F494622

General Info

Members Datasets Scaffolds Average Seq Length
1534 507 1524 169

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100033753|Ga0075430_1000337533
Length 187
Sequence MAQSSQKFIARNRAPRVQIEYDVELYGAEKKIQLPFVMGVLSDLSGKPSEPLPPVADRKFLDIDVDNFDSRLNAIKPRAAFQVPNTLTGEGNISVDITFESMDDFSPAAVARKVDALSKLLQARQQLSNLVTYMDGKTGAEELIAKVLQDPTLLQALAASRKQPADEAGKSGAASGLIGSTGGESNG

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221585 Pelomonas sp. Root662 Isolate Unclassified
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221656 Pelomonas sp. Root405 Isolate Unclassified
9 2831864461 Roseateles noduli HZ7 Isolate Nodule
10 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300002863 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
29 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
32 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
71 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
72 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
80 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
81 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
86 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
91 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
92 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
95 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
96 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
97 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
98 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
99 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
100 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
105 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
106 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
107 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
112 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
113 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
114 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
115 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
116 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
117 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
118 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
119 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
120 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
121 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
129 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
136 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
152 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
153 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
154 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
155 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
156 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
157 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
158 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
159 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
160 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
161 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
162 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
163 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
164 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
165 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
166 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
167 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
168 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
169 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
170 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
171 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
172 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
175 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
177 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
178 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
180 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
182 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
251 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
255 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
257 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
261 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
262 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
263 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
264 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
265 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
266 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
267 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
268 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
269 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
270 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
271 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
272 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
273 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
274 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
275 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
276 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
277 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
278 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
279 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
280 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
281 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
282 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
283 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
284 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
285 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
286 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
287 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
288 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
289 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
290 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
291 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
292 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
293 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
294 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
295 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
296 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
297 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
298 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
299 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
300 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
301 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
303 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
304 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
305 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
306 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
307 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
308 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
309 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
310 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
311 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
312 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
313 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
314 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
315 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
316 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
317 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
318 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
319 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
320 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
321 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
322 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
323 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
324 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
325 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
326 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
327 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
328 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
329 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
330 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
331 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
332 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
333 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
334 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
335 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
336 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
337 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
338 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
339 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
340 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
341 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
342 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
343 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
344 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
345 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
346 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
347 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
348 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
349 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
350 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
351 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
352 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
353 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
354 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
355 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
356 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
357 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
358 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
359 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
360 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
361 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
362 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
363 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
364 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
365 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
366 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
367 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
368 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
369 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
370 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
371 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
372 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
373 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
374 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
375 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
376 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
377 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
378 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
379 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
380 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
381 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
382 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
383 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
384 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
385 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
386 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
387 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
388 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
389 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
390 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
391 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
392 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
393 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
394 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
395 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
396 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
397 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
398 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
399 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
400 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
401 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
402 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
403 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
404 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
405 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
406 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
407 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
408 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
409 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
410 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
411 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
412 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
413 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
414 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
415 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
416 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
417 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
418 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
419 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
420 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
421 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
422 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
423 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
424 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
425 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
427 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
428 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
446 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
449 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
450 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
451 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
452 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
453 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
454 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
455 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
456 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
457 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
458 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
459 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
462 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
463 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
464 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
465 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
466 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
467 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
468 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
469 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
470 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
471 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
472 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
473 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
474 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
475 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
476 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
477 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
478 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
479 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
480 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
481 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
482 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
483 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
484 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
485 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
486 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
487 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
488 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
489 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
490 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
491 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
492 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
493 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
494 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
495 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
496 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
497 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
498 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
499 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
506 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
507 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.26
Metatranscriptomes 2.09
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6
Nodule 0.2
Rhizoplane 3.52
Rhizosphere 87.42
Stem 0
Stem Tuber 0
Unclassified 2.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001929 3300001977 Bacteria 3304
2 JGI24749J21850_1011539 3300002076 Bacteria 1240
3 JGI25152J39213_1002469 3300002773 Bacteria 7006
4 JGI25150J39212_1002495 3300002774 Bacteria 4557
5 Ga0006769J43182_105455 3300002863 Bacteria 703
6 Ga0006759J45824_1045780 3300003163 Bacteria 2755
7 Ga0006759J45824_1072990 3300003163 Bacteria 1144
8 Ga0006758J48902_1019290 3300003300 Bacteria 2817
9 rootH2_10014253 3300003320 Bacteria 3206
10 rootL2_10000217 3300003322 Bacteria 81342
11 rootL2_10230854 3300003322 Bacteria 1506
12 rootH1_10024429 3300003323 Bacteria 14705
13 rootH1_10027290 3300003323 Bacteria 2933
14 rootH1_10100721 3300003323 Bacteria 4557
15 rootH1_10140328 3300003323 Bacteria 3125
16 rootH1_10187746 3300003323 Bacteria 1650
17 rootH1_10327373 3300003323 Bacteria 1092
18 Ga0032354_1103123 3300003693 Bacteria 1113
19 Ga0055526_1006791 3300003771 Bacteria 6110
20 Ga0055526_1009196 3300003771 Bacteria 4798
21 Ga0055524_1059963 3300003775 Bacteria 795
22 Ga0055524_1064591 3300003775 Bacteria 738
23 Ga0055528_1035370 3300003790 Bacteria 1213
24 Ga0055530_10022225 3300003791 Bacteria 1850
25 Ga0055530_10034985 3300003791 Bacteria 1278
26 Ga0055531_10000046 3300003794 Bacteria 131979
27 Ga0055531_10013234 3300003794 Bacteria 3820
28 Ga0055531_10077552 3300003794 Bacteria 743
29 Ga0055543_1005759 3300004625 Bacteria 3113
30 Ga0058859_10032251 3300004798 Bacteria 1445
31 Ga0058859_10042077 3300004798 Bacteria 2530
32 Ga0058863_11261535 3300004799 Bacteria 674
33 Ga0058863_11632863 3300004799 Bacteria 1121
34 Ga0058863_11749444 3300004799 Bacteria 1386
35 Ga0058861_11693974 3300004800 Bacteria 1099
36 Ga0058861_11949201 3300004800 Bacteria 914
37 Ga0058860_11980627 3300004801 Bacteria 641
38 Ga0058860_12064838 3300004801 Bacteria 1068
39 Ga0058862_10264210 3300004803 Bacteria 604
40 Ga0058862_12658881 3300004803 Bacteria 1199
41 Ga0058862_12842042 3300004803 Bacteria 1720
42 Ga0058862_12851436 3300004803 Bacteria 1252
43 Ga0065165_1000270 3300005262 Bacteria 88828
44 Ga0065165_1001444 3300005262 Bacteria 25757
45 Ga0065165_1005243 3300005262 Bacteria 7423
46 Ga0065712_10106449 3300005290 Bacteria 1916
47 Ga0065712_10119547 3300005290 Bacteria 1649
48 Ga0065712_10142199 3300005290 Bacteria 1440
49 Ga0065715_10001432 3300005293 Bacteria 7417
50 Ga0065715_10136709 3300005293 Bacteria 1918
51 Ga0065715_10146303 3300005293 Bacteria 1784
52 Ga0065715_10442703 3300005293 Bacteria 832
53 Ga0065715_10517656 3300005293 Bacteria 766
54 Ga0065715_10670466 3300005293 Bacteria 668
55 Ga0065707_10180121 3300005295 Bacteria 1424
56 Ga0065707_10228330 3300005295 Bacteria 1198
57 Ga0065707_10362273 3300005295 Bacteria 902
58 Ga0070658_10001039 3300005327 Bacteria 23763
59 Ga0070658_10267781 3300005327 Bacteria 1452
60 Ga0070676_10002677 3300005328 Bacteria 9173
61 Ga0070676_10006667 3300005328 Bacteria 6183
62 Ga0070676_10053417 3300005328 Bacteria 2380
63 Ga0070676_10103781 3300005328 Bacteria 1760
64 Ga0070676_10235629 3300005328 Bacteria 1215
65 Ga0070676_10833974 3300005328 Bacteria 682
66 Ga0070676_10835388 3300005328 Bacteria 682
67 Ga0070683_100038354 3300005329 Bacteria 4392
68 Ga0070683_100075018 3300005329 Bacteria 3159
69 Ga0070690_100008599 3300005330 Bacteria 5885
70 Ga0070670_100005770 3300005331 Bacteria 10460
71 Ga0070670_100190908 3300005331 Bacteria 1779
72 Ga0070670_100275685 3300005331 Bacteria 1468
73 Ga0070670_100296990 3300005331 Bacteria 1412
74 Ga0070670_100343986 3300005331 Bacteria 1309
75 Ga0070670_100357084 3300005331 Bacteria 1284
76 Ga0070677_10015886 3300005333 Bacteria 2672
77 Ga0070677_10016256 3300005333 Bacteria 2647
78 Ga0070677_10094180 3300005333 Bacteria 1308
79 Ga0070677_10194824 3300005333 Bacteria 974
80 Ga0068869_100001262 3300005334 Bacteria 14954
81 Ga0068869_100001927 3300005334 Bacteria 12452
82 Ga0068869_100075664 3300005334 Bacteria 2502
83 Ga0068869_100118432 3300005334 Bacteria 2022
84 Ga0068869_100947937 3300005334 Bacteria 747
85 Ga0070666_10005360 3300005335 Bacteria 7862
86 Ga0070666_10128460 3300005335 Bacteria 1760
87 Ga0070666_10183340 3300005335 Bacteria 1469
88 Ga0070666_10284014 3300005335 Bacteria 1177
89 Ga0070680_100129399 3300005336 Bacteria 2111
90 Ga0070680_100249623 3300005336 Bacteria 1500
91 Ga0070680_100860914 3300005336 Bacteria 781
92 Ga0070682_100005605 3300005337 Bacteria 6999
93 Ga0070682_100033327 3300005337 Bacteria 3129
94 Ga0070682_100173739 3300005337 Bacteria 1499
95 Ga0070682_100330385 3300005337 Bacteria 1130
96 Ga0070682_100680256 3300005337 Bacteria 823
97 Ga0070682_100702651 3300005337 Bacteria 811
98 Ga0070682_101249269 3300005337 Bacteria 629
99 Ga0068868_100002893 3300005338 Bacteria 11915
100 Ga0068868_100033936 3300005338 Bacteria 3936
101 Ga0068868_100067294 3300005338 Bacteria 2851
102 Ga0068868_100223968 3300005338 Bacteria 1575
103 Ga0068868_100270232 3300005338 Bacteria 1436
104 Ga0068868_100272402 3300005338 Bacteria 1430
105 Ga0068868_100381745 3300005338 Bacteria 1212
106 Ga0068868_100462883 3300005338 Bacteria 1105
107 Ga0068868_100469319 3300005338 Bacteria 1097
108 Ga0070660_100024909 3300005339 Bacteria 4443
109 Ga0070660_100736877 3300005339 Bacteria 827
110 Ga0070689_100000124 3300005340 Bacteria 44440
111 Ga0070689_100095726 3300005340 Bacteria 2345
112 Ga0070689_100228176 3300005340 Bacteria 1530
113 Ga0070689_100297827 3300005340 Bacteria 1342
114 Ga0070689_100444572 3300005340 Bacteria 1102
115 Ga0070689_100659399 3300005340 Bacteria 911
116 Ga0070691_10039867 3300005341 Bacteria 2219
117 Ga0070687_100010152 3300005343 Bacteria 4059
118 Ga0070661_100085617 3300005344 Bacteria 2329
119 Ga0070661_100151182 3300005344 Bacteria 1755
120 Ga0070661_100179203 3300005344 Bacteria 1611
121 Ga0070661_100213011 3300005344 Bacteria 1479
122 Ga0070661_100309146 3300005344 Bacteria 1232
123 Ga0070692_10074221 3300005345 Bacteria 1819
124 Ga0070692_10191225 3300005345 Bacteria 1193
125 Ga0070692_10204187 3300005345 Bacteria 1159
126 Ga0070692_10418570 3300005345 Bacteria 850
