_100098353 | Ga0075428_1000983532 | 446 |
| 956 | 3300006846 | Ga0075430_100004771 | Ga0075430_1000047711 | 446 |
| 957 | 3300006846 | Ga0075430_100065258 | Ga0075430_1000652582 | 446 |
| 958 | 3300006847 | Ga0075431_100037647 | Ga0075431_1000376474 | 446 |
| 959 | 3300009174 | Ga0105241_10012907 | Ga0105241_100129074 | 446 |
| 960 | 3300009177 | Ga0105248_10090547 | Ga0105248_100905473 | 446 |
| 961 | 3300009177 | Ga0105248_10239281 | Ga0105248_102392812 | 446 |
| 962 | 3300010375 | Ga0105239_10043580 | Ga0105239_100435804 | 446 |
| 963 | 3300013296 | Ga0157374_10025104 | Ga0157374_100251043 | 446 |
| 964 | 3300013306 | Ga0163162_10013059 | Ga0163162_100130591 | 446 |
| 965 | 3300013308 | Ga0157375_10021128 | Ga0157375_100211284 | 446 |
| 966 | 3300014969 | Ga0157376_10002959 | Ga0157376_100029598 | 446 |
| 967 | 3300025261 | Ga0209233_1004907 | Ga0209233_10049073 | 446 |
| 968 | 3300025898 | Ga0207692_10007013 | Ga0207692_100070135 | 446 |
| 969 | 3300025901 | Ga0207688_10058016 | Ga0207688_100580162 | 446 |
| 970 | 3300025906 | Ga0207699_10002443 | Ga0207699_1000244310 | 446 |
| 971 | 3300025907 | Ga0207645_10018918 | Ga0207645_100189185 | 446 |
| 972 | 3300025911 | Ga0207654_10017669 | Ga0207654_100176692 | 446 |
| 973 | 3300025914 | Ga0207671_10139691 | Ga0207671_101396912 | 446 |
| 974 | 3300025915 | Ga0207693_10001385 | Ga0207693_100013856 | 446 |
| 975 | 3300025915 | Ga0207693_10064329 | Ga0207693_100643291 | 446 |
| 976 | 3300025916 | Ga0207663_10000136 | Ga0207663_100001363 | 446 |
| 977 | 3300025928 | Ga0207700_10032460 | Ga0207700_100324602 | 446 |
| 978 | 3300025928 | Ga0207700_10041044 | Ga0207700_100410444 | 446 |
| 979 | 3300025929 | Ga0207664_10013549 | Ga0207664_100135495 | 446 |
| 980 | 3300025939 | Ga0207665_10000064 | Ga0207665_1000006469 | 446 |
| 981 | 3300025940 | Ga0207691_10061618 | Ga0207691_100616182 | 446 |
| 982 | 3300025940 | Ga0207691_10091423 | Ga0207691_100914231 | 446 |
| 983 | 3300025940 | Ga0207691_10137905 | Ga0207691_101379051 | 446 |
| 984 | 3300025941 | Ga0207711_10043321 | Ga0207711_100433213 | 446 |
| 985 | 3300026023 | Ga0207677_10029878 | Ga0207677_100298783 | 446 |
| 986 | 3300026075 | Ga0207708_10102100 | Ga0207708_101021002 | 446 |
| 987 | 3300026089 | Ga0207648_10006999 | Ga0207648_100069998 | 446 |
| 988 | 3300026116 | Ga0207674_10151319 | Ga0207674_101513192 | 446 |
| 989 | 3300026142 | Ga0207698_10154018 | Ga0207698_101540182 | 446 |
| 990 | 3300027717 | Ga0209998_10006448 | Ga0209998_100064482 | 446 |
| 991 | 3300028379 | Ga0268266_10003117 | Ga0268266_100031172 | 446 |
| 992 | 3300028379 | Ga0268266_10137128 | Ga0268266_101371282 | 446 |
| 993 | 3300028379 | Ga0268266_10245286 | Ga0268266_102452861 | 446 |
| 994 | 3300031235 | Ga0265330_10013442 | Ga0265330_100134422 | 446 |
| 995 | 3300031241 | Ga0265325_10023047 | Ga0265325_100230472 | 446 |
| 996 | 3300031507 | Ga0307509_10083377 | Ga0307509_100833771 | 446 |
| 997 | 3300031548 | Ga0307408_100018764 | Ga0307408_1000187642 | 446 |
| 998 | 3300033180 | Ga0307510_10019318 | Ga0307510_100193183 | 446 |
| 999 | 3300033180 | Ga0307510_10031887 | Ga0307510_100318875 | 446 |
| 1000 | 3300033180 | Ga0307510_10044427 | Ga0307510_100444274 | 446 |
| 1001 | 3300033442 | Ga0315911_1000011 | Ga0315911_1000011106 | 446 |
| 1002 | 3300035111 | Ga0373923_0003802 | Ga0373923_0003802_2370_3836 | 446 |
| 1003 | 3300035118 | Ga0373954_0010242 | Ga0373954_0010242_997_2463 | 446 |
| 1004 | 3300035170 | Ga0373943_0008124 | Ga0373943_0008124_499_1941 | 446 |
| 1005 | 3300035171 | Ga0373946_0043539 | Ga0373946_0043539_136_1521 | 446 |
| 1006 | 3300035172 | Ga0373955_0000360 | Ga0373955_0000360_2499_3965 | 446 |
| 1007 | 3300035241 | Ga0373961_0020487 | Ga0373961_0020487_223_1614 | 446 |
| 1008 | 3300035410 | Ga0373924_0002747 | Ga0373924_0002747_4109_5575 | 446 |
| 1009 | 3300035691 | Ga0373931_0002260 | Ga0373931_0002260_889_2274 | 446 |
| 1010 | 3300035691 | Ga0373931_0006487 | Ga0373931_0006487_3916_5307 | 446 |
| 1011 | 3300035692 | Ga0373935_0002949 | Ga0373935_0002949_2856_4298 | 446 |
| 1012 | 3300035695 | Ga0373927_0000950 | Ga0373927_0000950_9716_11158 | 446 |
| 1013 | 3300035724 | Ga0373933_0003920 | Ga0373933_0003920_5150_6616 | 446 |
| 1014 | 3300035725 | Ga0373947_0003025 | Ga0373947_0003025_314_1756 | 446 |
| 1015 | 3300036401 | Ga0373937_0008436 | Ga0373937_0008436_1466_2932 | 446 |
| 1016 | 3300036401 | Ga0373937_0031959 | Ga0373937_0031959_1403_2845 | 446 |
| 1017 | 3300037068 | Ga0373925_0016899 | Ga0373925_0016899_121_1506 | 446 |
| 1018 | 3300037853 | Ga0436364_0810480 | Ga0436364_0810480_870_2255 | 446 |
| 1019 | 3300039437 | Ga0436365_0642532 | Ga0436365_0642532_1390_2874 | 446 |
| 1020 | 3300042008 | Ga0439450_006325 | Ga0439450_006325_83_1468 | 446 |
| 1021 | 3300042012 | Ga0439455_0011932 | Ga0439455_0011932_335_1720 | 446 |
| 1022 | 3300042439 | Ga0439464_0016409 | Ga0439464_0016409_108_1493 | 446 |
| 1023 | 3300045049 | Ga0466959_0092197 | Ga0466959_0092197_29_1411 | 446 |
| 1024 | 3300046454 | Ga0495592_0009069 | Ga0495592_0009069_5974_7440 | 446 |
| 1025 | 3300046454 | Ga0495592_0133728 | Ga0495592_0133728_18_1460 | 446 |
| 1026 | 3300046455 | Ga0495603_0000200 | Ga0495603_0000200_14870_16312 | 446 |
| 1027 | 3300046455 | Ga0495603_0004845 | Ga0495603_0004845_3533_4918 | 446 |
| 1028 | 3300046455 | Ga0495603_0013905 | Ga0495603_0013905_2629_4101 | 446 |
| 1029 | 3300046455 | Ga0495603_0035297 | Ga0495603_0035297_1485_2870 | 446 |
| 1030 | 3300046459 | Ga0495629_0002535 | Ga0495629_0002535_2994_4436 | 446 |
| 1031 | 3300046459 | Ga0495629_0010260 | Ga0495629_0010260_583_2049 | 446 |
| 1032 | 3300046460 | Ga0495638_0004444 | Ga0495638_0004444_8024_9409 | 446 |
| 1033 | 3300046461 | Ga0495641_0008896 | Ga0495641_0008896_4449_5891 | 446 |