127 Ga0070668_100013174 3300005347 Bacteria 6165
128 Ga0070668_100061190 3300005347 Bacteria 2916
129 Ga0070668_100233825 3300005347 Bacteria 1520
130 Ga0070668_100413295 3300005347 Bacteria 1154
131 Ga0070668_100871045 3300005347 Bacteria 804
132 Ga0070669_100006423 3300005353 Bacteria 8460
133 Ga0070669_100042870 3300005353 Bacteria 3294
134 Ga0070669_100076885 3300005353 Bacteria 2479
135 Ga0070669_100087606 3300005353 Bacteria 2328
136 Ga0070669_100155294 3300005353 Bacteria 1774
137 Ga0070675_100004679 3300005354 Bacteria 10447
138 Ga0070675_100011787 3300005354 Bacteria 6849
139 Ga0070675_100033284 3300005354 Bacteria 4178
140 Ga0070675_100036005 3300005354 Bacteria 4025
141 Ga0070675_100108789 3300005354 Bacteria 2341
142 Ga0070675_100473115 3300005354 Bacteria 1126
143 Ga0070675_100894654 3300005354 Bacteria 813
144 Ga0070671_100002535 3300005355 Bacteria 14144
145 Ga0070671_100024944 3300005355 Bacteria 4899
146 Ga0070671_100040867 3300005355 Bacteria 3853
147 Ga0070671_100057191 3300005355 Bacteria 3245
148 Ga0070671_100305905 3300005355 Bacteria 1354
149 Ga0070671_100311697 3300005355 Bacteria 1340
150 Ga0070671_100320872 3300005355 Bacteria 1320
151 Ga0070671_101165963 3300005355 Bacteria 678
152 Ga0070674_100009232 3300005356 Bacteria 5901
153 Ga0070674_100047614 3300005356 Bacteria 2939
154 Ga0070674_100268238 3300005356 Bacteria 1348
155 Ga0070674_100395469 3300005356 Bacteria 1128
156 Ga0070674_100449268 3300005356 Bacteria 1063
157 Ga0070674_100835992 3300005356 Bacteria 797
158 Ga0070673_100011253 3300005364 Bacteria 6101
159 Ga0070673_100076273 3300005364 Bacteria 2707
160 Ga0070673_100279743 3300005364 Bacteria 1463
161 Ga0070673_100309106 3300005364 Bacteria 1394
162 Ga0070673_100401747 3300005364 Bacteria 1225
163 Ga0070673_100545591 3300005364 Bacteria 1053
164 Ga0070673_100756462 3300005364 Bacteria 895
165 Ga0070688_100002131 3300005365 Bacteria 9972
166 Ga0070688_100025432 3300005365 Bacteria 3505
167 Ga0070688_100281975 3300005365 Bacteria 1194
168 Ga0070659_100108399 3300005366 Bacteria 2240
169 Ga0070659_100136306 3300005366 Bacteria 1996
170 Ga0070659_100247288 3300005366 Bacteria 1477
171 Ga0070659_100253857 3300005366 Bacteria 1458
172 Ga0070667_100000246 3300005367 Bacteria 61391
173 Ga0070667_100157333 3300005367 Bacteria 1999
174 Ga0070667_100230465 3300005367 Bacteria 1651
175 Ga0070667_100230563 3300005367 Bacteria 1651
176 Ga0070667_101091334 3300005367 Bacteria 746
177 Ga0070703_10016210 3300005406 Bacteria 2137
178 Ga0070703_10100402 3300005406 Bacteria 1019
179 Ga0070703_10463823 3300005406 Bacteria 563
180 Ga0070709_10788273 3300005434 Bacteria 745
181 Ga0070709_11359064 3300005434 Bacteria 574
182 Ga0070714_100175529 3300005435 Bacteria 1947
183 Ga0070713_100003837 3300005436 Bacteria 9959
184 Ga0070713_100061145 3300005436 Bacteria 3151
185 Ga0070710_10024681 3300005437 Bacteria 3175
186 Ga0070701_10003359 3300005438 Bacteria 6319
187 Ga0070701_10004317 3300005438 Bacteria 5738
188 Ga0070701_10027722 3300005438 Bacteria 2778
189 Ga0070701_10084269 3300005438 Bacteria 1728
190 Ga0070711_100735459 3300005439 Bacteria 833
191 Ga0070705_100000098 3300005440 Bacteria 48972
192 Ga0070705_100035940 3300005440 Bacteria 2781
193 Ga0070705_100052386 3300005440 Bacteria 2384
194 Ga0070705_100218420 3300005440 Bacteria 1318
195 Ga0070705_100394483 3300005440 Bacteria 1023
196 Ga0070705_100545204 3300005440 Bacteria 888
197 Ga0070705_100873731 3300005440 Bacteria 721
198 Ga0070700_100016207 3300005441 Bacteria 4243
199 Ga0070700_100079483 3300005441 Bacteria 2114
200 Ga0070700_100196787 3300005441 Bacteria 1413
201 Ga0070700_100213705 3300005441 Bacteria 1362
202 Ga0070694_100034641 3300005444 Bacteria 3331
203 Ga0070694_100036972 3300005444 Bacteria 3236
204 Ga0070694_100058464 3300005444 Bacteria 2623
205 Ga0070694_100139448 3300005444 Bacteria 1759
206 Ga0070694_100225635 3300005444 Bacteria 1407
207 Ga0070694_100375183 3300005444 Bacteria 1108
208 Ga0070708_100056732 3300005445 Bacteria 3485
209 Ga0070708_100064292 3300005445 Bacteria 3287
210 Ga0070708_100189772 3300005445 Bacteria 1922
211 Ga0070663_100034583 3300005455 Bacteria 3501
212 Ga0070663_100042916 3300005455 Bacteria 3180
213 Ga0070663_100067088 3300005455 Bacteria 2601
214 Ga0070663_100084113 3300005455 Bacteria 2344
215 Ga0070663_100106878 3300005455 Bacteria 2097
216 Ga0070663_100341900 3300005455 Bacteria 1209
217 Ga0070678_100017708 3300005456 Bacteria 4596
218 Ga0070678_100067376 3300005456 Bacteria 2664
219 Ga0070678_100086457 3300005456 Bacteria 2392
220 Ga0070678_100117702 3300005456 Bacteria 2090
221 Ga0070678_100173304 3300005456 Bacteria 1759
222 Ga0070678_100228291 3300005456 Bacteria 1551
223 Ga0070678_100375762 3300005456 Bacteria 1228
224 Ga0070678_100428426 3300005456 Bacteria 1155
225 Ga0070662_100006234 3300005457 Bacteria 7680
226 Ga0070662_100009097 3300005457 Bacteria 6483
227 Ga0070662_100009187 3300005457 Bacteria 6454
228 Ga0070662_100030540 3300005457 Bacteria 3772
229 Ga0070662_100403866 3300005457 Bacteria 1128
230 Ga0070662_100788058 3300005457 Bacteria 808
231 Ga0070681_10037723 3300005458 Bacteria 4847
232 Ga0070681_10677488 3300005458 Bacteria 946
233 Ga0070681_11397645 3300005458 Bacteria 623
234 Ga0068867_100000207 3300005459 Bacteria 39278
235 Ga0068867_100000726 3300005459 Bacteria 22047
236 Ga0068867_100017084 3300005459 Bacteria 5155
237 Ga0068867_100023341 3300005459 Bacteria 4428
238 Ga0068867_100033393 3300005459 Bacteria 3726
239 Ga0068867_100039843 3300005459 Bacteria 3427
240 Ga0068867_100170910 3300005459 Bacteria 1721
241 Ga0068867_100297705 3300005459 Bacteria 1329
242 Ga0068867_100419738 3300005459 Bacteria 1133
243 Ga0070685_10011104 3300005466 Bacteria 4705
244 Ga0070685_10029884 3300005466 Bacteria 3031
245 Ga0070685_10141746 3300005466 Bacteria 1514
246 Ga0070685_10155299 3300005466 Bacteria 1454
247 Ga0070685_10309527 3300005466 Bacteria 1067
248 Ga0070706_100000719 3300005467 Bacteria 37271
249 Ga0070706_100001075 3300005467 Bacteria 29541
250 Ga0070707_100088521 3300005468 Bacteria 2995
251 Ga0070707_100102738 3300005468 Bacteria 2770
252 Ga0070707_100482038 3300005468 Bacteria 1202
253 Ga0070698_100000427 3300005471 Bacteria 44952
254 Ga0070698_100030379 3300005471 Bacteria 5602
255 Ga0070698_100132895 3300005471 Bacteria 2443
256 Ga0070698_100194392 3300005471 Bacteria 1966
257 Ga0070699_100013907 3300005518 Bacteria 6922
258 Ga0070699_100032839 3300005518 Bacteria 4483
259 Ga0070699_100052633 3300005518 Bacteria 3522
260 Ga0070699_100338118 3300005518 Bacteria 1355
261 Ga0070699_100534202 3300005518 Bacteria 1067
262 Ga0070679_100079331 3300005530 Bacteria 3272
263 Ga0070679_100271430 3300005530 Bacteria 1650
264 Ga0070679_100398820 3300005530 Bacteria 1322
265 Ga0070679_100526366 3300005530 Bacteria 1126
266 Ga0070679_101022619 3300005530 Bacteria 770
267 Ga0070679_101646175 3300005530 Bacteria 590
268 Ga0070684_100531861 3300005535 Bacteria 1090
269 Ga0070684_100842279 3300005535 Bacteria 858
270 Ga0070697_100011088 3300005536 Bacteria 7042
271 Ga0070697_100067361 3300005536 Bacteria 2929
272 Ga0070697_100232142 3300005536 Bacteria 1574
273 Ga0068853_100000572 3300005539 Bacteria 25157
274 Ga0068853_100016266 3300005539 Bacteria 6121
275 Ga0068853_100154386 3300005539 Bacteria 2068
276 Ga0068853_100182959 3300005539 Bacteria 1901
277 Ga0068853_100340558 3300005539 Bacteria 1393
278 Ga0070672_100008154 3300005543 Bacteria 7160
279 Ga0070672_100009162 3300005543 Bacteria 6811
280 Ga0070672_100029014 3300005543 Bacteria 4144
281 Ga0070672_100055256 3300005543 Bacteria 3110
282 Ga0070672_100119226 3300005543 Bacteria 2158
283 Ga0070672_100269763 3300005543 Bacteria 1437
284 Ga0070672_100505930 3300005543 Bacteria 1045
285 Ga0070672_100639091 3300005543 Bacteria 929
286 Ga0070686_100238528 3300005544 Bacteria 1323
287 Ga0070686_100467425 3300005544 Bacteria 973
288 Ga0070686_100689177 3300005544 Bacteria 814
289 Ga0070686_100832956 3300005544 Bacteria 746
290 Ga0070686_100971865 3300005544 Bacteria 695
291 Ga0070695_100000039 3300005545 Bacteria 49562
292 Ga0070695_100019296 3300005545 Bacteria 4150
293 Ga0070695_100551888 3300005545 Bacteria 898
294 Ga0070696_100041940 3300005546 Bacteria 3164
295 Ga0070696_100064722 3300005546 Bacteria 2562
296 Ga0070696_100137944 3300005546 Bacteria 1779
297 Ga0070696_100749929 3300005546 Bacteria 800
298 Ga0070693_100039332 3300005547 Bacteria 2649
299 Ga0070693_100291194 3300005547 Bacteria 1097
300 Ga0070693_101159461 3300005547 Bacteria 592
301 Ga0070665_100001376 3300005548 Bacteria 28638
302 Ga0070665_100009488 3300005548 Bacteria 9844
303 Ga0070665_100011310 3300005548 Bacteria 9027
304 Ga0070665_100022374 3300005548 Bacteria 6362
305 Ga0070665_100044547 3300005548 Bacteria 4456
306 Ga0070665_100064336 3300005548 Bacteria 3678
307 Ga0070665_100164962 3300005548 Bacteria 2217
308 Ga0070665_100720230 3300005548 Bacteria 1011
309 Ga0070704_100155327 3300005549 Bacteria 1804
310 Ga0070704_100201826 3300005549 Bacteria 1605
311 Ga0070704_100653443 3300005549 Bacteria 928
312 Ga0070704_101066483 3300005549 Bacteria 733
313 Ga0068855_100010407 3300005563 Bacteria 11220
314 Ga0068855_100053916 3300005563 Bacteria 4730
315 Ga0068855_100058049 3300005563 Bacteria 4533
316 Ga0068855_100093548 3300005563 Bacteria 3466
317 Ga0068855_100260467 3300005563 Bacteria 1932
318 Ga0068855_100902156 3300005563 Bacteria 933
319 Ga0070664_100005556 3300005564 Bacteria 10127
320 Ga0070664_100006710 3300005564 Bacteria 9282
321 Ga0070664_100012765 3300005564 Bacteria 6835
322 Ga0070664_100063089 3300005564 Bacteria 3159
323 Ga0070664_100108266 3300005564 Bacteria 2423
324 Ga0070664_100209406 3300005564 Bacteria 1742
325 Ga0070664_100304905 3300005564 Bacteria 1440
326 Ga0070664_100307369 3300005564 Bacteria 1434
327 Ga0068857_100042826 3300005577 Bacteria 4016
328 Ga0068857_100074236 3300005577 Bacteria 3031
329 Ga0068857_100177464 3300005577 Bacteria 1938
330 Ga0068857_100204625 3300005577 Bacteria 1800
331 Ga0068854_100101387 3300005578 Bacteria 2159
332 Ga0068854_100670028 3300005578 Bacteria 892
333 Ga0068856_100459091 3300005614 Bacteria 1295
334 Ga0068856_100670363 3300005614 Bacteria 1058
335 Ga0068856_101392785 3300005614 Bacteria 716
336 Ga0070702_100017017 3300005615 Bacteria 3743
337 Ga0070702_100136383 3300005615 Bacteria 1557
338 Ga0070702_100300751 3300005615 Bacteria 1110
339 Ga0070702_100704572 3300005615 Bacteria 770
340 Ga0068852_100005866 3300005616 Bacteria 8827
341 Ga0068852_100028938 3300005616 Bacteria 4543
342 Ga0068852_100031972 3300005616 Bacteria 4352
343 Ga0068852_100088058 3300005616 Bacteria 2772
344 Ga0068852_100095292 3300005616 Bacteria 2672
345 Ga0068852_100435964 3300005616 Bacteria 1295
346 Ga0068852_100571369 3300005616 Bacteria 1133
347 Ga0068852_100749327 3300005616 Bacteria 989
348 Ga0068852_100815395 3300005616 Bacteria 948
349 Ga0068852_101432410 3300005616 Bacteria 713
350 Ga0068859_100004281 3300005617 Bacteria 14574
351 Ga0068859_100041330 3300005617 Bacteria 4631
352 Ga0068859_100345449 3300005617 Bacteria 1582
353 Ga0068859_100563901 3300005617 Bacteria 1233
354 Ga0068859_100667733 3300005617 Bacteria 1131
355 Ga0068859_101658916 3300005617 Bacteria 706
356 Ga0068864_100012239 3300005618 Bacteria 7090
357 Ga0068864_100027469 3300005618 Bacteria 4807
358 Ga0068864_100042201 3300005618 Bacteria 3903
359 Ga0068864_100091531 3300005618 Bacteria 2683
360 Ga0068864_100159990 3300005618 Bacteria 2046
361 Ga0068864_100415424 3300005618 Bacteria 1281
362 Ga0068866_10040449 3300005718 Bacteria 2308
363 Ga0068866_10194269 3300005718 Bacteria 1208
364 Ga0068866_10343863 3300005718 Bacteria 945
365 Ga0068861_100000654 3300005719 Bacteria 20566
366 Ga0068861_100013827 3300005719 Bacteria 5655
367 Ga0068861_100024379 3300005719 Bacteria 4375
368 Ga0068861_100081872 3300005719 Bacteria 2528
369 Ga0068861_100158435 3300005719 Bacteria 1865
370 Ga0068861_100450752 3300005719 Bacteria 1153
371 Ga0068861_100455381 3300005719 Bacteria 1147
372 Ga0068861_100572959 3300005719 Bacteria 1032
373 Ga0068861_100744475 3300005719 Bacteria 915
374 Ga0068861_100885149 3300005719 Bacteria 844
375 Ga0068861_101419643 3300005719 Bacteria 679
376 Ga0068851_10002695 3300005834 Bacteria 7827
377 Ga0068851_10013059 3300005834 Bacteria 3926
378 Ga0068851_10013405 3300005834 Bacteria 3880
379 Ga0068851_10146504 3300005834 Bacteria 1288
380 Ga0068870_10006752 3300005840 Bacteria 5084
381 Ga0068870_10064770 3300005840 Bacteria 1975
382 Ga0068870_10191237 3300005840 Bacteria 1235
383 Ga0068870_10237891 3300005840 Bacteria 1123
384 Ga0068870_10490679 3300005840 Bacteria 817
385 Ga0068870_10706968 3300005840 Bacteria 696
386 Ga0068863_100007057 3300005841 Bacteria 11007
387 Ga0068863_100088411 3300005841 Bacteria 2936
388 Ga0068863_100381928 3300005841 Bacteria 1375
389 Ga0068863_100711317 3300005841 Bacteria 999
390 Ga0068863_101239011 3300005841 Bacteria 752
391 Ga0068858_100010159 3300005842 Bacteria 8934
392 Ga0068858_100016103 3300005842 Bacteria 7023
393 Ga0068858_100066236 3300005842 Bacteria 3343
394 Ga0068858_100095073 3300005842 Bacteria 2776
395 Ga0068858_100241282 3300005842 Bacteria 1715
396 Ga0068858_100432362 3300005842 Bacteria 1267
397 Ga0068860_100000602 3300005843 Bacteria 42928
398 Ga0068860_100073344 3300005843 Bacteria 3254
399 Ga0068860_100090256 3300005843 Bacteria 2918
400 Ga0068860_100091655 3300005843 Bacteria 2895
401 Ga0068860_100132335 3300005843 Bacteria 2394
402 Ga0068860_100384461 3300005843 Bacteria 1386
403 Ga0068860_100477702 3300005843 Bacteria 1242
404 Ga0068860_100510849 3300005843 Bacteria 1201
405 Ga0068860_100655757 3300005843 Bacteria 1057
406 Ga0068860_100749968 3300005843 Bacteria 988
407 Ga0068860_101191300 3300005843 Bacteria 782
408 Ga0068862_100019744 3300005844 Bacteria 5628
409 Ga0068862_100029902 3300005844 Bacteria 4590
410 Ga0068862_100106978 3300005844 Bacteria 2452
411 Ga0068862_100210028 3300005844 Bacteria 1759
412 Ga0068862_100218958 3300005844 Bacteria 1723
413 Ga0068862_100259842 3300005844 Bacteria 1585
414 Ga0068862_100263380 3300005844 Bacteria 1574
415 Ga0068862_100340865 3300005844 Bacteria 1388
416 Ga0068862_100937623 3300005844 Bacteria 853
417 Ga0068862_102022885 3300005844 Bacteria 587
418 Ga0081538_10030555 3300005981 Bacteria 3654
419 Ga0081540_1059312 3300005983 Bacteria 1838
420 Ga0070717_10187073 3300006028 Bacteria 1808
421 Ga0070717_10320180 3300006028 Bacteria 1382
422 Ga0070717_11210667 3300006028 Bacteria 687
423 Ga0075365_10276652 3300006038 Bacteria 1181
424 Ga0075363_100334623 3300006048 Bacteria 882
425 Ga0075432_10151368 3300006058 Bacteria 892
426 Ga0070712_100304640 3300006175 Bacteria 1291
427 Ga0075362_10004341 3300006177 Bacteria 5080
428 Ga0075367_10295368 3300006178 Bacteria 1020
429 Ga0075367_10733942 3300006178 Bacteria 628
430 Ga0075369_10002428 3300006186 Bacteria 6642
431 Ga0075369_10025104 3300006186 Bacteria 2476
432 Ga0075369_10180886 3300006186 Bacteria 970
433 Ga0075366_10005371 3300006195 Bacteria 6942
434 Ga0075366_10069324 3300006195 Bacteria 2099
435 Ga0075366_10088771 3300006195 Bacteria 1851
436 Ga0075366_10267163 3300006195 Bacteria 1045
437 Ga0075366_10386707 3300006195 Bacteria 860
438 Ga0075366_10519541 3300006195 Bacteria 736
439 Ga0097621_100003669 3300006237 Bacteria 10611
440 Ga0097621_100033256 3300006237 Bacteria 4105
441 Ga0097621_100035926 3300006237 Bacteria 3960
442 Ga0097621_100079342 3300006237 Bacteria 2728
443 Ga0097621_100398027 3300006237 Bacteria 1232
444 Ga0097621_100660393 3300006237 Bacteria 960
445 Ga0097621_101156043 3300006237 Bacteria 728
446 Ga0075370_10001307 3300006353 Bacteria 10658
447 Ga0075370_10006254 3300006353 Bacteria 5978
448 Ga0075370_10009653 3300006353 Bacteria 5021
449 Ga0075370_10064860 3300006353 Bacteria 2083
450 Ga0075370_10186452 3300006353 Bacteria 1221
451 Ga0068871_100000960 3300006358 Bacteria 19285
452 Ga0068871_100006007 3300006358 Bacteria 8549
453 Ga0068871_100014251 3300006358 Bacteria 5920
454 Ga0068871_100175082 3300006358 Bacteria 1841
455 Ga0068871_100367448 3300006358 Bacteria 1275
456 Ga0075428_100002818 3300006844 Bacteria 18927
457 Ga0075428_100009989 3300006844 Bacteria 10545
458 Ga0075428_100088429 3300006844 Bacteria 3379
459 Ga0075428_100689046 3300006844 Bacteria 1089
460 Ga0075430_100024649 3300006846 Bacteria 5117
461 Ga0075430_100033753 3300006846 Bacteria 4343
462 Ga0075430_100054608 3300006846 Bacteria 3361
463 Ga0075430_100064980 3300006846 Bacteria 3066
464 Ga0075430_100721181 3300006846 Bacteria 822
465 Ga0075431_100000901 3300006847 Bacteria 26166
466 Ga0075431_100001080 3300006847 Bacteria 24384
467 Ga0075431_100002960 3300006847 Bacteria 16439
468 Ga0075431_100109517 3300006847 Bacteria 2851
469 Ga0075431_100115023 3300006847 Bacteria 2777
470 Ga0075431_100128643 3300006847 Bacteria 2613
471 Ga0075433_10003757 3300006852 Bacteria 11750
472 Ga0075433_10010211 3300006852 Bacteria 7530
473 Ga0075433_10157548 3300006852 Bacteria 2020
474 Ga0075433_10269855 3300006852 Bacteria 1508
475 Ga0075433_10513299 3300006852 Bacteria 1054
476 Ga0075433_10571154 3300006852 Bacteria 993
477 Ga0075434_100125679 3300006871 Bacteria 2582
478 Ga0075434_100296160 3300006871 Bacteria 1638
479 Ga0075434_100470565 3300006871 Bacteria 1278
480 Ga0075434_100757941 3300006871 Bacteria 987
481 Ga0075434_100762302 3300006871 Bacteria 984
482 Ga0075429_100015772 3300006880 Bacteria 6544
483 Ga0075429_100017847 3300006880 Bacteria 6137
484 Ga0075429_100035201 3300006880 Bacteria 4354
485 Ga0075429_100118506 3300006880 Bacteria 2314
486 Ga0075429_101116290 3300006880 Bacteria 689
487 Ga0068865_100004074 3300006881 Bacteria 8780
488 Ga0068865_100031716 3300006881 Bacteria 3525
489 Ga0068865_100113908 3300006881 Bacteria 1999
490 Ga0068865_100176599 3300006881 Bacteria 1642
491 Ga0068865_100180960 3300006881 Bacteria 1623
492 Ga0068865_100506316 3300006881 Bacteria 1007
493 Ga0075436_100000215 3300006914 Bacteria 35586
494 Ga0075436_100436142 3300006914 Bacteria 952
495 Ga0097620_100004281 3300006931 Bacteria 14574
496 Ga0097620_100041330 3300006931 Bacteria 4631
497 Ga0097620_100345446 3300006931 Bacteria 1582
498 Ga0097620_100563941 3300006931 Bacteria 1233
499 Ga0097620_100667661 3300006931 Bacteria 1131
500 Ga0097620_101659035 3300006931 Bacteria 706
501 Ga0099823_1007818 3300006944 Bacteria 10884
502 Ga0075435_100007075 3300007076 Bacteria 7966
503 Ga0075435_100016568 3300007076 Bacteria 5558
504 Ga0075435_100074791 3300007076 Bacteria 2772
505 Ga0075435_100133166 3300007076 Bacteria 2081
506 Ga0105240_10004613 3300009093 Bacteria 20887
507 Ga0105240_10015776 3300009093 Bacteria 10252
508 Ga0105240_10124004 3300009093 Bacteria 3107
509 Ga0105240_10131935 3300009093 Bacteria 2996
510 Ga0105240_10467037 3300009093 Bacteria 1409
511 Ga0105240_11418961 3300009093 Bacteria 729
512 Ga0111539_10002074 3300009094 Bacteria 26775
513 Ga0111539_10018976 3300009094 Bacteria 8502
514 Ga0111539_10071702 3300009094 Bacteria 4087
515 Ga0111539_10318158 3300009094 Bacteria 1811
516 Ga0111539_10847039 3300009094 Bacteria 1064
517 Ga0105245_10057786 3300009098 Bacteria 3490
518 Ga0105245_10109225 3300009098 Bacteria 2570
519 Ga0105245_10190028 3300009098 Bacteria 1966
520 Ga0105245_10707385 3300009098 Bacteria 1041
521 Ga0105245_10758321 3300009098 Bacteria 1007
522 Ga0105245_12000044 3300009098 Bacteria 633
523 Ga0105245_12313994 3300009098 Bacteria 591
524 Ga0105247_10524612 3300009101 Bacteria 867
525 Ga0114129_10001675 3300009147 Bacteria 30186
526 Ga0114129_10033390 3300009147 Bacteria 7272
527 Ga0114129_10201706 3300009147 Bacteria 2693
528 Ga0114129_10305446 3300009147 Bacteria 2119
529 Ga0114129_10307423 3300009147 Bacteria 2111
530 Ga0114129_11145322 3300009147 Bacteria 971
531 Ga0105243_10011807 3300009148 Bacteria 6605
532 Ga0105243_10040989 3300009148 Bacteria 3620
533 Ga0105243_10071105 3300009148 Bacteria 2812
534 Ga0105243_10367053 3300009148 Bacteria 1327
535 Ga0105243_10369408 3300009148 Bacteria 1323
536 Ga0105243_10952756 3300009148 Bacteria 857
537 Ga0105241_10330020 3300009174 Bacteria 1318
538 Ga0105241_10898039 3300009174 Bacteria 822
539 Ga0105242_10039238 3300009176 Bacteria 3810
540 Ga0105242_10129141 3300009176 Bacteria 2179
541 Ga0105242_10351867 3300009176 Bacteria 1361
542 Ga0105242_10359688 3300009176 Bacteria 1347
543 Ga0105242_10912851 3300009176 Bacteria 879
544 Ga0105242_11132088 3300009176 Bacteria 798
545 Ga0105242_11177429 3300009176 Bacteria 784
546 Ga0105248_10012122 3300009177 Bacteria 9512
547 Ga0105248_10100974 3300009177 Bacteria 3251
548 Ga0105248_10164351 3300009177 Bacteria 2502
549 Ga0105248_10224186 3300009177 Bacteria 2116
550 Ga0105248_10309111 3300009177 Bacteria 1780
551 Ga0105248_10435512 3300009177 Bacteria 1477
552 Ga0105248_10565035 3300009177 Bacteria 1283
553 Ga0105248_10664755 3300009177 Bacteria 1175
554 Ga0105248_10815075 3300009177 Bacteria 1053
555 Ga0105248_10972547 3300009177 Bacteria 959
556 Ga0105248_12153059 3300009177 Bacteria 634
557 Ga0105237_10000014 3300009545 Bacteria 293492
558 Ga0105237_10007496 3300009545 Bacteria 11932
559 Ga0105237_10015759 3300009545 Bacteria 7860
560 Ga0105237_10180239 3300009545 Bacteria 2113
561 Ga0105237_10503327 3300009545 Bacteria 1218
562 Ga0105237_10671959 3300009545 Bacteria 1042
563 Ga0105237_11537054 3300009545 Bacteria 672
564 Ga0105238_10003888 3300009551 Bacteria 14826
565 Ga0105238_10038952 3300009551 Bacteria 4825
566 Ga0105238_10177029 3300009551 Bacteria 2110
567 Ga0105238_10238080 3300009551 Bacteria 1797
568 Ga0105238_10273616 3300009551 Bacteria 1669
569 Ga0105238_10689353 3300009551 Bacteria 1033
570 Ga0105249_10006579 3300009553 Bacteria 10112
571 Ga0105249_10009159 3300009553 Bacteria 8657
572 Ga0105249_10039427 3300009553 Bacteria 4289
573 Ga0105249_10064266 3300009553 Bacteria 3374
574 Ga0105249_10122551 3300009553 Bacteria 2473
575 Ga0105249_10192366 3300009553 Bacteria 1992
576 Ga0105249_10388843 3300009553 Bacteria 1422
577 Ga0105249_10403276 3300009553 Bacteria 1398
578 Ga0105249_10450972 3300009553 Bacteria 1325
579 Ga0105249_10471864 3300009553 Bacteria 1296
580 Ga0105249_11399962 3300009553 Bacteria 771
581 Ga0105239_10023347 3300010375 Bacteria 6812
582 Ga0105239_10030394 3300010375 Bacteria 5940
583 Ga0105239_10404650 3300010375 Bacteria 1545
584 Ga0105239_11168803 3300010375 Bacteria 886
585 Ga0105246_10015278 3300011119 Bacteria 4845
586 Ga0105246_10894175 3300011119 Bacteria 796
587 Ga0157318_1012934 3300012482 Bacteria 651
588 Ga0157319_1000006 3300012497 Bacteria 361506
589 Ga0157339_1025357 3300012505 Bacteria 660
590 Ga0157316_1020674 3300012510 Bacteria 717
591 Ga0157327_1002757 3300012512 Bacteria 1240
592 Ga0157373_10249596 3300013100 Bacteria 1255
593 Ga0157371_10360090 3300013102 Bacteria 1060
594 Ga0157370_10001503 3300013104 Bacteria 28802
595 Ga0157370_10141381 3300013104 Bacteria 2242
596 Ga0157370_10185897 3300013104 Bacteria 1929
597 Ga0157369_10252653 3300013105 Bacteria 1840
598 Ga0157369_10515016 3300013105 Bacteria 1237
599 Ga0157374_10002222 3300013296 Bacteria 16365
600 Ga0157374_10025960 3300013296 Bacteria 5267
601 Ga0157374_10035554 3300013296 Bacteria 4558
602 Ga0157374_10038448 3300013296 Bacteria 4399
603 Ga0157374_10125086 3300013296 Bacteria 2485
604 Ga0157374_10133935 3300013296 Bacteria 2400
605 Ga0157374_11282701 3300013296 Bacteria 754
606 Ga0157378_10007729 3300013297 Bacteria 9384
607 Ga0157378_10362518 3300013297 Bacteria 1419
608 Ga0157378_10499220 3300013297 Bacteria 1215
609 Ga0157378_10806557 3300013297 Bacteria 965
610 Ga0157378_10809614 3300013297 Bacteria 963
611 Ga0157378_11105167 3300013297 Bacteria 830
612 Ga0157378_11813441 3300013297 Bacteria 658
613 Ga0163162_10003947 3300013306 Bacteria 14226
614 Ga0163162_10008554 3300013306 Bacteria 9978
615 Ga0163162_10243928 3300013306 Bacteria 1928
616 Ga0163162_11108398 3300013306 Bacteria 897
617 Ga0163162_11323572 3300013306 Bacteria 819
618 Ga0157372_10009495 3300013307 Bacteria 10345
619 Ga0157372_10328403 3300013307 Bacteria 1781
620 Ga0157375_10045345 3300013308 Bacteria 4278
621 Ga0157375_10058181 3300013308 Bacteria 3824
622 Ga0157375_10146918 3300013308 Bacteria 2489
623 Ga0157375_10183582 3300013308 Bacteria 2244
624 Ga0157375_10219429 3300013308 Bacteria 2060
625 Ga0157375_11350131 3300013308 Bacteria 839
626 Ga0157375_12037260 3300013308 Bacteria 682
627 Ga0163163_10015273 3300014325 Bacteria 7095
628 Ga0163163_10053837 3300014325 Bacteria 3974
629 Ga0163163_10138333 3300014325 Bacteria 2477
630 Ga0163163_10188274 3300014325 Bacteria 2112
631 Ga0163163_10203570 3300014325 Bacteria 2028
632 Ga0163163_10216105 3300014325 Bacteria 1966
633 Ga0163163_10384953 3300014325 Bacteria 1460
634 Ga0157380_10008631 3300014326 Bacteria 7283
635 Ga0157380_10017807 3300014326 Bacteria 5263
636 Ga0157380_11376922 3300014326 Bacteria 755
637 Ga0157380_11431109 3300014326 Bacteria 742
638 Ga0157377_10000013 3300014745 Bacteria 267125
639 Ga0157377_10000814 3300014745 Bacteria 12911
640 Ga0157377_10012450 3300014745 Bacteria 4278
641 Ga0157377_10106928 3300014745 Bacteria 1676
642 Ga0157377_10483910 3300014745 Bacteria 861
643 Ga0157377_10690453 3300014745 Bacteria 740
644 Ga0157379_10048210 3300014968 Bacteria 3802
645 Ga0157379_10080050 3300014968 Bacteria 2926
646 Ga0157379_10138815 3300014968 Bacteria 2191
647 Ga0157379_10183138 3300014968 Bacteria 1892
648 Ga0157379_10720053 3300014968 Bacteria 938
649 Ga0157376_10015680 3300014969 Bacteria 5732
650 Ga0157376_10109768 3300014969 Bacteria 2426
651 Ga0157376_10142738 3300014969 Bacteria 2150
652 Ga0157376_10439788 3300014969 Bacteria 1270
653 Ga0157376_10440174 3300014969 Bacteria 1269
654 Ga0157376_10668678 3300014969 Bacteria 1041
655 Ga0182007_10218761 3300015262 Bacteria 672
656 Ga0163161_10011022 3300017792 Bacteria 6261
657 Ga0163161_10011801 3300017792 Bacteria 6058
658 Ga0163161_10027439 3300017792 Bacteria 4039
659 Ga0163161_10121237 3300017792 Bacteria 1965
660 Ga0206356_10587414 3300020070 Bacteria 1234
661 Ga0206352_10888516 3300020078 Bacteria 1151
662 Ga0213874_10021759 3300021377 Bacteria 1772
663 Ga0209563_100013 3300025230 Bacteria 941463
664 Ga0207425_1000452 3300025245 Bacteria 26650
665 Ga0209129_1000027 3300025258 Bacteria 409587
666 Ga0209673_1002493 3300025273 Bacteria 12678
667 Ga0209673_1008050 3300025273 Bacteria 4744
668 Ga0209673_1039154 3300025273 Bacteria 1371
669 Ga0209673_1069754 3300025273 Bacteria 842
670 Ga0207673_1019319 3300025290 Bacteria 915
671 Ga0209564_1000003 3300025295 Bacteria 1585848
672 Ga0209564_1000046 3300025295 Bacteria 373787
673 Ga0209758_1000052 3300025297 Bacteria 338962
674 Ga0209758_1001020 3300025297 Bacteria 37059
675 Ga0209050_1000143 3300025298 Bacteria 171806
676 Ga0209050_1003147 3300025298 Bacteria 12589
677 Ga0209050_1006012 3300025298 Bacteria 7355
678 Ga0209256_1000053 3300025299 Bacteria 298731
679 Ga0209256_1018443 3300025299 Bacteria 2266
680 Ga0209256_1025556 3300025299 Bacteria 1717
681 Ga0209051_1105199 3300025303 Bacteria 749
682 Ga0209257_1000047 3300025304 Bacteria 460507
683 Ga0209257_1006119 3300025304 Bacteria 7982
684 Ga0209257_1014890 3300025304 Bacteria 3291
685 Ga0209257_1034099 3300025304 Bacteria 1593
686 Ga0209257_1049694 3300025304 Bacteria 1192
687 Ga0207697_10003240 3300025315 Bacteria 8093
688 Ga0207697_10040170 3300025315 Bacteria 1921
689 Ga0207697_10052802 3300025315 Bacteria 1682
690 Ga0207656_10009042 3300025321 Bacteria 3692
691 Ga0207656_10052063 3300025321 Bacteria 1772
692 Ga0207656_10055373 3300025321 Bacteria 1726
693 Ga0207656_10179219 3300025321 Bacteria 1016
694 Ga0207653_10053071 3300025885 Bacteria 1353
695 Ga0207682_10000541 3300025893 Bacteria 17404
696 Ga0207682_10009755 3300025893 Bacteria 3782
697 Ga0207682_10013442 3300025893 Bacteria 3189
698 Ga0207682_10013460 3300025893 Bacteria 3187
699 Ga0207682_10110635 3300025893 Bacteria 1209
700 Ga0207682_10246033 3300025893 Bacteria 832
701 Ga0207692_10016014 3300025898 Bacteria 3310
702 Ga0207642_10149053 3300025899 Bacteria 1243
703 Ga0207642_10159868 3300025899 Bacteria 1208
704 Ga0207642_10319563 3300025899 Bacteria 906
705 Ga0207688_10001706 3300025901 Bacteria 11644
706 Ga0207688_10025201 3300025901 Bacteria 3265
707 Ga0207688_10221142 3300025901 Bacteria 1141
708 Ga0207680_10035520 3300025903 Bacteria 2863
709 Ga0207680_10114888 3300025903 Bacteria 1752
710 Ga0207680_10118056 3300025903 Bacteria 1731
711 Ga0207680_10129904 3300025903 Bacteria 1659
712 Ga0207680_10177182 3300025903 Bacteria 1439
713 Ga0207680_10232920 3300025903 Bacteria 1266
714 Ga0207680_10333357 3300025903 Bacteria 1063
715 Ga0207680_10641463 3300025903 Bacteria 760
716 Ga0207680_10970129 3300025903 Bacteria 609
717 Ga0207645_10000521 3300025907 Bacteria 31943
718 Ga0207645_10001565 3300025907 Bacteria 18698
719 Ga0207645_10081662 3300025907 Bacteria 2072
720 Ga0207645_10116126 3300025907 Bacteria 1735
721 Ga0207645_10204616 3300025907 Bacteria 1299
722 Ga0207645_10305790 3300025907 Bacteria 1059
723 Ga0207645_10790199 3300025907 Bacteria 645
724 Ga0207643_10017273 3300025908 Bacteria 3944
725 Ga0207643_10036550 3300025908 Bacteria 2755
726 Ga0207643_10046042 3300025908 Bacteria 2465
727 Ga0207643_10125633 3300025908 Bacteria 1522
728 Ga0207643_10274579 3300025908 Bacteria 1044
729 Ga0207643_10281544 3300025908 Bacteria 1031
730 Ga0207705_10012439 3300025909 Bacteria 6148
731 Ga0207684_10001027 3300025910 Bacteria 31303
732 Ga0207684_10008274 3300025910 Bacteria 9260
733 Ga0207654_10322647 3300025911 Bacteria 1056
734 Ga0207707_10109767 3300025912 Bacteria 2411
735 Ga0207707_10117790 3300025912 Bacteria 2322
736 Ga0207707_10176278 3300025912 Bacteria 1868
737 Ga0207707_10884979 3300025912 Bacteria 739
738 Ga0207695_10007213 3300025913 Bacteria 14212
739 Ga0207695_10009988 3300025913 Bacteria 11661
740 Ga0207695_10100795 3300025913 Bacteria 2883
741 Ga0207695_10353635 3300025913 Bacteria 1356
742 Ga0207695_10899019 3300025913 Bacteria 765
743 Ga0207671_10000219 3300025914 Bacteria 85909
744 Ga0207671_10031927 3300025914 Bacteria 3922
745 Ga0207671_10106204 3300025914 Bacteria 2131
746 Ga0207671_10178711 3300025914 Bacteria 1651
747 Ga0207693_10178230 3300025915 Bacteria 1672
748 Ga0207663_10580444 3300025916 Bacteria 879
749 Ga0207660_10119451 3300025917 Bacteria 1995
750 Ga0207662_10001988 3300025918 Bacteria 10091
751 Ga0207662_10045801 3300025918 Bacteria 2586
752 Ga0207662_10141823 3300025918 Bacteria 1522
753 Ga0207662_10287691 3300025918 Bacteria 1089
754 Ga0207657_10064417 3300025919 Bacteria 3128
755 Ga0207657_10282154 3300025919 Bacteria 1318
756 Ga0207657_10758265 3300025919 Bacteria 752
757 Ga0207657_10771275 3300025919 Bacteria 744
758 Ga0207649_10073457 3300025920 Bacteria 2191
759 Ga0207649_10124422 3300025920 Bacteria 1743
760 Ga0207649_10133627 3300025920 Bacteria 1689
761 Ga0207652_10002474 3300025921 Bacteria 15565
762 Ga0207652_10007653 3300025921 Bacteria 8690
763 Ga0207652_10195289 3300025921 Bacteria 1821
764 Ga0207652_10306769 3300025921 Bacteria 1433
765 Ga0207652_10783417 3300025921 Bacteria 847
766 Ga0207646_10153565 3300025922 Bacteria 2076
767 Ga0207646_10504317 3300025922 Bacteria 1090
768 Ga0207681_10005130 3300025923 Bacteria 8044
769 Ga0207681_10008360 3300025923 Bacteria 6329
770 Ga0207681_10023722 3300025923 Bacteria 3928
771 Ga0207681_10082091 3300025923 Bacteria 2277
772 Ga0207681_10085118 3300025923 Bacteria 2243
773 Ga0207681_10275682 3300025923 Bacteria 1322
774 Ga0207681_10468136 3300025923 Bacteria 1028
775 Ga0207681_10533727 3300025923 Bacteria 964
776 Ga0207681_10936457 3300025923 Bacteria 726
777 Ga0207681_11278995 3300025923 Bacteria 616
778 Ga0207681_11419877 3300025923 Bacteria 582
779 Ga0207694_10005279 3300025924 Bacteria 9955
780 Ga0207694_10039625 3300025924 Bacteria 3626
781 Ga0207694_10096638 3300025924 Bacteria 2336
782 Ga0207694_10254713 3300025924 Bacteria 1437
783 Ga0207694_10907467 3300025924 Bacteria 745
784 Ga0207650_10004266 3300025925 Bacteria 9756
785 Ga0207650_10142061 3300025925 Bacteria 1888
786 Ga0207650_10146421 3300025925 Bacteria 1861
787 Ga0207650_10196857 3300025925 Bacteria 1612
788 Ga0207650_10312206 3300025925 Bacteria 1286
789 Ga0207650_10333518 3300025925 Bacteria 1244
790 Ga0207650_10344929 3300025925 Bacteria 1224
791 Ga0207650_10462179 3300025925 Bacteria 1057
792 Ga0207650_10642798 3300025925 Bacteria 894
793 Ga0207659_10006848 3300025926 Bacteria 7008
794 Ga0207659_10009873 3300025926 Bacteria 5975
795 Ga0207659_10041918 3300025926 Bacteria 3207
796 Ga0207659_10063531 3300025926 Bacteria 2669
797 Ga0207659_10070183 3300025926 Bacteria 2555
798 Ga0207659_10105508 3300025926 Bacteria 2132
799 Ga0207659_10363356 3300025926 Bacteria 1204
800 Ga0207659_10815093 3300025926 Bacteria 802
801 Ga0207659_10912051 3300025926 Bacteria 755
802 Ga0207687_10044763 3300025927 Bacteria 3056
803 Ga0207687_10081101 3300025927 Bacteria 2343
804 Ga0207687_10143758 3300025927 Bacteria 1813
805 Ga0207687_10426681 3300025927 Bacteria 1095
806 Ga0207687_10590728 3300025927 Bacteria 935
807 Ga0207687_11052468 3300025927 Bacteria 698
808 Ga0207700_10022022 3300025928 Bacteria 4365
809 Ga0207664_10028775 3300025929 Bacteria 4226
810 Ga0207644_10000320 3300025931 Bacteria 31313
811 Ga0207644_10016831 3300025931 Bacteria 4925
812 Ga0207644_10049232 3300025931 Bacteria 3016
813 Ga0207644_10059682 3300025931 Bacteria 2759
814 Ga0207644_10069835 3300025931 Bacteria 2565
815 Ga0207644_10375674 3300025931 Bacteria 1158
816 Ga0207644_10528098 3300025931 Bacteria 975
817 Ga0207690_10109781 3300025932 Bacteria 1985
818 Ga0207690_10200034 3300025932 Bacteria 1517
819 Ga0207690_10213958 3300025932 Bacteria 1471
820 Ga0207690_10368836 3300025932 Bacteria 1139
821 Ga0207706_10000608 3300025933 Bacteria 38085
822 Ga0207706_10002593 3300025933 Bacteria 17603
823 Ga0207706_10003943 3300025933 Bacteria 14057
824 Ga0207706_10005840 3300025933 Bacteria 11446
825 Ga0207706_10178532 3300025933 Bacteria 1865
826 Ga0207706_10267408 3300025933 Bacteria 1492
827 Ga0207706_10453674 3300025933 Bacteria 1109
828 Ga0207706_10968383 3300025933 Bacteria 716
829 Ga0207686_10034494 3300025934 Bacteria 3029
830 Ga0207686_10285376 3300025934 Bacteria 1220
831 Ga0207686_10349413 3300025934 Bacteria 1113
832 Ga0207709_10002299 3300025935 Bacteria 12102
833 Ga0207709_10090357 3300025935 Bacteria 2000
834 Ga0207709_10184638 3300025935 Bacteria 1476
835 Ga0207670_10000010 3300025936 Bacteria 283265
836 Ga0207670_10018796 3300025936 Bacteria 4210
837 Ga0207670_10134265 3300025936 Bacteria 1817
838 Ga0207670_10214632 3300025936 Bacteria 1469
839 Ga0207670_10217698 3300025936 Bacteria 1460
840 Ga0207670_10254393 3300025936 Bacteria 1359
841 Ga0207670_10270345 3300025936 Bacteria 1321
842 Ga0207669_10032267 3300025937 Bacteria 2939
843 Ga0207669_10058671 3300025937 Bacteria 2349
844 Ga0207669_10792086 3300025937 Bacteria 785
845 Ga0207704_10004439 3300025938 Bacteria 6414
846 Ga0207704_10134489 3300025938 Bacteria 1718
847 Ga0207704_10247247 3300025938 Bacteria 1336
848 Ga0207704_10346045 3300025938 Bacteria 1156
849 Ga0207704_10836020 3300025938 Bacteria 771
850 Ga0207704_11128450 3300025938 Bacteria 667
851 Ga0207665_10674296 3300025939 Bacteria 812
852 Ga0207691_10003673 3300025940 Bacteria 14890
853 Ga0207691_10015053 3300025940 Bacteria 7362
854 Ga0207691_10051809 3300025940 Bacteria 3751
855 Ga0207691_10052984 3300025940 Bacteria 3705
856 Ga0207691_10059853 3300025940 Bacteria 3462
857 Ga0207691_10070110 3300025940 Bacteria 3166
858 Ga0207691_10241286 3300025940 Bacteria 1562
859 Ga0207691_10300502 3300025940 Bacteria 1379
860 Ga0207711_10008230 3300025941 Bacteria 8731
861 Ga0207711_10021013 3300025941 Bacteria 5451
862 Ga0207711_10061615 3300025941 Bacteria 3235
863 Ga0207711_10068406 3300025941 Bacteria 3076
864 Ga0207711_10288472 3300025941 Bacteria 1512
865 Ga0207711_10421846 3300025941 Bacteria 1241
866 Ga0207711_10451471 3300025941 Bacteria 1197
867 Ga0207711_10480263 3300025941 Bacteria 1158
868 Ga0207711_10659297 3300025941 Bacteria 976
869 Ga0207711_10793288 3300025941 Bacteria 882
870 Ga0207711_10816105 3300025941 Bacteria 868
871 Ga0207711_11296726 3300025941 Bacteria 670
872 Ga0207689_10002174 3300025942 Bacteria 18426
873 Ga0207689_10007578 3300025942 Bacteria 9512
874 Ga0207689_10030676 3300025942 Bacteria 4480
875 Ga0207689_10087617 3300025942 Bacteria 2557
876 Ga0207689_10127234 3300025942 Bacteria 2096
877 Ga0207689_10208375 3300025942 Bacteria 1615
878 Ga0207661_10026723 3300025944 Bacteria 4402
879 Ga0207661_10152925 3300025944 Bacteria 1996
880 Ga0207661_10335042 3300025944 Bacteria 1362
881 Ga0207679_10051944 3300025945 Bacteria 3004
882 Ga0207679_10068330 3300025945 Bacteria 2669
883 Ga0207679_10158723 3300025945 Bacteria 1849
884 Ga0207679_10165364 3300025945 Bacteria 1816
885 Ga0207679_10229243 3300025945 Bacteria 1567
886 Ga0207679_10248746 3300025945 Bacteria 1510
887 Ga0207679_10323047 3300025945 Bacteria 1337
888 Ga0207679_10423019 3300025945 Bacteria 1176
889 Ga0207679_10522996 3300025945 Bacteria 1061
890 Ga0207667_10012327 3300025949 Bacteria 9860
891 Ga0207667_10016286 3300025949 Bacteria 8401
892 Ga0207667_10091974 3300025949 Bacteria 3134
893 Ga0207667_10247336 3300025949 Bacteria 1824
894 Ga0207667_10736978 3300025949 Bacteria 986
895 Ga0207667_10771579 3300025949 Bacteria 960
896 Ga0207651_10004643 3300025960 Bacteria 6961
897 Ga0207651_10056652 3300025960 Bacteria 2698
898 Ga0207651_10063062 3300025960 Bacteria 2586
899 Ga0207651_10192491 3300025960 Bacteria 1628
900 Ga0207651_10441061 3300025960 Bacteria 1115
901 Ga0207651_10616206 3300025960 Bacteria 950
902 Ga0207651_10681559 3300025960 Bacteria 904
903 Ga0207651_10693933 3300025960 Bacteria 896
904 Ga0207651_11006446 3300025960 Bacteria 745
905 Ga0207712_10006266 3300025961 Bacteria 7502
906 Ga0207712_10011321 3300025961 Bacteria 5681
907 Ga0207712_10046283 3300025961 Bacteria 3015
908 Ga0207712_10151966 3300025961 Bacteria 1789
909 Ga0207712_10272526 3300025961 Bacteria 1377
910 Ga0207712_10560967 3300025961 Bacteria 983
911 Ga0207712_10654440 3300025961 Bacteria 913
912 Ga0207668_10059499 3300025972 Bacteria 2677
913 Ga0207668_10189392 3300025972 Bacteria 1629
914 Ga0207668_10299151 3300025972 Bacteria 1327
915 Ga0207668_10983456 3300025972 Bacteria 754
916 Ga0207668_11106710 3300025972 Bacteria 710
917 Ga0207640_10068642 3300025981 Bacteria 2377
918 Ga0207640_10248049 3300025981 Bacteria 1380
919 Ga0207658_10000580 3300025986 Bacteria 32919
920 Ga0207658_10013861 3300025986 Bacteria 5516
921 Ga0207658_10042703 3300025986 Bacteria 3291
922 Ga0207658_10043213 3300025986 Bacteria 3275
923 Ga0207658_10044021 3300025986 Bacteria 3249
924 Ga0207658_10066617 3300025986 Bacteria 2709
925 Ga0207658_10130045 3300025986 Bacteria 2021
926 Ga0207658_10169122 3300025986 Bacteria 1799
927 Ga0207658_10184786 3300025986 Bacteria 1728
928 Ga0207677_10005457 3300026023 Bacteria 6904
929 Ga0207677_10015501 3300026023 Bacteria 4486
930 Ga0207677_10240116 3300026023 Bacteria 1465
931 Ga0207677_10326960 3300026023 Bacteria 1276
932 Ga0207677_10492774 3300026023 Bacteria 1058
933 Ga0207677_10916924 3300026023 Bacteria 790
934 Ga0207703_10010360 3300026035 Bacteria 7295
935 Ga0207703_10112763 3300026035 Bacteria 2323
936 Ga0207703_10182104 3300026035 Bacteria 1855
937 Ga0207703_10291542 3300026035 Bacteria 1485
938 Ga0207703_10520566 3300026035 Bacteria 1119
939 Ga0207639_10027710 3300026041 Bacteria 4130
940 Ga0207639_10047955 3300026041 Bacteria 3231
941 Ga0207639_10139970 3300026041 Bacteria 2015
942 Ga0207639_10262139 3300026041 Bacteria 1512
943 Ga0207639_10329551 3300026041 Bacteria 1358
944 Ga0207639_11637172 3300026041 Bacteria 604
945 Ga0207678_10050899 3300026067 Bacteria 3578
946 Ga0207678_10073873 3300026067 Bacteria 2922
947 Ga0207678_10135135 3300026067 Bacteria 2104
948 Ga0207678_10567190 3300026067 Bacteria 994
949 Ga0207678_10572284 3300026067 Bacteria 989
950 Ga0207708_10004438 3300026075 Bacteria 10342
951 Ga0207708_10103631 3300026075 Bacteria 2204
952 Ga0207708_10274404 3300026075 Bacteria 1365
953 Ga0207702_10039490 3300026078 Bacteria 3955
954 Ga0207702_10133049 3300026078 Bacteria 2240
955 Ga0207702_10434483 3300026078 Bacteria 1271
956 Ga0207702_10883633 3300026078 Bacteria 885
957 Ga0207702_11130045 3300026078 Bacteria 777
958 Ga0207641_10006419 3300026088 Bacteria 9910
959 Ga0207641_10016501 3300026088 Bacteria 6048
960 Ga0207641_10024381 3300026088 Bacteria 4986
961 Ga0207641_10182822 3300026088 Bacteria 1921
962 Ga0207641_10313304 3300026088 Bacteria 1486
963 Ga0207641_10639077 3300026088 Bacteria 1045
964 Ga0207641_11112579 3300026088 Bacteria 789
965 Ga0207641_11137796 3300026088 Bacteria 779
966 Ga0207648_10000500 3300026089 Bacteria 43696
967 Ga0207648_10000582 3300026089 Bacteria 40973
968 Ga0207648_10004799 3300026089 Bacteria 13802
969 Ga0207648_10026058 3300026089 Bacteria 5199
970 Ga0207648_10043623 3300026089 Bacteria 3936
971 Ga0207648_10044810 3300026089 Bacteria 3881
972 Ga0207648_10051074 3300026089 Bacteria 3614
973 Ga0207648_10234780 3300026089 Bacteria 1632
974 Ga0207648_10301003 3300026089 Bacteria 1438
975 Ga0207648_10365077 3300026089 Bacteria 1303
976 Ga0207648_10426484 3300026089 Bacteria 1205
977 Ga0207648_10435195 3300026089 Bacteria 1192
978 Ga0207648_10937947 3300026089 Bacteria 809
979 Ga0207648_11375420 3300026089 Bacteria 663
980 Ga0207676_10035259 3300026095 Bacteria 3796
981 Ga0207676_10091489 3300026095 Bacteria 2499
982 Ga0207676_10093836 3300026095 Bacteria 2471
983 Ga0207676_10128622 3300026095 Bacteria 2150
984 Ga0207676_10277816 3300026095 Bacteria 1519
985 Ga0207674_10007087 3300026116 Bacteria 13100
986 Ga0207674_10011336 3300026116 Bacteria 10017
987 Ga0207674_10075198 3300026116 Bacteria 3388
988 Ga0207674_10083205 3300026116 Bacteria 3200
989 Ga0207674_10149568 3300026116 Bacteria 2292
990 Ga0207674_10356921 3300026116 Bacteria 1413
991 Ga0207674_10401876 3300026116 Bacteria 1324
992 Ga0207675_100000601 3300026118 Bacteria 35110
993 Ga0207675_100000645 3300026118 Bacteria 34285
994 Ga0207675_100001414 3300026118 Bacteria 24026
995 Ga0207675_100001963 3300026118 Bacteria 20502
996 Ga0207675_100005243 3300026118 Bacteria 12475
997 Ga0207675_100043824 3300026118 Bacteria 4179
998 Ga0207675_100079288 3300026118 Bacteria 3077
999 Ga0207675_100164343 3300026118 Bacteria 2119
1000 Ga0207675_100270050 3300026118 Bacteria 1650
1001 Ga0207675_100326830 3300026118 Bacteria 1498
1002 Ga0207675_100348280 3300026118 Bacteria 1451
1003 Ga0207675_100575552 3300026118 Bacteria 1127
1004 Ga0207675_100589240 3300026118 Bacteria 1114
1005 Ga0207675_100662063 3300026118 Bacteria 1051
1006 Ga0207675_101807878 3300026118 Bacteria 630
1007 Ga0207683_10001148 3300026121 Bacteria 24094
1008 Ga0207683_10001966 3300026121 Bacteria 18186
1009 Ga0207683_10013511 3300026121 Bacteria 6968
1010 Ga0207683_10063287 3300026121 Bacteria 3259
1011 Ga0207683_10104905 3300026121 Bacteria 2526
1012 Ga0207683_10179805 3300026121 Bacteria 1918
1013 Ga0207683_10534423 3300026121 Bacteria 1084
1014 Ga0207683_10632853 3300026121 Bacteria 991
1015 Ga0207683_11068381 3300026121 Bacteria 749
1016 Ga0207683_11158355 3300026121 Bacteria 717
1017 Ga0207698_10008468 3300026142 Bacteria 6508
1018 Ga0207698_10019994 3300026142 Bacteria 4599
1019 Ga0207698_10066427 3300026142 Bacteria 2839
1020 Ga0207698_10078254 3300026142 Bacteria 2654
1021 Ga0207698_10914137 3300026142 Bacteria 885
1022 Ga0209389_1041279 3300027296 Bacteria 3532
1023 Ga0209371_1017994 3300027312 Bacteria 1811
1024 Ga0209982_1003716 3300027552 Bacteria 2176
1025 Ga0209983_1037059 3300027665 Bacteria 1049
1026 Ga0209813_10023816 3300027866 Bacteria 1744
1027 Ga0209974_10212266 3300027876 Bacteria 718
1028 Ga0207428_10000457 3300027907 Bacteria 49397
1029 Ga0207428_10146102 3300027907 Bacteria 1802
1030 Ga0207428_10588547 3300027907 Bacteria 802
1031 Ga0268266_10016967 3300028379 Bacteria 6221
1032 Ga0268266_10020758 3300028379 Bacteria 5600
1033 Ga0268266_10031811 3300028379 Bacteria 4483
1034 Ga0268266_10074660 3300028379 Bacteria 2944
1035 Ga0268266_10115429 3300028379 Bacteria 2384
1036 Ga0268266_10154492 3300028379 Bacteria 2071
1037 Ga0268266_10293663 3300028379 Bacteria 1514
1038 Ga0268266_10552903 3300028379 Bacteria 1103
1039 Ga0268266_11359053 3300028379 Bacteria 686
1040 Ga0268265_10002660 3300028380 Bacteria 13249
1041 Ga0268265_10029382 3300028380 Bacteria 3944
1042 Ga0268265_10144240 3300028380 Bacteria 1998
1043 Ga0268265_10221302 3300028380 Bacteria 1656
1044 Ga0268265_10484073 3300028380 Bacteria 1163
1045 Ga0268265_10521267 3300028380 Bacteria 1123
1046 Ga0268265_11347790 3300028380 Bacteria 714
1047 Ga0268264_10060088 3300028381 Bacteria 3185
1048 Ga0268264_10110095 3300028381 Bacteria 2411
1049 Ga0268264_10218855 3300028381 Bacteria 1752
1050 Ga0268264_10419033 3300028381 Bacteria 1291
1051 Ga0268264_10512354 3300028381 Bacteria 1171
1052 Ga0268264_10518124 3300028381 Bacteria 1165
1053 Ga0268264_10527028 3300028381 Bacteria 1156
1054 Ga0268264_10773059 3300028381 Bacteria 958
1055 Ga0268264_10800191 3300028381 Bacteria 942
1056 Ga0268264_10936761 3300028381 Bacteria 871
1057 Ga0268264_11160179 3300028381 Bacteria 782
1058 Ga0265319_1006235 3300028563 Bacteria 5552
1059 Ga0265334_10005463 3300028573 Bacteria 5553
1060 Ga0265334_10023829 3300028573 Bacteria 2487
1061 Ga0265318_10000001 3300028577 Bacteria 500711
1062 Ga0265318_10000192 3300028577 Bacteria 53822
1063 Ga0265323_10013702 3300028653 Bacteria 3225
1064 Ga0265336_10012883 3300028666 Bacteria 2801
1065 Ga0265336_10049117 3300028666 Bacteria 1278
1066 Ga0307517_10085903 3300028786 Bacteria 2631
1067 Ga0307517_10110446 3300028786 Bacteria 2096
1068 Ga0307515_10047991 3300028794 Bacteria 6470
1069 Ga0307515_10051500 3300028794 Bacteria 6136
1070 Ga0307515_10213639 3300028794 Bacteria 1766
1071 Ga0265338_10005111 3300028800 Bacteria 17292
1072 Ga0265338_10126924 3300028800 Bacteria 2022
1073 Ga0265324_10136631 3300029957 Bacteria 833
1074 Ga0268256_1020082 3300030500 Bacteria 1811
1075 Ga0307512_10315303 3300030522 Bacteria 716
1076 Ga0265330_10000002 3300031235 Bacteria 481237