| 1034 | 3300046462 | Ga0495651_0027827 | Ga0495651_0027827_1601_2986 | 446 |
| 1035 | 3300046463 | Ga0495653_0001070 | Ga0495653_0001070_9186_10652 | 446 |
| 1036 | 3300046472 | Ga0495580_0002104 | Ga0495580_0002104_14930_16372 | 446 |
| 1037 | 3300046473 | Ga0495582_0000354 | Ga0495582_0000354_3484_4926 | 446 |
| 1038 | 3300046473 | Ga0495582_0100804 | Ga0495582_0100804_172_1566 | 446 |
| 1039 | 3300046475 | Ga0495639_0005177 | Ga0495639_0005177_923_2308 | 446 |
| 1040 | 3300046477 | Ga0495664_0008000 | Ga0495664_0008000_4275_5717 | 446 |
| 1041 | 3300046477 | Ga0495664_0074724 | Ga0495664_0074724_583_1968 | 446 |
| 1042 | 3300046499 | Ga0495594_0001396 | Ga0495594_0001396_9798_11240 | 446 |
| 1043 | 3300046511 | Ga0495608_0000832 | Ga0495608_0000832_6293_7759 | 446 |
| 1044 | 3300046514 | Ga0495618_0019644 | Ga0495618_0019644_639_2105 | 446 |
| 1045 | 3300046516 | Ga0495628_0067228 | Ga0495628_0067228_747_2213 | 446 |
| 1046 | 3300046517 | Ga0495630_0030591 | Ga0495630_0030591_1192_2634 | 446 |
| 1047 | 3300046524 | Ga0495648_0008413 | Ga0495648_0008413_6403_7788 | 446 |
| 1048 | 3300046529 | Ga0495652_0023871 | Ga0495652_0023871_933_2399 | 446 |
| 1049 | 3300046529 | Ga0495652_0074114 | Ga0495652_0074114_1219_2661 | 446 |
| 1050 | 3300046531 | Ga0495665_0002572 | Ga0495665_0002572_3680_5122 | 446 |
| 1051 | 3300046533 | Ga0495640_0021984 | Ga0495640_0021984_692_2077 | 446 |
| 1052 | 3300046535 | Ga0495586_0052757 | Ga0495586_0052757_562_1947 | 446 |
| 1053 | 3300046536 | Ga0495587_0014270 | Ga0495587_0014270_2630_4096 | 446 |
| 1054 | 3300046557 | Ga0495622_0073150 | Ga0495622_0073150_78_1520 | 446 |
| 1055 | 3300046559 | Ga0495667_0003082 | Ga0495667_0003082_9309_10775 | 446 |
| 1056 | 3300046559 | Ga0495667_0005379 | Ga0495667_0005379_408_1850 | 446 |
| 1057 | 3300046559 | Ga0495667_0029156 | Ga0495667_0029156_1683_3068 | 446 |
| 1058 | 3300046642 | Ga0495634_0003609 | Ga0495634_0003609_8155_9597 | 446 |
| 1059 | 3300046642 | Ga0495634_0006837 | Ga0495634_0006837_2506_3972 | 446 |
| 1060 | 3300046663 | Ga0495635_0001348 | Ga0495635_0001348_2129_3571 | 446 |
| 1061 | 3300046663 | Ga0495635_0001667 | Ga0495635_0001667_12942_14408 | 446 |
| 1062 | 3300046663 | Ga0495635_0014408 | Ga0495635_0014408_614_1999 | 446 |
| 1063 | 3300046663 | Ga0495635_0026385 | Ga0495635_0026385_2430_3815 | 446 |
| 1064 | 3300046664 | Ga0495659_0013930 | Ga0495659_0013930_477_1862 | 446 |
| 1065 | 3300046674 | Ga0495588_0026608 | Ga0495588_0026608_1092_2534 | 446 |
| 1066 | 3300046675 | Ga0495657_0033520 | Ga0495657_0033520_1700_3166 | 446 |
| 1067 | 3300046675 | Ga0495657_0044165 | Ga0495657_0044165_1249_2634 | 446 |
| 1068 | 3300046678 | Ga0495599_0006501 | Ga0495599_0006501_4121_5587 | 446 |
| 1069 | 3300046679 | Ga0495623_0007128 | Ga0495623_0007128_685_2151 | 446 |
| 1070 | 3300046680 | Ga0495646_0010792 | Ga0495646_0010792_846_2312 | 446 |
| 1071 | 3300046680 | Ga0495646_0081565 | Ga0495646_0081565_426_1868 | 446 |
| 1072 | 3300046690 | Ga0495624_0002275 | Ga0495624_0002275_10489_11931 | 446 |
| 1073 | 3300046809 | Ga0495600_0071798 | Ga0495600_0071798_259_1725 | 446 |
| 1074 | 3300047315 | Ga0495581_0000851 | Ga0495581_0000851_11944_13386 | 446 |
| 1075 | 3300047315 | Ga0495581_0005368 | Ga0495581_0005368_3043_4428 | 446 |
| 1076 | 3300047317 | Ga0495604_0008438 | Ga0495604_0008438_2805_4190 | 446 |
| 1077 | 3300047317 | Ga0495604_0084461 | Ga0495604_0084461_811_2277 | 446 |
| 1078 | 3300047319 | Ga0495674_0000559 | Ga0495674_0000559_12752_14194 | 446 |
| 1079 | 3300047320 | Ga0495672_0100931 | Ga0495672_0100931_162_1544 | 446 |
| 1080 | 3300047322 | Ga0495680_0036826 | Ga0495680_0036826_1498_2964 | 446 |
| 1081 | 3300047444 | Ga0495675_0024047 | Ga0495675_0024047_950_2416 | 446 |
| 1082 | 3300047471 | Ga0495684_0005198 | Ga0495684_0005198_409_1875 | 446 |
| 1083 | 3300047673 | Ga0495593_0000606 | Ga0495593_0000606_14907_16349 | 446 |
| 1084 | 3300047673 | Ga0495593_0000953 | Ga0495593_0000953_4365_5831 | 446 |
| 1085 | 3300048089 | Ga0495614_0011184 | Ga0495614_0011184_1243_2685 | 446 |
| 1086 | 3300048903 | Ga0496100_0009429 | Ga0496100_0009429_1107_2492 | 446 |
| 1087 | 3300048904 | Ga0496101_0023426 | Ga0496101_0023426_127_1512 | 446 |
| 1088 | 3300048905 | Ga0496102_0167526 | Ga0496102_0167526_327_1712 | 446 |
| 1089 | 3300048907 | Ga0496104_0003501 | Ga0496104_0003501_1395_2780 | 446 |
| 1090 | 3300048907 | Ga0496104_0009306 | Ga0496104_0009306_2232_3629 | 446 |
| 1091 | 3300048907 | Ga0496104_0013196 | Ga0496104_0013196_4835_6232 | 446 |
| 1092 | 3300048908 | Ga0496105_0019841 | Ga0496105_0019841_3162_4559 | 446 |
| 1093 | 3300048909 | Ga0496106_0075706 | Ga0496106_0075706_1109_2536 | 446 |
| 1094 | 3300048910 | Ga0496107_0001922 | Ga0496107_0001922_2758_4185 | 446 |
| 1095 | 3300048911 | Ga0496108_0032499 | Ga0496108_0032499_289_1674 | 446 |
| 1096 | 3300048911 | Ga0496108_0097387 | Ga0496108_0097387_566_1993 | 446 |
| 1097 | 3300048912 | Ga0496109_0035557 | Ga0496109_0035557_2878_4263 | 446 |
| 1098 | 3300048912 | Ga0496109_0262605 | Ga0496109_0262605_66_1451 | 446 |
| 1099 | 3300048913 | Ga0496110_0005741 | Ga0496110_0005741_7899_9284 | 446 |
| 1100 | 3300048913 | Ga0496110_0039631 | Ga0496110_0039631_342_1727 | 446 |
| 1101 | 3300048913 | Ga0496110_0075322 | Ga0496110_0075322_24_1409 | 446 |
| 1102 | 3300048914 | Ga0496111_0035729 | Ga0496111_0035729_135_1520 | 446 |
| 1103 | 3300048914 | Ga0496111_0078761 | Ga0496111_0078761_870_2255 | 446 |
| 1104 | 3300048914 | Ga0496111_0103383 | Ga0496111_0103383_484_1911 | 446 |
| 1105 | 3300048915 | Ga0496112_0034574 | Ga0496112_0034574_2625_4010 | 446 |
| 1106 | 3300048915 | Ga0496112_0067283 | Ga0496112_0067283_1213_2598 | 446 |
| 1107 | 3300048915 | Ga0496112_0095342 | Ga0496112_0095342_1175_2572 | 446 |