1077 Ga0265330_10000751 3300031235 Bacteria 20404
1078 Ga0265330_10030908 3300031235 Bacteria 2401
1079 Ga0265330_10043015 3300031235 Bacteria 2000
1080 Ga0265332_10000644 3300031238 Bacteria 22702
1081 Ga0265328_10001121 3300031239 Bacteria 12361
1082 Ga0265328_10003765 3300031239 Bacteria 6671
1083 Ga0265328_10017716 3300031239 Bacteria 2757
1084 Ga0265328_10027596 3300031239 Bacteria 2127
1085 Ga0265328_10029482 3300031239 Bacteria 2049
1086 Ga0265328_10269617 3300031239 Bacteria 654
1087 Ga0265320_10000053 3300031240 Bacteria 112866
1088 Ga0265320_10000813 3300031240 Bacteria 23632
1089 Ga0265320_10007994 3300031240 Bacteria 6510
1090 Ga0265320_10128306 3300031240 Bacteria 1153
1091 Ga0265329_10000902 3300031242 Bacteria 14902
1092 Ga0265329_10042972 3300031242 Bacteria 1446
1093 Ga0265339_10010607 3300031249 Bacteria 5715
1094 Ga0265339_10047473 3300031249 Bacteria 2357
1095 Ga0265339_10048908 3300031249 Bacteria 2317
1096 Ga0265339_10173404 3300031249 Bacteria 1078
1097 Ga0265331_10000001 3300031250 Bacteria 798836
1098 Ga0265331_10000307 3300031250 Bacteria 53420
1099 Ga0265331_10001753 3300031250 Bacteria 15598
1100 Ga0265327_10000035 3300031251 Bacteria 314419
1101 Ga0265327_10000364 3300031251 Bacteria 86161
1102 Ga0265316_10003048 3300031344 Bacteria 17099
1103 Ga0265316_10058082 3300031344 Bacteria 3016
1104 Ga0265316_10235454 3300031344 Bacteria 1347
1105 Ga0265316_10310759 3300031344 Bacteria 1146
1106 Ga0265316_10366058 3300031344 Bacteria 1042
1107 Ga0307513_10132563 3300031456 Bacteria 2434
1108 Ga0307513_10189368 3300031456 Bacteria 1911
1109 Ga0307513_10385394 3300031456 Bacteria 1140
1110 Ga0307513_10653897 3300031456 Bacteria 758
1111 Ga0307509_10001260 3300031507 Bacteria 42936
1112 Ga0307509_10128392 3300031507 Bacteria 2496
1113 Ga0307509_10552462 3300031507 Bacteria 829
1114 Ga0307408_100146105 3300031548 Bacteria 1861
1115 Ga0307408_100244408 3300031548 Bacteria 1477
1116 Ga0307408_100509712 3300031548 Bacteria 1055
1117 Ga0307408_100888814 3300031548 Bacteria 815
1118 Ga0265313_10000051 3300031595 Bacteria 111381
1119 Ga0265313_10047288 3300031595 Bacteria 2083
1120 Ga0265313_10074479 3300031595 Bacteria 1556
1121 Ga0307508_10092529 3300031616 Bacteria 2613
1122 Ga0307514_10010565 3300031649 Bacteria 7715
1123 Ga0265314_10000006 3300031711 Bacteria 540431
1124 Ga0265314_10005720 3300031711 Bacteria 11150
1125 Ga0265314_10010192 3300031711 Bacteria 7870
1126 Ga0265314_10071473 3300031711 Bacteria 2321
1127 Ga0265342_10000554 3300031712 Bacteria 39479
1128 Ga0265342_10003077 3300031712 Bacteria 13942
1129 Ga0265342_10004347 3300031712 Bacteria 11214
1130 Ga0265342_10006409 3300031712 Bacteria 8768
1131 Ga0265342_10011384 3300031712 Bacteria 6094
1132 Ga0265342_10015833 3300031712 Bacteria 4948
1133 Ga0265342_10068617 3300031712 Bacteria 2072
1134 Ga0316576_10169506 3300031727 Bacteria 1647
1135 Ga0316578_10014511 3300031728 Bacteria 4211
1136 Ga0307516_10000074 3300031730 Bacteria 107888
1137 Ga0307516_10030345 3300031730 Bacteria 5456
1138 Ga0307516_10105324 3300031730 Bacteria 2632
1139 Ga0307516_10234270 3300031730 Bacteria 1538
1140 Ga0316577_10153776 3300031733 Bacteria 1297
1141 Ga0307413_10343193 3300031824 Bacteria 1149
1142 Ga0307413_10346164 3300031824 Bacteria 1145
1143 Ga0307410_10004849 3300031852 Bacteria 7031
1144 Ga0307410_10452231 3300031852 Bacteria 1048
1145 Ga0307410_10578119 3300031852 Bacteria 934
1146 Ga0307406_10092369 3300031901 Bacteria 2041
1147 Ga0307407_10013556 3300031903 Bacteria 3962
1148 Ga0307407_10302403 3300031903 Bacteria 1116
1149 Ga0307407_10486944 3300031903 Bacteria 902
1150 Ga0307412_10929664 3300031911 Bacteria 764
1151 Ga0307409_100018688 3300031995 Bacteria 4669
1152 Ga0307409_101466237 3300031995 Bacteria 709
1153 Ga0307416_100186187 3300032002 Bacteria 1952
1154 Ga0307416_100252354 3300032002 Bacteria 1718
1155 Ga0307416_100804400 3300032002 Bacteria 1036
1156 Ga0307414_10018111 3300032004 Bacteria 4326
1157 Ga0307414_10047590 3300032004 Bacteria 2953
1158 Ga0307414_10546190 3300032004 Bacteria 1032
1159 Ga0307411_10136459 3300032005 Bacteria 1802
1160 Ga0307411_10193077 3300032005 Bacteria 1556
1161 Ga0307411_10359552 3300032005 Bacteria 1190
1162 Ga0307411_10674486 3300032005 Bacteria 897
1163 Ga0307411_10938741 3300032005 Bacteria 771
1164 Ga0316593_10274495 3300032168 Bacteria 634
1165 Ga0307510_10274179 3300033180 Bacteria 1161
1166 Ga0373928_0065015 3300035084 Bacteria 890
1167 Ga0373929_0149819 3300035085 Bacteria 625
1168 Ga0373934_0135099 3300035086 Bacteria 1007
1169 Ga0373940_0023344 3300035088 Bacteria 1595
1170 Ga0373932_0025080 3300035112 Bacteria 1611
1171 Ga0373941_0110915 3300035115 Bacteria 967
1172 Ga0373945_0121515 3300035116 Bacteria 1039
1173 Ga0373953_0025712 3300035117 Bacteria 2251
1174 Ga0373953_0039061 3300035117 Bacteria 1880
1175 Ga0373956_0117566 3300035119 Bacteria 1240
1176 Ga0373956_0134100 3300035119 Bacteria 1161
1177 Ga0373957_0008022 3300035120 Bacteria 3404
1178 Ga0373957_0081084 3300035120 Bacteria 1281
1179 Ga0373943_0140343 3300035170 Bacteria 1301
1180 Ga0373946_0376294 3300035171 Bacteria 714
1181 Ga0373955_0096358 3300035172 Bacteria 1693
1182 Ga0373955_0695653 3300035172 Bacteria 624
1183 Ga0373924_0054226 3300035410 Bacteria 1667
1184 Ga0373924_0118836 3300035410 Bacteria 1146
1185 Ga0373931_0005447 3300035691 Bacteria 5887
1186 Ga0373931_0271616 3300035691 Bacteria 1038
1187 Ga0373935_0250171 3300035692 Bacteria 1240
1188 Ga0373935_0335155 3300035692 Bacteria 1076
1189 Ga0373935_1051349 3300035692 Bacteria 605
1190 Ga0373927_0038422 3300035695 Bacteria 3108
1191 Ga0373927_0192042 3300035695 Bacteria 1340
1192 Ga0373933_0021956 3300035724 Bacteria 3631
1193 Ga0373933_0046465 3300035724 Bacteria 2579
1194 Ga0373947_0034907 3300035725 Bacteria 2976
1195 Ga0373937_0001800 3300036401 Bacteria 18005
1196 Ga0373937_0027578 3300036401 Bacteria 5136
1197 Ga0373937_0067768 3300036401 Bacteria 3289
1198 Ga0316584_0026182 3300036712 Bacteria 4285
1199 Ga0373925_0030135 3300037068 Bacteria 3981
1200 Ga0373925_0031738 3300037068 Bacteria 3885
1201 Ga0373925_0093139 3300037068 Bacteria 2306
1202 Ga0373925_0184100 3300037068 Bacteria 1655
1203 Ga0373925_0292889 3300037068 Bacteria 1313
1204 Ga0395905_0000181 3300037471 Bacteria 100569
1205 Ga0395905_0014221 3300037471 Bacteria 7602
1206 Ga0395905_0016460 3300037471 Bacteria 7029
1207 Ga0395905_0257930 3300037471 Bacteria 1628
1208 Ga0395905_0608129 3300037471 Bacteria 995
1209 Ga0395901_0150045 3300038443 Bacteria 2450
1210 Ga0395901_0604246 3300038443 Bacteria 1106
1211 Ga0436361_0146805 3300039447 Bacteria 7402
1212 Ga0436363_1597640 3300039450 Bacteria 1990
1213 Ga0439461_0008873 3300041410 Bacteria 1813
1214 Ga0439465_0051394 3300041413 Bacteria 1350
1215 Ga0451789_0157665 3300041443 Bacteria 1019
1216 Ga0451791_0009221 3300041451 Bacteria 1051
1217 Ga0451793_1540511 3300041452 Bacteria 1224
1218 Ga0451797_0912579 3300041453 Eukaryota 989
1219 Ga0451797_1551872 3300041453 Bacteria 7638
1220 Ga0451795_1148503 3300041456 Bacteria 1551
1221 Ga0451798_0901360 3300041458 Bacteria 1178
1222 Ga0451800_0047566 3300041459 Bacteria 1239
1223 Ga0451800_1614163 3300041459 Bacteria 1414
1224 Ga0451807_0777239 3300041486 Bacteria 9440
1225 Ga0451807_1377956 3300041486 Bacteria 1511
1226 Ga0451807_1641963 3300041486 Bacteria 809
1227 Ga0451807_2220156 3300041486 Bacteria 1415
1228 Ga0451849_0804836 3300041505 Bacteria 712
1229 Ga0451851_1373861 3300041507 Bacteria 1729
1230 Ga0451843_1298584 3300041509 Bacteria 668
1231 Ga0439431_0019710 3300041997 Bacteria 1605
1232 Ga0439443_046346 3300042003 Bacteria 753
1233 Ga0439445_0012614 3300042004 Bacteria 2034
1234 Ga0439445_0038757 3300042004 Bacteria 1261
1235 Ga0439450_027765 3300042008 Bacteria 1255
1236 Ga0450890_002987 3300042127 Bacteria 2274
1237 Ga0450896_061295 3300042133 Bacteria 613
1238 Ga0450898_007638 3300042134 Bacteria 1687
1239 Ga0439446_0021736 3300042156 Bacteria 1815
1240 Ga0439446_0158167 3300042156 Bacteria 748
1241 Ga0439434_0013032 3300042435 Bacteria 2466
1242 Ga0439434_0017276 3300042435 Bacteria 2159
1243 Ga0439435_0019409 3300042436 Bacteria 1742
1244 Ga0439459_0000127 3300042438 Bacteria 7493
1245 Ga0451577_0066637 3300042876 Bacteria 3211
1246 Ga0466969_0006818 3300044656 Bacteria 6075
1247 Ga0466972_0003044 3300044658 Bacteria 8318
1248 Ga0466972_0056004 3300044658 Bacteria 1896
1249 Ga0466972_0079134 3300044658 Bacteria 1565
1250 Ga0466966_0044917 3300044684 Bacteria 2826
1251 Ga0466961_0010972 3300044693 Bacteria 5789
1252 Ga0466963_0069500 3300044694 Bacteria 2367
1253 Ga0466964_0081107 3300044706 Bacteria 1393
1254 Ga0453684_0000193 3300044712 Bacteria 266146
1255 Ga0453684_0000230 3300044712 Bacteria 241327
1256 Ga0453684_0046441 3300044712 Bacteria 5775
1257 Ga0453684_0442194 3300044712 Bacteria 1449
1258 Ga0453684_0737258 3300044712 Bacteria 1068
1259 Ga0466960_0228590 3300044901 Bacteria 1026
1260 Ga0466959_0061370 3300045049 Bacteria 2733
1261 Ga0451576_0022344 3300045051 Bacteria 6861
1262 Ga0451576_0022530 3300045051 Bacteria 6829
1263 Ga0451576_0074689 3300045051 Bacteria 3527
1264 Ga0451576_0155671 3300045051 Bacteria 2384
1265 Ga0451576_0185710 3300045051 Bacteria 2171
1266 Ga0495590_0010140 3300046457 Bacteria 3554
1267 Ga0495629_0043805 3300046459 Bacteria 3142
1268 Ga0495629_0243995 3300046459 Bacteria 1236
1269 Ga0495638_0045920 3300046460 Bacteria 2746
1270 Ga0495641_0127837 3300046461 Bacteria 1134
1271 Ga0495641_0327894 3300046461 Bacteria 691
1272 Ga0495580_0152087 3300046472 Bacteria 1603
1273 Ga0495582_0229726 3300046473 Bacteria 1062
1274 Ga0495582_0325750 3300046473 Bacteria 884
1275 Ga0495639_0117036 3300046475 Bacteria 1269
1276 Ga0495662_0138451 3300046476 Bacteria 1198
1277 Ga0495584_0012692 3300046491 Bacteria 4299
1278 Ga0495594_0548823 3300046499 Bacteria 656
1279 Ga0495583_0059658 3300046506 Bacteria 1709
1280 Ga0495606_0208189 3300046507 Bacteria 1110
1281 Ga0495610_0054273 3300046512 Bacteria 1937
1282 Ga0495616_0040227 3300046513 Bacteria 2390
1283 Ga0495620_0310223 3300046515 Bacteria 599
1284 Ga0495628_0303682 3300046516 Bacteria 1181
1285 Ga0495631_0167705 3300046518 Bacteria 942
1286 Ga0495632_0015428 3300046519 Bacteria 4284
1287 Ga0495632_0054846 3300046519 Bacteria 1952
1288 Ga0495663_0023604 3300046525 Bacteria 1782
1289 Ga0495586_0280199 3300046535 Bacteria 954
1290 Ga0495598_0052781 3300046537 Bacteria 1229
1291 Ga0495609_0234770 3300046538 Bacteria 758
1292 Ga0495621_0144487 3300046539 Bacteria 932
1293 Ga0495597_0082869 3300046542 Bacteria 1370
1294 Ga0495645_0036404 3300046543 Bacteria 3587
1295 Ga0495645_0187970 3300046543 Bacteria 1410
1296 Ga0495656_0260898 3300046615 Bacteria 878
1297 Ga0495634_0321409 3300046642 Bacteria 932
1298 Ga0495625_0018541 3300046660 Bacteria 5428
1299 Ga0495635_0234966 3300046663 Bacteria 1238
1300 Ga0495635_0296332 3300046663 Bacteria 1085
1301 Ga0495659_0019760 3300046664 Bacteria 2255
1302 Ga0495659_0031504 3300046664 Bacteria 1851
1303 Ga0495659_0147212 3300046664 Bacteria 943
1304 Ga0495588_0412687 3300046674 Bacteria 709
1305 Ga0495657_0405843 3300046675 Bacteria 801
1306 Ga0495623_0045280 3300046679 Bacteria 2795
1307 Ga0495646_0222257 3300046680 Bacteria 1021
1308 Ga0495647_0062112 3300046681 Bacteria 1477
1309 Ga0495647_0090024 3300046681 Bacteria 1257
1310 Ga0495647_0387005 3300046681 Bacteria 641
1311 Ga0495647_0425945 3300046681 Bacteria 612
1312 Ga0495658_0044667 3300046683 Bacteria 2483
1313 Ga0495658_0049965 3300046683 Bacteria 2364
1314 Ga0495669_0261354 3300046684 Bacteria 832
1315 Ga0495613_0324150 3300046689 Bacteria 1063
1316 Ga0495613_0371810 3300046689 Bacteria 979
1317 Ga0495649_0011083 3300046694 Bacteria 5308
1318 Ga0495600_0144433 3300046809 Bacteria 1543
1319 Ga0495636_0017379 3300047318 Bacteria 2879
1320 Ga0495636_0155614 3300047318 Bacteria 1028
1321 Ga0495687_006287 3300047443 Bacteria 7322
1322 Ga0495677_0028630 3300047445 Bacteria 2024
1323 Ga0495685_050358 3300047447 Bacteria 1414
1324 Ga0495684_0137873 3300047471 Bacteria 1830
1325 Ga0495684_0370828 3300047471 Bacteria 1012
1326 Ga0496100_0379691 3300048903 Bacteria 1073
1327 Ga0496100_0604173 3300048903 Bacteria 852
1328 Ga0496100_1105381 3300048903 Bacteria 625
1329 Ga0496102_0330722 3300048905 Bacteria 1435
1330 Ga0496102_0338214 3300048905 Bacteria 1418
1331 Ga0496102_0451427 3300048905 Bacteria 1206
1332 Ga0496102_1265116 3300048905 Bacteria 657
1333 Ga0496103_0389839 3300048906 Bacteria 895
1334 Ga0496104_0069797 3300048907 Bacteria 3340
1335 Ga0496104_0177547 3300048907 Bacteria 2040
1336 Ga0496104_0823093 3300048907 Bacteria 834
1337 Ga0496104_1056176 3300048907 Bacteria 716
1338 Ga0496104_1143830 3300048907 Bacteria 682
1339 Ga0496104_1149072 3300048907 Bacteria 680
1340 Ga0496105_0072403 3300048908 Bacteria 2848
1341 Ga0496105_0317604 3300048908 Bacteria 1249
1342 Ga0496106_0008452 3300048909 Bacteria 7618
1343 Ga0496106_0506012 3300048909 Bacteria 970
1344 Ga0496107_0089606 3300048910 Bacteria 2246
1345 Ga0496107_0397017 3300048910 Bacteria 1026
1346 Ga0496108_0007703 3300048911 Bacteria 8724
1347 Ga0496108_0180029 3300048911 Bacteria 1830
1348 Ga0496108_0388908 3300048911 Bacteria 1218
1349 Ga0496109_0081575 3300048912 Bacteria 2980
1350 Ga0496109_0756500 3300048912 Bacteria 909
1351 Ga0496109_0759772 3300048912 Bacteria 907
1352 Ga0496110_0038343 3300048913 Bacteria 4169
1353 Ga0496110_0111050 3300048913 Bacteria 2464
1354 Ga0496110_0316002 3300048913 Bacteria 1423
1355 Ga0496110_0407331 3300048913 Bacteria 1240
1356 Ga0496111_0054984 3300048914 Bacteria 2879
1357 Ga0496112_0120053 3300048915 Bacteria 2599
1358 Ga0496112_0182920 3300048915 Bacteria 2060
1359 Ga0496112_0284847 3300048915 Bacteria 1599
1360 Ga0496112_0301669 3300048915 Bacteria 1547
1361 Ga0496113_0123910 3300048916 Bacteria 2023
1362 Ga0496114_0031396 3300048917 Bacteria 4372
1363 Ga0496114_0211985 3300048917 Bacteria 1699
1364 Ga0496114_0335546 3300048917 Bacteria 1337
1365 Ga0496114_0414094 3300048917 Bacteria 1194
1366 Ga0496115_0111406 3300048918 Bacteria 2248
1367 Ga0496125_0002326 3300048928 Bacteria 25026
1368 Ga0501305_050978 3300049161 Bacteria 694
1369 Ga0495682_0023874 3300049460 Bacteria 2282
1370 Ga0501299_013151 3300049522 Bacteria 1424
1371 Ga0501311_005136 3300049527 Bacteria 1422
1372 Ga0501311_046578 3300049527 Bacteria 670
1373 Ga0501312_010036 3300049528 Bacteria 1260
1374 Ga0501317_048301 3300049533 Bacteria 669
1375 Ga0501031_0015019 3300049568 Bacteria 5030
1376 Ga0501031_0053226 3300049568 Bacteria 2637
1377 Ga0501032_0002974 3300049569 Bacteria 13154
1378 Ga0501032_0022224 3300049569 Bacteria 4399
1379 Ga0501033_0001594 3300049570 Bacteria 19939
1380 Ga0501033_0067120 3300049570 Bacteria 2637
1381 Ga0501034_0040330 3300049571 Bacteria 4725
1382 Ga0501036_0004807 3300049572 Bacteria 10918
1383 Ga0501036_0020745 3300049572 Bacteria 5518
1384 Ga0501037_0002776 3300049573 Bacteria 12676
1385 Ga0501038_0002215 3300049574 Bacteria 18081
1386 Ga0501038_0018551 3300049574 Bacteria 6283
1387 Ga0501038_0022440 3300049574 Bacteria 5655
1388 Ga0501038_0243899 3300049574 Bacteria 1425
1389 Ga0501039_0005521 3300049575 Bacteria 9568
1390 Ga0501039_0017532 3300049575 Bacteria 5492
1391 Ga0501039_0548926 3300049575 Bacteria 907
1392 Ga0501040_0007076 3300049576 Bacteria 7272
1393 Ga0501040_0131851 3300049576 Bacteria 1758
1394 Ga0501042_0001122 3300049578 Bacteria 15421
1395 Ga0501043_0005777 3300049579 Bacteria 9960
1396 Ga0501043_0052424 3300049579 Bacteria 3204
1397 Ga0501043_0168468 3300049579 Bacteria 1709
1398 Ga0501046_0001218 3300049580 Bacteria 24929
1399 Ga0501046_0013156 3300049580 Bacteria 7020
1400 Ga0501047_0022202 3300049581 Bacteria 6097
1401 Ga0501048_0165945 3300049582 Bacteria 1563
1402 Ga0501067_0251823 3300049583 Bacteria 983
1403 Ga0501068_0006058 3300049584 Bacteria 6647
1404 Ga0501070_0045795 3300049586 Bacteria 3638
1405 Ga0501072_1210163 3300049588 Bacteria 587
1406 Ga0501074_0439034 3300049590 Bacteria 926
1407 Ga0501075_0735973 3300049591 Bacteria 751
1408 Ga0501077_0034548 3300049593 Bacteria 3218
1409 Ga0501216_014205 3300049660 Bacteria 1328
1410 Ga0501230_087436 3300049667 Bacteria 659
1411 Ga0501250_051263 3300049680 Bacteria 634
1412 Ga0501221_100869 3300049704 Bacteria 716
1413 Ga0501080_0135281 3300049742 Bacteria 2281
1414 Ga0501081_0280803 3300049743 Bacteria 1219
1415 Ga0501283_016823 3300049779 Bacteria 1138
1416 Ga0501035_0001588 3300049822 Bacteria 23027
1417 Ga0501035_0035428 3300049822 Bacteria 4529
1418 Ga0501035_0069458 3300049822 Bacteria 3123
1419 Ga0501035_0380759 3300049822 Bacteria 1177
1420 Ga0501044_0009871 3300049823 Bacteria 10376
1421 Ga0501044_0015564 3300049823 Bacteria 8194
1422 Ga0501044_0051133 3300049823 Bacteria 4261
1423 Ga0501045_0005631 3300049824 Bacteria 8671
1424 Ga0501045_0118746 3300049824 Bacteria 1963
1425 Ga0501045_0228133 3300049824 Bacteria 1386
1426 Ga0501045_0242970 3300049824 Bacteria 1340
1427 nmdc:mga03n38_557177_c1 3300050490 Bacteria 649
1428 nmdc:mga0yw44_323358_c1 3300050492 Bacteria 1036
1429 nmdc:mga0k408_1307_c1 3300050493 Bacteria 13451
1430 nmdc:mga0k408_224880_c1 3300050493 Bacteria 1120
1431 nmdc:mga0k408_4141_c1 3300050493 Bacteria 7702
1432 nmdc:mga0k408_74967_c1 3300050493 Bacteria 1977
1433 nmdc:mga0k408_9121_c1 3300050493 Bacteria 5342
1434 nmdc:mga06z11_110453_c1 3300050494 Bacteria 1522
1435 nmdc:mga06z11_115242_c1 3300050494 Bacteria 1493
1436 nmdc:mga04h51_69802_c1 3300050495 Bacteria 1224
1437 nmdc:mga07m45_10948_c1 3300050496 Bacteria 4753
1438 nmdc:mga07m45_17194_c1 3300050496 Bacteria 3880
1439 nmdc:mga07m45_24473_c1 3300050496 Bacteria 3308
1440 nmdc:mga07m45_27707_c1 3300050496 Bacteria 3124
1441 nmdc:mga07m45_543308_c1 3300050496 Bacteria 672
1442 nmdc:mga07m45_8413_c1 3300050496 Bacteria 5303
1443 nmdc:mga05p37_111891_c1 3300050507 Bacteria 3358
1444 nmdc:mga05p37_172253_c1 3300050507 Bacteria 2639
1445 nmdc:mga05p37_223907_c1 3300050507 Bacteria 2269
1446 nmdc:mga05p37_69600_c1 3300050507 Bacteria 4329
1447 nmdc:mga09592_31896_c1 3300050508 Bacteria 4391
1448 nmdc:mga09592_3840_c1 3300050508 Bacteria 12099
1449 nmdc:mga09592_412311_c1 3300050508 Bacteria 1167
1450 nmdc:mga09592_43252_c1 3300050508 Bacteria 3791
1451 nmdc:mga09592_6731_c1 3300050508 Bacteria 9351
1452 nmdc:mga09592_902525_c1 3300050508 Bacteria 743
1453 nmdc:mga0qj67_44205_c1 3300050509 Bacteria 3509
1454 nmdc:mga0qj67_44942_c1 3300050509 Bacteria 3484
1455 nmdc:mga0qj67_65227_c1 3300050509 Bacteria 2899
1456 nmdc:mga0qj67_875337_c1 3300050509 Bacteria 709
1457 nmdc:mga06r32_20968_c1 3300050510 Bacteria 6026
1458 nmdc:mga06r32_21094_c1 3300050510 Bacteria 6010
1459 nmdc:mga06r32_30066_c1 3300050510 Bacteria 5096
1460 nmdc:mga06r32_39022_c1 3300050510 Bacteria 4504
1461 nmdc:mga06r32_5511_c1 3300050510 Bacteria 11401
1462 nmdc:mga06r32_77831_c1 3300050510 Bacteria 3222
1463 nmdc:mga08y16_149140_c1 3300050511 Bacteria 2431
1464 nmdc:mga08y16_2267_c1 3300050511 Bacteria 19723
1465 nmdc:mga08y16_417153_c1 3300050511 Bacteria 1372
1466 nmdc:mga08y16_740776_c1 3300050511 Bacteria 979
1467 nmdc:mga08y16_971_c1 3300050511 Bacteria 27901
1468 nmdc:mga0n895_1077622_c1 3300050512 Bacteria 782
1469 nmdc:mga0n895_164117_c1 3300050512 Bacteria 2253
1470 nmdc:mga0n895_351631_c1 3300050512 Bacteria 1493
1471 nmdc:mga0n895_432066_c1 3300050512 Bacteria 1331
1472 nmdc:mga0n895_83466_c1 3300050512 Bacteria 3187
1473 nmdc:mga0rr50_11930_c1 3300050513 Bacteria 5589
1474 nmdc:mga0rr50_42324_c1 3300050513 Bacteria 3326
1475 nmdc:mga0rr50_554848_c1 3300050513 Bacteria 978
1476 nmdc:mga08x19_32808_c1 3300050514 Bacteria 3275
1477 nmdc:mga0a205_106757_c1 3300050515 Bacteria 2698
1478 nmdc:mga0a205_11720_c1 3300050515 Bacteria 8088
1479 nmdc:mga0a205_324442_c1 3300050515 Bacteria 1410
1480 nmdc:mga0a205_339571_c1 3300050515 Bacteria 1371
1481 nmdc:mga0a205_45271_c1 3300050515 Bacteria 4243
1482 nmdc:mga0a205_5074_c1 3300050515 Bacteria 11837
1483 nmdc:mga0sz30_46797_c1 3300050516 Bacteria 1827
1484 nmdc:mga0sz30_6986_c1 3300050516 Bacteria 4219
1485 Ga0495601_0009126 3300053077 Bacteria 5857
1486 Ga0495601_0413324 3300053077 Bacteria 874
1487 Ga0495619_0169213 3300053085 Bacteria 1511
1488 Ga0495619_0540236 3300053085 Bacteria 800
1489 Ga0500644_0163361 3300053088 Bacteria 901
1490 Ga0500651_0305076 3300053093 Bacteria 912
1491 Ga0500555_057941 3300053103 Bacteria 1047
1492 Ga0500562_000577 3300053108 Bacteria 8802
1493 Ga0500572_199005 3300053111 Bacteria 656
1494 Ga0500642_0076400 3300053130 Bacteria 1531
1495 Ga0500652_047554 3300053131 Bacteria 1743
1496 Ga0500658_0016945 3300053134 Bacteria 2718
1497 Ga0500559_0164618 3300053136 Bacteria 1043
1498 Ga0500568_0080678 3300053139 Bacteria 1235
1499 Ga0500586_056540 3300053145 Bacteria 1360
1500 Ga0500588_0121427 3300053146 Bacteria 922
1501 Ga0500622_0000671 3300053156 Bacteria 30240
1502 Ga0500636_0247282 3300053177 Bacteria 912
1503 Ga0500552_060897 3300053733 Bacteria 660
1504 Ga0590071_000019 3300059421 Bacteria 42395
1505 Ga0590071_000517 3300059421 Bacteria 11261
1506 Ga0590071_046832 3300059421 Bacteria 1045
1507 Ga0590074_000358 3300059423 Bacteria 6384
1508 Ga0590074_000618 3300059423 Bacteria 5374
1509 Ga0590075_000532 3300059424 Bacteria 10291
1510 Ga0590075_000655 3300059424 Bacteria 9211
1511 Ga0590077_001823 3300059426 Bacteria 4754
1512 Ga0590077_002027 3300059426 Bacteria 4443
1513 Ga0590077_012554 3300059426 Bacteria 1758
1514 Ga0587077_021707 3300059493 Bacteria 1142
1515 Ga0587094_075766 3300059513 Bacteria 614
1516 Ga0587125_034082 3300059607 Bacteria 663
1517 Ga0587101_013175 3300059623 Bacteria 1086
1518 Ga0587068_063280 3300059641 Bacteria 716
1519 Ga0587111_0093076 3300060346 Bacteria 739
1520 Ga0501082_0487244 3300060353 Bacteria 1078
1521 Ga0501082_1165029 3300060353 Bacteria 674
1522 Ga0466962_0012722 3300061719 Bacteria 4048
1523 Ga0530510_0411191 3300061734 Bacteria 1021
1524 Ga0530510_0619177 3300061734 Bacteria 824

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042133 Ga0450896_061295 Ga0450896_061295_128_583 149
2 3300046539 Ga0495621_0144487 Ga0495621_0144487_445_903 150
3 3300009094 Ga0111539_10018976 Ga0111539_100189762 151
4 3300009147 Ga0114129_10305446 Ga0114129_103054462 151
5 3300009177 Ga0105248_10012122 Ga0105248_100121224 151
6 3300009553 Ga0105249_10403276 Ga0105249_104032762 151
7 3300011119 Ga0105246_10015278 Ga0105246_100152783 151
8 3300011119 Ga0105246_10894175 Ga0105246_108941752 151
9 3300012505 Ga0157339_1025357 Ga0157339_10253572 151
10 3300014326 Ga0157380_10008631 Ga0157380_100086312 151
11 3300014969 Ga0157376_10439788 Ga0157376_104397882 151
12 3300035115 Ga0373941_0110915 Ga0373941_0110915_423_878 151
13 3300042008 Ga0439450_027765 Ga0439450_027765_767_1222 151
14 3300046475 Ga0495639_0117036 Ga0495639_0117036_14_475 151
15 3300048907 Ga0496104_1149072 Ga0496104_1149072_196_660 151
16 3300050508 nmdc:mga09592_43252_c1 nmdc:mga09592_43252_c1_2087_2542 151
17 3300050508 nmdc:mga09592_902525_c1 nmdc:mga09592_902525_c1_166_630 151