| 1108 | 3300048915 | Ga0496112_0096518 | Ga0496112_0096518_437_1828 | 446 |
| 1109 | 3300048916 | Ga0496113_0074000 | Ga0496113_0074000_741_2138 | 446 |
| 1110 | 3300048917 | Ga0496114_0003638 | Ga0496114_0003638_1641_3026 | 446 |
| 1111 | 3300048918 | Ga0496115_0002584 | Ga0496115_0002584_686_2113 | 446 |
| 1112 | 3300048918 | Ga0496115_0031895 | Ga0496115_0031895_101_1498 | 446 |
| 1113 | 3300048920 | Ga0496117_0110843 | Ga0496117_0110843_230_1615 | 446 |
| 1114 | 3300048924 | Ga0496121_0001006 | Ga0496121_0001006_38169_39554 | 446 |
| 1115 | 3300049459 | Ga0495678_018166 | Ga0495678_018166_269_1654 | 446 |
| 1116 | 3300050490 | nmdc:mga03n38_1633_c1 | nmdc:mga03n38_1633_c1_1915_3300 | 446 |
| 1117 | 3300050494 | nmdc:mga06z11_110024_c1 | nmdc:mga06z11_110024_c1_98_1483 | 446 |
| 1118 | 3300050496 | nmdc:mga07m45_61814_c1 | nmdc:mga07m45_61814_c1_262_1647 | 446 |
| 1119 | 3300050507 | nmdc:mga05p37_80496_c1 | nmdc:mga05p37_80496_c1_1753_3135 | 446 |
| 1120 | 3300050509 | nmdc:mga0qj67_56258_c1 | nmdc:mga0qj67_56258_c1_898_2298 | 446 |
| 1121 | 3300050509 | nmdc:mga0qj67_933_c1 | nmdc:mga0qj67_933_c1_11432_12814 | 446 |
| 1122 | 3300050512 | nmdc:mga0n895_64657_c1 | nmdc:mga0n895_64657_c1_654_2051 | 446 |
| 1123 | 3300053077 | Ga0495601_0056086 | Ga0495601_0056086_20_1414 | 446 |
| 1124 | 3300053079 | Ga0500610_0056426 | Ga0500610_0056426_15_1463 | 446 |
| 1125 | 3300053084 | Ga0495595_0000696 | Ga0495595_0000696_3462_4928 | 446 |
| 1126 | 3300053085 | Ga0495619_0000966 | Ga0495619_0000966_9187_10653 | 446 |
| 1127 | 3300053085 | Ga0495619_0033264 | Ga0495619_0033264_749_2134 | 446 |
| 1128 | 3300053094 | Ga0500566_0001280 | Ga0500566_0001280_13010_14407 | 446 |
| 1129 | 3300053095 | Ga0500640_048834 | Ga0500640_048834_416_1813 | 446 |
| 1130 | 3300053096 | Ga0500641_0007284 | Ga0500641_0007284_1812_3197 | 446 |
| 1131 | 3300053102 | Ga0500554_002430 | Ga0500554_002430_2003_3388 | 446 |
| 1132 | 3300053111 | Ga0500572_000559 | Ga0500572_000559_180_1577 | 446 |
| 1133 | 3300053123 | Ga0500614_001873 | Ga0500614_001873_207_1604 | 446 |
| 1134 | 3300053130 | Ga0500642_0066964 | Ga0500642_0066964_26_1411 | 446 |
| 1135 | 3300053134 | Ga0500658_0016238 | Ga0500658_0016238_905_2290 | 446 |
| 1136 | 3300053136 | Ga0500559_0008368 | Ga0500559_0008368_323_1720 | 446 |
| 1137 | 3300053150 | Ga0500603_000423 | Ga0500603_000423_9513_10910 | 446 |
| 1138 | 3300053150 | Ga0500603_002454 | Ga0500603_002454_624_2009 | 446 |
| 1139 | 3300053159 | Ga0500630_001193 | Ga0500630_001193_10631_12028 | 446 |
| 1140 | 3300053163 | Ga0500639_000025 | Ga0500639_000025_83257_84654 | 446 |
| 1141 | 3300053178 | Ga0500637_0000655 | Ga0500637_0000655_10884_12275 | 446 |
| 1142 | 3300053178 | Ga0500637_0008929 | Ga0500637_0008929_336_1721 | 446 |
| 1143 | 3300053735 | Ga0500596_001197 | Ga0500596_001197_10_1407 | 446 |
| 1144 | 3300054114 | Ga0501084_0167955 | Ga0501084_0167955_444_1829 | 446 |
| 1145 | 3300061719 | Ga0466962_0066665 | Ga0466962_0066665_221_1603 | 446 |
| 1146 | iso_pu_bacteria | 2513237137 | 2513858194 | 446 |
| 1147 | iso_pu_bacteria | 2517572143 | 2517893917 | 446 |
| 1148 | iso_pu_bacteria | 3005474847 | 3005478648 | 446 |
| 1149 | iso_pu_bacteria | 8019555841 | 8019558477 | 446 |
| 1150 | iso_pu_bacteria | 8019565922 | 8019566820 | 446 |
| 1151 | 2209111006 | 2214745205 | 2213754696 | 447 |
| 1152 | 3300000041 | ARcpr5oldR_c000087 | ARcpr5oldR_00008712 | 447 |
| 1153 | 3300000042 | ARSoilYngRDRAFT_c00048 | ARSoilYngRDRAFT_000486 | 447 |
| 1154 | 3300000043 | ARcpr5yngRDRAFT_c000112 | ARcpr5yngRDRAFT_0001123 | 447 |
| 1155 | 3300000044 | ARSoilOldRDRAFT_c000094 | ARSoilOldRDRAFT_00009412 | 447 |
| 1156 | 3300000652 | ARCol0yngRDRAFT_1000121 | ARCol0yngRDRAFT_100012110 | 447 |
| 1157 | 3300001989 | JGI24739J22299_10002910 | JGI24739J22299_100029102 | 447 |
| 1158 | 3300001990 | JGI24737J22298_10001520 | JGI24737J22298_100015205 | 447 |
| 1159 | 3300001991 | JGI24743J22301_10002453 | JGI24743J22301_100024533 | 447 |
| 1160 | 3300002070 | JGI24750J21931_1000426 | JGI24750J21931_10004262 | 447 |
| 1161 | 3300002073 | JGI24745J21846_1000426 | JGI24745J21846_10004262 | 447 |
| 1162 | 3300002074 | JGI24748J21848_1000786 | JGI24748J21848_10007863 | 447 |
| 1163 | 3300002075 | JGI24738J21930_10000707 | JGI24738J21930_100007076 | 447 |
| 1164 | 3300002076 | JGI24749J21850_1001137 | JGI24749J21850_10011373 | 447 |
| 1165 | 3300002077 | JGI24744J21845_10004543 | JGI24744J21845_100045432 | 447 |
| 1166 | 3300002126 | JGI24035J26624_1000282 | JGI24035J26624_10002822 | 447 |
| 1167 | 3300002239 | JGI24034J26672_10000879 | JGI24034J26672_100008792 | 447 |
| 1168 | 3300002244 | JGI24742J22300_10001239 | JGI24742J22300_100012392 | 447 |
| 1169 | 3300002459 | JGI24751J29686_10004754 | JGI24751J29686_100047542 | 447 |
| 1170 | 3300003659 | JGI25404J52841_10002956 | JGI25404J52841_100029562 | 447 |
| 1171 | 3300005289 | Ga0065704_10002258 | Ga0065704_100022587 | 447 |
| 1172 | 3300005290 | Ga0065712_10068851 | Ga0065712_100688512 | 447 |
| 1173 | 3300005290 | Ga0065712_10075439 | Ga0065712_100754393 | 447 |
| 1174 | 3300005293 | Ga0065715_10093263 | Ga0065715_100932635 | 447 |
| 1175 | 3300005293 | Ga0065715_10105949 | Ga0065715_101059492 | 447 |
| 1176 | 3300005295 | Ga0065707_10098445 | Ga0065707_100984453 | 447 |
| 1177 | 3300005328 | Ga0070676_10022543 | Ga0070676_100225432 | 447 |
| 1178 | 3300005330 | Ga0070690_100012396 | Ga0070690_1000123962 | 447 |
| 1179 | 3300005331 | Ga0070670_100041518 | Ga0070670_1000415183 | 447 |
| 1180 | 3300005333 | Ga0070677_10000893 | Ga0070677_100008936 | 447 |
| 1181 | 3300005334 | Ga0068869_100007674 | Ga0068869_1000076742 | 447 |
| 1182 | 3300005335 | Ga0070666_10031431 | Ga0070666_100314312 | 447 |
| 1183 | 3300005336 | Ga0070680_100022312 | Ga0070680_1000223125 | 447 |
| 1184 | 3300005337 | Ga0070682_100030025 | Ga0070682_1000300252 | 447 |
| 1185 | 3300005338 | Ga0068868_100006926 | Ga0068868_1000069266 | 447 |
| 1186 | 3300005339 | Ga0070660_100008270 | Ga0070660_1000082706 | 447 |
| 1187 | 3300005339 | Ga0070660_100123502 | Ga0070660_1001235022 | 447 |
| 1188 | 3300005340 | Ga0070689_100016937 | Ga0070689_1000169375 | 447 |
| 1189 | 3300005341 | Ga0070691_10005653 | Ga0070691_100056535 | 447 |
| 1190 | 3300005343 | Ga0070687_100004982 | Ga0070687_1000049825 | 447 |
| 1191 | 3300005344 | Ga0070661_100020584 | Ga0070661_1000205844 | 447 |
| 1192 | 3300005345 | Ga0070692_10002117 | Ga0070692_100021176 | 447 |
| 1193 | 3300005347 | Ga0070668_100015686 | Ga0070668_1000156865 | 447 |
| 1194 | 3300005353 | Ga0070669_100016043 | Ga0070669_1000160434 | 447 |
| 1195 | 3300005354 | Ga0070675_100038825 | Ga0070675_1000388253 | 447 |
| 1196 | 3300005355 | Ga0070671_100031211 | Ga0070671_1000312115 | 447 |
| 1197 | 3300005356 | Ga0070674_100008724 | Ga0070674_1000087243 | 447 |
| 1198 | 3300005356 | Ga0070674_100085197 | Ga0070674_1000851971 | 447 |
| 1199 | 3300005364 | Ga0070673_100002682 | Ga0070673_1000026822 | 447 |
| 1200 | 3300005365 | Ga0070688_100004383 | Ga0070688_1000043835 | 447 |
| 1201 | 3300005366 | Ga0070659_100004732 | Ga0070659_1000047326 | 447 |
| 1202 | 3300005367 | Ga0070667_100029364 | Ga0070667_1000293644 | 447 |
| 1203 | 3300005367 | Ga0070667_100100389 | Ga0070667_1001003892 | 447 |
| 1204 | 3300005406 | Ga0070703_10017295 | Ga0070703_100172952 | 447 |
| 1205 | 3300005434 | Ga0070709_10005467 | Ga0070709_100054676 | 447 |
| 1206 | 3300005436 | Ga0070713_100002130 | Ga0070713_1000021305 | 447 |
| 1207 | 3300005437 | Ga0070710_10015367 | Ga0070710_100153671 | 447 |
| 1208 | 3300005438 | Ga0070701_10007846 | Ga0070701_100078462 | 447 |
| 1209 | 3300005441 | Ga0070700_100010970 | Ga0070700_1000109704 | 447 |
| 1210 | 3300005444 | Ga0070694_100006993 | Ga0070694_1000069936 | 447 |
| 1211 | 3300005445 | Ga0070708_100022450 | Ga0070708_1000224502 | 447 |
| 1212 | 3300005455 | Ga0070663_100026359 | Ga0070663_1000263593 | 447 |
| 1213 | 3300005456 | Ga0070678_100023744 | Ga0070678_1000237445 | 447 |
| 1214 | 3300005456 | Ga0070678_100033206 | Ga0070678_1000332062 | 447 |
| 1215 | 3300005457 | Ga0070662_100013871 | Ga0070662_1000138713 | 447 |
| 1216 | 3300005458 | Ga0070681_10019127 | Ga0070681_100191276 | 447 |
| 1217 | 3300005459 | Ga0068867_100018968 | Ga0068867_1000189682 | 447 |
| 1218 | 3300005466 | Ga0070685_10024114 | Ga0070685_100241143 | 447 |
| 1219 | 3300005466 | Ga0070685_10062627 | Ga0070685_100626271 | 447 |
| 1220 | 3300005530 | Ga0070679_100016263 | Ga0070679_1000162634 | 447 |
| 1221 | 3300005535 | Ga0070684_100042489 | Ga0070684_1000424892 | 447 |
| 1222 | 3300005535 | Ga0070684_100056596 | Ga0070684_1000565963 | 447 |
| 1223 | 3300005543 | Ga0070672_100010094 | Ga0070672_1000100943 | 447 |
| 1224 | 3300005543 | Ga0070672_100060655 | Ga0070672_1000606551 | 447 |
| 1225 | 3300005544 | Ga0070686_100001845 | Ga0070686_1000018459 | 447 |
| 1226 | 3300005545 | Ga0070695_100003597 | Ga0070695_1000035975 | 447 |
| 1227 | 3300005546 | Ga0070696_100013188 | Ga0070696_1000131883 | 447 |
| 1228 | 3300005547 | Ga0070693_100014637 | Ga0070693_1000146373 | 447 |
| 1229 | 3300005547 | Ga0070693_100020390 | Ga0070693_1000203902 | 447 |
| 1230 | 3300005548 | Ga0070665_100102801 | Ga0070665_1001028013 | 447 |
| 1231 | 3300005549 | Ga0070704_100003777 | Ga0070704_1000037777 | 447 |
| 1232 | 3300005549 | Ga0070704_100010479 | Ga0070704_1000104792 | 447 |
| 1233 | 3300005563 | Ga0068855_100147013 | Ga0068855_1001470132 | 447 |
| 1234 | 3300005564 | Ga0070664_100057460 | Ga0070664_1000574603 | 447 |
| 1235 | 3300005577 | Ga0068857_100000825 | Ga0068857_1000008256 | 447 |
| 1236 | 3300005578 | Ga0068854_100005746 | Ga0068854_1000057465 | 447 |
| 1237 | 3300005614 | Ga0068856_100004702 | Ga0068856_1000047025 | 447 |
| 1238 | 3300005615 | Ga0070702_100007181 | Ga0070702_1000071812 | 447 |
| 1239 | 3300005615 | Ga0070702_100027848 | Ga0070702_1000278482 | 447 |
| 1240 | 3300005616 | Ga0068852_100005334 | Ga0068852_1000053345 | 447 |
| 1241 | 3300005617 | Ga0068859_100012382 | Ga0068859_1000123825 | 447 |
| 1242 | 3300005618 | Ga0068864_100003085 | Ga0068864_1000030856 | 447 |
| 1243 | 3300005718 | Ga0068866_10001247 | Ga0068866_100012479 | 447 |
| 1244 | 3300005719 | Ga0068861_100018109 | Ga0068861_1000181092 | 447 |
| 1245 | 3300005719 | Ga0068861_100018613 | Ga0068861_1000186133 | 447 |
| 1246 | 3300005840 | Ga0068870_10011056 | Ga0068870_100110563 | 447 |
| 1247 | 3300005841 | Ga0068863_100020493 | Ga0068863_1000204932 | 447 |
| 1248 | 3300005841 | Ga0068863_100093151 | Ga0068863_1000931512 | 447 |
| 1249 | 3300005842 | Ga0068858_100063302 | Ga0068858_1000633023 | 447 |
| 1250 | 3300005843 | Ga0068860_100026283 | Ga0068860_1000262835 | 447 |
| 1251 | 3300005843 | Ga0068860_100077921 | Ga0068860_1000779212 | 447 |
| 1252 | 3300005844 | Ga0068862_100010699 | Ga0068862_1000106994 | 447 |
| 1253 | 3300005937 | Ga0081455_10000200 | Ga0081455_1000020062 | 447 |
| 1254 | 3300005937 | Ga0081455_10067882 | Ga0081455_100678821 | 447 |
| 1255 | 3300005983 | Ga0081540_1000726 | Ga0081540_10007266 | 447 |
| 1256 | 3300005983 | Ga0081540_1009787 | Ga0081540_10097872 | 447 |
| 1257 | 3300006028 | Ga0070717_10002186 | Ga0070717_100021864 | 447 |
| 1258 | 3300006058 | Ga0075432_10007773 | Ga0075432_100077731 | 447 |
| 1259 | 3300006163 | Ga0070715_10000420 | Ga0070715_100004203 | 447 |
| 1260 | 3300006178 | Ga0075367_10013796 | Ga0075367_100137963 | 447 |
| 1261 | 3300006178 | Ga0075367_10021373 | Ga0075367_100213734 | 447 |