18 3300050509 nmdc:mga0qj67_44942_c1 nmdc:mga0qj67_44942_c1_1919_2374 151
19 3300050510 nmdc:mga06r32_5511_c1 nmdc:mga06r32_5511_c1_8783_9238 151
20 3300050511 nmdc:mga08y16_2267_c1 nmdc:mga08y16_2267_c1_18592_19047 151
21 3300050515 nmdc:mga0a205_5074_c1 nmdc:mga0a205_5074_c1_7126_7581 151
22 3300053136 Ga0500559_0164618 Ga0500559_0164618_529_999 151
23 3300026088 Ga0207641_11112579 Ga0207641_111125791 157
24 3300031824 Ga0307413_10343193 Ga0307413_103431932 159
25 3300032004 Ga0307414_10018111 Ga0307414_100181114 159
26 3300032005 Ga0307411_10938741 Ga0307411_109387412 159
27 iso_pu_bacteria 2643221585 2643937486 159
28 iso_pu_bacteria 2643221656 2644315024 159
29 3300005844 Ga0068862_102022885 Ga0068862_1020228851 160
30 3300009553 Ga0105249_11399962 Ga0105249_113999621 160
31 3300025918 Ga0207662_10287691 Ga0207662_102876912 160
32 3300026088 Ga0207641_10639077 Ga0207641_106390772 160
33 3300035692 Ga0373935_0335155 Ga0373935_0335155_15_518 160
34 3300037068 Ga0373925_0030135 Ga0373925_0030135_2597_3100 160
35 3300048907 Ga0496104_1143830 Ga0496104_1143830_115_618 160
36 3300005365 Ga0070688_100025432 Ga0070688_1000254322 161
37 3300005406 Ga0070703_10016210 Ga0070703_100162102 161
38 3300005435 Ga0070714_100175529 Ga0070714_1001755292 161
39 3300005437 Ga0070710_10024681 Ga0070710_100246812 161
40 3300005439 Ga0070711_100735459 Ga0070711_1007354592 161
41 3300005466 Ga0070685_10155299 Ga0070685_101552992 161
42 3300005468 Ga0070707_100102738 Ga0070707_1001027382 161
43 3300005844 Ga0068862_100340865 Ga0068862_1003408652 161
44 3300006028 Ga0070717_10320180 Ga0070717_103201802 161
45 3300006175 Ga0070712_100304640 Ga0070712_1003046402 161
46 3300025230 Ga0209563_100013 Ga0209563_10001350 161
47 3300025898 Ga0207692_10016014 Ga0207692_100160142 161
48 3300025915 Ga0207693_10178230 Ga0207693_101782302 161
49 3300025916 Ga0207663_10580444 Ga0207663_105804442 161
50 3300025944 Ga0207661_10152925 Ga0207661_101529252 161
51 3300031239 Ga0265328_10027596 Ga0265328_100275962 161
52 3300031250 Ga0265331_10001753 Ga0265331_1000175310 161
53 3300031251 Ga0265327_10000035 Ga0265327_1000003541 161
54 3300035086 Ga0373934_0135099 Ga0373934_0135099_400_933 161
55 3300035117 Ga0373953_0025712 Ga0373953_0025712_551_1084 161
56 3300035119 Ga0373956_0117566 Ga0373956_0117566_407_940 161
57 3300035120 Ga0373957_0081084 Ga0373957_0081084_398_931 161
58 3300035724 Ga0373933_0021956 Ga0373933_0021956_1429_1962 161
59 3300036401 Ga0373937_0001800 Ga0373937_0001800_7327_7860 161
60 3300039447 Ga0436361_0146805 Ga0436361_0146805_3003_3494 161
61 3300049593 Ga0501077_0034548 Ga0501077_0034548_1763_2290 161
62 3300053103 Ga0500555_057941 Ga0500555_057941_176_709 161
63 3300053146 Ga0500588_0121427 Ga0500588_0121427_95_619 161
64 3300002863 Ga0006769J43182_105455 Ga0006769J43182_1054551 162
65 3300003163 Ga0006759J45824_1045780 Ga0006759J45824_10457802 162
66 3300003300 Ga0006758J48902_1019290 Ga0006758J48902_10192902 162
67 3300003322 rootL2_10230854 rootL2_102308542 162
68 3300003323 rootH1_10100721 rootH1_101007212 162
69 3300003323 rootH1_10187746 rootH1_101877462 162
70 3300003323 rootH1_10327373 rootH1_103273732 162
71 3300003693 Ga0032354_1103123 Ga0032354_11031231 162
72 3300005337 Ga0070682_100005605 Ga0070682_1000056055 162
73 3300005337 Ga0070682_100173739 Ga0070682_1001737392 162
74 3300005337 Ga0070682_101249269 Ga0070682_1012492691 162
75 3300005347 Ga0070668_100233825 Ga0070668_1002338252 162
76 3300005438 Ga0070701_10084269 Ga0070701_100842692 162
77 3300005440 Ga0070705_100873731 Ga0070705_1008737311 162
78 3300005441 Ga0070700_100213705 Ga0070700_1002137052 162
79 3300005455 Ga0070663_100034583 Ga0070663_1000345834 162
80 3300005456 Ga0070678_100228291 Ga0070678_1002282912 162
81 3300005459 Ga0068867_100017084 Ga0068867_1000170844 162
82 3300005466 Ga0070685_10029884 Ga0070685_100298842 162
83 3300005535 Ga0070684_100531861 Ga0070684_1005318612 162
84 3300005543 Ga0070672_100119226 Ga0070672_1001192262 162
85 3300005548 Ga0070665_100064336 Ga0070665_1000643362 162
86 3300005615 Ga0070702_100136383 Ga0070702_1001363832 162
87 3300005617 Ga0068859_100041330 Ga0068859_1000413302 162
88 3300005719 Ga0068861_100013827 Ga0068861_1000138273 162
89 3300005841 Ga0068863_101239011 Ga0068863_1012390111 162
90 3300005843 Ga0068860_100091655 Ga0068860_1000916552 162
91 3300006195 Ga0075366_10005371 Ga0075366_100053713 162
92 3300006195 Ga0075366_10069324 Ga0075366_100693242 162
93 3300006195 Ga0075366_10267163 Ga0075366_102671632 162
94 3300006881 Ga0068865_100180960 Ga0068865_1001809602 162
95 3300006931 Ga0097620_100041330 Ga0097620_1000413303 162
96 3300009177 Ga0105248_10435512 Ga0105248_104355122 162
97 3300009553 Ga0105249_10039427 Ga0105249_100394273 162
98 3300014325 Ga0163163_10015273 Ga0163163_100152736 162
99 3300025938 Ga0207704_10247247 Ga0207704_102472472 162
100 3300025941 Ga0207711_10480263 Ga0207711_104802632 162
101 3300025961 Ga0207712_10046283 Ga0207712_100462832 162
102 3300025972 Ga0207668_10189392 Ga0207668_101893922 162
103 3300026067 Ga0207678_10050899 Ga0207678_100508992 162
104 3300026075 Ga0207708_10274404 Ga0207708_102744042 162
105 3300026089 Ga0207648_10026058 Ga0207648_100260582 162
106 3300026118 Ga0207675_100005243 Ga0207675_1000052439 162
107 3300026118 Ga0207675_100575552 Ga0207675_1005755522 162
108 3300028379 Ga0268266_10031811 Ga0268266_100318114 162
109 3300028381 Ga0268264_10110095 Ga0268264_101100952 162
110 3300031507 Ga0307509_10128392 Ga0307509_101283922 162
111 3300041452 Ga0451793_1540511 Ga0451793_1540511_129_638 162
112 3300041453 Ga0451797_0912579 Ga0451797_0912579_145_654 162
113 3300041453 Ga0451797_1551872 Ga0451797_1551872_2278_2787 162
114 3300041459 Ga0451800_0047566 Ga0451800_0047566_504_1013 162
115 3300041486 Ga0451807_0777239 Ga0451807_0777239_7157_7666 162
116 3300041507 Ga0451851_1373861 Ga0451851_1373861_1150_1659 162
117 3300042004 Ga0439445_0038757 Ga0439445_0038757_42_551 162
118 3300044712 Ga0453684_0046441 Ga0453684_0046441_986_1480 162
119 3300049822 Ga0501035_0069458 Ga0501035_0069458_2324_2833 162
120 3300050493 nmdc:mga0k408_1307_c1 nmdc:mga0k408_1307_c1_4122_4616 162
121 3300050493 nmdc:mga0k408_4141_c1 nmdc:mga0k408_4141_c1_4642_5136 162
122 3300053085 Ga0495619_0169213 Ga0495619_0169213_390_923 162
123 3300003323 rootH1_10027290 rootH1_100272903 163
124 3300003323 rootH1_10140328 rootH1_101403283 163
125 3300003794 Ga0055531_10000046 Ga0055531_1000004631 163
126 3300005337 Ga0070682_100330385 Ga0070682_1003303851 163
127 3300005340 Ga0070689_100228176 Ga0070689_1002281762 163
128 3300005364 Ga0070673_100756462 Ga0070673_1007564622 163
129 3300005365 Ga0070688_100281975 Ga0070688_1002819752 163
130 3300005543 Ga0070672_100639091 Ga0070672_1006390912 163
131 3300005563 Ga0068855_100010407 Ga0068855_1000104075 163
132 3300005616 Ga0068852_100571369 Ga0068852_1005713691 163
133 3300005840 Ga0068870_10237891 Ga0068870_102378912 163
134 3300006195 Ga0075366_10386707 Ga0075366_103867072 163
135 3300006844 Ga0075428_100689046 Ga0075428_1006890462 163
136 3300006847 Ga0075431_100001080 Ga0075431_1000010804 163
137 3300006871 Ga0075434_100296160 Ga0075434_1002961602 163
138 3300009545 Ga0105237_10180239 Ga0105237_101802392 163
139 3300013102 Ga0157371_10360090 Ga0157371_103600902 163
140 3300014745 Ga0157377_10106928 Ga0157377_101069282 163
141 3300025298 Ga0209050_1006012 Ga0209050_10060126 163
142 3300025304 Ga0209257_1000047 Ga0209257_1000047353 163
143 3300025304 Ga0209257_1034099 Ga0209257_10340992 163
144 3300025914 Ga0207671_10106204 Ga0207671_101062042 163
145 3300025936 Ga0207670_10217698 Ga0207670_102176982 163
146 3300025940 Ga0207691_10300502 Ga0207691_103005022 163
147 3300025949 Ga0207667_10012327 Ga0207667_100123275 163
148 3300025960 Ga0207651_10693933 Ga0207651_106939332 163
149 3300031507 Ga0307509_10001260 Ga0307509_1000126030 163
150 3300031649 Ga0307514_10010565 Ga0307514_100105656 163
151 3300031852 Ga0307410_10452231 Ga0307410_104522312 163
152 3300031903 Ga0307407_10486944 Ga0307407_104869442 163
153 3300037471 Ga0395905_0014221 Ga0395905_0014221_232_726 163
154 3300042436 Ga0439435_0019409 Ga0439435_0019409_262_759 163
155 3300044712 Ga0453684_0442194 Ga0453684_0442194_703_1197 163
156 3300046681 Ga0495647_0387005 Ga0495647_0387005_67_564 163
157 3300048928 Ga0496125_0002326 Ga0496125_0002326_10177_10674 163
158 3300049588 Ga0501072_1210163 Ga0501072_1210163_48_545 163
159 3300050496 nmdc:mga07m45_543308_c1 nmdc:mga07m45_543308_c1_120_617 163
160 3300050508 nmdc:mga09592_412311_c1 nmdc:mga09592_412311_c1_356_853 163
161 3300050510 nmdc:mga06r32_39022_c1 nmdc:mga06r32_39022_c1_1040_1537 163
162 iso_pu_bacteria 2585428057 2587726620 163
163 iso_pu_bacteria 2585428058 2587733321 163
164 iso_pu_bacteria 2588253510 2588290919 163
165 iso_pu_bacteria 2643221592 2643972140 163
166 iso_pu_bacteria 2643221625 2644142339 163
167 iso_pu_bacteria 2643221648 2644276033 163
168 iso_pu_bacteria 2831864461 2831867431 163
169 iso_pu_bacteria 2886848708 2886852524 163
170 3300004799 Ga0058863_11261535 Ga0058863_112615351 164
171 3300004799 Ga0058863_11749444 Ga0058863_117494442 164
172 3300004800 Ga0058861_11693974 Ga0058861_116939742 164
173 3300004800 Ga0058861_11949201 Ga0058861_119492011 164
174 3300004803 Ga0058862_10264210 Ga0058862_102642101 164
175 3300004803 Ga0058862_12851436 Ga0058862_128514362 164
176 3300005293 Ga0065715_10146303 Ga0065715_101463032 164
177 3300005327 Ga0070658_10001039 Ga0070658_1000103912 164
178 3300005337 Ga0070682_100033327 Ga0070682_1000333273 164
179 3300005339 Ga0070660_100736877 Ga0070660_1007368772 164
180 3300005440 Ga0070705_100035940 Ga0070705_1000359403 164
181 3300005444 Ga0070694_100375183 Ga0070694_1003751832 164
182 3300005458 Ga0070681_11397645 Ga0070681_113976451 164
183 3300005530 Ga0070679_100079331 Ga0070679_1000793311 164
184 3300005530 Ga0070679_100526366 Ga0070679_1005263662 164
185 3300005545 Ga0070695_100019296 Ga0070695_1000192963 164
186 3300005548 Ga0070665_100001376 Ga0070665_1000013766 164
187 3300005563 Ga0068855_100058049 Ga0068855_1000580492 164
188 3300005614 Ga0068856_101392785 Ga0068856_1013927852 164
189 3300005616 Ga0068852_100088058 Ga0068852_1000880582 164
190 3300005719 Ga0068861_100450752 Ga0068861_1004507522 164
191 3300005719 Ga0068861_100572959 Ga0068861_1005729591 164
192 3300006186 Ga0075369_10002428 Ga0075369_100024284 164
193 3300009093 Ga0105240_10015776 Ga0105240_100157766 164
194 3300009176 Ga0105242_11177429 Ga0105242_111774291 164
195 3300009177 Ga0105248_10565035 Ga0105248_105650352 164
196 3300009545 Ga0105237_10000014 Ga0105237_10000014177 164
197 3300013308 Ga0157375_12037260 Ga0157375_120372601 164
198 3300025885 Ga0207653_10053071 Ga0207653_100530712 164
199 3300025909 Ga0207705_10012439 Ga0207705_100124394 164
200 3300025912 Ga0207707_10884979 Ga0207707_108849791 164
201 3300025913 Ga0207695_10009988 Ga0207695_100099882 164
202 3300025914 Ga0207671_10000219 Ga0207671_1000021926 164
203 3300025919 Ga0207657_10758265 Ga0207657_107582651 164
204 3300025921 Ga0207652_10002474 Ga0207652_100024743 164
205 3300025921 Ga0207652_10195289 Ga0207652_101952892 164
206 3300025921 Ga0207652_10783417 Ga0207652_107834171 164
207 3300025927 Ga0207687_10426681 Ga0207687_104266812 164
208 3300025927 Ga0207687_11052468 Ga0207687_110524681 164
209 3300025932 Ga0207690_10200034 Ga0207690_102000342 164
210 3300025941 Ga0207711_10288472 Ga0207711_102884722 164
211 3300025941 Ga0207711_10421846 Ga0207711_104218462 164
212 3300026121 Ga0207683_11158355 Ga0207683_111583552 164
213 3300026142 Ga0207698_10066427 Ga0207698_100664272 164
214 3300028379 Ga0268266_10020758 Ga0268266_100207582 164
215 3300028563 Ga0265319_1006235 Ga0265319_10062352 164
216 3300028573 Ga0265334_10005463 Ga0265334_100054632 164
217 3300028577 Ga0265318_10000192 Ga0265318_1000019237 164
218 3300028786 Ga0307517_10110446 Ga0307517_101104463 164
219 3300028794 Ga0307515_10213639 Ga0307515_102136392 164
220 3300028800 Ga0265338_10126924 Ga0265338_101269242 164
221 3300029957 Ga0265324_10136631 Ga0265324_101366312 164
222 3300031235 Ga0265330_10000751 Ga0265330_1000075110 164
223 3300031238 Ga0265332_10000644 Ga0265332_1000064418 164
224 3300031239 Ga0265328_10001121 Ga0265328_100011219 164
225 3300031240 Ga0265320_10000813 Ga0265320_1000081312 164
226 3300031242 Ga0265329_10000902 Ga0265329_100009027 164
227 3300031249 Ga0265339_10048908 Ga0265339_100489082 164
228 3300031250 Ga0265331_10000307 Ga0265331_100003072 164
229 3300031344 Ga0265316_10003048 Ga0265316_1000304811 164
230 3300031507 Ga0307509_10552462 Ga0307509_105524622 164
231 3300031595 Ga0265313_10047288 Ga0265313_100472882 164
232 3300031616 Ga0307508_10092529 Ga0307508_100925292 164
233 3300031711 Ga0265314_10071473 Ga0265314_100714732 164
234 3300031712 Ga0265342_10004347 Ga0265342_100043472 164
235 3300031901 Ga0307406_10092369 Ga0307406_100923692 164
236 3300032005 Ga0307411_10359552 Ga0307411_103595522 164
237 3300035172 Ga0373955_0096358 Ga0373955_0096358_476_1012 164
238 3300035695 Ga0373927_0192042 Ga0373927_0192042_176_676 164
239 3300036401 Ga0373937_0027578 Ga0373937_0027578_4315_4851 164
240 3300037068 Ga0373925_0093139 Ga0373925_0093139_1324_1824 164
241 3300037471 Ga0395905_0257930 Ga0395905_0257930_450_950 164
242 3300041486 Ga0451807_1641963 Ga0451807_1641963_103_600 164
243 3300042876 Ga0451577_0066637 Ga0451577_0066637_1069_1569 164
244 3300044712 Ga0453684_0000230 Ga0453684_0000230_189784_190284 164
245 3300044712 Ga0453684_0737258 Ga0453684_0737258_427_939 164
246 3300045051 Ga0451576_0022530 Ga0451576_0022530_990_1502 164
247 3300046457 Ga0495590_0010140 Ga0495590_0010140_232_732 164
248 3300046459 Ga0495629_0243995 Ga0495629_0243995_270_806 164
249 3300046461 Ga0495641_0327894 Ga0495641_0327894_84_584 164
250 3300046506 Ga0495583_0059658 Ga0495583_0059658_323_823 164
251 3300046513 Ga0495616_0040227 Ga0495616_0040227_395_895 164
252 3300046515 Ga0495620_0310223 Ga0495620_0310223_10_510 164
253 3300046518 Ga0495631_0167705 Ga0495631_0167705_399_899 164
254 3300046519 Ga0495632_0054846 Ga0495632_0054846_734_1234 164
255 3300046543 Ga0495645_0187970 Ga0495645_0187970_110_646 164
256 3300046660 Ga0495625_0018541 Ga0495625_0018541_3081_3581 164
257 3300046679 Ga0495623_0045280 Ga0495623_0045280_685_1221 164
258 3300046689 Ga0495613_0371810 Ga0495613_0371810_360_860 164
259 3300046694 Ga0495649_0011083 Ga0495649_0011083_731_1231 164
260 3300047443 Ga0495687_006287 Ga0495687_006287_4932_5432 164
261 3300049460 Ga0495682_0023874 Ga0495682_0023874_448_948 164
262 3300049575 Ga0501039_0548926 Ga0501039_0548926_283_783 164
263 3300050492 nmdc:mga0yw44_323358_c1 nmdc:mga0yw44_323358_c1_177_677 164
264 3300050493 nmdc:mga0k408_9121_c1 nmdc:mga0k408_9121_c1_1047_1547 164
265 3300050494 nmdc:mga06z11_110453_c1 nmdc:mga06z11_110453_c1_370_870 164
266 3300050496 nmdc:mga07m45_17194_c1 nmdc:mga07m45_17194_c1_653_1153 164
267 3300050496 nmdc:mga07m45_8413_c1 nmdc:mga07m45_8413_c1_987_1487 164
268 3300050516 nmdc:mga0sz30_6986_c1 nmdc:mga0sz30_6986_c1_1116_1616 164
269 3300053134 Ga0500658_0016945 Ga0500658_0016945_390_890 164
270 3300053139 Ga0500568_0080678 Ga0500568_0080678_359_859 164
271 3300003163 Ga0006759J45824_1072990 Ga0006759J45824_10729901 165
272 3300004798 Ga0058859_10032251 Ga0058859_100322511 165
273 3300005293 Ga0065715_10670466 Ga0065715_106704661 165
274 3300005328 Ga0070676_10002677 Ga0070676_1000267710 165
275 3300005334 Ga0068869_100118432 Ga0068869_1001184322 165
276 3300005336 Ga0070680_100860914 Ga0070680_1008609142 165
277 3300005337 Ga0070682_100702651 Ga0070682_1007026512 165
278 3300005338 Ga0068868_100067294 Ga0068868_1000672943 165
279 3300005338 Ga0068868_100272402 Ga0068868_1002724021 165
280 3300005340 Ga0070689_100000124 Ga0070689_1000001247 165
281 3300005340 Ga0070689_100444572 Ga0070689_1004445722 165
282 3300005354 Ga0070675_100036005 Ga0070675_1000360052 165
283 3300005355 Ga0070671_100305905 Ga0070671_1003059052 165
284 3300005364 Ga0070673_100011253 Ga0070673_1000112532 165
285 3300005364 Ga0070673_100545591 Ga0070673_1005455912 165
286 3300005366 Ga0070659_100253857 Ga0070659_1002538572 165
287 3300005367 Ga0070667_100000246 Ga0070667_10000024636 165
288 3300005367 Ga0070667_100157333 Ga0070667_1001573332 165
289 3300005406 Ga0070703_10463823 Ga0070703_104638231 165
290 3300005436 Ga0070713_100061145 Ga0070713_1000611452 165
291 3300005445 Ga0070708_100189772 Ga0070708_1001897722 165
292 3300005457 Ga0070662_100009097 Ga0070662_1000090972 165
293 3300005458 Ga0070681_10677488 Ga0070681_106774882 165
294 3300005459 Ga0068867_100297705 Ga0068867_1002977052 165
295 3300005467 Ga0070706_100000719 Ga0070706_10000071922 165
296 3300005471 Ga0070698_100030379 Ga0070698_1000303794 165
297 3300005518 Ga0070699_100338118 Ga0070699_1003381182 165
298 3300005530 Ga0070679_101022619 Ga0070679_1010226191 165
299 3300005539 Ga0068853_100000572 Ga0068853_1000005722 165
300 3300005539 Ga0068853_100154386 Ga0068853_1001543862 165
301 3300005544 Ga0070686_100832956 Ga0070686_1008329561 165
302 3300005563 Ga0068855_100093548 Ga0068855_1000935483 165
303 3300005563 Ga0068855_100902156 Ga0068855_1009021562 165
304 3300005577 Ga0068857_100042826 Ga0068857_1000428264 165
305 3300005614 Ga0068856_100459091 Ga0068856_1004590912 165
306 3300005614 Ga0068856_100670363 Ga0068856_1006703631 165
307 3300005616 Ga0068852_100749327 Ga0068852_1007493271 165
308 3300005616 Ga0068852_100815395 Ga0068852_1008153952 165
309 3300005617 Ga0068859_100004281 Ga0068859_1000042818 165
310 3300005617 Ga0068859_101658916 Ga0068859_1016589161 165
311 3300005718 Ga0068866_10194269 Ga0068866_101942692 165
312 3300005719 Ga0068861_100081872 Ga0068861_1000818723 165
313 3300005840 Ga0068870_10064770 Ga0068870_100647702 165
314 3300005841 Ga0068863_100711317 Ga0068863_1007113172 165
315 3300005843 Ga0068860_100090256 Ga0068860_1000902562 165
316 3300006177 Ga0075362_10004341 Ga0075362_100043412 165
317 3300006178 Ga0075367_10733942 Ga0075367_107339421 165
318 3300006186 Ga0075369_10025104 Ga0075369_100251042 165
319 3300006195 Ga0075366_10519541 Ga0075366_105195412 165
320 3300006237 Ga0097621_100660393 Ga0097621_1006603932 165
321 3300006237 Ga0097621_101156043 Ga0097621_1011560432 165
322 3300006353 Ga0075370_10001307 Ga0075370_100013074 165
323 3300006353 Ga0075370_10006254 Ga0075370_100062545 165
324 3300006353 Ga0075370_10009653 Ga0075370_100096532 165
325 3300006353 Ga0075370_10064860 Ga0075370_100648602 165
326 3300006358 Ga0068871_100175082 Ga0068871_1001750822 165
327 3300006846 Ga0075430_100064980 Ga0075430_1000649802 165
328 3300006880 Ga0075429_100015772 Ga0075429_1000157726 165
329 3300006931 Ga0097620_100004281 Ga0097620_1000042817 165
330 3300006931 Ga0097620_101659035 Ga0097620_1016590351 165
331 3300009093 Ga0105240_10124004 Ga0105240_101240043 165
332 3300009093 Ga0105240_11418961 Ga0105240_114189612 165
333 3300009098 Ga0105245_10190028 Ga0105245_101900282 165
334 3300009098 Ga0105245_10707385 Ga0105245_107073852 165
335 3300009098 Ga0105245_12000044 Ga0105245_120000441 165
336 3300009148 Ga0105243_10367053 Ga0105243_103670532 165
337 3300009174 Ga0105241_10330020 Ga0105241_103300202 165
338 3300009177 Ga0105248_10309111 Ga0105248_103091112 165
339 3300009545 Ga0105237_10007496 Ga0105237_100074967 165
340 3300009545 Ga0105237_10503327 Ga0105237_105033272 165
341 3300009545 Ga0105237_10671959 Ga0105237_106719592 165
342 3300009551 Ga0105238_10177029 Ga0105238_101770292 165
343 3300010375 Ga0105239_10023347 Ga0105239_100233475 165
344 3300010375 Ga0105239_11168803 Ga0105239_111688032 165
345 3300013296 Ga0157374_11282701 Ga0157374_112827011 165
346 3300013297 Ga0157378_11105167 Ga0157378_111051671 165
347 3300013308 Ga0157375_10146918 Ga0157375_101469182 165
348 3300014968 Ga0157379_10138815 Ga0157379_101388152 165
349 3300014969 Ga0157376_10668678 Ga0157376_106686782 165
350 3300021377 Ga0213874_10021759 Ga0213874_100217592 165
351 3300025899 Ga0207642_10149053 Ga0207642_101490532 165
352 3300025903 Ga0207680_10118056 Ga0207680_101180562 165
353 3300025907 Ga0207645_10001565 Ga0207645_100015658 165
354 3300025908 Ga0207643_10017273 Ga0207643_100172732 165
355 3300025910 Ga0207684_10008274 Ga0207684_100082744 165
356 3300025911 Ga0207654_10322647 Ga0207654_103226471 165
357 3300025912 Ga0207707_10176278 Ga0207707_101762782 165
358 3300025913 Ga0207695_10100795 Ga0207695_101007953 165
359 3300025914 Ga0207671_10031927 Ga0207671_100319272 165
360 3300025921 Ga0207652_10007653 Ga0207652_100076531 165
361 3300025924 Ga0207694_10039625 Ga0207694_100396252 165
362 3300025925 Ga0207650_10146421 Ga0207650_101464212 165
363 3300025926 Ga0207659_10070183 Ga0207659_100701833 165
364 3300025927 Ga0207687_10590728 Ga0207687_105907282 165
365 3300025931 Ga0207644_10375674 Ga0207644_103756742 165
366 3300025932 Ga0207690_10213958 Ga0207690_102139582 165
367 3300025933 Ga0207706_10005840 Ga0207706_100058405 165
368 3300025936 Ga0207670_10000010 Ga0207670_100000105 165
369 3300025936 Ga0207670_10270345 Ga0207670_102703452 165
370 3300025938 Ga0207704_11128450 Ga0207704_111284501 165
371 3300025940 Ga0207691_10241286 Ga0207691_102412862 165
372 3300025941 Ga0207711_10816105 Ga0207711_108161052 165
373 3300025942 Ga0207689_10030676 Ga0207689_100306764 165
374 3300025945 Ga0207679_10323047 Ga0207679_103230472 165
375 3300025949 Ga0207667_10736978 Ga0207667_107369781 165
376 3300025960 Ga0207651_10063062 Ga0207651_100630621 165
377 3300025960 Ga0207651_10192491 Ga0207651_101924913 165
378 3300025986 Ga0207658_10000580 Ga0207658_1000058023 165
379 3300025986 Ga0207658_10043213 Ga0207658_100432132 165
380 3300026023 Ga0207677_10015501 Ga0207677_100155012 165
381 3300026041 Ga0207639_10027710 Ga0207639_100277104 165
382 3300026041 Ga0207639_10139970 Ga0207639_101399702 165
383 3300026078 Ga0207702_10434483 Ga0207702_104344832 165
384 3300026078 Ga0207702_10883633 Ga0207702_108836331 165
385 3300026078 Ga0207702_11130045 Ga0207702_111300451 165
386 3300026089 Ga0207648_10004799 Ga0207648_1000479911 165
387 3300026089 Ga0207648_10234780 Ga0207648_102347801 165
388 3300026089 Ga0207648_10365077 Ga0207648_103650772 165
389 3300026116 Ga0207674_10007087 Ga0207674_100070878 165
390 3300026116 Ga0207674_10401876 Ga0207674_104018762 165
391 3300026118 Ga0207675_100079288 Ga0207675_1000792883 165
392 3300026118 Ga0207675_100164343 Ga0207675_1001643432 165
393 3300026118 Ga0207675_100348280 Ga0207675_1003482802 165
394 3300026121 Ga0207683_10063287 Ga0207683_100632872 165
395 3300027866 Ga0209813_10023816 Ga0209813_100238162 165
396 3300028381 Ga0268264_10218855 Ga0268264_102188552 165
397 3300028381 Ga0268264_10419033 Ga0268264_104190331 165
398 3300028381 Ga0268264_10773059 Ga0268264_107730592 165
399 3300028786 Ga0307517_10085903 Ga0307517_100859032 165
400 3300030522 Ga0307512_10315303 Ga0307512_103153032 165
401 3300031456 Ga0307513_10132563 Ga0307513_101325632 165
402 3300031456 Ga0307513_10189368 Ga0307513_101893682 165
403 3300031595 Ga0265313_10074479 Ga0265313_100744792 165
404 3300031712 Ga0265342_10068617 Ga0265342_100686172 165
405 3300031730 Ga0307516_10105324 Ga0307516_101053242 165
406 3300033180 Ga0307510_10274179 Ga0307510_102741792 165
407 3300037471 Ga0395905_0000181 Ga0395905_0000181_80627_81130 165
408 3300038443 Ga0395901_0150045 Ga0395901_0150045_545_1048 165
409 3300041505 Ga0451849_0804836 Ga0451849_0804836_26_529 165
410 3300045051 Ga0451576_0022344 Ga0451576_0022344_4347_4850 165
411 3300050493 nmdc:mga0k408_224880_c1 nmdc:mga0k408_224880_c1_448_981 165
412 3300050493 nmdc:mga0k408_74967_c1 nmdc:mga0k408_74967_c1_1327_1830 165
413 3300050494 nmdc:mga06z11_115242_c1 nmdc:mga06z11_115242_c1_38_541 165
414 3300050495 nmdc:mga04h51_69802_c1 nmdc:mga04h51_69802_c1_551_1054 165
415 3300050496 nmdc:mga07m45_10948_c1 nmdc:mga07m45_10948_c1_1371_1874 165
416 3300050496 nmdc:mga07m45_24473_c1 nmdc:mga07m45_24473_c1_165_668 165
417 3300050496 nmdc:mga07m45_27707_c1 nmdc:mga07m45_27707_c1_697_1200 165
418 3300050508 nmdc:mga09592_6731_c1 nmdc:mga09592_6731_c1_6478_6981 165
419 3300050509 nmdc:mga0qj67_44205_c1 nmdc:mga0qj67_44205_c1_857_1360 165
420 3300050516 nmdc:mga0sz30_46797_c1 nmdc:mga0sz30_46797_c1_688_1191 165
421 3300053088 Ga0500644_0163361 Ga0500644_0163361_309_830 165
422 3300053108 Ga0500562_000577 Ga0500562_000577_6820_7341 165
423 3300060346 Ga0587111_0093076 Ga0587111_0093076_138_662 165
424 3300005293 Ga0065715_10442703 Ga0065715_104427032 166
425 3300005328 Ga0070676_10053417 Ga0070676_100534172 166
426 3300005328 Ga0070676_10103781 Ga0070676_101037812 166
427 3300005328 Ga0070676_10833974 Ga0070676_108339741 166
428 3300005328 Ga0070676_10835388 Ga0070676_108353881 166
429 3300005329 Ga0070683_100038354 Ga0070683_1000383544 166
430 3300005329 Ga0070683_100075018 Ga0070683_1000750183 166
431 3300005331 Ga0070670_100190908 Ga0070670_1001909082 166
432 3300005331 Ga0070670_100296990 Ga0070670_1002969902 166
433 3300005331 Ga0070670_100357084 Ga0070670_1003570842 166
434 3300005333 Ga0070677_10015886 Ga0070677_100158862 166
435 3300005333 Ga0070677_10094180 Ga0070677_100941802 166
436 3300005334 Ga0068869_100001927 Ga0068869_1000019278 166
437 3300005334 Ga0068869_100075664 Ga0068869_1000756642 166
438 3300005335 Ga0070666_10128460 Ga0070666_101284602 166
439 3300005337 Ga0070682_100680256 Ga0070682_1006802562 166
440 3300005338 Ga0068868_100002893 Ga0068868_1000028934 166
441 3300005338 Ga0068868_100469319 Ga0068868_1004693192 166
442 3300005339 Ga0070660_100024909 Ga0070660_1000249094 166
443 3300005344 Ga0070661_100179203 Ga0070661_1001792032 166
444 3300005344 Ga0070661_100213011 Ga0070661_1002130112 166
445 3300005345 Ga0070692_10191225 Ga0070692_101912252 166
446 3300005345 Ga0070692_10204187 Ga0070692_102041872 166
447 3300005347 Ga0070668_100061190 Ga0070668_1000611903 166
448 3300005347 Ga0070668_100871045 Ga0070668_1008710452 166
449 3300005353 Ga0070669_100042870 Ga0070669_1000428704 166
450 3300005354 Ga0070675_100004679 Ga0070675_1000046799 166
451 3300005354 Ga0070675_100108789 Ga0070675_1001087892 166
452 3300005354 Ga0070675_100894654 Ga0070675_1008946542 166
453 3300005355 Ga0070671_100040867 Ga0070671_1000408673 166
454 3300005355 Ga0070671_100320872 Ga0070671_1003208722 166
455 3300005355 Ga0070671_101165963 Ga0070671_1011659631 166
456 3300005356 Ga0070674_100009232 Ga0070674_1000092323 166
457 3300005356 Ga0070674_100047614 Ga0070674_1000476142 166
458 3300005356 Ga0070674_100449268 Ga0070674_1004492682 166
459 3300005364 Ga0070673_100076273 Ga0070673_1000762732 166
460 3300005366 Ga0070659_100108399 Ga0070659_1001083992 166
461 3300005366 Ga0070659_100247288 Ga0070659_1002472882 166
462 3300005367 Ga0070667_100230563 Ga0070667_1002305632 166
463 3300005438 Ga0070701_10027722 Ga0070701_100277223 166
464 3300005440 Ga0070705_100218420 Ga0070705_1002184202 166
465 3300005441 Ga0070700_100079483 Ga0070700_1000794832 166
466 3300005444 Ga0070694_100058464 Ga0070694_1000584643 166
467 3300005455 Ga0070663_100067088 Ga0070663_1000670882 166
468 3300005455 Ga0070663_100084113 Ga0070663_1000841131 166
469 3300005455 Ga0070663_100341900 Ga0070663_1003419001 166
470 3300005456 Ga0070678_100067376 Ga0070678_1000673762 166
471 3300005456 Ga0070678_100173304 Ga0070678_1001733042 166
472 3300005456 Ga0070678_100375762 Ga0070678_1003757621 166
473 3300005457 Ga0070662_100009187 Ga0070662_1000091877 166
474 3300005457 Ga0070662_100788058 Ga0070662_1007880581 166
475 3300005459 Ga0068867_100000207 Ga0068867_10000020711 166
476 3300005459 Ga0068867_100000726 Ga0068867_10000072615 166
477 3300005459 Ga0068867_100039843 Ga0068867_1000398431 166
478 3300005459 Ga0068867_100170910 Ga0068867_1001709102 166
479 3300005459 Ga0068867_100419738 Ga0068867_1004197382 166
480 3300005466 Ga0070685_10309527 Ga0070685_103095272 166
481 3300005518 Ga0070699_100052633 Ga0070699_1000526333 166
482 3300005530 Ga0070679_100398820 Ga0070679_1003988202 166
483 3300005530 Ga0070679_101646175 Ga0070679_1016461751 166
484 3300005539 Ga0068853_100016266 Ga0068853_1000162667 166
485 3300005543 Ga0070672_100009162 Ga0070672_1000091623 166
486 3300005543 Ga0070672_100055256 Ga0070672_1000552562 166
487 3300005543 Ga0070672_100505930 Ga0070672_1005059302 166
488 3300005544 Ga0070686_100238528 Ga0070686_1002385282 166
489 3300005546 Ga0070696_100749929 Ga0070696_1007499291 166
490 3300005547 Ga0070693_100039332 Ga0070693_1000393322 166
491 3300005549 Ga0070704_100201826 Ga0070704_1002018262 166
492 3300005564 Ga0070664_100006710 Ga0070664_1000067105 166
493 3300005564 Ga0070664_100063089 Ga0070664_1000630893 166
494 3300005564 Ga0070664_100108266 Ga0070664_1001082662 166
495 3300005564 Ga0070664_100304905 Ga0070664_1003049051 166
496 3300005578 Ga0068854_100101387 Ga0068854_1001013872 166
497 3300005578 Ga0068854_100670028 Ga0068854_1006700281 166
498 3300005616 Ga0068852_100005866 Ga0068852_1000058664 166
499 3300005616 Ga0068852_100031972 Ga0068852_1000319721 166
500 3300005616 Ga0068852_100095292 Ga0068852_1000952922 166
501 3300005616 Ga0068852_100435964 Ga0068852_1004359642 166
502 3300005617 Ga0068859_100345449 Ga0068859_1003454492 166
503 3300005618 Ga0068864_100027469 Ga0068864_1000274694 166
504 3300005618 Ga0068864_100159990 Ga0068864_1001599902 166
505 3300005719 Ga0068861_100000654 Ga0068861_10000065421 166
506 3300005719 Ga0068861_100024379 Ga0068861_1000243792 166
507 3300005719 Ga0068861_100455381 Ga0068861_1004553812 166
508 3300005834 Ga0068851_10002695 Ga0068851_100026952 166
509 3300005834 Ga0068851_10013059 Ga0068851_100130591 166
510 3300005840 Ga0068870_10706968 Ga0068870_107069682 166
511 3300005841 Ga0068863_100381928 Ga0068863_1003819282 166
512 3300005842 Ga0068858_100010159 Ga0068858_1000101597 166
513 3300005843 Ga0068860_100000602 Ga0068860_10000060223 166
514 3300005843 Ga0068860_100132335 Ga0068860_1001323352 166
515 3300005844 Ga0068862_100019744 Ga0068862_1000197444 166
516 3300005844 Ga0068862_100210028 Ga0068862_1002100282 166
517 3300005844 Ga0068862_100263380 Ga0068862_1002633802 166
518 3300006028 Ga0070717_11210667 Ga0070717_112106671 166
519 3300006038 Ga0075365_10276652 Ga0075365_102766523 166
520 3300006237 Ga0097621_100003669 Ga0097621_1000036694 166
521 3300006237 Ga0097621_100398027 Ga0097621_1003980272 166
522 3300006358 Ga0068871_100014251 Ga0068871_1000142514 166
523 3300006358 Ga0068871_100367448 Ga0068871_1003674482 166
524 3300006852 Ga0075433_10571154 Ga0075433_105711542 166
525 3300006871 Ga0075434_100762302 Ga0075434_1007623021 166
526 3300006881 Ga0068865_100004074 Ga0068865_1000040743 166
527 3300006881 Ga0068865_100113908 Ga0068865_1001139082 166
528 3300006881 Ga0068865_100176599 Ga0068865_1001765992 166
529 3300006914 Ga0075436_100436142 Ga0075436_1004361421 166
530 3300006931 Ga0097620_100345446 Ga0097620_1003454462 166
531 3300009093 Ga0105240_10131935 Ga0105240_101319352 166
532 3300009094 Ga0111539_10071702 Ga0111539_100717022 166
533 3300009098 Ga0105245_10109225 Ga0105245_101092252 166
534 3300009147 Ga0114129_10201706 Ga0114129_102017062 166
535 3300009148 Ga0105243_10011807 Ga0105243_100118077 166
536 3300009148 Ga0105243_10040989 Ga0105243_100409892 166
537 3300009148 Ga0105243_10071105 Ga0105243_100711053 166
538 3300009176 Ga0105242_10129141 Ga0105242_101291412 166
539 3300009177 Ga0105248_10815075 Ga0105248_108150752 166
540 3300009177 Ga0105248_12153059 Ga0105248_121530591 166
541 3300009551 Ga0105238_10038952 Ga0105238_100389522 166
542 3300009551 Ga0105238_10273616 Ga0105238_102736162 166
543 3300009551 Ga0105238_10689353 Ga0105238_106893532 166
544 3300009553 Ga0105249_10009159 Ga0105249_100091598 166
545 3300009553 Ga0105249_10122551 Ga0105249_101225513 166
546 3300010375 Ga0105239_10030394 Ga0105239_100303947 166
547 3300012482 Ga0157318_1012934 Ga0157318_10129341 166
548 3300012510 Ga0157316_1020674 Ga0157316_10206741 166
549 3300013100 Ga0157373_10249596 Ga0157373_102495962 166
550 3300013104 Ga0157370_10141381 Ga0157370_101413812 166
551 3300013105 Ga0157369_10515016 Ga0157369_105150162 166
552 3300013296 Ga0157374_10025960 Ga0157374_100259602 166
553 3300013296 Ga0157374_10038448 Ga0157374_100384482 166
554 3300013297 Ga0157378_10007729 Ga0157378_100077297 166
555 3300013297 Ga0157378_11813441 Ga0157378_118134411 166
556 3300013306 Ga0163162_10003947 Ga0163162_1000394713 166
557 3300013307 Ga0157372_10009495 Ga0157372_100094959 166
558 3300013308 Ga0157375_10045345 Ga0157375_100453454 166
559 3300014325 Ga0163163_10203570 Ga0163163_102035703 166
560 3300014326 Ga0157380_11376922 Ga0157380_113769222 166
561 3300014745 Ga0157377_10000013 Ga0157377_1000001326 166
562 3300014745 Ga0157377_10012450 Ga0157377_100124504 166
563 3300014745 Ga0157377_10483910 Ga0157377_104839102 166
564 3300014968 Ga0157379_10080050 Ga0157379_100800503 166
565 3300014969 Ga0157376_10440174 Ga0157376_104401742 166
566 3300015262 Ga0182007_10218761 Ga0182007_102187611 166
567 3300017792 Ga0163161_10011801 Ga0163161_100118012 166
568 3300017792 Ga0163161_10027439 Ga0163161_100274393 166
569 3300020070 Ga0206356_10587414 Ga0206356_105874142 166
570 3300020078 Ga0206352_10888516 Ga0206352_108885162 166
571 3300025290 Ga0207673_1019319 Ga0207673_10193192 166
572 3300025304 Ga0209257_1014890 Ga0209257_10148904 166
573 3300025315 Ga0207697_10052802 Ga0207697_100528022 166
574 3300025321 Ga0207656_10052063 Ga0207656_100520632 166
575 3300025321 Ga0207656_10179219 Ga0207656_101792192 166
576 3300025893 Ga0207682_10009755 Ga0207682_100097553 166
577 3300025893 Ga0207682_10013460 Ga0207682_100134602 166
578 3300025893 Ga0207682_10110635 Ga0207682_101106352 166
579 3300025899 Ga0207642_10159868 Ga0207642_101598682 166
580 3300025901 Ga0207688_10025201 Ga0207688_100252013 166
581 3300025903 Ga0207680_10114888 Ga0207680_101148882 166
582 3300025903 Ga0207680_10641463 Ga0207680_106414632 166
583 3300025907 Ga0207645_10081662 Ga0207645_100816622 166
584 3300025907 Ga0207645_10116126 Ga0207645_101161263 166
585 3300025907 Ga0207645_10204616 Ga0207645_102046162 166
586 3300025908 Ga0207643_10281544 Ga0207643_102815442 166
587 3300025912 Ga0207707_10109767 Ga0207707_101097671 166
588 3300025913 Ga0207695_10899019 Ga0207695_108990192 166
589 3300025914 Ga0207671_10178711 Ga0207671_101787112 166
590 3300025918 Ga0207662_10141823 Ga0207662_101418232 166
591 3300025919 Ga0207657_10064417 Ga0207657_100644174 166
592 3300025919 Ga0207657_10771275 Ga0207657_107712751 166
593 3300025923 Ga0207681_10008360 Ga0207681_100083607 166
594 3300025923 Ga0207681_10023722 Ga0207681_100237223 166
595 3300025923 Ga0207681_10082091 Ga0207681_100820912 166
596 3300025923 Ga0207681_10533727 Ga0207681_105337272 166
597 3300025924 Ga0207694_10096638 Ga0207694_100966382 166
598 3300025925 Ga0207650_10004266 Ga0207650_100042667 166
599 3300025925 Ga0207650_10142061 Ga0207650_101420612 166
600 3300025925 Ga0207650_10312206 Ga0207650_103122062 166
601 3300025925 Ga0207650_10462179 Ga0207650_104621792 166
602 3300025926 Ga0207659_10063531 Ga0207659_100635312 166
603 3300025926 Ga0207659_10105508 Ga0207659_101055082 166
604 3300025927 Ga0207687_10143758 Ga0207687_101437581 166
605 3300025931 Ga0207644_10069835 Ga0207644_100698352 166
606 3300025931 Ga0207644_10528098 Ga0207644_105280982 166
607 3300025932 Ga0207690_10109781 Ga0207690_101097812 166
608 3300025933 Ga0207706_10003943 Ga0207706_100039439 166
609 3300025933 Ga0207706_10178532 Ga0207706_101785322 166
610 3300025933 Ga0207706_10267408 Ga0207706_102674082 166
611 3300025933 Ga0207706_10453674 Ga0207706_104536742 166
612 3300025934 Ga0207686_10285376 Ga0207686_102853762 166
613 3300025935 Ga0207709_10002299 Ga0207709_100022998 166
614 3300025935 Ga0207709_10090357 Ga0207709_100903572 166
615 3300025936 Ga0207670_10214632 Ga0207670_102146322 166
616 3300025937 Ga0207669_10032267 Ga0207669_100322672 166
617 3300025937 Ga0207669_10058671 Ga0207669_100586712 166
618 3300025937 Ga0207669_10792086 Ga0207669_107920862 166
619 3300025938 Ga0207704_10134489 Ga0207704_101344892 166
620 3300025940 Ga0207691_10051809 Ga0207691_100518094 166
621 3300025940 Ga0207691_10052984 Ga0207691_100529842 166
622 3300025940 Ga0207691_10059853 Ga0207691_100598532 166
623 3300025941 Ga0207711_10008230 Ga0207711_100082304 166
624 3300025942 Ga0207689_10002174 Ga0207689_100021747 166
625 3300025942 Ga0207689_10087617 Ga0207689_100876173 166
626 3300025944 Ga0207661_10026723 Ga0207661_100267234 166
627 3300025944 Ga0207661_10335042 Ga0207661_103350422 166
628 3300025945 Ga0207679_10158723 Ga0207679_101587232 166
629 3300025945 Ga0207679_10229243 Ga0207679_102292432 166
630 3300025945 Ga0207679_10248746 Ga0207679_102487461 166
631 3300025949 Ga0207667_10016286 Ga0207667_100162867 166
632 3300025949 Ga0207667_10771579 Ga0207667_107715792 166
633 3300025960 Ga0207651_10056652 Ga0207651_100566522 166
634 3300025960 Ga0207651_10441061 Ga0207651_104410612 166
635 3300025961 Ga0207712_10006266 Ga0207712_100062662 166
636 3300025972 Ga0207668_10059499 Ga0207668_100594992 166
637 3300025972 Ga0207668_10983456 Ga0207668_109834561 166
638 3300025981 Ga0207640_10068642 Ga0207640_100686422 166
639 3300025981 Ga0207640_10248049 Ga0207640_102480492 166
640 3300025986 Ga0207658_10013861 Ga0207658_100138615 166
641 3300025986 Ga0207658_10066617 Ga0207658_100666173 166
642 3300025986 Ga0207658_10169122 Ga0207658_101691222 166
643 3300025986 Ga0207658_10184786 Ga0207658_101847862 166
644 3300026023 Ga0207677_10240116 Ga0207677_102401162 166
645 3300026023 Ga0207677_10916924 Ga0207677_109169242 166
646 3300026035 Ga0207703_10010360 Ga0207703_100103604 166
647 3300026041 Ga0207639_10047955 Ga0207639_100479552 166
648 3300026041 Ga0207639_10262139 Ga0207639_102621392 166
649 3300026067 Ga0207678_10572284 Ga0207678_105722842 166
650 3300026075 Ga0207708_10103631 Ga0207708_101036312 166
651 3300026078 Ga0207702_10039490 Ga0207702_100394904 166
652 3300026088 Ga0207641_10182822 Ga0207641_101828223 166
653 3300026088 Ga0207641_10313304 Ga0207641_103133042 166
654 3300026088 Ga0207641_11137796 Ga0207641_111377961 166
655 3300026089 Ga0207648_10000500 Ga0207648_1000050025 166
656 3300026089 Ga0207648_10000582 Ga0207648_1000058216 166
657 3300026089 Ga0207648_10043623 Ga0207648_100436232 166
658 3300026089 Ga0207648_10301003 Ga0207648_103010032 166
659 3300026089 Ga0207648_10426484 Ga0207648_104264841 166
660 3300026089 Ga0207648_11375420 Ga0207648_113754202 166
661 3300026095 Ga0207676_10093836 Ga0207676_100938363 166
662 3300026095 Ga0207676_10277816 Ga0207676_102778162 166
663 3300026116 Ga0207674_10011336 Ga0207674_100113369 166
664 3300026116 Ga0207674_10149568 Ga0207674_101495682 166
665 3300026118 Ga0207675_100000601 Ga0207675_10000060114 166
666 3300026118 Ga0207675_100000645 Ga0207675_1000006457 166
667 3300026118 Ga0207675_100001963 Ga0207675_1000019639 166
668 3300026118 Ga0207675_100043824 Ga0207675_1000438242 166
669 3300026121 Ga0207683_10013511 Ga0207683_100135115 166
670 3300026121 Ga0207683_10104905 Ga0207683_101049052 166
671 3300026121 Ga0207683_10179805 Ga0207683_101798052 166
672 3300026142 Ga0207698_10008468 Ga0207698_100084682 166
673 3300026142 Ga0207698_10078254 Ga0207698_100782541 166
674 3300026142 Ga0207698_10914137 Ga0207698_109141372 166
675 3300028379 Ga0268266_10115429 Ga0268266_101154292 166
676 3300028380 Ga0268265_10002660 Ga0268265_1000266011 166
677 3300028380 Ga0268265_10221302 Ga0268265_102213022 166
678 3300028380 Ga0268265_10484073 Ga0268265_104840732 166
679 3300028380 Ga0268265_11347790 Ga0268265_113477902 166
680 3300028381 Ga0268264_10060088 Ga0268264_100600882 166
681 3300028666 Ga0265336_10049117 Ga0265336_100491172 166
682 3300028794 Ga0307515_10047991 Ga0307515_100479917 166
683 3300028800 Ga0265338_10005111 Ga0265338_100051119 166
684 3300031239 Ga0265328_10003765 Ga0265328_100037653 166
685 3300031239 Ga0265328_10017716 Ga0265328_100177163 166
686 3300031240 Ga0265320_10007994 Ga0265320_100079942 166
687 3300031240 Ga0265320_10128306 Ga0265320_101283062 166
688 3300031249 Ga0265339_10010607 Ga0265339_100106074 166
689 3300031249 Ga0265339_10047473 Ga0265339_100474732 166
690 3300031251 Ga0265327_10000364 Ga0265327_1000036422 166
691 3300031344 Ga0265316_10366058 Ga0265316_103660581 166
692 3300031456 Ga0307513_10385394 Ga0307513_103853942 166
693 3300031711 Ga0265314_10005720 Ga0265314_100057203 166
694 3300031711 Ga0265314_10010192 Ga0265314_100101926 166
695 3300031712 Ga0265342_10000554 Ga0265342_1000055415 166
696 3300031712 Ga0265342_10003077 Ga0265342_100030776 166
697 3300032168 Ga0316593_10274495 Ga0316593_102744951 166
698 3300035084 Ga0373928_0065015 Ga0373928_0065015_88_594 166
699 3300035088 Ga0373940_0023344 Ga0373940_0023344_199_705 166
700 3300035112 Ga0373932_0025080 Ga0373932_0025080_699_1205 166
701 3300035120 Ga0373957_0008022 Ga0373957_0008022_2195_2728 166
702 3300035171 Ga0373946_0376294 Ga0373946_0376294_80_613 166
703 3300035172 Ga0373955_0695653 Ga0373955_0695653_56_562 166
704 3300035410 Ga0373924_0118836 Ga0373924_0118836_152_658 166
705 3300035691 Ga0373931_0005447 Ga0373931_0005447_5189_5695 166
706 3300035695 Ga0373927_0038422 Ga0373927_0038422_2281_2787 166
707 3300035725 Ga0373947_0034907 Ga0373947_0034907_2279_2785 166
708 3300036401 Ga0373937_0067768 Ga0373937_0067768_40_546 166
709 3300037068 Ga0373925_0031738 Ga0373925_0031738_557_1063 166
710 3300037471 Ga0395905_0016460 Ga0395905_0016460_4814_5320 166
711 3300039450 Ga0436363_1597640 Ga0436363_1597640_95_601 166
712 3300041451 Ga0451791_0009221 Ga0451791_0009221_123_629 166
713 3300044656 Ga0466969_0006818 Ga0466969_0006818_4577_5083 166
714 3300044658 Ga0466972_0056004 Ga0466972_0056004_1337_1843 166
715 3300044658 Ga0466972_0079134 Ga0466972_0079134_437_943 166
716 3300044684 Ga0466966_0044917 Ga0466966_0044917_1671_2177 166
717 3300044693 Ga0466961_0010972 Ga0466961_0010972_3409_3915 166
718 3300044706 Ga0466964_0081107 Ga0466964_0081107_692_1198 166
719 3300044901 Ga0466960_0228590 Ga0466960_0228590_158_664 166
720 3300045049 Ga0466959_0061370 Ga0466959_0061370_974_1480 166
721 3300045051 Ga0451576_0155671 Ga0451576_0155671_814_1320 166
722 3300046461 Ga0495641_0127837 Ga0495641_0127837_159_692 166
723 3300046472 Ga0495580_0152087 Ga0495580_0152087_701_1207 166
724 3300046473 Ga0495582_0229726 Ga0495582_0229726_384_890 166
725 3300046507 Ga0495606_0208189 Ga0495606_0208189_38_544 166
726 3300046516 Ga0495628_0303682 Ga0495628_0303682_615_1121 166
727 3300046543 Ga0495645_0036404 Ga0495645_0036404_1973_2479 166
728 3300046663 Ga0495635_0296332 Ga0495635_0296332_403_909 166
729 3300046675 Ga0495657_0405843 Ga0495657_0405843_221_727 166
730 3300046680 Ga0495646_0222257 Ga0495646_0222257_357_863 166
731 3300046681 Ga0495647_0062112 Ga0495647_0062112_173_679 166
732 3300046681 Ga0495647_0090024 Ga0495647_0090024_735_1241 166
733 3300046683 Ga0495658_0044667 Ga0495658_0044667_1552_2058 166
734 3300047471 Ga0495684_0137873 Ga0495684_0137873_339_845 166
735 3300048903 Ga0496100_0604173 Ga0496100_0604173_244_750 166
736 3300048903 Ga0496100_1105381 Ga0496100_1105381_85_591 166
737 3300048905 Ga0496102_0330722 Ga0496102_0330722_649_1155 166
738 3300048907 Ga0496104_0823093 Ga0496104_0823093_68_601 166
739 3300048908 Ga0496105_0072403 Ga0496105_0072403_62_568 166
740 3300048908 Ga0496105_0317604 Ga0496105_0317604_615_1121 166
741 3300048909 Ga0496106_0008452 Ga0496106_0008452_5506_6012 166
742 3300048910 Ga0496107_0089606 Ga0496107_0089606_1241_1747 166
743 3300048911 Ga0496108_0007703 Ga0496108_0007703_4781_5287 166
744 3300048911 Ga0496108_0180029 Ga0496108_0180029_363_869 166
745 3300048912 Ga0496109_0081575 Ga0496109_0081575_1371_1877 166
746 3300048912 Ga0496109_0756500 Ga0496109_0756500_390_896 166
747 3300048913 Ga0496110_0038343 Ga0496110_0038343_290_796 166
748 3300048913 Ga0496110_0316002 Ga0496110_0316002_325_831 166
749 3300048914 Ga0496111_0054984 Ga0496111_0054984_759_1265 166
750 3300048915 Ga0496112_0284847 Ga0496112_0284847_556_1089 166
751 3300048915 Ga0496112_0301669 Ga0496112_0301669_944_1450 166
752 3300048916 Ga0496113_0123910 Ga0496113_0123910_1109_1615 166
753 3300048917 Ga0496114_0031396 Ga0496114_0031396_2516_3022 166
754 3300048917 Ga0496114_0414094 Ga0496114_0414094_313_819 166
755 3300048918 Ga0496115_0111406 Ga0496115_0111406_1345_1851 166
756 3300049522 Ga0501299_013151 Ga0501299_013151_663_1166 166
757 3300049527 Ga0501311_046578 Ga0501311_046578_67_573 166
758 3300049590 Ga0501074_0439034 Ga0501074_0439034_282_788 166
759 3300049660 Ga0501216_014205 Ga0501216_014205_731_1234 166
760 3300049704 Ga0501221_100869 Ga0501221_100869_52_555 166
761 3300049779 Ga0501283_016823 Ga0501283_016823_485_988 166
762 3300049824 Ga0501045_0242970 Ga0501045_0242970_14_520 166
763 3300050507 nmdc:mga05p37_172253_c1 nmdc:mga05p37_172253_c1_475_981 166
764 3300050511 nmdc:mga08y16_417153_c1 nmdc:mga08y16_417153_c1_449_955 166
765 3300050515 nmdc:mga0a205_45271_c1 nmdc:mga0a205_45271_c1_2266_2772 166
766 3300053077 Ga0495601_0009126 Ga0495601_0009126_2330_2836 166
767 3300053077 Ga0495601_0413324 Ga0495601_0413324_176_682 166
768 3300053145 Ga0500586_056540 Ga0500586_056540_689_1213 166
769 3300061719 Ga0466962_0012722 Ga0466962_0012722_2395_2901 166
770 3300002773 JGI25152J39213_1002469 JGI25152J39213_10024693 167
771 3300002774 JGI25150J39212_1002495 JGI25150J39212_10024955 167
772 3300003320 rootH2_10014253 rootH2_100142532 167
773 3300003322 rootL2_10000217 rootL2_1000021738 167
774 3300003323 rootH1_10024429 rootH1_100244297 167
775 3300003771 Ga0055526_1006791 Ga0055526_10067917 167
776 3300003771 Ga0055526_1009196 Ga0055526_10091962 167
777 3300003775 Ga0055524_1059963 Ga0055524_10599631 167
778 3300003775 Ga0055524_1064591 Ga0055524_10645912 167
779 3300003790 Ga0055528_1035370 Ga0055528_10353701 167
780 3300003791 Ga0055530_10022225 Ga0055530_100222252 167
781 3300003791 Ga0055530_10034985 Ga0055530_100349852 167
782 3300003794 Ga0055531_10013234 Ga0055531_100132341 167
783 3300003794 Ga0055531_10077552 Ga0055531_100775522 167
784 3300004625 Ga0055543_1005759 Ga0055543_10057592 167
785 3300004803 Ga0058862_12842042 Ga0058862_128420421 167