| 1262 | 3300006195 | Ga0075366_10049192 | Ga0075366_100491922 | 447 |
| 1263 | 3300006237 | Ga0097621_100018375 | Ga0097621_1000183754 | 447 |
| 1264 | 3300006353 | Ga0075370_10036524 | Ga0075370_100365242 | 447 |
| 1265 | 3300006358 | Ga0068871_100017948 | Ga0068871_1000179484 | 447 |
| 1266 | 3300006844 | Ga0075428_100003399 | Ga0075428_10000339910 | 447 |
| 1267 | 3300006846 | Ga0075430_100000133 | Ga0075430_10000013312 | 447 |
| 1268 | 3300006847 | Ga0075431_100002259 | Ga0075431_1000022597 | 447 |
| 1269 | 3300006852 | Ga0075433_10000506 | Ga0075433_1000050615 | 447 |
| 1270 | 3300006852 | Ga0075433_10159343 | Ga0075433_101593431 | 447 |
| 1271 | 3300006871 | Ga0075434_100000472 | Ga0075434_10000047214 | 447 |
| 1272 | 3300006871 | Ga0075434_100001125 | Ga0075434_10000112515 | 447 |
| 1273 | 3300006871 | Ga0075434_100080376 | Ga0075434_1000803762 | 447 |
| 1274 | 3300006880 | Ga0075429_100000163 | Ga0075429_10000016312 | 447 |
| 1275 | 3300006881 | Ga0068865_100006160 | Ga0068865_1000061606 | 447 |
| 1276 | 3300006931 | Ga0097620_100012381 | Ga0097620_1000123815 | 447 |
| 1277 | 3300007076 | Ga0075435_100005547 | Ga0075435_1000055475 | 447 |
| 1278 | 3300007076 | Ga0075435_100006632 | Ga0075435_1000066326 | 447 |
| 1279 | 3300007076 | Ga0075435_100076789 | Ga0075435_1000767893 | 447 |
| 1280 | 3300007788 | Ga0099795_10000216 | Ga0099795_100002165 | 447 |
| 1281 | 3300009093 | Ga0105240_10020880 | Ga0105240_100208803 | 447 |
| 1282 | 3300009094 | Ga0111539_10000389 | Ga0111539_1000038938 | 447 |
| 1283 | 3300009094 | Ga0111539_10004544 | Ga0111539_100045449 | 447 |
| 1284 | 3300009094 | Ga0111539_10005183 | Ga0111539_100051839 | 447 |
| 1285 | 3300009098 | Ga0105245_10004886 | Ga0105245_100048862 | 447 |
| 1286 | 3300009101 | Ga0105247_10003705 | Ga0105247_100037052 | 447 |
| 1287 | 3300009101 | Ga0105247_10040980 | Ga0105247_100409803 | 447 |
| 1288 | 3300009147 | Ga0114129_10021030 | Ga0114129_100210308 | 447 |
| 1289 | 3300009147 | Ga0114129_10046959 | Ga0114129_100469594 | 447 |
| 1290 | 3300009148 | Ga0105243_10006915 | Ga0105243_100069152 | 447 |
| 1291 | 3300009148 | Ga0105243_10016177 | Ga0105243_100161775 | 447 |
| 1292 | 3300009174 | Ga0105241_10018500 | Ga0105241_100185002 | 447 |
| 1293 | 3300009176 | Ga0105242_10005843 | Ga0105242_100058438 | 447 |
| 1294 | 3300009177 | Ga0105248_10008593 | Ga0105248_100085933 | 447 |
| 1295 | 3300009177 | Ga0105248_10030646 | Ga0105248_100306466 | 447 |
| 1296 | 3300009545 | Ga0105237_10025782 | Ga0105237_100257826 | 447 |
| 1297 | 3300009545 | Ga0105237_10031793 | Ga0105237_100317935 | 447 |
| 1298 | 3300009545 | Ga0105237_10134246 | Ga0105237_101342462 | 447 |
| 1299 | 3300009553 | Ga0105249_10094744 | Ga0105249_100947441 | 447 |
| 1300 | 3300010159 | Ga0099796_10000421 | Ga0099796_100004211 | 447 |
| 1301 | 3300010375 | Ga0105239_10058713 | Ga0105239_100587131 | 447 |
| 1302 | 3300010375 | Ga0105239_10216347 | Ga0105239_102163472 | 447 |
| 1303 | 3300011119 | Ga0105246_10017018 | Ga0105246_100170184 | 447 |
| 1304 | 3300011119 | Ga0105246_10030521 | Ga0105246_100305213 | 447 |
| 1305 | 3300013100 | Ga0157373_10150890 | Ga0157373_101508902 | 447 |
| 1306 | 3300013102 | Ga0157371_10023732 | Ga0157371_100237322 | 447 |
| 1307 | 3300013296 | Ga0157374_10010540 | Ga0157374_100105402 | 447 |
| 1308 | 3300013297 | Ga0157378_10007681 | Ga0157378_100076812 | 447 |
| 1309 | 3300013306 | Ga0163162_10039006 | Ga0163162_100390062 | 447 |
| 1310 | 3300013307 | Ga0157372_10031288 | Ga0157372_100312885 | 447 |
| 1311 | 3300013308 | Ga0157375_10037929 | Ga0157375_100379292 | 447 |
| 1312 | 3300013308 | Ga0157375_10076771 | Ga0157375_100767712 | 447 |
| 1313 | 3300013308 | Ga0157375_10431132 | Ga0157375_104311321 | 447 |
| 1314 | 3300014325 | Ga0163163_10004872 | Ga0163163_100048725 | 447 |
| 1315 | 3300014325 | Ga0163163_10009467 | Ga0163163_100094676 | 447 |
| 1316 | 3300014326 | Ga0157380_10001774 | Ga0157380_100017749 | 447 |
| 1317 | 3300014745 | Ga0157377_10003064 | Ga0157377_100030646 | 447 |
| 1318 | 3300014968 | Ga0157379_10031492 | Ga0157379_100314923 | 447 |
| 1319 | 3300014968 | Ga0157379_10058893 | Ga0157379_100588932 | 447 |
| 1320 | 3300014969 | Ga0157376_10004003 | Ga0157376_100040039 | 447 |
| 1321 | 3300017792 | Ga0163161_10003456 | Ga0163161_100034566 | 447 |
| 1322 | 3300025271 | Ga0207666_1000077 | Ga0207666_10000776 | 447 |
| 1323 | 3300025290 | Ga0207673_1000891 | Ga0207673_10008912 | 447 |
| 1324 | 3300025315 | Ga0207697_10001615 | Ga0207697_100016153 | 447 |
| 1325 | 3300025893 | Ga0207682_10000009 | Ga0207682_1000000974 | 447 |
| 1326 | 3300025893 | Ga0207682_10007879 | Ga0207682_100078793 | 447 |
| 1327 | 3300025899 | Ga0207642_10011334 | Ga0207642_100113343 | 447 |
| 1328 | 3300025900 | Ga0207710_10023791 | Ga0207710_100237912 | 447 |
| 1329 | 3300025901 | Ga0207688_10001372 | Ga0207688_100013726 | 447 |
| 1330 | 3300025901 | Ga0207688_10015227 | Ga0207688_100152273 | 447 |
| 1331 | 3300025903 | Ga0207680_10055095 | Ga0207680_100550952 | 447 |
| 1332 | 3300025904 | Ga0207647_10006480 | Ga0207647_100064806 | 447 |
| 1333 | 3300025907 | Ga0207645_10002502 | Ga0207645_100025029 | 447 |
| 1334 | 3300025908 | Ga0207643_10000292 | Ga0207643_1000029237 | 447 |
| 1335 | 3300025911 | Ga0207654_10015148 | Ga0207654_100151483 | 447 |
| 1336 | 3300025912 | Ga0207707_10002931 | Ga0207707_100029316 | 447 |
| 1337 | 3300025914 | Ga0207671_10066825 | Ga0207671_100668253 | 447 |
| 1338 | 3300025917 | Ga0207660_10000893 | Ga0207660_100008936 | 447 |
| 1339 | 3300025918 | Ga0207662_10000861 | Ga0207662_100008617 | 447 |
| 1340 | 3300025918 | Ga0207662_10064505 | Ga0207662_100645052 | 447 |
| 1341 | 3300025919 | Ga0207657_10003725 | Ga0207657_100037259 | 447 |
| 1342 | 3300025919 | Ga0207657_10036461 | Ga0207657_100364612 | 447 |