786 3300005262 Ga0065165_1000270 Ga0065165_100027010 167
787 3300005262 Ga0065165_1001444 Ga0065165_100144412 167
788 3300005262 Ga0065165_1005243 Ga0065165_10052433 167
789 3300005290 Ga0065712_10142199 Ga0065712_101421992 167
790 3300005293 Ga0065715_10136709 Ga0065715_101367092 167
791 3300005295 Ga0065707_10228330 Ga0065707_102283302 167
792 3300005295 Ga0065707_10362273 Ga0065707_103622731 167
793 3300005327 Ga0070658_10267781 Ga0070658_102677812 167
794 3300005331 Ga0070670_100005770 Ga0070670_1000057708 167
795 3300005333 Ga0070677_10194824 Ga0070677_101948242 167
796 3300005334 Ga0068869_100947937 Ga0068869_1009479371 167
797 3300005335 Ga0070666_10183340 Ga0070666_101833402 167
798 3300005338 Ga0068868_100381745 Ga0068868_1003817452 167
799 3300005340 Ga0070689_100297827 Ga0070689_1002978272 167
800 3300005340 Ga0070689_100659399 Ga0070689_1006593992 167
801 3300005341 Ga0070691_10039867 Ga0070691_100398673 167
802 3300005343 Ga0070687_100010152 Ga0070687_1000101523 167
803 3300005344 Ga0070661_100309146 Ga0070661_1003091461 167
804 3300005345 Ga0070692_10074221 Ga0070692_100742212 167
805 3300005345 Ga0070692_10418570 Ga0070692_104185702 167
806 3300005353 Ga0070669_100076885 Ga0070669_1000768853 167
807 3300005353 Ga0070669_100155294 Ga0070669_1001552941 167
808 3300005354 Ga0070675_100473115 Ga0070675_1004731152 167
809 3300005355 Ga0070671_100002535 Ga0070671_1000025359 167
810 3300005355 Ga0070671_100057191 Ga0070671_1000571912 167
811 3300005356 Ga0070674_100268238 Ga0070674_1002682381 167
812 3300005364 Ga0070673_100279743 Ga0070673_1002797432 167
813 3300005367 Ga0070667_101091334 Ga0070667_1010913342 167
814 3300005438 Ga0070701_10004317 Ga0070701_100043172 167
815 3300005440 Ga0070705_100000098 Ga0070705_10000009811 167
816 3300005440 Ga0070705_100052386 Ga0070705_1000523863 167
817 3300005440 Ga0070705_100545204 Ga0070705_1005452042 167
818 3300005441 Ga0070700_100196787 Ga0070700_1001967871 167
819 3300005444 Ga0070694_100034641 Ga0070694_1000346413 167
820 3300005444 Ga0070694_100036972 Ga0070694_1000369722 167
821 3300005444 Ga0070694_100139448 Ga0070694_1001394482 167
822 3300005456 Ga0070678_100017708 Ga0070678_1000177082 167
823 3300005456 Ga0070678_100086457 Ga0070678_1000864574 167
824 3300005456 Ga0070678_100117702 Ga0070678_1001177021 167
825 3300005457 Ga0070662_100006234 Ga0070662_1000062345 167
826 3300005468 Ga0070707_100088521 Ga0070707_1000885213 167
827 3300005518 Ga0070699_100032839 Ga0070699_1000328392 167
828 3300005535 Ga0070684_100842279 Ga0070684_1008422792 167
829 3300005536 Ga0070697_100011088 Ga0070697_1000110884 167
830 3300005539 Ga0068853_100340558 Ga0068853_1003405582 167
831 3300005543 Ga0070672_100269763 Ga0070672_1002697632 167
832 3300005544 Ga0070686_100971865 Ga0070686_1009718651 167
833 3300005545 Ga0070695_100000039 Ga0070695_10000003911 167
834 3300005546 Ga0070696_100064722 Ga0070696_1000647223 167
835 3300005546 Ga0070696_100137944 Ga0070696_1001379442 167
836 3300005547 Ga0070693_101159461 Ga0070693_1011594611 167
837 3300005548 Ga0070665_100044547 Ga0070665_1000445471 167
838 3300005548 Ga0070665_100720230 Ga0070665_1007202302 167
839 3300005549 Ga0070704_100653443 Ga0070704_1006534431 167
840 3300005564 Ga0070664_100012765 Ga0070664_1000127653 167
841 3300005564 Ga0070664_100307369 Ga0070664_1003073692 167
842 3300005577 Ga0068857_100204625 Ga0068857_1002046252 167
843 3300005615 Ga0070702_100017017 Ga0070702_1000170174 167
844 3300005617 Ga0068859_100667733 Ga0068859_1006677332 167
845 3300005618 Ga0068864_100042201 Ga0068864_1000422011 167
846 3300005618 Ga0068864_100091531 Ga0068864_1000915312 167
847 3300005618 Ga0068864_100415424 Ga0068864_1004154242 167
848 3300005718 Ga0068866_10343863 Ga0068866_103438632 167
849 3300005719 Ga0068861_100158435 Ga0068861_1001584352 167
850 3300005719 Ga0068861_100744475 Ga0068861_1007444752 167
851 3300005840 Ga0068870_10490679 Ga0068870_104906792 167
852 3300005841 Ga0068863_100088411 Ga0068863_1000884114 167
853 3300005843 Ga0068860_100384461 Ga0068860_1003844612 167
854 3300005843 Ga0068860_100655757 Ga0068860_1006557572 167
855 3300005844 Ga0068862_100259842 Ga0068862_1002598422 167
856 3300006058 Ga0075432_10151368 Ga0075432_101513682 167
857 3300006178 Ga0075367_10295368 Ga0075367_102953682 167
858 3300006186 Ga0075369_10180886 Ga0075369_101808862 167
859 3300006195 Ga0075366_10088771 Ga0075366_100887712 167
860 3300006237 Ga0097621_100033256 Ga0097621_1000332562 167
861 3300006353 Ga0075370_10186452 Ga0075370_101864522 167
862 3300006844 Ga0075428_100088429 Ga0075428_1000884293 167
863 3300006846 Ga0075430_100033753 Ga0075430_1000337533 167
864 3300006847 Ga0075431_100000901 Ga0075431_1000009017 167
865 3300006847 Ga0075431_100115023 Ga0075431_1001150232 167
866 3300006852 Ga0075433_10513299 Ga0075433_105132992 167
867 3300006871 Ga0075434_100757941 Ga0075434_1007579411 167
868 3300006880 Ga0075429_100017847 Ga0075429_1000178473 167
869 3300006931 Ga0097620_100667661 Ga0097620_1006676612 167
870 3300006944 Ga0099823_1007818 Ga0099823_10078185 167
871 3300007076 Ga0075435_100074791 Ga0075435_1000747911 167
872 3300009094 Ga0111539_10318158 Ga0111539_103181582 167
873 3300009094 Ga0111539_10847039 Ga0111539_108470391 167
874 3300009147 Ga0114129_11145322 Ga0114129_111453222 167
875 3300009176 Ga0105242_10039238 Ga0105242_100392384 167
876 3300009176 Ga0105242_10359688 Ga0105242_103596882 167
877 3300009545 Ga0105237_11537054 Ga0105237_115370541 167
878 3300012497 Ga0157319_1000006 Ga0157319_1000006244 167
879 3300012512 Ga0157327_1002757 Ga0157327_10027572 167
880 3300013296 Ga0157374_10002222 Ga0157374_100022228 167
881 3300013296 Ga0157374_10125086 Ga0157374_101250863 167
882 3300013297 Ga0157378_10362518 Ga0157378_103625181 167
883 3300013297 Ga0157378_10809614 Ga0157378_108096141 167
884 3300013306 Ga0163162_11108398 Ga0163162_111083982 167
885 3300013308 Ga0157375_10058181 Ga0157375_100581812 167
886 3300014325 Ga0163163_10138333 Ga0163163_101383332 167
887 3300014325 Ga0163163_10188274 Ga0163163_101882742 167
888 3300014969 Ga0157376_10142738 Ga0157376_101427382 167
889 3300017792 Ga0163161_10121237 Ga0163161_101212372 167
890 3300025245 Ga0207425_1000452 Ga0207425_100045219 167
891 3300025258 Ga0209129_1000027 Ga0209129_10000273 167
892 3300025273 Ga0209673_1002493 Ga0209673_10024935 167
893 3300025273 Ga0209673_1008050 Ga0209673_10080502 167
894 3300025273 Ga0209673_1039154 Ga0209673_10391541 167
895 3300025273 Ga0209673_1069754 Ga0209673_10697541 167
896 3300025295 Ga0209564_1000003 Ga0209564_10000031410 167
897 3300025295 Ga0209564_1000046 Ga0209564_1000046346 167
898 3300025297 Ga0209758_1000052 Ga0209758_1000052117 167
899 3300025297 Ga0209758_1001020 Ga0209758_10010208 167
900 3300025298 Ga0209050_1000143 Ga0209050_100014371 167
901 3300025298 Ga0209050_1003147 Ga0209050_100314713 167
902 3300025299 Ga0209256_1000053 Ga0209256_1000053136 167
903 3300025299 Ga0209256_1018443 Ga0209256_10184432 167
904 3300025299 Ga0209256_1025556 Ga0209256_10255561 167
905 3300025303 Ga0209051_1105199 Ga0209051_11051991 167
906 3300025304 Ga0209257_1006119 Ga0209257_10061195 167
907 3300025304 Ga0209257_1049694 Ga0209257_10496942 167
908 3300025315 Ga0207697_10040170 Ga0207697_100401702 167
909 3300025893 Ga0207682_10246033 Ga0207682_102460332 167
910 3300025899 Ga0207642_10319563 Ga0207642_103195632 167
911 3300025903 Ga0207680_10232920 Ga0207680_102329202 167
912 3300025903 Ga0207680_10970129 Ga0207680_109701291 167
913 3300025908 Ga0207643_10274579 Ga0207643_102745792 167
914 3300025918 Ga0207662_10045801 Ga0207662_100458012 167
915 3300025920 Ga0207649_10133627 Ga0207649_101336272 167
916 3300025922 Ga0207646_10153565 Ga0207646_101535652 167
917 3300025923 Ga0207681_10085118 Ga0207681_100851183 167
918 3300025923 Ga0207681_10936457 Ga0207681_109364571 167
919 3300025924 Ga0207694_10907467 Ga0207694_109074671 167
920 3300025925 Ga0207650_10196857 Ga0207650_101968571 167
921 3300025925 Ga0207650_10333518 Ga0207650_103335182 167
922 3300025926 Ga0207659_10006848 Ga0207659_100068483 167
923 3300025926 Ga0207659_10363356 Ga0207659_103633562 167
924 3300025926 Ga0207659_10912051 Ga0207659_109120511 167
925 3300025931 Ga0207644_10000320 Ga0207644_100003207 167
926 3300025933 Ga0207706_10000608 Ga0207706_1000060812 167
927 3300025936 Ga0207670_10134265 Ga0207670_101342652 167
928 3300025936 Ga0207670_10254393 Ga0207670_102543932 167
929 3300025940 Ga0207691_10015053 Ga0207691_100150534 167
930 3300025941 Ga0207711_10793288 Ga0207711_107932882 167
931 3300025941 Ga0207711_11296726 Ga0207711_112967262 167
932 3300025945 Ga0207679_10051944 Ga0207679_100519442 167
933 3300025945 Ga0207679_10423019 Ga0207679_104230192 167
934 3300025960 Ga0207651_10616206 Ga0207651_106162062 167
935 3300025986 Ga0207658_10044021 Ga0207658_100440212 167
936 3300026088 Ga0207641_10016501 Ga0207641_100165012 167
937 3300026088 Ga0207641_10024381 Ga0207641_100243814 167
938 3300026095 Ga0207676_10035259 Ga0207676_100352592 167
939 3300026095 Ga0207676_10091489 Ga0207676_100914893 167
940 3300026095 Ga0207676_10128622 Ga0207676_101286222 167
941 3300026118 Ga0207675_100326830 Ga0207675_1003268302 167
942 3300026118 Ga0207675_100662063 Ga0207675_1006620631 167
943 3300026118 Ga0207675_101807878 Ga0207675_1018078782 167
944 3300027296 Ga0209389_1041279 Ga0209389_10412793 167
945 3300027312 Ga0209371_1017994 Ga0209371_10179942 167
946 3300027552 Ga0209982_1003716 Ga0209982_10037162 167
947 3300027907 Ga0207428_10588547 Ga0207428_105885471 167
948 3300028379 Ga0268266_10016967 Ga0268266_100169672 167
949 3300028379 Ga0268266_10552903 Ga0268266_105529031 167
950 3300028380 Ga0268265_10144240 Ga0268265_101442402 167
951 3300028381 Ga0268264_10800191 Ga0268264_108001912 167
952 3300028573 Ga0265334_10023829 Ga0265334_100238293 167
953 3300028577 Ga0265318_10000001 Ga0265318_10000001135 167
954 3300028653 Ga0265323_10013702 Ga0265323_100137022 167
955 3300028794 Ga0307515_10051500 Ga0307515_100515002 167
956 3300030500 Ga0268256_1020082 Ga0268256_10200821 167
957 3300031235 Ga0265330_10000002 Ga0265330_10000002238 167
958 3300031235 Ga0265330_10030908 Ga0265330_100309082 167
959 3300031235 Ga0265330_10043015 Ga0265330_100430152 167
960 3300031239 Ga0265328_10029482 Ga0265328_100294822 167
961 3300031239 Ga0265328_10269617 Ga0265328_102696171 167
962 3300031240 Ga0265320_10000053 Ga0265320_1000005331 167
963 3300031242 Ga0265329_10042972 Ga0265329_100429721 167
964 3300031249 Ga0265339_10173404 Ga0265339_101734042 167
965 3300031250 Ga0265331_10000001 Ga0265331_10000001217 167
966 3300031344 Ga0265316_10058082 Ga0265316_100580822 167
967 3300031344 Ga0265316_10235454 Ga0265316_102354542 167
968 3300031344 Ga0265316_10310759 Ga0265316_103107592 167
969 3300031548 Ga0307408_100146105 Ga0307408_1001461052 167
970 3300031548 Ga0307408_100888814 Ga0307408_1008888142 167
971 3300031595 Ga0265313_10000051 Ga0265313_1000005134 167
972 3300031711 Ga0265314_10000006 Ga0265314_10000006427 167
973 3300031712 Ga0265342_10006409 Ga0265342_100064093 167
974 3300031712 Ga0265342_10011384 Ga0265342_100113844 167
975 3300031712 Ga0265342_10015833 Ga0265342_100158335 167
976 3300031727 Ga0316576_10169506 Ga0316576_101695062 167
977 3300031728 Ga0316578_10014511 Ga0316578_100145113 167
978 3300031730 Ga0307516_10000074 Ga0307516_1000007469 167
979 3300031730 Ga0307516_10030345 Ga0307516_100303454 167
980 3300031730 Ga0307516_10234270 Ga0307516_102342702 167
981 3300031733 Ga0316577_10153776 Ga0316577_101537762 167
982 3300031824 Ga0307413_10346164 Ga0307413_103461642 167
983 3300031852 Ga0307410_10004849 Ga0307410_100048494 167
984 3300031903 Ga0307407_10013556 Ga0307407_100135564 167
985 3300031911 Ga0307412_10929664 Ga0307412_109296641 167
986 3300031995 Ga0307409_100018688 Ga0307409_1000186882 167
987 3300032002 Ga0307416_100804400 Ga0307416_1008044002 167
988 3300032004 Ga0307414_10546190 Ga0307414_105461902 167
989 3300032005 Ga0307411_10674486 Ga0307411_106744862 167
990 3300035691 Ga0373931_0271616 Ga0373931_0271616_157_663 167
991 3300036712 Ga0316584_0026182 Ga0316584_0026182_3596_4141 167
992 3300037068 Ga0373925_0292889 Ga0373925_0292889_538_1059 167
993 3300037471 Ga0395905_0608129 Ga0395905_0608129_112_621 167
994 3300041410 Ga0439461_0008873 Ga0439461_0008873_797_1315 167
995 3300041413 Ga0439465_0051394 Ga0439465_0051394_487_1005 167
996 3300041456 Ga0451795_1148503 Ga0451795_1148503_897_1406 167
997 3300041458 Ga0451798_0901360 Ga0451798_0901360_331_840 167
998 3300041459 Ga0451800_1614163 Ga0451800_1614163_762_1271 167
999 3300041486 Ga0451807_1377956 Ga0451807_1377956_316_834 167
1000 3300041509 Ga0451843_1298584 Ga0451843_1298584_106_618 167
1001 3300041997 Ga0439431_0019710 Ga0439431_0019710_425_943 167
1002 3300042127 Ga0450890_002987 Ga0450890_002987_1412_1924 167
1003 3300042134 Ga0450898_007638 Ga0450898_007638_559_1077 167
1004 3300042435 Ga0439434_0013032 Ga0439434_0013032_1768_2286 167
1005 3300042438 Ga0439459_0000127 Ga0439459_0000127_1995_2507 167
1006 3300044658 Ga0466972_0003044 Ga0466972_0003044_5358_5867 167
1007 3300044694 Ga0466963_0069500 Ga0466963_0069500_1162_1671 167
1008 3300044712 Ga0453684_0000193 Ga0453684_0000193_122352_122870 167
1009 3300046460 Ga0495638_0045920 Ga0495638_0045920_926_1435 167
1010 3300046491 Ga0495584_0012692 Ga0495584_0012692_385_894 167
1011 3300046512 Ga0495610_0054273 Ga0495610_0054273_516_1025 167
1012 3300046519 Ga0495632_0015428 Ga0495632_0015428_3075_3584 167
1013 3300046525 Ga0495663_0023604 Ga0495663_0023604_838_1347 167
1014 3300046538 Ga0495609_0234770 Ga0495609_0234770_101_610 167
1015 3300046542 Ga0495597_0082869 Ga0495597_0082869_422_931 167
1016 3300046615 Ga0495656_0260898 Ga0495656_0260898_148_657 167
1017 3300046664 Ga0495659_0019760 Ga0495659_0019760_919_1428 167
1018 3300046664 Ga0495659_0147212 Ga0495659_0147212_148_657 167
1019 3300046684 Ga0495669_0261354 Ga0495669_0261354_184_693 167
1020 3300046809 Ga0495600_0144433 Ga0495600_0144433_467_991 167
1021 3300047318 Ga0495636_0017379 Ga0495636_0017379_56_565 167
1022 3300047445 Ga0495677_0028630 Ga0495677_0028630_1285_1794 167
1023 3300047447 Ga0495685_050358 Ga0495685_050358_57_566 167
1024 3300048907 Ga0496104_1056176 Ga0496104_1056176_37_549 167
1025 3300048910 Ga0496107_0397017 Ga0496107_0397017_14_526 167
1026 3300048911 Ga0496108_0388908 Ga0496108_0388908_216_725 167
1027 3300048913 Ga0496110_0407331 Ga0496110_0407331_262_780 167
1028 3300049528 Ga0501312_010036 Ga0501312_010036_451_969 167
1029 3300049533 Ga0501317_048301 Ga0501317_048301_100_609 167
1030 3300049568 Ga0501031_0015019 Ga0501031_0015019_2179_2691 167
1031 3300049568 Ga0501031_0053226 Ga0501031_0053226_1787_2299 167
1032 3300049569 Ga0501032_0002974 Ga0501032_0002974_8308_8820 167
1033 3300049569 Ga0501032_0022224 Ga0501032_0022224_3462_3974 167
1034 3300049570 Ga0501033_0001594 Ga0501033_0001594_10900_11412 167
1035 3300049570 Ga0501033_0067120 Ga0501033_0067120_339_851 167
1036 3300049571 Ga0501034_0040330 Ga0501034_0040330_2647_3159 167
1037 3300049572 Ga0501036_0004807 Ga0501036_0004807_7214_7726 167
1038 3300049572 Ga0501036_0020745 Ga0501036_0020745_4540_5052 167
1039 3300049573 Ga0501037_0002776 Ga0501037_0002776_10195_10707 167
1040 3300049574 Ga0501038_0002215 Ga0501038_0002215_6268_6780 167
1041 3300049574 Ga0501038_0018551 Ga0501038_0018551_1865_2377 167
1042 3300049574 Ga0501038_0022440 Ga0501038_0022440_3357_3869 167
1043 3300049575 Ga0501039_0005521 Ga0501039_0005521_580_1092 167
1044 3300049575 Ga0501039_0017532 Ga0501039_0017532_2794_3306 167
1045 3300049576 Ga0501040_0007076 Ga0501040_0007076_2357_2869 167
1046 3300049576 Ga0501040_0131851 Ga0501040_0131851_988_1497 167
1047 3300049578 Ga0501042_0001122 Ga0501042_0001122_1534_2046 167
1048 3300049579 Ga0501043_0005777 Ga0501043_0005777_3637_4149 167
1049 3300049579 Ga0501043_0168468 Ga0501043_0168468_177_689 167
1050 3300049580 Ga0501046_0001218 Ga0501046_0001218_12796_13308 167
1051 3300049580 Ga0501046_0013156 Ga0501046_0013156_500_1012 167
1052 3300049581 Ga0501047_0022202 Ga0501047_0022202_3118_3630 167
1053 3300049582 Ga0501048_0165945 Ga0501048_0165945_713_1225 167
1054 3300049583 Ga0501067_0251823 Ga0501067_0251823_105_617 167
1055 3300049584 Ga0501068_0006058 Ga0501068_0006058_1711_2223 167
1056 3300049586 Ga0501070_0045795 Ga0501070_0045795_1916_2428 167
1057 3300049591 Ga0501075_0735973 Ga0501075_0735973_197_706 167
1058 3300049742 Ga0501080_0135281 Ga0501080_0135281_1591_2103 167
1059 3300049822 Ga0501035_0001588 Ga0501035_0001588_18197_18709 167
1060 3300049822 Ga0501035_0035428 Ga0501035_0035428_1542_2054 167
1061 3300049823 Ga0501044_0015564 Ga0501044_0015564_4336_4848 167
1062 3300049823 Ga0501044_0051133 Ga0501044_0051133_2084_2596 167
1063 3300049824 Ga0501045_0005631 Ga0501045_0005631_3747_4259 167
1064 3300049824 Ga0501045_0118746 Ga0501045_0118746_178_687 167
1065 3300049824 Ga0501045_0228133 Ga0501045_0228133_504_1016 167
1066 3300050507 nmdc:mga05p37_111891_c1 nmdc:mga05p37_111891_c1_2764_3273 167
1067 3300050508 nmdc:mga09592_31896_c1 nmdc:mga09592_31896_c1_631_1194 167
1068 3300050510 nmdc:mga06r32_20968_c1 nmdc:mga06r32_20968_c1_5091_5654 167
1069 3300050510 nmdc:mga06r32_77831_c1 nmdc:mga06r32_77831_c1_1480_1989 167
1070 3300050511 nmdc:mga08y16_149140_c1 nmdc:mga08y16_149140_c1_1440_1967 167
1071 3300050512 nmdc:mga0n895_351631_c1 nmdc:mga0n895_351631_c1_44_553 167
1072 3300053093 Ga0500651_0305076 Ga0500651_0305076_330_839 167
1073 3300053130 Ga0500642_0076400 Ga0500642_0076400_698_1207 167
1074 3300053131 Ga0500652_047554 Ga0500652_047554_262_771 167
1075 3300053156 Ga0500622_0000671 Ga0500622_0000671_29407_29916 167
1076 3300060353 Ga0501082_1165029 Ga0501082_1165029_62_565 167
1077 3300061734 Ga0530510_0411191 Ga0530510_0411191_471_983 167
1078 3300001977 JGI24746J21847_1001929 JGI24746J21847_10019292 168
1079 3300002076 JGI24749J21850_1011539 JGI24749J21850_10115392 168
1080 3300004798 Ga0058859_10042077 Ga0058859_100420772 168
1081 3300004799 Ga0058863_11632863 Ga0058863_116328632 168
1082 3300004801 Ga0058860_11980627 Ga0058860_119806271 168
1083 3300004801 Ga0058860_12064838 Ga0058860_120648382 168
1084 3300004803 Ga0058862_12658881 Ga0058862_126588812 168
1085 3300005290 Ga0065712_10106449 Ga0065712_101064492 168
1086 3300005290 Ga0065712_10119547 Ga0065712_101195472 168
1087 3300005293 Ga0065715_10001432 Ga0065715_100014322 168
1088 3300005293 Ga0065715_10517656 Ga0065715_105176561 168
1089 3300005295 Ga0065707_10180121 Ga0065707_101801212 168
1090 3300005328 Ga0070676_10006667 Ga0070676_100066673 168
1091 3300005328 Ga0070676_10235629 Ga0070676_102356292 168
1092 3300005330 Ga0070690_100008599 Ga0070690_1000085993 168
1093 3300005331 Ga0070670_100275685 Ga0070670_1002756852 168
1094 3300005331 Ga0070670_100343986 Ga0070670_1003439862 168
1095 3300005333 Ga0070677_10016256 Ga0070677_100162563 168
1096 3300005334 Ga0068869_100001262 Ga0068869_1000012629 168
1097 3300005335 Ga0070666_10005360 Ga0070666_100053604 168
1098 3300005335 Ga0070666_10284014 Ga0070666_102840142 168
1099 3300005336 Ga0070680_100129399 Ga0070680_1001293992 168
1100 3300005336 Ga0070680_100249623 Ga0070680_1002496232 168
1101 3300005338 Ga0068868_100033936 Ga0068868_1000339363 168
1102 3300005338 Ga0068868_100223968 Ga0068868_1002239682 168
1103 3300005338 Ga0068868_100270232 Ga0068868_1002702322 168
1104 3300005338 Ga0068868_100462883 Ga0068868_1004628832 168
1105 3300005340 Ga0070689_100095726 Ga0070689_1000957261 168
1106 3300005344 Ga0070661_100085617 Ga0070661_1000856172 168
1107 3300005344 Ga0070661_100151182 Ga0070661_1001511822 168
1108 3300005347 Ga0070668_100013174 Ga0070668_1000131744 168
1109 3300005347 Ga0070668_100413295 Ga0070668_1004132952 168
1110 3300005353 Ga0070669_100006423 Ga0070669_1000064234 168
1111 3300005353 Ga0070669_100087606 Ga0070669_1000876061 168
1112 3300005354 Ga0070675_100011787 Ga0070675_1000117874 168
1113 3300005354 Ga0070675_100033284 Ga0070675_1000332844 168
1114 3300005355 Ga0070671_100024944 Ga0070671_1000249444 168
1115 3300005355 Ga0070671_100311697 Ga0070671_1003116972 168
1116 3300005356 Ga0070674_100395469 Ga0070674_1003954692 168
1117 3300005356 Ga0070674_100835992 Ga0070674_1008359921 168
1118 3300005364 Ga0070673_100309106 Ga0070673_1003091062 168
1119 3300005364 Ga0070673_100401747 Ga0070673_1004017472 168
1120 3300005365 Ga0070688_100002131 Ga0070688_1000021315 168
1121 3300005366 Ga0070659_100136306 Ga0070659_1001363062 168
1122 3300005367 Ga0070667_100230465 Ga0070667_1002304652 168
1123 3300005406 Ga0070703_10100402 Ga0070703_101004022 168
1124 3300005434 Ga0070709_10788273 Ga0070709_107882732 168
1125 3300005434 Ga0070709_11359064 Ga0070709_113590641 168
1126 3300005436 Ga0070713_100003837 Ga0070713_1000038373 168
1127 3300005438 Ga0070701_10003359 Ga0070701_100033594 168
1128 3300005440 Ga0070705_100394483 Ga0070705_1003944831 168
1129 3300005441 Ga0070700_100016207 Ga0070700_1000162074 168
1130 3300005444 Ga0070694_100225635 Ga0070694_1002256352 168
1131 3300005445 Ga0070708_100056732 Ga0070708_1000567324 168
1132 3300005445 Ga0070708_100064292 Ga0070708_1000642922 168
1133 3300005455 Ga0070663_100042916 Ga0070663_1000429162 168
1134 3300005455 Ga0070663_100106878 Ga0070663_1001068782 168
1135 3300005456 Ga0070678_100428426 Ga0070678_1004284262 168
1136 3300005457 Ga0070662_100030540 Ga0070662_1000305402 168
1137 3300005457 Ga0070662_100403866 Ga0070662_1004038661 168
1138 3300005458 Ga0070681_10037723 Ga0070681_100377234 168
1139 3300005459 Ga0068867_100023341 Ga0068867_1000233412 168
1140 3300005459 Ga0068867_100033393 Ga0068867_1000333933 168
1141 3300005466 Ga0070685_10011104 Ga0070685_100111043 168
1142 3300005466 Ga0070685_10141746 Ga0070685_101417461 168
1143 3300005467 Ga0070706_100001075 Ga0070706_10000107526 168
1144 3300005468 Ga0070707_100482038 Ga0070707_1004820382 168
1145 3300005471 Ga0070698_100000427 Ga0070698_10000042729 168
1146 3300005471 Ga0070698_100132895 Ga0070698_1001328951 168
1147 3300005471 Ga0070698_100194392 Ga0070698_1001943922 168
1148 3300005518 Ga0070699_100013907 Ga0070699_1000139072 168
1149 3300005518 Ga0070699_100534202 Ga0070699_1005342021 168
1150 3300005530 Ga0070679_100271430 Ga0070679_1002714302 168
1151 3300005536 Ga0070697_100067361 Ga0070697_1000673612 168
1152 3300005536 Ga0070697_100232142 Ga0070697_1002321422 168
1153 3300005539 Ga0068853_100182959 Ga0068853_1001829592 168
1154 3300005543 Ga0070672_100008154 Ga0070672_1000081542 168
1155 3300005543 Ga0070672_100029014 Ga0070672_1000290143 168
1156 3300005544 Ga0070686_100467425 Ga0070686_1004674252 168
1157 3300005544 Ga0070686_100689177 Ga0070686_1006891771 168
1158 3300005545 Ga0070695_100551888 Ga0070695_1005518881 168
1159 3300005546 Ga0070696_100041940 Ga0070696_1000419402 168
1160 3300005547 Ga0070693_100291194 Ga0070693_1002911941 168
1161 3300005548 Ga0070665_100009488 Ga0070665_1000094889 168
1162 3300005548 Ga0070665_100011310 Ga0070665_1000113107 168
1163 3300005548 Ga0070665_100022374 Ga0070665_1000223742 168
1164 3300005548 Ga0070665_100164962 Ga0070665_1001649622 168
1165 3300005549 Ga0070704_100155327 Ga0070704_1001553272 168
1166 3300005549 Ga0070704_101066483 Ga0070704_1010664831 168
1167 3300005563 Ga0068855_100053916 Ga0068855_1000539164 168
1168 3300005563 Ga0068855_100260467 Ga0068855_1002604672 168
1169 3300005564 Ga0070664_100005556 Ga0070664_1000055564 168
1170 3300005564 Ga0070664_100209406 Ga0070664_1002094062 168
1171 3300005577 Ga0068857_100074236 Ga0068857_1000742362 168
1172 3300005577 Ga0068857_100177464 Ga0068857_1001774642 168
1173 3300005615 Ga0070702_100300751 Ga0070702_1003007512 168
1174 3300005615 Ga0070702_100704572 Ga0070702_1007045721 168
1175 3300005616 Ga0068852_100028938 Ga0068852_1000289383 168
1176 3300005616 Ga0068852_101432410 Ga0068852_1014324102 168
1177 3300005617 Ga0068859_100563901 Ga0068859_1005639012 168
1178 3300005618 Ga0068864_100012239 Ga0068864_1000122392 168
1179 3300005718 Ga0068866_10040449 Ga0068866_100404492 168
1180 3300005719 Ga0068861_100885149 Ga0068861_1008851491 168
1181 3300005719 Ga0068861_101419643 Ga0068861_1014196432 168
1182 3300005834 Ga0068851_10013405 Ga0068851_100134052 168
1183 3300005834 Ga0068851_10146504 Ga0068851_101465042 168
1184 3300005840 Ga0068870_10006752 Ga0068870_100067525 168
1185 3300005840 Ga0068870_10191237 Ga0068870_101912371 168
1186 3300005841 Ga0068863_100007057 Ga0068863_1000070576 168
1187 3300005842 Ga0068858_100016103 Ga0068858_1000161031 168
1188 3300005842 Ga0068858_100066236 Ga0068858_1000662362 168
1189 3300005842 Ga0068858_100095073 Ga0068858_1000950732 168
1190 3300005842 Ga0068858_100241282 Ga0068858_1002412822 168
1191 3300005842 Ga0068858_100432362 Ga0068858_1004323622 168
1192 3300005843 Ga0068860_100073344 Ga0068860_1000733443 168
1193 3300005843 Ga0068860_100477702 Ga0068860_1004777022 168
1194 3300005843 Ga0068860_100510849 Ga0068860_1005108492 168
1195 3300005843 Ga0068860_100749968 Ga0068860_1007499681 168
1196 3300005843 Ga0068860_101191300 Ga0068860_1011913002 168
1197 3300005844 Ga0068862_100029902 Ga0068862_1000299022 168
1198 3300005844 Ga0068862_100106978 Ga0068862_1001069782 168
1199 3300005844 Ga0068862_100218958 Ga0068862_1002189582 168
1200 3300005844 Ga0068862_100937623 Ga0068862_1009376232 168
1201 3300005981 Ga0081538_10030555 Ga0081538_100305552 168
1202 3300005983 Ga0081540_1059312 Ga0081540_10593122 168
1203 3300006028 Ga0070717_10187073 Ga0070717_101870732 168
1204 3300006048 Ga0075363_100334623 Ga0075363_1003346231 168
1205 3300006237 Ga0097621_100035926 Ga0097621_1000359264 168
1206 3300006237 Ga0097621_100079342 Ga0097621_1000793422 168
1207 3300006358 Ga0068871_100000960 Ga0068871_1000009605 168
1208 3300006358 Ga0068871_100006007 Ga0068871_1000060076 168
1209 3300006844 Ga0075428_100002818 Ga0075428_1000028189 168
1210 3300006844 Ga0075428_100009989 Ga0075428_1000099893 168
1211 3300006846 Ga0075430_100024649 Ga0075430_1000246496 168
1212 3300006846 Ga0075430_100054608 Ga0075430_1000546082 168
1213 3300006846 Ga0075430_100721181 Ga0075430_1007211812 168
1214 3300006847 Ga0075431_100002960 Ga0075431_10000296015 168
1215 3300006847 Ga0075431_100109517 Ga0075431_1001095172 168
1216 3300006847 Ga0075431_100128643 Ga0075431_1001286432 168
1217 3300006852 Ga0075433_10003757 Ga0075433_100037575 168
1218 3300006852 Ga0075433_10010211 Ga0075433_100102118 168
1219 3300006852 Ga0075433_10157548 Ga0075433_101575482 168
1220 3300006852 Ga0075433_10269855 Ga0075433_102698552 168
1221 3300006871 Ga0075434_100125679 Ga0075434_1001256792 168
1222 3300006871 Ga0075434_100470565 Ga0075434_1004705652 168
1223 3300006880 Ga0075429_100035201 Ga0075429_1000352014 168
1224 3300006880 Ga0075429_100118506 Ga0075429_1001185061 168
1225 3300006880 Ga0075429_101116290 Ga0075429_1011162902 168
1226 3300006881 Ga0068865_100031716 Ga0068865_1000317163 168
1227 3300006881 Ga0068865_100506316 Ga0068865_1005063162 168
1228 3300006914 Ga0075436_100000215 Ga0075436_1000002159 168
1229 3300006931 Ga0097620_100563941 Ga0097620_1005639412 168
1230 3300007076 Ga0075435_100007075 Ga0075435_1000070752 168
1231 3300007076 Ga0075435_100016568 Ga0075435_1000165685 168
1232 3300007076 Ga0075435_100133166 Ga0075435_1001331662 168
1233 3300009093 Ga0105240_10004613 Ga0105240_1000461313 168
1234 3300009093 Ga0105240_10467037 Ga0105240_104670372 168
1235 3300009094 Ga0111539_10002074 Ga0111539_100020749 168
1236 3300009098 Ga0105245_10057786 Ga0105245_100577863 168
1237 3300009098 Ga0105245_10758321 Ga0105245_107583212 168
1238 3300009098 Ga0105245_12313994 Ga0105245_123139941 168
1239 3300009101 Ga0105247_10524612 Ga0105247_105246122 168
1240 3300009147 Ga0114129_10001675 Ga0114129_1000167521 168
1241 3300009147 Ga0114129_10033390 Ga0114129_100333904 168
1242 3300009147 Ga0114129_10307423 Ga0114129_103074231 168
1243 3300009148 Ga0105243_10369408 Ga0105243_103694082 168
1244 3300009148 Ga0105243_10952756 Ga0105243_109527561 168
1245 3300009174 Ga0105241_10898039 Ga0105241_108980392 168
1246 3300009176 Ga0105242_10351867 Ga0105242_103518672 168
1247 3300009176 Ga0105242_10912851 Ga0105242_109128511 168
1248 3300009176 Ga0105242_11132088 Ga0105242_111320882 168
1249 3300009177 Ga0105248_10100974 Ga0105248_101009743 168
1250 3300009177 Ga0105248_10164351 Ga0105248_101643512 168
1251 3300009177 Ga0105248_10224186 Ga0105248_102241861 168
1252 3300009177 Ga0105248_10664755 Ga0105248_106647552 168
1253 3300009177 Ga0105248_10972547 Ga0105248_109725472 168
1254 3300009545 Ga0105237_10015759 Ga0105237_100157592 168
1255 3300009551 Ga0105238_10003888 Ga0105238_100038888 168
1256 3300009551 Ga0105238_10238080 Ga0105238_102380802 168
1257 3300009553 Ga0105249_10006579 Ga0105249_100065794 168
1258 3300009553 Ga0105249_10064266 Ga0105249_100642662 168
1259 3300009553 Ga0105249_10192366 Ga0105249_101923662 168
1260 3300009553 Ga0105249_10388843 Ga0105249_103888432 168
1261 3300009553 Ga0105249_10450972 Ga0105249_104509722 168
1262 3300009553 Ga0105249_10471864 Ga0105249_104718642 168
1263 3300010375 Ga0105239_10404650 Ga0105239_104046502 168
1264 3300013104 Ga0157370_10001503 Ga0157370_1000150324 168
1265 3300013104 Ga0157370_10185897 Ga0157370_101858972 168
1266 3300013105 Ga0157369_10252653 Ga0157369_102526532 168
1267 3300013296 Ga0157374_10035554 Ga0157374_100355542 168
1268 3300013296 Ga0157374_10133935 Ga0157374_101339351 168
1269 3300013297 Ga0157378_10499220 Ga0157378_104992202 168
1270 3300013297 Ga0157378_10806557 Ga0157378_108065572 168
1271 3300013306 Ga0163162_10008554 Ga0163162_100085542 168
1272 3300013306 Ga0163162_10243928 Ga0163162_102439282 168
1273 3300013306 Ga0163162_11323572 Ga0163162_113235722 168
1274 3300013307 Ga0157372_10328403 Ga0157372_103284032 168
1275 3300013308 Ga0157375_10183582 Ga0157375_101835823 168
1276 3300013308 Ga0157375_10219429 Ga0157375_102194293 168
1277 3300013308 Ga0157375_11350131 Ga0157375_113501311 168
1278 3300014325 Ga0163163_10053837 Ga0163163_100538372 168
1279 3300014325 Ga0163163_10216105 Ga0163163_102161052 168
1280 3300014325 Ga0163163_10384953 Ga0163163_103849532 168
1281 3300014326 Ga0157380_10017807 Ga0157380_100178074 168
1282 3300014326 Ga0157380_11431109 Ga0157380_114311091 168
1283 3300014745 Ga0157377_10000814 Ga0157377_100008146 168
1284 3300014745 Ga0157377_10690453 Ga0157377_106904531 168
1285 3300014968 Ga0157379_10048210 Ga0157379_100482102 168
1286 3300014968 Ga0157379_10183138 Ga0157379_101831382 168
1287 3300014968 Ga0157379_10720053 Ga0157379_107200532 168
1288 3300014969 Ga0157376_10015680 Ga0157376_100156801 168
1289 3300014969 Ga0157376_10109768 Ga0157376_101097682 168
1290 3300017792 Ga0163161_10011022 Ga0163161_100110224 168
1291 3300025315 Ga0207697_10003240 Ga0207697_100032403 168
1292 3300025321 Ga0207656_10009042 Ga0207656_100090422 168
1293 3300025321 Ga0207656_10055373 Ga0207656_100553732 168
1294 3300025893 Ga0207682_10000541 Ga0207682_1000054110 168
1295 3300025893 Ga0207682_10013442 Ga0207682_100134422 168
1296 3300025901 Ga0207688_10001706 Ga0207688_100017066 168
1297 3300025901 Ga0207688_10221142 Ga0207688_102211422 168
1298 3300025903 Ga0207680_10035520 Ga0207680_100355202 168
1299 3300025903 Ga0207680_10129904 Ga0207680_101299042 168
1300 3300025903 Ga0207680_10177182 Ga0207680_101771822 168
1301 3300025903 Ga0207680_10333357 Ga0207680_103333571 168
1302 3300025907 Ga0207645_10000521 Ga0207645_100005219 168
1303 3300025907 Ga0207645_10305790 Ga0207645_103057902 168
1304 3300025907 Ga0207645_10790199 Ga0207645_107901991 168
1305 3300025908 Ga0207643_10036550 Ga0207643_100365502 168
1306 3300025908 Ga0207643_10046042 Ga0207643_100460423 168
1307 3300025908 Ga0207643_10125633 Ga0207643_101256332 168
1308 3300025910 Ga0207684_10001027 Ga0207684_100010278 168
1309 3300025912 Ga0207707_10117790 Ga0207707_101177902 168
1310 3300025913 Ga0207695_10007213 Ga0207695_100072134 168
1311 3300025913 Ga0207695_10353635 Ga0207695_103536352 168
1312 3300025917 Ga0207660_10119451 Ga0207660_101194512 168
1313 3300025918 Ga0207662_10001988 Ga0207662_100019886 168
1314 3300025919 Ga0207657_10282154 Ga0207657_102821541 168
1315 3300025920 Ga0207649_10073457 Ga0207649_100734572 168
1316 3300025920 Ga0207649_10124422 Ga0207649_101244222 168
1317 3300025921 Ga0207652_10306769 Ga0207652_103067692 168
1318 3300025922 Ga0207646_10504317 Ga0207646_105043172 168
1319 3300025923 Ga0207681_10005130 Ga0207681_100051302 168
1320 3300025923 Ga0207681_10275682 Ga0207681_102756821 168
1321 3300025923 Ga0207681_10468136 Ga0207681_104681362 168
1322 3300025923 Ga0207681_11278995 Ga0207681_112789951 168
1323 3300025923 Ga0207681_11419877 Ga0207681_114198771 168
1324 3300025924 Ga0207694_10005279 Ga0207694_100052798 168
1325 3300025924 Ga0207694_10254713 Ga0207694_102547132 168
1326 3300025925 Ga0207650_10344929 Ga0207650_103449292 168
1327 3300025925 Ga0207650_10642798 Ga0207650_106427982 168
1328 3300025926 Ga0207659_10009873 Ga0207659_100098737 168
1329 3300025926 Ga0207659_10041918 Ga0207659_100419182 168
1330 3300025926 Ga0207659_10815093 Ga0207659_108150931 168
1331 3300025927 Ga0207687_10044763 Ga0207687_100447632 168
1332 3300025927 Ga0207687_10081101 Ga0207687_100811012 168
1333 3300025928 Ga0207700_10022022 Ga0207700_100220224 168
1334 3300025929 Ga0207664_10028775 Ga0207664_100287753 168
1335 3300025931 Ga0207644_10016831 Ga0207644_100168313 168
1336 3300025931 Ga0207644_10049232 Ga0207644_100492323 168
1337 3300025931 Ga0207644_10059682 Ga0207644_100596823 168
1338 3300025932 Ga0207690_10368836 Ga0207690_103688361 168
1339 3300025933 Ga0207706_10002593 Ga0207706_1000259310 168
1340 3300025933 Ga0207706_10968383 Ga0207706_109683831 168
1341 3300025934 Ga0207686_10034494 Ga0207686_100344943 168
1342 3300025934 Ga0207686_10349413 Ga0207686_103494132 168
1343 3300025935 Ga0207709_10184638 Ga0207709_101846382 168
1344 3300025936 Ga0207670_10018796 Ga0207670_100187962 168
1345 3300025938 Ga0207704_10004439 Ga0207704_100044396 168
1346 3300025938 Ga0207704_10346045 Ga0207704_103460452 168
1347 3300025938 Ga0207704_10836020 Ga0207704_108360201 168
1348 3300025939 Ga0207665_10674296 Ga0207665_106742961 168
1349 3300025940 Ga0207691_10003673 Ga0207691_100036734 168
1350 3300025940 Ga0207691_10070110 Ga0207691_100701102 168
1351 3300025941 Ga0207711_10021013 Ga0207711_100210133 168
1352 3300025941 Ga0207711_10061615 Ga0207711_100616153 168
1353 3300025941 Ga0207711_10068406 Ga0207711_100684062 168
1354 3300025941 Ga0207711_10451471 Ga0207711_104514712 168
1355 3300025941 Ga0207711_10659297 Ga0207711_106592972 168
1356 3300025942 Ga0207689_10007578 Ga0207689_100075785 168
1357 3300025942 Ga0207689_10127234 Ga0207689_101272342 168
1358 3300025942 Ga0207689_10208375 Ga0207689_102083752 168
1359 3300025945 Ga0207679_10068330 Ga0207679_100683302 168
1360 3300025945 Ga0207679_10165364 Ga0207679_101653642 168
1361 3300025945 Ga0207679_10522996 Ga0207679_105229962 168
1362 3300025949 Ga0207667_10091974 Ga0207667_100919744 168
1363 3300025949 Ga0207667_10247336 Ga0207667_102473362 168
1364 3300025960 Ga0207651_10004643 Ga0207651_100046433 168
1365 3300025960 Ga0207651_10681559 Ga0207651_106815592 168
1366 3300025960 Ga0207651_11006446 Ga0207651_110064461 168
1367 3300025961 Ga0207712_10011321 Ga0207712_100113214 168
1368 3300025961 Ga0207712_10151966 Ga0207712_101519662 168
1369 3300025961 Ga0207712_10272526 Ga0207712_102725262 168
1370 3300025961 Ga0207712_10560967 Ga0207712_105609671 168
1371 3300025961 Ga0207712_10654440 Ga0207712_106544402 168
1372 3300025972 Ga0207668_10299151 Ga0207668_102991512 168
1373 3300025972 Ga0207668_11106710 Ga0207668_111067102 168
1374 3300025986 Ga0207658_10042703 Ga0207658_100427033 168
1375 3300025986 Ga0207658_10130045 Ga0207658_101300452 168
1376 3300026023 Ga0207677_10005457 Ga0207677_100054574 168
1377 3300026023 Ga0207677_10326960 Ga0207677_103269602 168
1378 3300026023 Ga0207677_10492774 Ga0207677_104927742 168
1379 3300026035 Ga0207703_10112763 Ga0207703_101127633 168
1380 3300026035 Ga0207703_10182104 Ga0207703_101821041 168
1381 3300026035 Ga0207703_10291542 Ga0207703_102915422 168
1382 3300026035 Ga0207703_10520566 Ga0207703_105205662 168
1383 3300026041 Ga0207639_10329551 Ga0207639_103295512 168
1384 3300026041 Ga0207639_11637172 Ga0207639_116371721 168
1385 3300026067 Ga0207678_10073873 Ga0207678_100738732 168
1386 3300026067 Ga0207678_10135135 Ga0207678_101351352 168
1387 3300026067 Ga0207678_10567190 Ga0207678_105671902 168
1388 3300026075 Ga0207708_10004438 Ga0207708_100044386 168
1389 3300026078 Ga0207702_10133049 Ga0207702_101330492 168
1390 3300026088 Ga0207641_10006419 Ga0207641_100064195 168
1391 3300026089 Ga0207648_10044810 Ga0207648_100448102 168
1392 3300026089 Ga0207648_10051074 Ga0207648_100510742 168
1393 3300026089 Ga0207648_10435195 Ga0207648_104351951 168
1394 3300026089 Ga0207648_10937947 Ga0207648_109379471 168
1395 3300026116 Ga0207674_10075198 Ga0207674_100751983 168
1396 3300026116 Ga0207674_10083205 Ga0207674_100832054 168
1397 3300026116 Ga0207674_10356921 Ga0207674_103569212 168
1398 3300026118 Ga0207675_100001414 Ga0207675_1000014149 168
1399 3300026118 Ga0207675_100270050 Ga0207675_1002700501 168
1400 3300026118 Ga0207675_100589240 Ga0207675_1005892402 168
1401 3300026121 Ga0207683_10001148 Ga0207683_1000114810 168
1402 3300026121 Ga0207683_10001966 Ga0207683_100019666 168
1403 3300026121 Ga0207683_10534423 Ga0207683_105344232 168
1404 3300026121 Ga0207683_10632853 Ga0207683_106328532 168
1405 3300026121 Ga0207683_11068381 Ga0207683_110683812 168
1406 3300026142 Ga0207698_10019994 Ga0207698_100199944 168
1407 3300027665 Ga0209983_1037059 Ga0209983_10370591 168
1408 3300027876 Ga0209974_10212266 Ga0209974_102122661 168
1409 3300027907 Ga0207428_10000457 Ga0207428_1000045714 168
1410 3300027907 Ga0207428_10146102 Ga0207428_101461022 168
1411 3300028379 Ga0268266_10074660 Ga0268266_100746602 168
1412 3300028379 Ga0268266_10154492 Ga0268266_101544922 168
1413 3300028379 Ga0268266_10293663 Ga0268266_102936632 168
1414 3300028379 Ga0268266_11359053 Ga0268266_113590531 168
1415 3300028380 Ga0268265_10029382 Ga0268265_100293824 168
1416 3300028380 Ga0268265_10521267 Ga0268265_105212672 168
1417 3300028381 Ga0268264_10512354 Ga0268264_105123542 168
1418 3300028381 Ga0268264_10518124 Ga0268264_105181242 168
1419 3300028381 Ga0268264_10527028 Ga0268264_105270282 168
1420 3300028381 Ga0268264_10936761 Ga0268264_109367611 168
1421 3300028381 Ga0268264_11160179 Ga0268264_111601792 168
1422 3300028666 Ga0265336_10012883 Ga0265336_100128832 168
1423 3300031456 Ga0307513_10653897 Ga0307513_106538972 168
1424 3300031548 Ga0307408_100244408 Ga0307408_1002444082 168
1425 3300031548 Ga0307408_100509712 Ga0307408_1005097122 168
1426 3300031852 Ga0307410_10578119 Ga0307410_105781192 168
1427 3300031903 Ga0307407_10302403 Ga0307407_103024032 168
1428 3300031995 Ga0307409_101466237 Ga0307409_1014662371 168
1429 3300032002 Ga0307416_100186187 Ga0307416_1001861872 168
1430 3300032002 Ga0307416_100252354 Ga0307416_1002523542 168
1431 3300032004 Ga0307414_10047590 Ga0307414_100475902 168
1432 3300032005 Ga0307411_10136459 Ga0307411_101364592 168
1433 3300032005 Ga0307411_10193077 Ga0307411_101930772 168
1434 3300035085 Ga0373929_0149819 Ga0373929_0149819_91_597 168
1435 3300035116 Ga0373945_0121515 Ga0373945_0121515_48_560 168
1436 3300035117 Ga0373953_0039061 Ga0373953_0039061_1347_1856 168
1437 3300035119 Ga0373956_0134100 Ga0373956_0134100_398_910 168
1438 3300035170 Ga0373943_0140343 Ga0373943_0140343_491_1003 168
1439 3300035410 Ga0373924_0054226 Ga0373924_0054226_233_745 168
1440 3300035692 Ga0373935_0250171 Ga0373935_0250171_624_1136 168
1441 3300035692 Ga0373935_1051349 Ga0373935_1051349_58_567 168
1442 3300035724 Ga0373933_0046465 Ga0373933_0046465_47_556 168
1443 3300037068 Ga0373925_0184100 Ga0373925_0184100_562_1074 168
1444 3300038443 Ga0395901_0604246 Ga0395901_0604246_75_587 168
1445 3300041443 Ga0451789_0157665 Ga0451789_0157665_244_774 168
1446 3300041486 Ga0451807_2220156 Ga0451807_2220156_447_959 168
1447 3300042003 Ga0439443_046346 Ga0439443_046346_71_583 168
1448 3300042004 Ga0439445_0012614 Ga0439445_0012614_371_883 168
1449 3300042156 Ga0439446_0021736 Ga0439446_0021736_1013_1525 168
1450 3300042156 Ga0439446_0158167 Ga0439446_0158167_187_708 168
1451 3300042435 Ga0439434_0017276 Ga0439434_0017276_532_1044 168
1452 3300045051 Ga0451576_0074689 Ga0451576_0074689_1678_2184 168
1453 3300045051 Ga0451576_0185710 Ga0451576_0185710_1062_1577 168
1454 3300046459 Ga0495629_0043805 Ga0495629_0043805_1287_1799 168
1455 3300046473 Ga0495582_0325750 Ga0495582_0325750_168_680 168
1456 3300046476 Ga0495662_0138451 Ga0495662_0138451_317_829 168
1457 3300046499 Ga0495594_0548823 Ga0495594_0548823_22_534 168
1458 3300046535 Ga0495586_0280199 Ga0495586_0280199_214_726 168
1459 3300046537 Ga0495598_0052781 Ga0495598_0052781_181_693 168
1460 3300046642 Ga0495634_0321409 Ga0495634_0321409_74_586 168
1461 3300046663 Ga0495635_0234966 Ga0495635_0234966_227_739 168
1462 3300046664 Ga0495659_0031504 Ga0495659_0031504_535_1047 168
1463 3300046674 Ga0495588_0412687 Ga0495588_0412687_150_662 168
1464 3300046681 Ga0495647_0425945 Ga0495647_0425945_42_554 168
1465 3300046683 Ga0495658_0049965 Ga0495658_0049965_1468_1980 168
1466 3300046689 Ga0495613_0324150 Ga0495613_0324150_63_575 168
1467 3300047318 Ga0495636_0155614 Ga0495636_0155614_77_589 168
1468 3300047471 Ga0495684_0370828 Ga0495684_0370828_80_592 168
1469 3300048903 Ga0496100_0379691 Ga0496100_0379691_316_858 168
1470 3300048905 Ga0496102_0338214 Ga0496102_0338214_160_666 168
1471 3300048905 Ga0496102_0451427 Ga0496102_0451427_477_989 168
1472 3300048905 Ga0496102_1265116 Ga0496102_1265116_32_547 168
1473 3300048906 Ga0496103_0389839 Ga0496103_0389839_86_628 168
1474 3300048907 Ga0496104_0069797 Ga0496104_0069797_2725_3234 168
1475 3300048907 Ga0496104_0177547 Ga0496104_0177547_1029_1541 168
1476 3300048909 Ga0496106_0506012 Ga0496106_0506012_333_845 168
1477 3300048912 Ga0496109_0759772 Ga0496109_0759772_66_578 168
1478 3300048913 Ga0496110_0111050 Ga0496110_0111050_1001_1543 168
1479 3300048915 Ga0496112_0120053 Ga0496112_0120053_473_985 168
1480 3300048915 Ga0496112_0182920 Ga0496112_0182920_448_960 168
1481 3300048917 Ga0496114_0211985 Ga0496114_0211985_195_707 168
1482 3300048917 Ga0496114_0335546 Ga0496114_0335546_439_951 168
1483 3300049161 Ga0501305_050978 Ga0501305_050978_57_569 168
1484 3300049527 Ga0501311_005136 Ga0501311_005136_782_1294 168
1485 3300049574 Ga0501038_0243899 Ga0501038_0243899_498_1052 168
1486 3300049579 Ga0501043_0052424 Ga0501043_0052424_2089_2643 168
1487 3300049667 Ga0501230_087436 Ga0501230_087436_123_632 168
1488 3300049680 Ga0501250_051263 Ga0501250_051263_44_574 168
1489 3300049743 Ga0501081_0280803 Ga0501081_0280803_151_663 168
1490 3300049822 Ga0501035_0380759 Ga0501035_0380759_123_677 168
1491 3300049823 Ga0501044_0009871 Ga0501044_0009871_4335_4889 168
1492 3300050490 nmdc:mga03n38_557177_c1 nmdc:mga03n38_557177_c1_88_600 168
1493 3300050507 nmdc:mga05p37_223907_c1 nmdc:mga05p37_223907_c1_1170_1682 168
1494 3300050507 nmdc:mga05p37_69600_c1 nmdc:mga05p37_69600_c1_2310_2825 168
1495 3300050508 nmdc:mga09592_3840_c1 nmdc:mga09592_3840_c1_7745_8260 168
1496 3300050509 nmdc:mga0qj67_65227_c1 nmdc:mga0qj67_65227_c1_1633_2148 168
1497 3300050509 nmdc:mga0qj67_875337_c1 nmdc:mga0qj67_875337_c1_154_669 168
1498 3300050510 nmdc:mga06r32_21094_c1 nmdc:mga06r32_21094_c1_1852_2367 168
1499 3300050510 nmdc:mga06r32_30066_c1 nmdc:mga06r32_30066_c1_3762_4277 168
1500 3300050511 nmdc:mga08y16_740776_c1 nmdc:mga08y16_740776_c1_258_770 168
1501 3300050511 nmdc:mga08y16_971_c1 nmdc:mga08y16_971_c1_6678_7193 168
1502 3300050512 nmdc:mga0n895_1077622_c1 nmdc:mga0n895_1077622_c1_38_553 168
1503 3300050512 nmdc:mga0n895_164117_c1 nmdc:mga0n895_164117_c1_976_1491 168
1504 3300050512 nmdc:mga0n895_432066_c1 nmdc:mga0n895_432066_c1_485_997 168
1505 3300050512 nmdc:mga0n895_83466_c1 nmdc:mga0n895_83466_c1_242_757 168
1506 3300050513 nmdc:mga0rr50_11930_c1 nmdc:mga0rr50_11930_c1_3331_3846 168
1507 3300050513 nmdc:mga0rr50_42324_c1 nmdc:mga0rr50_42324_c1_1807_2319 168
1508 3300050513 nmdc:mga0rr50_554848_c1 nmdc:mga0rr50_554848_c1_396_905 168
1509 3300050514 nmdc:mga08x19_32808_c1 nmdc:mga08x19_32808_c1_1175_1687 168
1510 3300050515 nmdc:mga0a205_106757_c1 nmdc:mga0a205_106757_c1_1446_1961 168
1511 3300050515 nmdc:mga0a205_11720_c1 nmdc:mga0a205_11720_c1_4583_5098 168
1512 3300050515 nmdc:mga0a205_324442_c1 nmdc:mga0a205_324442_c1_463_975 168
1513 3300050515 nmdc:mga0a205_339571_c1 nmdc:mga0a205_339571_c1_824_1336 168
1514 3300053085 Ga0495619_0540236 Ga0495619_0540236_71_583 168
1515 3300053111 Ga0500572_199005 Ga0500572_199005_100_621 168
1516 3300053177 Ga0500636_0247282 Ga0500636_0247282_292_813 168
1517 3300053733 Ga0500552_060897 Ga0500552_060897_49_561 168
1518 3300059421 Ga0590071_000019 Ga0590071_000019_41812_42324 168
1519 3300059421 Ga0590071_000517 Ga0590071_000517_9279_9794 168
1520 3300059421 Ga0590071_046832 Ga0590071_046832_47_559 168
1521 3300059423 Ga0590074_000358 Ga0590074_000358_3532_4047 168
1522 3300059423 Ga0590074_000618 Ga0590074_000618_4581_5093 168
1523 3300059424 Ga0590075_000532 Ga0590075_000532_1063_1575 168
1524 3300059424 Ga0590075_000655 Ga0590075_000655_7956_8471 168
1525 3300059426 Ga0590077_001823 Ga0590077_001823_1985_2500 168
1526 3300059426 Ga0590077_002027 Ga0590077_002027_2175_2687 168
1527 3300059426 Ga0590077_012554 Ga0590077_012554_624_1136 168
1528 3300059493 Ga0587077_021707 Ga0587077_021707_500_1012 168
1529 3300059513 Ga0587094_075766 Ga0587094_075766_82_594 168
1530 3300059607 Ga0587125_034082 Ga0587125_034082_12_542 168
1531 3300059623 Ga0587101_013175 Ga0587101_013175_128_640 168
1532 3300059641 Ga0587068_063280 Ga0587068_063280_82_594 168
1533 3300060353 Ga0501082_0487244 Ga0501082_0487244_155_661 168
1534 3300061734 Ga0530510_0619177 Ga0530510_0619177_280_792 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05591

T6SS_VipA

Type VI secretion system, VipA, VC_A0107 or Hcp2

9

162

0.98

Feature Viewer

pLDDT pTM Quality
67.47 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map