| 1343 | 3300025920 | Ga0207649_10004064 | Ga0207649_100040646 | 447 |
| 1344 | 3300025921 | Ga0207652_10002516 | Ga0207652_100025165 | 447 |
| 1345 | 3300025923 | Ga0207681_10008223 | Ga0207681_100082232 | 447 |
| 1346 | 3300025923 | Ga0207681_10014965 | Ga0207681_100149653 | 447 |
| 1347 | 3300025925 | Ga0207650_10045906 | Ga0207650_100459061 | 447 |
| 1348 | 3300025926 | Ga0207659_10001554 | Ga0207659_100015546 | 447 |
| 1349 | 3300025927 | Ga0207687_10001197 | Ga0207687_100011978 | 447 |
| 1350 | 3300025927 | Ga0207687_10006940 | Ga0207687_100069406 | 447 |
| 1351 | 3300025928 | Ga0207700_10023730 | Ga0207700_100237305 | 447 |
| 1352 | 3300025931 | Ga0207644_10001963 | Ga0207644_1000196310 | 447 |
| 1353 | 3300025931 | Ga0207644_10014948 | Ga0207644_100149483 | 447 |
| 1354 | 3300025932 | Ga0207690_10005575 | Ga0207690_100055757 | 447 |
| 1355 | 3300025933 | Ga0207706_10002827 | Ga0207706_100028279 | 447 |
| 1356 | 3300025933 | Ga0207706_10024198 | Ga0207706_100241983 | 447 |
| 1357 | 3300025933 | Ga0207706_10095387 | Ga0207706_100953872 | 447 |
| 1358 | 3300025934 | Ga0207686_10001310 | Ga0207686_100013109 | 447 |
| 1359 | 3300025934 | Ga0207686_10001988 | Ga0207686_100019888 | 447 |
| 1360 | 3300025935 | Ga0207709_10002910 | Ga0207709_100029104 | 447 |
| 1361 | 3300025935 | Ga0207709_10009749 | Ga0207709_100097494 | 447 |
| 1362 | 3300025935 | Ga0207709_10016042 | Ga0207709_100160424 | 447 |
| 1363 | 3300025936 | Ga0207670_10010411 | Ga0207670_100104115 | 447 |
| 1364 | 3300025937 | Ga0207669_10000909 | Ga0207669_100009097 | 447 |
| 1365 | 3300025938 | Ga0207704_10004639 | Ga0207704_100046396 | 447 |
| 1366 | 3300025939 | Ga0207665_10008638 | Ga0207665_100086383 | 447 |
| 1367 | 3300025940 | Ga0207691_10005519 | Ga0207691_100055199 | 447 |
| 1368 | 3300025940 | Ga0207691_10025609 | Ga0207691_100256094 | 447 |
| 1369 | 3300025941 | Ga0207711_10001144 | Ga0207711_100011445 | 447 |
| 1370 | 3300025941 | Ga0207711_10037712 | Ga0207711_100377123 | 447 |
| 1371 | 3300025942 | Ga0207689_10001448 | Ga0207689_100014486 | 447 |
| 1372 | 3300025944 | Ga0207661_10002433 | Ga0207661_100024335 | 447 |
| 1373 | 3300025945 | Ga0207679_10003604 | Ga0207679_100036042 | 447 |
| 1374 | 3300025945 | Ga0207679_10075413 | Ga0207679_100754132 | 447 |
| 1375 | 3300025960 | Ga0207651_10047471 | Ga0207651_100474713 | 447 |
| 1376 | 3300025961 | Ga0207712_10003650 | Ga0207712_100036506 | 447 |
| 1377 | 3300025972 | Ga0207668_10001981 | Ga0207668_100019819 | 447 |
| 1378 | 3300025981 | Ga0207640_10003763 | Ga0207640_100037636 | 447 |
| 1379 | 3300025986 | Ga0207658_10031138 | Ga0207658_100311383 | 447 |
| 1380 | 3300026035 | Ga0207703_10017302 | Ga0207703_100173024 | 447 |
| 1381 | 3300026035 | Ga0207703_10023676 | Ga0207703_100236765 | 447 |
| 1382 | 3300026035 | Ga0207703_10031824 | Ga0207703_100318242 | 447 |
| 1383 | 3300026041 | Ga0207639_10040853 | Ga0207639_100408532 | 447 |
| 1384 | 3300026041 | Ga0207639_10051630 | Ga0207639_100516303 | 447 |
| 1385 | 3300026067 | Ga0207678_10002714 | Ga0207678_100027146 | 447 |
| 1386 | 3300026067 | Ga0207678_10006709 | Ga0207678_100067094 | 447 |
| 1387 | 3300026075 | Ga0207708_10003108 | Ga0207708_100031089 | 447 |
| 1388 | 3300026088 | Ga0207641_10009054 | Ga0207641_100090544 | 447 |
| 1389 | 3300026089 | Ga0207648_10003666 | Ga0207648_100036669 | 447 |
| 1390 | 3300026095 | Ga0207676_10010622 | Ga0207676_100106224 | 447 |
| 1391 | 3300026095 | Ga0207676_10016879 | Ga0207676_100168791 | 447 |
| 1392 | 3300026116 | Ga0207674_10024031 | Ga0207674_100240312 | 447 |
| 1393 | 3300026118 | Ga0207675_100005413 | Ga0207675_1000054133 | 447 |
| 1394 | 3300026118 | Ga0207675_100039892 | Ga0207675_1000398924 | 447 |
| 1395 | 3300026121 | Ga0207683_10000782 | Ga0207683_1000078213 | 447 |
| 1396 | 3300026121 | Ga0207683_10001222 | Ga0207683_100012226 | 447 |
| 1397 | 3300026142 | Ga0207698_10045774 | Ga0207698_100457743 | 447 |
| 1398 | 3300027617 | Ga0210002_1003574 | Ga0210002_10035741 | 447 |
| 1399 | 3300027717 | Ga0209998_10001207 | Ga0209998_100012075 | 447 |
| 1400 | 3300027876 | Ga0209974_10001210 | Ga0209974_100012105 | 447 |
| 1401 | 3300027876 | Ga0209974_10020357 | Ga0209974_100203572 | 447 |
| 1402 | 3300027907 | Ga0207428_10000164 | Ga0207428_1000016437 | 447 |
| 1403 | 3300027907 | Ga0207428_10000391 | Ga0207428_1000039138 | 447 |
| 1404 | 3300027907 | Ga0207428_10002684 | Ga0207428_100026847 | 447 |
| 1405 | 3300028379 | Ga0268266_10005300 | Ga0268266_1000530010 | 447 |
| 1406 | 3300028381 | Ga0268264_10007183 | Ga0268264_100071836 | 447 |
| 1407 | 3300028381 | Ga0268264_10124929 | Ga0268264_101249291 | 447 |
| 1408 | 3300028794 | Ga0307515_10008473 | Ga0307515_1000847315 | 447 |
| 1409 | 3300031250 | Ga0265331_10025683 | Ga0265331_100256832 | 447 |
| 1410 | 3300031344 | Ga0265316_10109432 | Ga0265316_101094322 | 447 |
| 1411 | 3300031711 | Ga0265314_10127697 | Ga0265314_101276971 | 447 |
| 1412 | 3300034818 | Ga0373950_0000340 | Ga0373950_0000340_2439_3824 | 447 |
| 1413 | 3300034819 | Ga0373958_0000223 | Ga0373958_0000223_4617_6002 | 447 |
| 1414 | 3300034820 | Ga0373959_0000418 | Ga0373959_0000418_2550_3935 | 447 |
| 1415 | 3300034957 | Ga0373938_0000580 | Ga0373938_0000580_2778_4163 | 447 |
| 1416 | 3300035084 | Ga0373928_0000151 | Ga0373928_0000151_3175_4560 | 447 |
| 1417 | 3300035085 | Ga0373929_0001036 | Ga0373929_0001036_433_1818 | 447 |
| 1418 | 3300035088 | Ga0373940_0003150 | Ga0373940_0003150_258_1643 | 447 |
| 1419 | 3300035090 | Ga0373949_0001703 | Ga0373949_0001703_689_2074 | 447 |
| 1420 | 3300035091 | Ga0373951_0000232 | Ga0373951_0000232_5618_7003 | 447 |
| 1421 | 3300035092 | Ga0373952_0000567 | Ga0373952_0000567_26_1411 | 447 |
| 1422 | 3300035111 | Ga0373923_0000595 | Ga0373923_0000595_5646_7034 | 447 |
| 1423 | 3300035112 | Ga0373932_0000366 | Ga0373932_0000366_1572_2957 | 447 |
| 1424 | 3300035113 | Ga0373936_0028657 | Ga0373936_0028657_45_1433 | 447 |
| 1425 | 3300035114 | Ga0373939_0000753 | Ga0373939_0000753_4610_5995 | 447 |
| 1426 | 3300035114 | Ga0373939_0006530 | Ga0373939_0006530_1018_2403 | 447 |
| 1427 | 3300035115 | Ga0373941_0001679 | Ga0373941_0001679_2493_3878 | 447 |
| 1428 | 3300035117 | Ga0373953_0005683 | Ga0373953_0005683_2203_3591 | 447 |
| 1429 | 3300035118 | Ga0373954_0000951 | Ga0373954_0000951_1219_2607 | 447 |
| 1430 | 3300035170 | Ga0373943_0066244 | Ga0373943_0066244_359_1747 | 447 |
| 1431 | 3300035171 | Ga0373946_0018323 | Ga0373946_0018323_584_1972 | 447 |
| 1432 | 3300035172 | Ga0373955_0030797 | Ga0373955_0030797_1192_2580 | 447 |
| 1433 | 3300035207 | Ga0373942_0000780 | Ga0373942_0000780_7228_8613 | 447 |
| 1434 | 3300035241 | Ga0373961_0004799 | Ga0373961_0004799_1723_3111 | 447 |
| 1435 | 3300035242 | Ga0373962_0001878 | Ga0373962_0001878_3515_4900 | 447 |
| 1436 | 3300035410 | Ga0373924_0030057 | Ga0373924_0030057_31_1419 | 447 |
| 1437 | 3300035691 | Ga0373931_0010679 | Ga0373931_0010679_2130_3515 | 447 |
| 1438 | 3300035691 | Ga0373931_0010912 | Ga0373931_0010912_699_2084 | 447 |
| 1439 | 3300035691 | Ga0373931_0113141 | Ga0373931_0113141_69_1457 | 447 |
| 1440 | 3300035692 | Ga0373935_0019417 | Ga0373935_0019417_1831_3219 | 447 |
| 1441 | 3300035695 | Ga0373927_0014279 | Ga0373927_0014279_2361_3749 | 447 |
| 1442 | 3300035724 | Ga0373933_0002546 | Ga0373933_0002546_3181_4569 | 447 |
| 1443 | 3300035725 | Ga0373947_0040432 | Ga0373947_0040432_451_1839 | 447 |
| 1444 | 3300035725 | Ga0373947_0063903 | Ga0373947_0063903_537_1925 | 447 |
| 1445 | 3300036401 | Ga0373937_0116753 | Ga0373937_0116753_295_1683 | 447 |
| 1446 | 3300037068 | Ga0373925_0007900 | Ga0373925_0007900_1662_3050 | 447 |
| 1447 | 3300042436 | Ga0439435_0001852 | Ga0439435_0001852_2554_3951 | 447 |
| 1448 | 3300045051 | Ga0451576_0017298 | Ga0451576_0017298_4055_5440 | 447 |
| 1449 | 3300046454 | Ga0495592_0006322 | Ga0495592_0006322_2310_3698 | 447 |
| 1450 | 3300046455 | Ga0495603_0021588 | Ga0495603_0021588_410_1798 | 447 |
| 1451 | 3300046455 | Ga0495603_0033822 | Ga0495603_0033822_1281_2669 | 447 |
| 1452 | 3300046459 | Ga0495629_0000139 | Ga0495629_0000139_24012_25400 | 447 |
| 1453 | 3300046460 | Ga0495638_0054119 | Ga0495638_0054119_547_1941 | 447 |
| 1454 | 3300046461 | Ga0495641_0007101 | Ga0495641_0007101_5682_7070 | 447 |
| 1455 | 3300046461 | Ga0495641_0011896 | Ga0495641_0011896_3416_4804 | 447 |
| 1456 | 3300046463 | Ga0495653_0001537 | Ga0495653_0001537_8329_9717 | 447 |
| 1457 | 3300046472 | Ga0495580_0034637 | Ga0495580_0034637_1027_2415 | 447 |
| 1458 | 3300046477 | Ga0495664_0000915 | Ga0495664_0000915_8555_9943 | 447 |
| 1459 | 3300046477 | Ga0495664_0009369 | Ga0495664_0009369_3790_5178 | 447 |
| 1460 | 3300046491 | Ga0495584_0001897 | Ga0495584_0001897_105_1493 | 447 |
| 1461 | 3300046492 | Ga0495585_0094128 | Ga0495585_0094128_103_1491 | 447 |
| 1462 | 3300046499 | Ga0495594_0020533 | Ga0495594_0020533_335_1723 | 447 |
| 1463 | 3300046501 | Ga0495607_0006400 | Ga0495607_0006400_12_1400 | 447 |
| 1464 | 3300046511 | Ga0495608_0042381 | Ga0495608_0042381_437_1825 | 447 |
| 1465 | 3300046514 | Ga0495618_0061547 | Ga0495618_0061547_136_1524 | 447 |
| 1466 | 3300046517 | Ga0495630_0018196 | Ga0495630_0018196_3278_4666 | 447 |
| 1467 | 3300046520 | Ga0495637_0015591 | Ga0495637_0015591_1450_2838 | 447 |
| 1468 | 3300046529 | Ga0495652_0017901 | Ga0495652_0017901_4563_5951 | 447 |
| 1469 | 3300046529 | Ga0495652_0040925 | Ga0495652_0040925_76_1464 | 447 |
| 1470 | 3300046531 | Ga0495665_0002145 | Ga0495665_0002145_6246_7634 | 447 |
| 1471 | 3300046533 | Ga0495640_0017266 | Ga0495640_0017266_1216_2604 | 447 |
| 1472 | 3300046533 | Ga0495640_0094870 | Ga0495640_0094870_209_1597 | 447 |
| 1473 | 3300046536 | Ga0495587_0017630 | Ga0495587_0017630_3005_4393 | 447 |
| 1474 | 3300046543 | Ga0495645_0087492 | Ga0495645_0087492_370_1758 | 447 |
| 1475 | 3300046558 | Ga0495633_0002146 | Ga0495633_0002146_6342_7730 | 447 |
| 1476 | 3300046559 | Ga0495667_0037964 | Ga0495667_0037964_321_1709 | 447 |
| 1477 | 3300046615 | Ga0495656_0000091 | Ga0495656_0000091_12812_14200 | 447 |
| 1478 | 3300046663 | Ga0495635_0005923 | Ga0495635_0005923_2879_4267 | 447 |
| 1479 | 3300046664 | Ga0495659_0003716 | Ga0495659_0003716_200_1588 | 447 |
| 1480 | 3300046674 | Ga0495588_0007030 | Ga0495588_0007030_61_1449 | 447 |
| 1481 | 3300046678 | Ga0495599_0035992 | Ga0495599_0035992_386_1774 | 447 |
| 1482 | 3300046680 | Ga0495646_0002199 | Ga0495646_0002199_5386_6774 | 447 |
| 1483 | 3300046683 | Ga0495658_0000065 | Ga0495658_0000065_14040_15428 | 447 |
| 1484 | 3300046683 | Ga0495658_0062648 | Ga0495658_0062648_655_2043 | 447 |
| 1485 | 3300046684 | Ga0495669_0035333 | Ga0495669_0035333_24_1409 | 447 |
| 1486 | 3300046689 | Ga0495613_0002672 | Ga0495613_0002672_493_1881 | 447 |
| 1487 | 3300046690 | Ga0495624_0001939 | Ga0495624_0001939_8252_9640 | 447 |
| 1488 | 3300046690 | Ga0495624_0049899 | Ga0495624_0049899_1182_2570 | 447 |
| 1489 | 3300046691 | Ga0495670_0000199 | Ga0495670_0000199_16019_17407 | 447 |
| 1490 | 3300046794 | Ga0495589_0061358 | Ga0495589_0061358_106_1494 | 447 |
| 1491 | 3300046809 | Ga0495600_0005269 | Ga0495600_0005269_209_1597 | 447 |
| 1492 | 3300046809 | Ga0495600_0076891 | Ga0495600_0076891_446_1834 | 447 |
| 1493 | 3300047315 | Ga0495581_0009905 | Ga0495581_0009905_3970_5358 | 447 |
| 1494 | 3300047319 | Ga0495674_0073683 | Ga0495674_0073683_1500_2888 | 447 |
| 1495 | 3300047322 | Ga0495680_0016879 | Ga0495680_0016879_449_1837 | 447 |
| 1496 | 3300047471 | Ga0495684_0001073 | Ga0495684_0001073_2518_3906 | 447 |
| 1497 | 3300047673 | Ga0495593_0002018 | Ga0495593_0002018_1814_3202 | 447 |
| 1498 | 3300048088 | Ga0495602_0117562 | Ga0495602_0117562_658_2046 | 447 |
| 1499 | 3300048903 | Ga0496100_0001531 | Ga0496100_0001531_5563_6948 | 447 |
| 1500 | 3300048904 | Ga0496101_0002275 | Ga0496101_0002275_9645_11030 | 447 |
| 1501 | 3300048904 | Ga0496101_0015686 | Ga0496101_0015686_2590_3978 | 447 |
| 1502 | 3300048905 | Ga0496102_0004237 | Ga0496102_0004237_521_1906 | 447 |
| 1503 | 3300048905 | Ga0496102_0009466 | Ga0496102_0009466_71_1459 | 447 |
| 1504 | 3300048905 | Ga0496102_0072006 | Ga0496102_0072006_883_2268 | 447 |
| 1505 | 3300048906 | Ga0496103_0032074 | Ga0496103_0032074_22_1407 | 447 |
| 1506 | 3300048907 | Ga0496104_0115067 | Ga0496104_0115067_1130_2518 | 447 |
| 1507 | 3300048909 | Ga0496106_0015208 | Ga0496106_0015208_1845_3233 | 447 |
| 1508 | 3300048910 | Ga0496107_0005227 | Ga0496107_0005227_198_1583 | 447 |
| 1509 | 3300048911 | Ga0496108_0057939 | Ga0496108_0057939_1857_3242 | 447 |
| 1510 | 3300048911 | Ga0496108_0059583 | Ga0496108_0059583_1278_2663 | 447 |
| 1511 | 3300048912 | Ga0496109_0008633 | Ga0496109_0008633_5440_6825 | 447 |
| 1512 | 3300048912 | Ga0496109_0083342 | Ga0496109_0083342_1157_2545 | 447 |
| 1513 | 3300048913 | Ga0496110_0073614 | Ga0496110_0073614_1061_2449 | 447 |
| 1514 | 3300048914 | Ga0496111_0009563 | Ga0496111_0009563_1523_2908 | 447 |
| 1515 | 3300048916 | Ga0496113_0012280 | Ga0496113_0012280_2956_4341 | 447 |
| 1516 | 3300048917 | Ga0496114_0127904 | Ga0496114_0127904_733_2121 | 447 |
| 1517 | 3300048918 | Ga0496115_0013022 | Ga0496115_0013022_3864_5252 | 447 |
| 1518 | 3300048918 | Ga0496115_0027835 | Ga0496115_0027835_2246_3631 | 447 |
| 1519 | 3300048924 | Ga0496121_0003460 | Ga0496121_0003460_374_1762 | 447 |
| 1520 | 3300050493 | nmdc:mga0k408_48540_c1 | nmdc:mga0k408_48540_c1_561_2078 | 447 |
| 1521 | 3300050494 | nmdc:mga06z11_72698_c1 | nmdc:mga06z11_72698_c1_36_1553 | 447 |
| 1522 | 3300050496 | nmdc:mga07m45_13314_c1 | nmdc:mga07m45_13314_c1_506_2023 | 447 |
| 1523 | 3300050507 | nmdc:mga05p37_151_c1 | nmdc:mga05p37_151_c1_44822_46210 | 447 |
| 1524 | 3300050507 | nmdc:mga05p37_9089_c1 | nmdc:mga05p37_9089_c1_3081_4469 | 447 |
| 1525 | 3300050508 | nmdc:mga09592_1771_c1 | nmdc:mga09592_1771_c1_9948_11336 | 447 |
| 1526 | 3300050509 | nmdc:mga0qj67_3588_c1 | nmdc:mga0qj67_3588_c1_1749_3137 | 447 |
| 1527 | 3300050511 | nmdc:mga08y16_108_c1 | nmdc:mga08y16_108_c1_62216_63601 | 447 |
| 1528 | 3300050511 | nmdc:mga08y16_193529_c1 | nmdc:mga08y16_193529_c1_23_1411 | 447 |
| 1529 | 3300050512 | nmdc:mga0n895_244857_c1 | nmdc:mga0n895_244857_c1_77_1465 | 447 |
| 1530 | 3300050512 | nmdc:mga0n895_265_c1 | nmdc:mga0n895_265_c1_10837_12225 | 447 |
| 1531 | 3300050512 | nmdc:mga0n895_404_c1 | nmdc:mga0n895_404_c1_20626_22011 | 447 |
| 1532 | 3300050513 | nmdc:mga0rr50_10550_c1 | nmdc:mga0rr50_10550_c1_3784_5172 | 447 |
| 1533 | 3300050513 | nmdc:mga0rr50_173038_c1 | nmdc:mga0rr50_173038_c1_196_1584 | 447 |
| 1534 | 3300050513 | nmdc:mga0rr50_65104_c1 | nmdc:mga0rr50_65104_c1_202_1587 | 447 |
| 1535 | 3300050515 | nmdc:mga0a205_146_c1 | nmdc:mga0a205_146_c1_31308_32696 | 447 |
| 1536 | 3300050515 | nmdc:mga0a205_78738_c1 | nmdc:mga0a205_78738_c1_116_1501 | 447 |
| 1537 | 3300053077 | Ga0495601_0002986 | Ga0495601_0002986_2833_4221 | 447 |
| 1538 | 3300053078 | Ga0495612_0006837 | Ga0495612_0006837_593_1981 | 447 |
| 1539 | 3300053078 | Ga0495612_0018845 | Ga0495612_0018845_209_1597 | 447 |
| 1540 | 3300053084 | Ga0495595_0008608 | Ga0495595_0008608_484_1872 | 447 |
| 1541 | 3300053085 | Ga0495619_0001255 | Ga0495619_0001255_4498_5886 | 447 |
| 1542 | 3300053085 | Ga0495619_0006396 | Ga0495619_0006396_3254_4642 | 447 |
| 1543 | 3300053085 | Ga0495619_0047709 | Ga0495619_0047709_209_1597 | 447 |
| 1544 | 3300053093 | Ga0500651_0019640 | Ga0500651_0019640_1934_3322 | 447 |
| 1545 | 3300053130 | Ga0500642_0023818 | Ga0500642_0023818_74_1462 | 447 |
| 1546 | 3300053153 | Ga0500616_0068270 | Ga0500616_0068270_356_1753 | 447 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g29-assembly1.cif.gz_A | crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 | 0.9628 | 87 | 443 |
| 2i49-assembly1.cif.gz_A | crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 | 0.9276 | 90 | 446 |
| 2g29-assembly1.cif.gz_A | crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 | 0.8922 | 87 | 443 |
| 3un6-assembly1.cif.gz_A | 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound | 0.8883 | 91 | 406 |
| 3un6-assembly1.cif.gz_A | 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound | 0.8768 | 91 | 406 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2g29A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9245 | 176 | 273 | 3.40.190.10 |
| 2g29A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8803 | 87 | 426 | 3.40.190.10 |
| 2g29A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8737 | 87 | 426 | 3.40.190.10 |
| 3qslB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8691 | 178 | 268 | 3.40.190.10 |
| 3ksxA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8661 | 175 | 271 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W5IAF3-F1-model_v4 | deleted | 0.9868 | 148 | 446 |
|
| AF-A0A352IQL9-F1-model_v4 | Nitrate ABC transporter substrate-binding protein | 0.9852 | 120 | 446 |
GO:0005886
GO:0012505 |
| AF-A0A149VCP2-F1-model_v4 | Nitrate ABC transporter substrate-binding protein | 0.9849 | 84 | 432 |
GO:0005886
GO:0012505 |
| AF-A0A352IQL9-F1-model_v4 | Nitrate ABC transporter substrate-binding protein | 0.9822 | 120 | 446 |
GO:0005886
GO:0012505 |
| AF-A0A2W5IAF3-F1-model_v4 | deleted | 0.9803 | 148 | 446 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar