F494580

General Info

Members Datasets Scaffolds Average Seq Length
1528 508 1528 61

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_101562058|Ga0070680_1015620581
Length 71
Sequence MAKIKIKQIGSPIRRTKDQRATLIGLGLNKMHKVSELEDTPEVRGMIRKLPHMVTIVINRRSTNRRPSSRT

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
21 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
72 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
73 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
80 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
99 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
105 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
133 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
134 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
151 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
158 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
159 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
162 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
163 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
164 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
165 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
166 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
169 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
170 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
246 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
247 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
248 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
263 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
275 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
278 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
279 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
280 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
281 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
282 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
283 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
284 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
285 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
286 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
287 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
288 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
289 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
290 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
291 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
292 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
293 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
294 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
295 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
296 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
297 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
298 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
299 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
300 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
301 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
302 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
303 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
304 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
305 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
306 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
307 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
308 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
309 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
310 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
311 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
312 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
313 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
314 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
317 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
318 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
319 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
320 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
321 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
322 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
323 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
324 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
325 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
326 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
327 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
328 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
329 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
330 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
331 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
332 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
333 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
334 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
335 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
336 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
337 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
338 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
339 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
340 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
341 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
342 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
343 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
344 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
345 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
346 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
347 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
348 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
349 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
350 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
351 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
352 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
353 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
354 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
355 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
356 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
357 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
358 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
359 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
360 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
361 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
362 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
363 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
364 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
365 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
366 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
367 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
368 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
369 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
370 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
371 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
372 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
373 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
374 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
375 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
376 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
377 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
380 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
381 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
382 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
383 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
384 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
385 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
386 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
387 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
388 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
389 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
390 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
391 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
392 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
393 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
394 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
395 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
396 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
397 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
398 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
399 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
400 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
401 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
404 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
405 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
406 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
407 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
408 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
409 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
410 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
434 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
435 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
436 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
437 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
438 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
439 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
440 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
441 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
442 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
443 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
444 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
445 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
446 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
447 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
448 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
449 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
450 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
451 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
452 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
456 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
457 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
458 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
459 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
460 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
461 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
462 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
463 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
464 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
465 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
466 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
467 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
468 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
469 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
470 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
471 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
472 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
473 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
474 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
475 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
476 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
477 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
478 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
479 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
480 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
481 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
482 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
483 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
484 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
485 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
486 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
487 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
488 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
489 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
490 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
508 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 3.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.24
Nodule 0
Rhizoplane 3.73
Rhizosphere 77.88
Stem 0
Stem Tuber 0
Unclassified 6.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c003367 3300000041 Bacteria 1422
2 ARcpr5yngRDRAFT_c000513 3300000043 Bacteria 4977
3 JGI24736J21556_1000064 3300001904 Bacteria 17271
4 JGI24736J21556_1009108 3300001904 Bacteria 1642
5 JGI24736J21556_1017419 3300001904 Bacteria 1140
6 JGI24741J21665_1001255 3300001915 Bacteria 7456
7 JGI24741J21665_1011514 3300001915 Bacteria 1543
8 JGI24752J21851_1000348 3300001976 Bacteria 6448
9 JGI24752J21851_1000507 3300001976 Bacteria 5227
10 JGI24740J21852_10001392 3300001979 Bacteria 11043
11 JGI24740J21852_10002955 3300001979 Bacteria 7552
12 JGI24740J21852_10036607 3300001979 Bacteria 1523
13 JGI24740J21852_10038021 3300001979 Bacteria 1480
14 JGI24740J21852_10120951 3300001979 Bacteria 656
15 JGI24739J22299_10003209 3300001989 Bacteria 6234
16 JGI24739J22299_10004443 3300001989 Bacteria 5373
17 JGI24739J22299_10009935 3300001989 Bacteria 3538
18 JGI24739J22299_10021051 3300001989 Bacteria 2325
19 JGI24739J22299_10029358 3300001989 Bacteria 1913
20 JGI24739J22299_10051500 3300001989 Bacteria 1328
21 JGI24739J22299_10134404 3300001989 Bacteria 735
22 JGI24739J22299_10157074 3300001989 Bacteria 672
23 JGI24737J22298_10001590 3300001990 Bacteria 8075
24 JGI24737J22298_10003732 3300001990 Bacteria 5360
25 JGI24737J22298_10027060 3300001990 Bacteria 1810
26 JGI24737J22298_10036959 3300001990 Bacteria 1506
27 JGI24737J22298_10041158 3300001990 Bacteria 1417
28 JGI24737J22298_10061695 3300001990 Bacteria 1127
29 JGI24737J22298_10068351 3300001990 Bacteria 1062
30 JGI24737J22298_10069519 3300001990 Bacteria 1052
31 JGI24737J22298_10085395 3300001990 Bacteria 938
32 JGI24737J22298_10117018 3300001990 Bacteria 788
33 JGI24743J22301_10122747 3300001991 Bacteria 570
34 JGI24735J21928_10001961 3300002067 Bacteria 7231
35 JGI24735J21928_10013354 3300002067 Bacteria 2584
36 JGI24735J21928_10020484 3300002067 Bacteria 2025
37 JGI24735J21928_10037139 3300002067 Bacteria 1428
38 JGI24735J21928_10050720 3300002067 Bacteria 1198
39 JGI24735J21928_10087919 3300002067 Bacteria 890
40 JGI24735J21928_10122964 3300002067 Bacteria 747
41 JGI24735J21928_10164286 3300002067 Bacteria 641
42 JGI24735J21928_10251458 3300002067 Bacteria 515
43 JGI24750J21931_1000199 3300002070 Bacteria 10095
44 JGI24748J21848_1000070 3300002074 Bacteria 36407
45 JGI24748J21848_1012787 3300002074 Bacteria 991
46 JGI24738J21930_10001288 3300002075 Bacteria 7018
47 JGI24738J21930_10004666 3300002075 Bacteria 3337
48 JGI24738J21930_10132714 3300002075 Bacteria 546
49 JGI24749J21850_1000118 3300002076 Bacteria 13310
50 JGI24744J21845_10005787 3300002077 Bacteria 2561
51 JGI24033J26618_1073154 3300002155 Bacteria 517
52 JGI24034J26672_10000038 3300002239 Bacteria 75372
53 JGI24034J26672_10012171 3300002239 Bacteria 1294
54 JGI24742J22300_10128925 3300002244 Bacteria 503
55 JGI24751J29686_10000379 3300002459 Bacteria 14986
56 JGI25157J39369_1026112 3300002741 Bacteria 679
57 JGI25152J39213_1045210 3300002773 Bacteria 597
58 JGI25150J39212_1000365 3300002774 Bacteria 21872
59 JGI25150J39212_1000837 3300002774 Bacteria 10314
60 JGI25151J46595_10029327 3300003187 Bacteria 2180
61 JGI25165J46597_1000021 3300003214 Bacteria 359288
62 JGI25165J46597_1000023 3300003214 Bacteria 338873
63 JGI25153J46596_10000173 3300003215 Bacteria 64195
64 JGI25153J46596_10001359 3300003215 Bacteria 14645
65 JGI25153J46596_10087839 3300003215 Bacteria 759
66 Ga0055525_1000012 3300003759 Bacteria 486564
67 Ga0055542_1000025 3300003762 Bacteria 263538
68 Ga0055542_1013672 3300003762 Bacteria 1358
69 Ga0055529_1000014 3300003763 Bacteria 367283
70 Ga0055529_1012053 3300003763 Bacteria 1109
71 Ga0055526_1001689 3300003771 Bacteria 15428
72 Ga0055537_1002389 3300003773 Bacteria 6339
73 Ga0055537_1013876 3300003773 Bacteria 1490
74 Ga0055524_1000320 3300003775 Bacteria 45185
75 Ga0055524_1000341 3300003775 Bacteria 42723
76 Ga0055536_1004136 3300003781 Bacteria 7522
77 Ga0055536_1024452 3300003781 Bacteria 1749
78 Ga0055536_1046965 3300003781 Bacteria 977
79 Ga0055534_1019454 3300003784 Bacteria 1164
80 Ga0055528_1076706 3300003790 Bacteria 594
81 Ga0055528_1078700 3300003790 Bacteria 582
82 Ga0055530_10001710 3300003791 Bacteria 15484
83 Ga0055530_10013813 3300003791 Bacteria 2732
84 Ga0055530_10014457 3300003791 Bacteria 2627
85 Ga0055530_10019749 3300003791 Bacteria 2033
86 Ga0055530_10026068 3300003791 Bacteria 1622
87 Ga0055540_1000723 3300003792 Bacteria 22522
88 Ga0055531_10002727 3300003794 Bacteria 11616
89 Ga0055531_10012970 3300003794 Bacteria 3879
90 Ga0055531_10025423 3300003794 Bacteria 2151
91 Ga0055531_10025502 3300003794 Bacteria 2143
92 Ga0055531_10032983 3300003794 Bacteria 1678
93 Ga0055531_10034125 3300003794 Bacteria 1622
94 Ga0055531_10041336 3300003794 Bacteria 1336
95 JGI25405J52794_10009841 3300003911 Bacteria 1812
96 Ga0055543_1014693 3300004625 Bacteria 1522
97 Ga0065165_1015699 3300005262 Bacteria 2876
98 Ga0065165_1069905 3300005262 Bacteria 935
99 Ga0065165_1094332 3300005262 Bacteria 757
100 Ga0065165_1167928 3300005262 Bacteria 503
101 Ga0065714_10315197 3300005288 Bacteria 676
102 Ga0065704_10278800 3300005289 Bacteria 927
103 Ga0065704_10314217 3300005289 Bacteria 863
104 Ga0065715_10782746 3300005293 Bacteria 617
105 Ga0065707_10000576 3300005295 Bacteria 23548
106 Ga0065707_10091874 3300005295 Bacteria 3866
107 Ga0065707_10211558 3300005295 Bacteria 1259
108 Ga0065707_10274776 3300005295 Bacteria 1057
109 Ga0065707_10452404 3300005295 Bacteria 799
110 Ga0070658_10001786 3300005327 Bacteria 18103
111 Ga0070658_10010598 3300005327 Bacteria 7384
112 Ga0070658_10293600 3300005327 Bacteria 1385
113 Ga0070658_10340516 3300005327 Bacteria 1283
114 Ga0070658_10441688 3300005327 Bacteria 1120
115 Ga0070658_10517219 3300005327 Bacteria 1032
116 Ga0070658_10661252 3300005327 Bacteria 907
117 Ga0070658_10829423 3300005327 Bacteria 803
118 Ga0070658_10947640 3300005327 Bacteria 748
119 Ga0070676_10209264 3300005328 Bacteria 1283
120 Ga0070676_10323450 3300005328 Bacteria 1052
121 Ga0070683_100204503 3300005329 Bacteria 1875
122 Ga0070683_100277426 3300005329 Bacteria 1595
123 Ga0070683_101594646 3300005329 Bacteria 628
124 Ga0070683_102166812 3300005329 Bacteria 534
125 Ga0070690_100000097 3300005330 Bacteria 44576
126 Ga0070670_100000075 3300005331 Bacteria 97494
127 Ga0070670_100000093 3300005331 Bacteria 84800
128 Ga0070670_100010675 3300005331 Bacteria 7846
129 Ga0070670_100093304 3300005331 Bacteria 2589
130 Ga0070670_100687098 3300005331 Bacteria 920
131 Ga0070677_10069925 3300005333 Bacteria 1474
132 Ga0070677_10083489 3300005333 Bacteria 1373
133 Ga0068869_100000029 3300005334 Bacteria 61111
134 Ga0068869_100056174 3300005334 Bacteria 2871
135 Ga0068869_100556697 3300005334 Bacteria 964
136 Ga0068869_100619997 3300005334 Bacteria 915
137 Ga0068869_102032265 3300005334 Bacteria 516
138 Ga0070666_10000004 3300005335 Bacteria 372098
139 Ga0070666_10150584 3300005335 Bacteria 1623
140 Ga0070666_10514357 3300005335 Bacteria 869
141 Ga0070666_10788306 3300005335 Bacteria 699
142 Ga0070666_11000859 3300005335 Bacteria 620
143 Ga0070680_100021258 3300005336 Bacteria 5156
144 Ga0070680_100933788 3300005336 Bacteria 749
145 Ga0070680_101562058 3300005336 Bacteria 572
146 Ga0070682_100076023 3300005337 Bacteria 2161
147 Ga0070682_100710784 3300005337 Bacteria 807
148 Ga0068868_100003973 3300005338 Bacteria 10321
149 Ga0068868_100501188 3300005338 Bacteria 1063
150 Ga0068868_100841095 3300005338 Bacteria 831
151 Ga0068868_101749607 3300005338 Bacteria 586
152 Ga0070660_100016618 3300005339 Bacteria 5345
153 Ga0070660_100061300 3300005339 Bacteria 2921
154 Ga0070660_100125410 3300005339 Bacteria 2051
155 Ga0070660_100173748 3300005339 Bacteria 1741
156 Ga0070660_100240844 3300005339 Bacteria 1473
157 Ga0070660_100286815 3300005339 Bacteria 1348
158 Ga0070660_100559437 3300005339 Bacteria 954
159 Ga0070660_100594981 3300005339 Bacteria 925
160 Ga0070689_100050883 3300005340 Bacteria 3201
161 Ga0070689_100919983 3300005340 Bacteria 774
162 Ga0070691_10456170 3300005341 Bacteria 731
163 Ga0070687_100420059 3300005343 Bacteria 882
164 Ga0070661_100020393 3300005344 Bacteria 4726
165 Ga0070661_100031335 3300005344 Bacteria 3845
166 Ga0070661_100230723 3300005344 Bacteria 1422
167 Ga0070661_100377865 3300005344 Bacteria 1116
168 Ga0070661_100808839 3300005344 Bacteria 769
169 Ga0070661_100862778 3300005344 Bacteria 746
170 Ga0070661_101126156 3300005344 Bacteria 654
171 Ga0070692_10841793 3300005345 Bacteria 630
172 Ga0070668_100000831 3300005347 Bacteria 21324
173 Ga0070668_100017594 3300005347 Bacteria 5360
174 Ga0070668_100719613 3300005347 Bacteria 881
175 Ga0070668_100732995 3300005347 Bacteria 874
176 Ga0070669_100000115 3300005353 Bacteria 75928
177 Ga0070669_100000296 3300005353 Bacteria 39004
178 Ga0070669_100854356 3300005353 Bacteria 776
179 Ga0070669_100934560 3300005353 Bacteria 742
180 Ga0070669_100991154 3300005353 Bacteria 721
181 Ga0070675_100098854 3300005354 Bacteria 2455
182 Ga0070675_100126421 3300005354 Bacteria 2175
183 Ga0070675_101302178 3300005354 Bacteria 670
184 Ga0070671_100024172 3300005355 Bacteria 4973
185 Ga0070671_100145848 3300005355 Bacteria 1998
186 Ga0070671_100287990 3300005355 Bacteria 1398
187 Ga0070671_100436300 3300005355 Bacteria 1123
188 Ga0070671_100488119 3300005355 Bacteria 1059
189 Ga0070671_100615864 3300005355 Bacteria 939
190 Ga0070674_100058209 3300005356 Bacteria 2685
191 Ga0070674_100829410 3300005356 Bacteria 800
192 Ga0070674_100861718 3300005356 Bacteria 786
193 Ga0070673_100000019 3300005364 Bacteria 107024
194 Ga0070673_100286720 3300005364 Bacteria 1446
195 Ga0070673_101102375 3300005364 Bacteria 742
196 Ga0070673_101841538 3300005364 Bacteria 573
197 Ga0070673_102297973 3300005364 Bacteria 513
198 Ga0070688_100004740 3300005365 Bacteria 7107
199 Ga0070688_100955353 3300005365 Bacteria 679
200 Ga0070659_100095005 3300005366 Bacteria 2394
201 Ga0070659_100140885 3300005366 Bacteria 1963
202 Ga0070659_100221271 3300005366 Bacteria 1562
203 Ga0070659_100222739 3300005366 Bacteria 1557
204 Ga0070659_100246930 3300005366 Bacteria 1478
205 Ga0070659_100704189 3300005366 Bacteria 873
206 Ga0070659_101377798 3300005366 Bacteria 626
207 Ga0070659_101819905 3300005366 Bacteria 545
208 Ga0070659_102069681 3300005366 Bacteria 512
209 Ga0070667_100000039 3300005367 Bacteria 170228
210 Ga0070667_100013671 3300005367 Bacteria 6708
211 Ga0070667_100044820 3300005367 Bacteria 3716
212 Ga0070667_100188643 3300005367 Bacteria 1825
213 Ga0070667_101768041 3300005367 Bacteria 582
214 Ga0070667_102150848 3300005367 Bacteria 526
215 Ga0070710_10640199 3300005437 Bacteria 744
216 Ga0070701_10673112 3300005438 Bacteria 693
217 Ga0070694_101003286 3300005444 Bacteria 693
218 Ga0070663_100081755 3300005455 Bacteria 2375
219 Ga0070663_100148712 3300005455 Bacteria 1794
220 Ga0070663_100225700 3300005455 Bacteria 1473
221 Ga0070663_100420899 3300005455 Bacteria 1095
222 Ga0070663_100669376 3300005455 Bacteria 880
223 Ga0070678_100006601 3300005456 Bacteria 6820
224 Ga0070678_100040527 3300005456 Bacteria 3296
225 Ga0070678_101189213 3300005456 Bacteria 707
226 Ga0070678_101574103 3300005456 Bacteria 617
227 Ga0070662_100020163 3300005457 Bacteria 4537
228 Ga0070662_100024536 3300005457 Bacteria 4155
229 Ga0070662_100044582 3300005457 Bacteria 3177
230 Ga0070662_100358188 3300005457 Bacteria 1196
231 Ga0070662_100377085 3300005457 Bacteria 1167
232 Ga0070662_100436172 3300005457 Bacteria 1085
233 Ga0070662_100519772 3300005457 Bacteria 994
234 Ga0070662_100811721 3300005457 Bacteria 795
235 Ga0070662_101285102 3300005457 Bacteria 630
236 Ga0070662_101615296 3300005457 Bacteria 560
237 Ga0070662_101777111 3300005457 Bacteria 533
238 Ga0070662_101986251 3300005457 Bacteria 503
239 Ga0070681_10078394 3300005458 Bacteria 3261
240 Ga0070681_10131424 3300005458 Bacteria 2436
241 Ga0068867_100000014 3300005459 Bacteria 112097
242 Ga0068867_100083516 3300005459 Bacteria 2411
243 Ga0068867_101459937 3300005459 Bacteria 636
244 Ga0070685_10000806 3300005466 Bacteria 17034
245 Ga0070706_101846410 3300005467 Bacteria 549
246 Ga0070679_100000873 3300005530 Bacteria 26175
247 Ga0070679_100651895 3300005530 Bacteria 995
248 Ga0070679_101959785 3300005530 Bacteria 535
249 Ga0070684_100136074 3300005535 Bacteria 2219
250 Ga0070684_100204115 3300005535 Bacteria 1801
251 Ga0070684_101536557 3300005535 Bacteria 627
252 Ga0068853_100000960 3300005539 Bacteria 20266
253 Ga0068853_100202129 3300005539 Bacteria 1808
254 Ga0068853_100282094 3300005539 Bacteria 1531
255 Ga0068853_100306801 3300005539 Bacteria 1468
256 Ga0068853_100337575 3300005539 Bacteria 1399
257 Ga0068853_100618322 3300005539 Bacteria 1030
258 Ga0068853_100656641 3300005539 Bacteria 998
259 Ga0068853_101091271 3300005539 Bacteria 769
260 Ga0068853_102037210 3300005539 Bacteria 557
261 Ga0070672_100182037 3300005543 Bacteria 1751
262 Ga0070672_100534380 3300005543 Bacteria 1017
263 Ga0070686_100000061 3300005544 Bacteria 83811
264 Ga0070686_100006821 3300005544 Bacteria 6358
265 Ga0070686_100561102 3300005544 Bacteria 895
266 Ga0070686_101857804 3300005544 Bacteria 513
267 Ga0070693_100211135 3300005547 Bacteria 1267
268 Ga0070693_100435491 3300005547 Bacteria 917
269 Ga0070693_100802929 3300005547 Bacteria 698
270 Ga0070665_100000004 3300005548 Bacteria 785500
271 Ga0070665_100000109 3300005548 Bacteria 155026
272 Ga0070665_100001527 3300005548 Bacteria 26808
273 Ga0070665_100010005 3300005548 Bacteria 9595
274 Ga0070665_100126607 3300005548 Bacteria 2557
275 Ga0070665_100255203 3300005548 Bacteria 1754
276 Ga0070665_100429143 3300005548 Bacteria 1331
277 Ga0070665_101247662 3300005548 Bacteria 754
278 Ga0068855_100010206 3300005563 Bacteria 11321
279 Ga0068855_100237795 3300005563 Bacteria 2036
280 Ga0068855_100361015 3300005563 Bacteria 1598
281 Ga0068855_100456541 3300005563 Bacteria 1394
282 Ga0068855_100491032 3300005563 Bacteria 1335
283 Ga0068855_100508392 3300005563 Bacteria 1308
284 Ga0068855_100822833 3300005563 Bacteria 986
285 Ga0068855_100855046 3300005563 Bacteria 964
286 Ga0068855_101257490 3300005563 Bacteria 768
287 Ga0068855_102579830 3300005563 Bacteria 504
288 Ga0070664_100063876 3300005564 Bacteria 3139
289 Ga0070664_100145529 3300005564 Bacteria 2089
290 Ga0070664_100698762 3300005564 Bacteria 945
291 Ga0070664_101529857 3300005564 Bacteria 631
292 Ga0070664_101765256 3300005564 Bacteria 587
293 Ga0068857_100055851 3300005577 Bacteria 3503
294 Ga0068857_100060023 3300005577 Bacteria 3379
295 Ga0068857_100066375 3300005577 Bacteria 3210
296 Ga0068857_100167943 3300005577 Bacteria 1993
297 Ga0068857_100233827 3300005577 Bacteria 1681
298 Ga0068857_101240083 3300005577 Bacteria 723
299 Ga0068857_101884696 3300005577 Bacteria 586
300 Ga0068854_100031424 3300005578 Bacteria 3689
301 Ga0068854_100051084 3300005578 Bacteria 2961
302 Ga0068854_100074235 3300005578 Bacteria 2494
303 Ga0068854_100092457 3300005578 Bacteria 2253
304 Ga0068854_100410357 3300005578 Bacteria 1123
305 Ga0068854_100465647 3300005578 Bacteria 1058
306 Ga0068854_100845579 3300005578 Bacteria 801
307 Ga0068854_101759412 3300005578 Bacteria 568
308 Ga0068856_100060779 3300005614 Bacteria 3732
309 Ga0068856_100262174 3300005614 Bacteria 1743
310 Ga0068856_100338965 3300005614 Bacteria 1521
311 Ga0068856_100372649 3300005614 Bacteria 1446
312 Ga0068856_100443696 3300005614 Bacteria 1318
313 Ga0068856_100480227 3300005614 Bacteria 1264
314 Ga0068856_100620097 3300005614 Bacteria 1102
315 Ga0068852_100098053 3300005616 Bacteria 2638
316 Ga0068852_100185948 3300005616 Bacteria 1957
317 Ga0068852_100239696 3300005616 Bacteria 1732
318 Ga0068852_100262271 3300005616 Bacteria 1659
319 Ga0068852_100443711 3300005616 Bacteria 1283
320 Ga0068852_101031550 3300005616 Bacteria 842
321 Ga0068852_101812706 3300005616 Bacteria 632
322 Ga0068852_102499611 3300005616 Bacteria 537
323 Ga0068852_102720078 3300005616 Bacteria 514
324 Ga0068859_100001416 3300005617 Bacteria 24328
325 Ga0068859_100009835 3300005617 Bacteria 9655
326 Ga0068859_100058681 3300005617 Bacteria 3877
327 Ga0068859_100166281 3300005617 Bacteria 2286
328 Ga0068859_100173979 3300005617 Bacteria 2235
329 Ga0068859_100505472 3300005617 Bacteria 1304
330 Ga0068859_100798469 3300005617 Bacteria 1032
331 Ga0068864_100000016 3300005618 Bacteria 292454
332 Ga0068864_100000087 3300005618 Bacteria 98532
333 Ga0068864_100002567 3300005618 Bacteria 14987
334 Ga0068864_102434270 3300005618 Bacteria 530
335 Ga0068866_11085482 3300005718 Bacteria 573
336 Ga0068861_100000040 3300005719 Bacteria 59725
337 Ga0068861_100006640 3300005719 Bacteria 7896
338 Ga0068861_100635023 3300005719 Bacteria 984
339 Ga0068861_101939186 3300005719 Bacteria 586
340 Ga0068861_102125254 3300005719 Bacteria 562
341 Ga0068851_10010412 3300005834 Bacteria 4342
342 Ga0068851_10056665 3300005834 Bacteria 1999
343 Ga0068851_10329818 3300005834 Bacteria 883
344 Ga0068851_11038818 3300005834 Bacteria 518
345 Ga0068870_10096183 3300005840 Bacteria 1665
346 Ga0068870_10558785 3300005840 Bacteria 772
347 Ga0068863_100000013 3300005841 Bacteria 220357
348 Ga0068863_100000017 3300005841 Bacteria 207950
349 Ga0068863_100000033 3300005841 Bacteria 170238
350 Ga0068863_100008320 3300005841 Bacteria 10132
351 Ga0068863_100140643 3300005841 Bacteria 2307
352 Ga0068863_100234419 3300005841 Bacteria 1771
353 Ga0068863_100358661 3300005841 Bacteria 1421
354 Ga0068858_100000664 3300005842 Bacteria 35973
355 Ga0068858_100004566 3300005842 Bacteria 13557
356 Ga0068858_100708504 3300005842 Bacteria 980
357 Ga0068858_102283401 3300005842 Bacteria 535
358 Ga0068860_100000009 3300005843 Bacteria 372089
359 Ga0068860_100028829 3300005843 Bacteria 5342
360 Ga0068860_100053483 3300005843 Bacteria 3839
361 Ga0068860_100264367 3300005843 Bacteria 1678
362 Ga0068862_100000032 3300005844 Bacteria 179887
363 Ga0068862_100000040 3300005844 Bacteria 167832
364 Ga0068862_100000466 3300005844 Bacteria 43651
365 Ga0068862_100001446 3300005844 Bacteria 21877
366 Ga0068862_100105127 3300005844 Bacteria 2474
367 Ga0068862_101080627 3300005844 Bacteria 797
368 Ga0081455_10000215 3300005937 Bacteria 73808
369 Ga0081540_1013216 3300005983 Bacteria 5381
370 Ga0075364_10001520 3300006051 Bacteria 12625
371 Ga0075364_11177761 3300006051 Bacteria 520
372 Ga0075362_10167624 3300006177 Bacteria 1060
373 Ga0075369_10031638 3300006186 Bacteria 2235
374 Ga0075369_10084853 3300006186 Bacteria 1408
375 Ga0075369_10116166 3300006186 Bacteria 1209
376 Ga0075369_10337703 3300006186 Bacteria 706
377 Ga0075366_10130637 3300006195 Bacteria 1516
378 Ga0075366_10182388 3300006195 Bacteria 1275
379 Ga0075366_10233689 3300006195 Bacteria 1120
380 Ga0075366_10759202 3300006195 Bacteria 603
381 Ga0075366_11042173 3300006195 Bacteria 511
382 Ga0097621_100240098 3300006237 Bacteria 1584
383 Ga0097621_101343528 3300006237 Bacteria 676
384 Ga0097621_101467576 3300006237 Bacteria 647
385 Ga0097621_101723020 3300006237 Bacteria 597
386 Ga0097621_101868557 3300006237 Bacteria 573
387 Ga0097621_102103718 3300006237 Bacteria 540
388 Ga0075370_10008629 3300006353 Bacteria 5252
389 Ga0075370_10023057 3300006353 Bacteria 3424
390 Ga0075370_10412683 3300006353 Bacteria 811
391 Ga0075370_10664875 3300006353 Bacteria 633
392 Ga0075370_10676786 3300006353 Bacteria 627
393 Ga0068871_100261117 3300006358 Bacteria 1511
394 Ga0068871_100587711 3300006358 Bacteria 1012
395 Ga0068871_101186315 3300006358 Bacteria 716
396 Ga0075430_101078196 3300006846 Bacteria 662
397 Ga0075434_100255877 3300006871 Bacteria 1770
398 Ga0068865_100000018 3300006881 Bacteria 106975
399 Ga0097620_100001416 3300006931 Bacteria 24328
400 Ga0097620_100009835 3300006931 Bacteria 9655
401 Ga0097620_100058681 3300006931 Bacteria 3877
402 Ga0097620_100166292 3300006931 Bacteria 2286
403 Ga0097620_100173972 3300006931 Bacteria 2235
404 Ga0097620_100505473 3300006931 Bacteria 1304
405 Ga0097620_100798483 3300006931 Bacteria 1032
406 Ga0105251_10004716 3300009011 Bacteria 9147
407 Ga0105251_10155260 3300009011 Bacteria 1032
408 Ga0105244_10297884 3300009036 Bacteria 747
409 Ga0105240_10001116 3300009093 Bacteria 47225
410 Ga0105240_10024394 3300009093 Bacteria 7971
411 Ga0105240_10191747 3300009093 Bacteria 2403
412 Ga0105240_10610797 3300009093 Bacteria 1200
413 Ga0105240_10749955 3300009093 Bacteria 1061
414 Ga0105240_12393971 3300009093 Bacteria 546
415 Ga0105240_12490842 3300009093 Bacteria 535
416 Ga0105245_10002967 3300009098 Bacteria 15205
417 Ga0105245_10005275 3300009098 Bacteria 11352
418 Ga0105245_10406216 3300009098 Bacteria 1362
419 Ga0105245_11568913 3300009098 Bacteria 710
420 Ga0105247_10018821 3300009101 Bacteria 4146
421 Ga0105247_10086839 3300009101 Bacteria 1980
422 Ga0105247_10091941 3300009101 Bacteria 1927
423 Ga0114129_12342286 3300009147 Bacteria 640
424 Ga0105243_10000076 3300009148 Bacteria 110445
425 Ga0105243_10003106 3300009148 Bacteria 13657
426 Ga0105243_10358718 3300009148 Bacteria 1341
427 Ga0105243_10522486 3300009148 Bacteria 1129
428 Ga0105243_10693651 3300009148 Bacteria 992
429 Ga0105243_11675996 3300009148 Bacteria 664
430 Ga0105243_11796911 3300009148 Bacteria 644
431 Ga0105243_13135099 3300009148 Bacteria 500
432 Ga0105241_10004308 3300009174 Bacteria 10523
433 Ga0105241_10090211 3300009174 Bacteria 2417
434 Ga0105241_10407073 3300009174 Bacteria 1194
435 Ga0105241_10417038 3300009174 Bacteria 1181
436 Ga0105241_11874660 3300009174 Bacteria 587
437 Ga0105241_11879984 3300009174 Bacteria 586
438 Ga0105242_10009804 3300009176 Bacteria 7341
439 Ga0105242_11353886 3300009176 Bacteria 737
440 Ga0105248_10000021 3300009177 Bacteria 276159
441 Ga0105248_10003987 3300009177 Bacteria 16323
442 Ga0105248_10006062 3300009177 Bacteria 13270
443 Ga0105248_10008689 3300009177 Bacteria 11162
444 Ga0105248_10255282 3300009177 Bacteria 1973
445 Ga0105248_10504523 3300009177 Bacteria 1364
446 Ga0105237_10002858 3300009545 Bacteria 20999
447 Ga0105237_10011259 3300009545 Bacteria 9464
448 Ga0105237_10045964 3300009545 Bacteria 4393
449 Ga0105237_10082257 3300009545 Bacteria 3211
450 Ga0105237_10114196 3300009545 Bacteria 2693
451 Ga0105237_10200169 3300009545 Bacteria 1997
452 Ga0105237_10469740 3300009545 Bacteria 1264
453 Ga0105237_11204749 3300009545 Bacteria 764
454 Ga0105237_11486404 3300009545 Bacteria 684
455 Ga0105237_12270548 3300009545 Bacteria 552
456 Ga0105238_10103849 3300009551 Bacteria 2823
457 Ga0105238_10108749 3300009551 Bacteria 2754
458 Ga0105238_10138886 3300009551 Bacteria 2407
459 Ga0105238_10157495 3300009551 Bacteria 2246
460 Ga0105238_10214234 3300009551 Bacteria 1902
461 Ga0105238_10373621 3300009551 Bacteria 1416
462 Ga0105238_10421717 3300009551 Bacteria 1329
463 Ga0105238_10521037 3300009551 Bacteria 1191
464 Ga0105238_10541365 3300009551 Bacteria 1168
465 Ga0105238_10843372 3300009551 Bacteria 933
466 Ga0105238_11477082 3300009551 Bacteria 708
467 Ga0105238_12385496 3300009551 Bacteria 564
468 Ga0105238_12416452 3300009551 Bacteria 561
469 Ga0105238_12548021 3300009551 Bacteria 547
470 Ga0105238_12971625 3300009551 Bacteria 510
471 Ga0105249_10000006 3300009553 Bacteria 354449
472 Ga0105249_10000017 3300009553 Bacteria 277115
473 Ga0105249_10001881 3300009553 Bacteria 18180
474 Ga0105249_10203829 3300009553 Bacteria 1937
475 Ga0105249_10249779 3300009553 Bacteria 1758
476 Ga0105249_12218491 3300009553 Bacteria 622
477 Ga0105239_10000546 3300010375 Bacteria 53959
478 Ga0105239_10070988 3300010375 Bacteria 3826
479 Ga0105239_10379102 3300010375 Bacteria 1599
480 Ga0105239_11008231 3300010375 Bacteria 957
481 Ga0105239_11166215 3300010375 Bacteria 887
482 Ga0105239_12076595 3300010375 Bacteria 660
483 Ga0105239_12764741 3300010375 Bacteria 573
484 Ga0105239_13631876 3300010375 Bacteria 501
485 Ga0105246_10161931 3300011119 Bacteria 1705
486 Ga0105246_10588517 3300011119 Bacteria 959
487 Ga0105246_10851547 3300011119 Bacteria 813
488 Ga0105246_11219958 3300011119 Bacteria 693
489 Ga0157317_1023388 3300012475 Bacteria 564
490 Ga0157315_1007765 3300012508 Bacteria 879
491 Ga0157326_1079519 3300012513 Bacteria 534
492 Ga0157373_10081148 3300013100 Bacteria 2287
493 Ga0157373_10565416 3300013100 Bacteria 826
494 Ga0157373_10660838 3300013100 Bacteria 764
495 Ga0157373_10662801 3300013100 Bacteria 763
496 Ga0157373_10798128 3300013100 Bacteria 696
497 Ga0157373_11528879 3300013100 Bacteria 510
498 Ga0157371_10000059 3300013102 Bacteria 170541
499 Ga0157371_10089328 3300013102 Bacteria 2182
500 Ga0157371_10342701 3300013102 Bacteria 1087
501 Ga0157371_10606382 3300013102 Bacteria 815
502 Ga0157371_11339788 3300013102 Bacteria 555
503 Ga0157370_10327199 3300013104 Bacteria 1413
504 Ga0157370_10370331 3300013104 Bacteria 1320
505 Ga0157370_10415992 3300013104 Bacteria 1237
506 Ga0157370_10545838 3300013104 Bacteria 1063
507 Ga0157370_11249102 3300013104 Bacteria 670
508 Ga0157369_10073353 3300013105 Bacteria 3672
509 Ga0157369_10083235 3300013105 Bacteria 3422
510 Ga0157369_10211906 3300013105 Bacteria 2030
511 Ga0157369_10281167 3300013105 Bacteria 1733
512 Ga0157369_10298220 3300013105 Bacteria 1677
513 Ga0157369_10312143 3300013105 Bacteria 1635
514 Ga0157369_10444995 3300013105 Bacteria 1342
515 Ga0157369_10840300 3300013105 Bacteria 943
516 Ga0157369_11229243 3300013105 Bacteria 764
517 Ga0157369_11658669 3300013105 Bacteria 650
518 Ga0157369_12017709 3300013105 Bacteria 585
519 Ga0157369_12583312 3300013105 Bacteria 514
520 Ga0157374_10412425 3300013296 Bacteria 1349
521 Ga0157378_10000504 3300013297 Bacteria 37070
522 Ga0157378_10107742 3300013297 Bacteria 2550
523 Ga0157378_10539715 3300013297 Bacteria 1170
524 Ga0157378_10950271 3300013297 Bacteria 892
525 Ga0157378_11480740 3300013297 Bacteria 723
526 Ga0157378_11587366 3300013297 Bacteria 700
527 Ga0163162_10092290 3300013306 Bacteria 3111
528 Ga0163162_10421093 3300013306 Bacteria 1468
529 Ga0163162_11521886 3300013306 Bacteria 762
530 Ga0163162_12218841 3300013306 Bacteria 630
531 Ga0157372_10084779 3300013307 Bacteria 3592
532 Ga0157372_10573559 3300013307 Bacteria 1315
533 Ga0157372_11126859 3300013307 Bacteria 907
534 Ga0157372_11317178 3300013307 Bacteria 833
535 Ga0157372_11994999 3300013307 Bacteria 667
536 Ga0157372_12178074 3300013307 Bacteria 637
537 Ga0157375_10082591 3300013308 Bacteria 3255
538 Ga0157375_10446526 3300013308 Bacteria 1459
539 Ga0157375_11409902 3300013308 Bacteria 821
540 Ga0157375_13608339 3300013308 Bacteria 515
541 Ga0163163_10465584 3300014325 Bacteria 1325
542 Ga0163163_11563685 3300014325 Bacteria 721
543 Ga0163163_11777425 3300014325 Bacteria 677
544 Ga0163163_12645250 3300014325 Bacteria 559
545 Ga0157380_10000157 3300014326 Bacteria 39384
546 Ga0157380_10002166 3300014326 Bacteria 13178
547 Ga0157380_10006678 3300014326 Bacteria 8144
548 Ga0157380_10812507 3300014326 Bacteria 953
549 Ga0157380_11992912 3300014326 Bacteria 642
550 Ga0182008_10166668 3300014497 Bacteria 1111
551 Ga0157377_10082035 3300014745 Bacteria 1887
552 Ga0157377_10180500 3300014745 Bacteria 1327
553 Ga0157377_10583524 3300014745 Bacteria 795
554 Ga0157379_10001735 3300014968 Bacteria 18043
555 Ga0157379_10051816 3300014968 Bacteria 3664
556 Ga0157379_11466984 3300014968 Bacteria 663
557 Ga0157379_12505109 3300014968 Bacteria 516
558 Ga0157376_10000092 3300014969 Bacteria 68198
559 Ga0157376_10492886 3300014969 Bacteria 1203
560 Ga0157376_10716193 3300014969 Bacteria 1007
561 Ga0157376_11441483 3300014969 Bacteria 721
562 Ga0157376_11622424 3300014969 Bacteria 681
563 Ga0183360_10368 3300015689 Bacteria 1189
564 Ga0183363_1006 3300015690 Bacteria 400466
565 Ga0163161_10000208 3300017792 Bacteria 53837
566 Ga0163161_10144828 3300017792 Bacteria 1801
567 Ga0163161_10167645 3300017792 Bacteria 1678
568 Ga0163161_10541954 3300017792 Bacteria 953
569 Ga0163161_10943367 3300017792 Bacteria 733
570 Ga0197907_10274206 3300020069 Bacteria 875
571 Ga0206356_10317151 3300020070 Bacteria 1289
572 Ga0206349_1668694 3300020075 Bacteria 936
573 Ga0206353_11808888 3300020082 Bacteria 1435
574 Ga0213876_10016636 3300021384 Bacteria 3886
575 Ga0213875_10001626 3300021388 Bacteria 14182
576 Ga0209674_101560 3300025226 Bacteria 5818
577 Ga0209563_100030 3300025230 Bacteria 489259
578 Ga0207427_104026 3300025231 Bacteria 2681
579 Ga0209437_123370 3300025233 Bacteria 712
580 Ga0207425_1000049 3300025245 Bacteria 180735
581 Ga0207425_1011898 3300025245 Bacteria 2058
582 Ga0209646_1020951 3300025246 Bacteria 941
583 Ga0209646_1031500 3300025246 Bacteria 710
584 Ga0209026_1000352 3300025250 Bacteria 43432
585 Ga0209026_1013989 3300025250 Bacteria 1352
586 Ga0209026_1031029 3300025250 Bacteria 792
587 Ga0209677_105325 3300025253 Bacteria 3391
588 Ga0209148_1000011 3300025254 Bacteria 1196503
589 Ga0209148_1000243 3300025254 Bacteria 86896
590 Ga0209148_1005193 3300025254 Bacteria 3032
591 Ga0209129_1000471 3300025258 Bacteria 29587
592 Ga0209233_1000003 3300025261 Bacteria 1607366
593 Ga0209233_1000065 3300025261 Bacteria 387195
594 Ga0209233_1006188 3300025261 Bacteria 3877
595 Ga0209565_1000008 3300025263 Bacteria 774179
596 Ga0209565_1000985 3300025263 Bacteria 14637
597 Ga0209455_1000006 3300025272 Bacteria 1196503
598 Ga0209455_1002555 3300025272 Bacteria 6959
599 Ga0209455_1031389 3300025272 Bacteria 893
600 Ga0209673_1004450 3300025273 Bacteria 7501
601 Ga0209673_1023801 3300025273 Bacteria 2075
602 Ga0209675_1000104 3300025291 Bacteria 121249
603 Ga0209676_1000512 3300025292 Bacteria 61167
604 Ga0209676_1000807 3300025292 Bacteria 41068
605 Ga0209676_1001199 3300025292 Bacteria 27715
606 Ga0209676_1009827 3300025292 Bacteria 4068
607 Ga0209676_1021566 3300025292 Bacteria 2159
608 Ga0209676_1029229 3300025292 Bacteria 1705
609 Ga0209025_1000068 3300025294 Bacteria 294129
610 Ga0209025_1011083 3300025294 Bacteria 6006
611 Ga0209025_1050489 3300025294 Bacteria 1662
612 Ga0209564_1000335 3300025295 Bacteria 91079
613 Ga0209564_1016953 3300025295 Bacteria 2869
614 Ga0209564_1085619 3300025295 Bacteria 598
615 Ga0209758_1000001 3300025297 Bacteria 1981790
616 Ga0209758_1000004 3300025297 Bacteria 1375322
617 Ga0209758_1017731 3300025297 Bacteria 3525
618 Ga0209758_1169594 3300025297 Bacteria 534
619 Ga0209050_1000001 3300025298 Bacteria 3563507
620 Ga0209050_1000286 3300025298 Bacteria 106566
621 Ga0209050_1002774 3300025298 Bacteria 14045
622 Ga0209050_1003389 3300025298 Bacteria 11828
623 Ga0209050_1035962 3300025298 Bacteria 1455
624 Ga0209256_1000009 3300025299 Bacteria 922071
625 Ga0209256_1000010 3300025299 Bacteria 912110
626 Ga0207426_1140179 3300025302 Bacteria 575
627 Ga0209051_1000191 3300025303 Bacteria 108763
628 Ga0209051_1038886 3300025303 Bacteria 1726
629 Ga0209257_1000245 3300025304 Bacteria 125987
630 Ga0209257_1000321 3300025304 Bacteria 100476
631 Ga0209257_1000577 3300025304 Bacteria 61710
632 Ga0209257_1000597 3300025304 Bacteria 59900
633 Ga0209257_1003551 3300025304 Bacteria 13248
634 Ga0209257_1004959 3300025304 Bacteria 9760
635 Ga0209257_1016465 3300025304 Bacteria 2990
636 Ga0209257_1026884 3300025304 Bacteria 1928
637 Ga0209257_1028408 3300025304 Bacteria 1841
638 Ga0209257_1035933 3300025304 Bacteria 1527
639 Ga0207656_10004180 3300025321 Bacteria 5025
640 Ga0207656_10023916 3300025321 Bacteria 2465
641 Ga0207656_10229427 3300025321 Bacteria 904
642 Ga0207656_10302528 3300025321 Bacteria 792
643 Ga0207682_10001453 3300025893 Bacteria 10936
644 Ga0207682_10407906 3300025893 Bacteria 642
645 Ga0207682_10474015 3300025893 Bacteria 593
646 Ga0207692_10992207 3300025898 Bacteria 554
647 Ga0207642_10869034 3300025899 Bacteria 576
648 Ga0207710_10004955 3300025900 Bacteria 5769
649 Ga0207710_10008017 3300025900 Bacteria 4465
650 Ga0207710_10066752 3300025900 Bacteria 1642
651 Ga0207688_10302991 3300025901 Bacteria 977
652 Ga0207688_10449418 3300025901 Bacteria 803
653 Ga0207688_11080046 3300025901 Bacteria 506
654 Ga0207680_10000010 3300025903 Bacteria 414170
655 Ga0207680_10559990 3300025903 Bacteria 816
656 Ga0207680_10775750 3300025903 Bacteria 687
657 Ga0207680_10792934 3300025903 Bacteria 679
658 Ga0207680_11343394 3300025903 Bacteria 508
659 Ga0207647_10000069 3300025904 Bacteria 80952
660 Ga0207647_10009251 3300025904 Bacteria 7006
661 Ga0207647_10035876 3300025904 Bacteria 3155
662 Ga0207647_10068151 3300025904 Bacteria 2154
663 Ga0207647_10137710 3300025904 Bacteria 1432
664 Ga0207647_10168495 3300025904 Bacteria 1276
665 Ga0207645_10014111 3300025907 Bacteria 5353
666 Ga0207645_10021253 3300025907 Bacteria 4234
667 Ga0207645_10372006 3300025907 Bacteria 958
668 Ga0207705_10000084 3300025909 Bacteria 116809
669 Ga0207705_10000243 3300025909 Bacteria 53479
670 Ga0207705_10000511 3300025909 Bacteria 33036
671 Ga0207705_10002954 3300025909 Bacteria 12998
672 Ga0207705_10049162 3300025909 Bacteria 3035
673 Ga0207705_10841844 3300025909 Bacteria 711
674 Ga0207705_10862539 3300025909 Bacteria 702
675 Ga0207705_11032938 3300025909 Bacteria 634
676 Ga0207684_11444845 3300025910 Bacteria 561
677 Ga0207654_10000796 3300025911 Bacteria 17350
678 Ga0207654_10000810 3300025911 Bacteria 17231
679 Ga0207654_10195143 3300025911 Bacteria 1330
680 Ga0207707_10045078 3300025912 Bacteria 3843
681 Ga0207695_10000288 3300025913 Bacteria 125085
682 Ga0207695_10003496 3300025913 Bacteria 22050
683 Ga0207695_10006167 3300025913 Bacteria 15631
684 Ga0207695_10095035 3300025913 Bacteria 2986
685 Ga0207695_10103895 3300025913 Bacteria 2832
686 Ga0207695_10171402 3300025913 Bacteria 2096
687 Ga0207671_10002884 3300025914 Bacteria 17804
688 Ga0207671_10003173 3300025914 Bacteria 16603
689 Ga0207671_10003747 3300025914 Bacteria 14974
690 Ga0207671_10022700 3300025914 Bacteria 4741
691 Ga0207671_10182611 3300025914 Bacteria 1633
692 Ga0207671_10552124 3300025914 Bacteria 918
693 Ga0207660_10001492 3300025917 Bacteria 15752
694 Ga0207660_11185096 3300025917 Bacteria 622
695 Ga0207662_11065466 3300025918 Bacteria 574
696 Ga0207657_10028620 3300025919 Bacteria 5080
697 Ga0207657_10028866 3300025919 Bacteria 5055
698 Ga0207657_10028985 3300025919 Bacteria 5044
699 Ga0207657_10048886 3300025919 Bacteria 3690
700 Ga0207657_10085735 3300025919 Bacteria 2637
701 Ga0207657_10139728 3300025919 Bacteria 1979
702 Ga0207657_10214187 3300025919 Bacteria 1545
703 Ga0207657_10232634 3300025919 Bacteria 1473
704 Ga0207657_10276144 3300025919 Bacteria 1335
705 Ga0207657_10495134 3300025919 Bacteria 958
706 Ga0207657_10506335 3300025919 Bacteria 946
707 Ga0207657_10632222 3300025919 Bacteria 834
708 Ga0207649_10000212 3300025920 Bacteria 48063
709 Ga0207649_10003617 3300025920 Bacteria 8440
710 Ga0207649_10103905 3300025920 Bacteria 1886
711 Ga0207649_10197129 3300025920 Bacteria 1420
712 Ga0207649_10395053 3300025920 Bacteria 1033
713 Ga0207649_11186539 3300025920 Bacteria 603
714 Ga0207652_10000008 3300025921 Bacteria 286698
715 Ga0207652_10502029 3300025921 Bacteria 1092
716 Ga0207681_10000005 3300025923 Bacteria 555724
717 Ga0207681_10000197 3300025923 Bacteria 48475
718 Ga0207681_10684161 3300025923 Bacteria 852
719 Ga0207681_11150961 3300025923 Bacteria 652
720 Ga0207694_10002782 3300025924 Bacteria 14124
721 Ga0207694_10016018 3300025924 Bacteria 5657
722 Ga0207694_10049198 3300025924 Bacteria 3263
723 Ga0207694_10124310 3300025924 Bacteria 2062
724 Ga0207694_10363345 3300025924 Bacteria 1200
725 Ga0207694_10382618 3300025924 Bacteria 1168
726 Ga0207694_10659746 3300025924 Bacteria 881
727 Ga0207694_11014525 3300025924 Bacteria 702
728 Ga0207694_11894867 3300025924 Bacteria 500
729 Ga0207650_10000004 3300025925 Bacteria 743372
730 Ga0207650_10000069 3300025925 Bacteria 138442
731 Ga0207650_10068635 3300025925 Bacteria 2662
732 Ga0207650_10208243 3300025925 Bacteria 1570
733 Ga0207650_10218925 3300025925 Bacteria 1531
734 Ga0207659_10009064 3300025926 Bacteria 6208
735 Ga0207659_10396469 3300025926 Bacteria 1153
736 Ga0207659_11003722 3300025926 Bacteria 718
737 Ga0207659_11019975 3300025926 Bacteria 712
738 Ga0207687_10003114 3300025927 Bacteria 11241
739 Ga0207687_10079745 3300025927 Bacteria 2361
740 Ga0207687_10236428 3300025927 Bacteria 1446
741 Ga0207687_11118299 3300025927 Bacteria 677
742 Ga0207644_10000145 3300025931 Bacteria 50586
743 Ga0207644_10058536 3300025931 Bacteria 2785
744 Ga0207644_10163232 3300025931 Bacteria 1733
745 Ga0207644_10312997 3300025931 Bacteria 1268
746 Ga0207644_10611291 3300025931 Bacteria 906
747 Ga0207690_10004341 3300025932 Bacteria 8375
748 Ga0207690_10066595 3300025932 Bacteria 2468
749 Ga0207690_10075431 3300025932 Bacteria 2339
750 Ga0207690_10480941 3300025932 Bacteria 1002
751 Ga0207690_10666319 3300025932 Bacteria 854
752 Ga0207690_10725464 3300025932 Bacteria 818
753 Ga0207690_11366109 3300025932 Bacteria 592
754 Ga0207690_11450002 3300025932 Bacteria 574
755 Ga0207706_10022259 3300025933 Bacteria 5687
756 Ga0207706_10041508 3300025933 Bacteria 4079
757 Ga0207706_10180514 3300025933 Bacteria 1854
758 Ga0207706_10181057 3300025933 Bacteria 1851
759 Ga0207706_10229574 3300025933 Bacteria 1624
760 Ga0207706_10310239 3300025933 Bacteria 1374
761 Ga0207706_10344241 3300025933 Bacteria 1297
762 Ga0207706_10361163 3300025933 Bacteria 1262
763 Ga0207706_10702569 3300025933 Bacteria 864
764 Ga0207706_10946056 3300025933 Bacteria 726
765 Ga0207706_11181552 3300025933 Bacteria 636
766 Ga0207686_10004287 3300025934 Bacteria 7648
767 Ga0207686_10156000 3300025934 Bacteria 1595
768 Ga0207686_11396709 3300025934 Bacteria 576
769 Ga0207709_10000114 3300025935 Bacteria 124672
770 Ga0207709_10000246 3300025935 Bacteria 66685
771 Ga0207709_10462012 3300025935 Bacteria 983
772 Ga0207709_10550523 3300025935 Bacteria 907
773 Ga0207709_10703101 3300025935 Bacteria 809
774 Ga0207670_10017586 3300025936 Bacteria 4324
775 Ga0207670_11740647 3300025936 Bacteria 530
776 Ga0207669_10005822 3300025937 Bacteria 5575
777 Ga0207669_10017734 3300025937 Bacteria 3660
778 Ga0207669_10629947 3300025937 Bacteria 875
779 Ga0207669_10946787 3300025937 Bacteria 721
780 Ga0207704_10000008 3300025938 Bacteria 204682
781 Ga0207691_10125275 3300025940 Bacteria 2274
782 Ga0207691_10473191 3300025940 Bacteria 1065
783 Ga0207691_10492740 3300025940 Bacteria 1041
784 Ga0207691_11152377 3300025940 Bacteria 644
785 Ga0207691_11629418 3300025940 Bacteria 524
786 Ga0207711_10000025 3300025941 Bacteria 289972
787 Ga0207711_10001472 3300025941 Bacteria 21955
788 Ga0207711_10005846 3300025941 Bacteria 10390
789 Ga0207711_10006762 3300025941 Bacteria 9642
790 Ga0207711_10015720 3300025941 Bacteria 6277
791 Ga0207689_10000608 3300025942 Bacteria 34222
792 Ga0207689_10099854 3300025942 Bacteria 2385
793 Ga0207689_10280169 3300025942 Bacteria 1381
794 Ga0207689_10392332 3300025942 Bacteria 1156
795 Ga0207689_10716978 3300025942 Bacteria 844
796 Ga0207661_10236839 3300025944 Bacteria 1618
797 Ga0207661_10536130 3300025944 Bacteria 1071
798 Ga0207661_10638479 3300025944 Bacteria 978
799 Ga0207661_11430975 3300025944 Bacteria 634
800 Ga0207679_10050964 3300025945 Bacteria 3028
801 Ga0207679_10157897 3300025945 Bacteria 1854
802 Ga0207679_10378715 3300025945 Bacteria 1240
803 Ga0207679_11301270 3300025945 Bacteria 667
804 Ga0207679_11432425 3300025945 Bacteria 634
805 Ga0207667_10000002 3300025949 Bacteria 895662
806 Ga0207667_10000024 3300025949 Bacteria 355874
807 Ga0207667_10004183 3300025949 Bacteria 17730
808 Ga0207667_10206634 3300025949 Bacteria 2013
809 Ga0207667_10491059 3300025949 Bacteria 1246
810 Ga0207667_10553369 3300025949 Bacteria 1163
811 Ga0207667_10686476 3300025949 Bacteria 1027
812 Ga0207667_11598959 3300025949 Bacteria 620
813 Ga0207651_10000008 3300025960 Bacteria 204538
814 Ga0207651_10486602 3300025960 Bacteria 1064
815 Ga0207651_11659456 3300025960 Bacteria 576
816 Ga0207651_11838274 3300025960 Bacteria 545
817 Ga0207712_10000012 3300025961 Bacteria 392363
818 Ga0207712_10000014 3300025961 Bacteria 375393
819 Ga0207712_10005054 3300025961 Bacteria 8350
820 Ga0207712_10074681 3300025961 Bacteria 2448
821 Ga0207712_10124290 3300025961 Bacteria 1957
822 Ga0207668_10000113 3300025972 Bacteria 57453
823 Ga0207668_10017274 3300025972 Bacteria 4516
824 Ga0207668_10817192 3300025972 Bacteria 826
825 Ga0207668_11440424 3300025972 Bacteria 621
826 Ga0207668_11921966 3300025972 Bacteria 533
827 Ga0207640_10002027 3300025981 Bacteria 10944
828 Ga0207640_10013183 3300025981 Bacteria 4730
829 Ga0207640_10036573 3300025981 Bacteria 3084
830 Ga0207640_10100085 3300025981 Bacteria 2030
831 Ga0207640_10440941 3300025981 Bacteria 1071
832 Ga0207640_10608503 3300025981 Bacteria 926
833 Ga0207640_10998134 3300025981 Bacteria 736
834 Ga0207640_11205523 3300025981 Bacteria 673
835 Ga0207658_10000428 3300025986 Bacteria 39861
836 Ga0207658_10009141 3300025986 Bacteria 6722
837 Ga0207658_10010246 3300025986 Bacteria 6368
838 Ga0207658_11843379 3300025986 Bacteria 551
839 Ga0207677_10000091 3300026023 Bacteria 74163
840 Ga0207677_11302107 3300026023 Bacteria 667
841 Ga0207677_11497990 3300026023 Bacteria 623
842 Ga0207703_10002426 3300026035 Bacteria 16170
843 Ga0207703_10003828 3300026035 Bacteria 12502
844 Ga0207703_10994092 3300026035 Bacteria 805
845 Ga0207639_10003616 3300026041 Bacteria 10382
846 Ga0207639_10013397 3300026041 Bacteria 5739
847 Ga0207639_10020428 3300026041 Bacteria 4740
848 Ga0207639_10020539 3300026041 Bacteria 4728
849 Ga0207639_10041198 3300026041 Bacteria 3454
850 Ga0207639_10119130 3300026041 Bacteria 2166
851 Ga0207639_10200720 3300026041 Bacteria 1710
852 Ga0207639_10272272 3300026041 Bacteria 1486
853 Ga0207639_10307772 3300026041 Bacteria 1403
854 Ga0207639_11098996 3300026041 Bacteria 746
855 Ga0207639_11296198 3300026041 Bacteria 684
856 Ga0207678_10004876 3300026067 Bacteria 12048
857 Ga0207678_10016489 3300026067 Bacteria 6486
858 Ga0207678_10175338 3300026067 Bacteria 1831
859 Ga0207678_10301146 3300026067 Bacteria 1378
860 Ga0207678_10703703 3300026067 Bacteria 889
861 Ga0207678_10909510 3300026067 Bacteria 778
862 Ga0207702_10003021 3300026078 Bacteria 15630
863 Ga0207702_10005062 3300026078 Bacteria 11576
864 Ga0207702_10006302 3300026078 Bacteria 10251
865 Ga0207702_10153725 3300026078 Bacteria 2095
866 Ga0207702_10192692 3300026078 Bacteria 1884
867 Ga0207702_10210284 3300026078 Bacteria 1808
868 Ga0207702_10274235 3300026078 Bacteria 1592
869 Ga0207641_10000002 3300026088 Bacteria 981004
870 Ga0207641_10000036 3300026088 Bacteria 213165
871 Ga0207641_10000099 3300026088 Bacteria 122892
872 Ga0207641_10006011 3300026088 Bacteria 10288
873 Ga0207641_10112331 3300026088 Bacteria 2417
874 Ga0207641_10223420 3300026088 Bacteria 1747
875 Ga0207641_11260024 3300026088 Bacteria 740
876 Ga0207648_10000009 3300026089 Bacteria 204229
877 Ga0207648_10014717 3300026089 Bacteria 7220
878 Ga0207648_10603009 3300026089 Bacteria 1012
879 Ga0207648_10787837 3300026089 Bacteria 884
880 Ga0207676_10000006 3300026095 Bacteria 681936
881 Ga0207676_10000044 3300026095 Bacteria 161679
882 Ga0207676_10001345 3300026095 Bacteria 18261
883 Ga0207676_10922563 3300026095 Bacteria 857
884 Ga0207676_12417247 3300026095 Bacteria 522
885 Ga0207674_10017839 3300026116 Bacteria 7737
886 Ga0207674_10050570 3300026116 Bacteria 4245
887 Ga0207674_10066644 3300026116 Bacteria 3626
888 Ga0207674_10095821 3300026116 Bacteria 2953
889 Ga0207674_10197887 3300026116 Bacteria 1959
890 Ga0207674_10423883 3300026116 Bacteria 1286
891 Ga0207674_10536182 3300026116 Bacteria 1131
892 Ga0207674_11775389 3300026116 Bacteria 584
893 Ga0207674_12056820 3300026116 Bacteria 535
894 Ga0207675_100000157 3300026118 Bacteria 59865
895 Ga0207675_100001117 3300026118 Bacteria 26571
896 Ga0207675_100015082 3300026118 Bacteria 7210
897 Ga0207675_100318652 3300026118 Bacteria 1518
898 Ga0207675_102043211 3300026118 Bacteria 590
899 Ga0207683_10004633 3300026121 Bacteria 11856
900 Ga0207683_10006500 3300026121 Bacteria 10001
901 Ga0207683_10701972 3300026121 Bacteria 938
902 Ga0207683_11689544 3300026121 Bacteria 582
903 Ga0207698_10000496 3300026142 Bacteria 22942
904 Ga0207698_10002491 3300026142 Bacteria 10925
905 Ga0207698_10005844 3300026142 Bacteria 7643
906 Ga0207698_10215161 3300026142 Bacteria 1732
907 Ga0207698_10235827 3300026142 Bacteria 1664
908 Ga0207698_10308204 3300026142 Bacteria 1477
909 Ga0207698_10579932 3300026142 Bacteria 1103
910 Ga0207698_10826820 3300026142 Bacteria 930
911 Ga0207698_11144138 3300026142 Bacteria 792
912 Ga0209998_10068929 3300027717 Bacteria 843
913 Ga0209974_10058972 3300027876 Bacteria 1298
914 Ga0268266_10000009 3300028379 Bacteria 1097737
915 Ga0268266_10000015 3300028379 Bacteria 630629
916 Ga0268266_10000560 3300028379 Bacteria 51866
917 Ga0268266_10008365 3300028379 Bacteria 9202
918 Ga0268266_10157745 3300028379 Bacteria 2051
919 Ga0268266_10553148 3300028379 Bacteria 1103
920 Ga0268266_11113731 3300028379 Bacteria 764
921 Ga0268266_11854022 3300028379 Bacteria 577
922 Ga0268265_10000001 3300028380 Bacteria 1230727
923 Ga0268265_10000003 3300028380 Bacteria 949201
924 Ga0268265_10000047 3300028380 Bacteria 179354
925 Ga0268265_10000125 3300028380 Bacteria 96710
926 Ga0268265_10231745 3300028380 Bacteria 1623
927 Ga0268265_12333057 3300028380 Bacteria 542
928 Ga0268264_10000023 3300028381 Bacteria 471408
929 Ga0268264_10014193 3300028381 Bacteria 6550
930 Ga0268264_10074867 3300028381 Bacteria 2877
931 Ga0268264_10205367 3300028381 Bacteria 1805
932 Ga0268264_11672397 3300028381 Bacteria 647
933 Ga0307515_10341363 3300028794 Bacteria 1150
934 Ga0265338_10170208 3300028800 Bacteria 1672
935 Ga0314311_1129629 3300030733 Bacteria 894
936 Ga0316183_1101809 3300030742 Bacteria 3404
937 Ga0307513_10032777 3300031456 Bacteria 5852
938 Ga0307513_10259144 3300031456 Bacteria 1530
939 Ga0307513_10504297 3300031456 Bacteria 927
940 Ga0307513_10691202 3300031456 Bacteria 726
941 Ga0307513_10745609 3300031456 Bacteria 685
942 Ga0307408_100002738 3300031548 Bacteria 12231
943 Ga0307408_100999629 3300031548 Bacteria 771
944 Ga0307408_101455450 3300031548 Bacteria 646
945 Ga0307508_10004384 3300031616 Bacteria 13803
946 Ga0307405_10045306 3300031731 Bacteria 2694
947 Ga0307405_10064746 3300031731 Bacteria 2324
948 Ga0307405_10341476 3300031731 Bacteria 1151
949 Ga0307405_10464188 3300031731 Bacteria 1007
950 Ga0307405_10912860 3300031731 Bacteria 743
951 Ga0307405_11445527 3300031731 Bacteria 602
952 Ga0307405_11717863 3300031731 Bacteria 556
953 Ga0307405_11939894 3300031731 Bacteria 526
954 Ga0307413_10074350 3300031824 Bacteria 2152
955 Ga0307413_10267957 3300031824 Bacteria 1277
956 Ga0307413_10876998 3300031824 Bacteria 760
957 Ga0307413_10923106 3300031824 Bacteria 743
958 Ga0307413_10989766 3300031824 Bacteria 720
959 Ga0307413_11491805 3300031824 Bacteria 597
960 Ga0307410_10020800 3300031852 Bacteria 4023
961 Ga0307410_10182426 3300031852 Bacteria 1590
962 Ga0307410_10757338 3300031852 Bacteria 823
963 Ga0307410_11125492 3300031852 Bacteria 681
964 Ga0307406_10022639 3300031901 Bacteria 3730
965 Ga0307406_10040041 3300031901 Bacteria 2911
966 Ga0307406_10047398 3300031901 Bacteria 2708
967 Ga0307406_10198586 3300031901 Bacteria 1474
968 Ga0307406_10271505 3300031901 Bacteria 1288
969 Ga0307406_10409954 3300031901 Bacteria 1077
970 Ga0307406_10431566 3300031901 Bacteria 1052
971 Ga0307406_10900703 3300031901 Bacteria 753
972 Ga0307406_11616058 3300031901 Bacteria 573
973 Ga0307407_10050253 3300031903 Bacteria 2385
974 Ga0307407_10202991 3300031903 Bacteria 1330
975 Ga0307412_10000330 3300031911 Bacteria 30088
976 Ga0307412_10002114 3300031911 Bacteria 11025
977 Ga0307412_10005437 3300031911 Bacteria 7151
978 Ga0307412_10031479 3300031911 Bacteria 3351
979 Ga0307412_10032820 3300031911 Bacteria 3294
980 Ga0307412_10063499 3300031911 Bacteria 2491
981 Ga0307412_10069509 3300031911 Bacteria 2397
982 Ga0307412_10133634 3300031911 Bacteria 1806
983 Ga0307412_10731022 3300031911 Bacteria 852
984 Ga0307409_100075828 3300031995 Bacteria 2694
985 Ga0307409_101074060 3300031995 Bacteria 825
986 Ga0307409_101444973 3300031995 Bacteria 714
987 Ga0307416_100013642 3300032002 Bacteria 5533
988 Ga0307416_100024455 3300032002 Bacteria 4410
989 Ga0307416_100056646 3300032002 Bacteria 3165
990 Ga0307416_100228529 3300032002 Bacteria 1791
991 Ga0307416_100296789 3300032002 Bacteria 1603
992 Ga0307416_101661728 3300032002 Bacteria 744
993 Ga0307416_101971073 3300032002 Bacteria 687
994 Ga0307414_10000117 3300032004 Bacteria 56697
995 Ga0307414_10000371 3300032004 Bacteria 24637
996 Ga0307414_10031754 3300032004 Bacteria 3468
997 Ga0307414_10036610 3300032004 Bacteria 3278
998 Ga0307414_10115431 3300032004 Bacteria 2053
999 Ga0307414_10342652 3300032004 Bacteria 1280
1000 Ga0307414_10344197 3300032004 Bacteria 1277
1001 Ga0307414_10449790 3300032004 Bacteria 1129
1002 Ga0307414_10922789 3300032004 Bacteria 801
1003 Ga0307414_11157305 3300032004 Bacteria 715
1004 Ga0307414_12074244 3300032004 Bacteria 531
1005 Ga0307411_10069400 3300032005 Bacteria 2380
1006 Ga0307411_10182421 3300032005 Bacteria 1594
1007 Ga0307411_10227412 3300032005 Bacteria 1452
1008 Ga0307411_10249025 3300032005 Bacteria 1396
1009 Ga0307411_10877007 3300032005 Bacteria 796
1010 Ga0307415_100135597 3300032126 Bacteria 1871
1011 Ga0307415_100208297 3300032126 Bacteria 1558
1012 Ga0307415_101494312 3300032126 Bacteria 646
1013 Ga0307415_101576380 3300032126 Bacteria 630
1014 Ga0307510_10127422 3300033180 Bacteria 2230
1015 Ga0307510_10608921 3300033180 Bacteria 545
1016 Ga0373954_0204433 3300035118 Bacteria 970
1017 Ga0373931_0061226 3300035691 Bacteria 2029
1018 Ga0373935_0588072 3300035692 Bacteria 813
1019 Ga0373927_0041187 3300035695 Bacteria 2996
1020 Ga0373925_0449014 3300037068 Bacteria 1056
1021 Ga0395899_0116591 3300037312 Bacteria 1916
1022 Ga0395899_0134214 3300037312 Bacteria 1765
1023 Ga0395900_0232480 3300037418 Bacteria 1853
1024 Ga0395900_0265355 3300037418 Bacteria 1713
1025 Ga0395900_0549404 3300037418 Bacteria 1100
1026 Ga0395898_0804277 3300037466 Bacteria 880
1027 Ga0395905_0257057 3300037471 Bacteria 1631
1028 Ga0395905_0501499 3300037471 Bacteria 1114
1029 Ga0395905_0520966 3300037471 Bacteria 1089
1030 Ga0395905_1136521 3300037471 Bacteria 684
1031 Ga0436364_0957806 3300037853 Bacteria 2079
1032 Ga0436364_1065372 3300037853 Bacteria 196587
1033 Ga0436364_1253875 3300037853 Bacteria 646
1034 Ga0395901_0318284 3300038443 Bacteria 1610
1035 Ga0395901_0617526 3300038443 Bacteria 1091
1036 Ga0395901_0863371 3300038443 Bacteria 889
1037 Ga0237819_00478 3300038705 Bacteria 13587
1038 Ga0237816_01697 3300039145 Bacteria 1758
1039 Ga0436365_1056819 3300039437 Bacteria 544
1040 Ga0436365_1234023 3300039437 Bacteria 954
1041 Ga0436365_1437704 3300039437 Bacteria 4356
1042 Ga0436365_1495591 3300039437 Bacteria 728
1043 Ga0436362_0379666 3300039453 Bacteria 1169
1044 Ga0439436_0104422 3300041404 Bacteria 790
1045 Ga0439436_0166421 3300041404 Bacteria 624
1046 Ga0439439_0019879 3300041406 Bacteria 1668
1047 Ga0439461_0003935 3300041410 Bacteria 2463
1048 Ga0439461_0096709 3300041410 Bacteria 714
1049 Ga0439465_0004239 3300041413 Bacteria 4665
1050 Ga0439465_0005674 3300041413 Bacteria 3972
1051 Ga0439465_0042157 3300041413 Bacteria 1478
1052 Ga0451789_0548732 3300041443 Bacteria 552
1053 Ga0451790_23905 3300041444 Bacteria 890
1054 Ga0451791_0198074 3300041451 Bacteria 555
1055 Ga0451791_0638383 3300041451 Bacteria 513
1056 Ga0451791_0752784 3300041451 Bacteria 600
1057 Ga0451791_0863431 3300041451 Bacteria 652
1058 Ga0451797_1153188 3300041453 Bacteria 1021
1059 Ga0451795_0712337 3300041456 Bacteria 778
1060 Ga0451795_1707330 3300041456 Bacteria 970
1061 Ga0451795_1714707 3300041456 Bacteria 592
1062 Ga0451800_0368767 3300041459 Bacteria 523
1063 Ga0451802_0283989 3300041460 Bacteria 2618
1064 Ga0451802_0673154 3300041460 Bacteria 653
1065 Ga0451802_1024104 3300041460 Bacteria 545
1066 Ga0451802_2140950 3300041460 Bacteria 964
1067 Ga0451805_129527 3300041461 Bacteria 521
1068 Ga0451806_203876 3300041462 Bacteria 788
1069 Ga0451806_592453 3300041462 Bacteria 527
1070 Ga0451806_758294 3300041462 Bacteria 796
1071 Ga0451804_0246643 3300041463 Bacteria 672
1072 Ga0451804_0292217 3300041463 Bacteria 510
1073 Ga0451804_0477757 3300041463 Bacteria 504
1074 Ga0451807_0470631 3300041486 Bacteria 648
1075 Ga0451807_1170541 3300041486 Bacteria 851
1076 Ga0451807_1532452 3300041486 Bacteria 708
1077 Ga0451807_2302565 3300041486 Bacteria 1010
1078 Ga0451807_2545728 3300041486 Bacteria 947
1079 Ga0451807_2637162 3300041486 Bacteria 1229
1080 Ga0451833_1456891 3300041491 Bacteria 520
1081 Ga0451837_0903713 3300041494 Bacteria 504
1082 Ga0451837_1313285 3300041494 Bacteria 648
1083 Ga0451841_1289656 3300041498 Bacteria 510
1084 Ga0451845_0647259 3300041501 Bacteria 1089
1085 Ga0451843_0561276 3300041509 Bacteria 511
1086 Ga0451843_0868889 3300041509 Bacteria 503
1087 Ga0451855_0464587 3300041511 Bacteria 881
1088 Ga0451853_1470546 3300041512 Bacteria 620
1089 Ga0451853_1927772 3300041512 Bacteria 577
1090 Ga0451853_1977551 3300041512 Bacteria 1202
1091 Ga0439431_0003098 3300041997 Bacteria 3653
1092 Ga0439431_0139411 3300041997 Bacteria 684
1093 Ga0439445_0001259 3300042004 Bacteria 5489
1094 Ga0439445_0046001 3300042004 Bacteria 1169
1095 Ga0439445_0057073 3300042004 Bacteria 1063
1096 Ga0439445_0064378 3300042004 Bacteria 1006
1097 Ga0439445_0077090 3300042004 Bacteria 928
1098 Ga0439448_0001965 3300042005 Bacteria 5493
1099 Ga0439448_0021597 3300042005 Bacteria 1995
1100 Ga0439448_0034484 3300042005 Bacteria 1617
1101 Ga0439432_006259 3300042006 Bacteria 4257
1102 Ga0439450_143599 3300042008 Bacteria 623
1103 Ga0439452_041030 3300042010 Bacteria 1090
1104 Ga0439455_0003944 3300042012 Bacteria 2893
1105 Ga0439455_0064401 3300042012 Bacteria 976
1106 Ga0439462_0004404 3300042015 Bacteria 3435
1107 Ga0439462_0004785 3300042015 Bacteria 3319
1108 Ga0450894_038137 3300042131 Bacteria 685
1109 Ga0439446_0019699 3300042156 Bacteria 1898
1110 Ga0439458_0001028 3300042157 Bacteria 7126
1111 Ga0439458_0004227 3300042157 Bacteria 3315
1112 Ga0439434_0000103 3300042435 Bacteria 21899
1113 Ga0439434_0075974 3300042435 Bacteria 1062
1114 Ga0439464_0179423 3300042439 Bacteria 670
1115 Ga0450893_0027173 3300042532 Bacteria 1008
1116 Ga0466972_0022049 3300044658 Bacteria 3171
1117 Ga0466966_0224862 3300044684 Bacteria 1133
1118 Ga0466961_0076990 3300044693 Bacteria 2113
1119 Ga0466963_0015793 3300044694 Bacteria 4685
1120 Ga0466964_0641459 3300044706 Bacteria 586
1121 Ga0466971_0041189 3300044719 Bacteria 2074
1122 Ga0466971_0531987 3300044719 Bacteria 582
1123 Ga0466968_0457697 3300044735 Bacteria 631
1124 Ga0466970_0075472 3300044765 Bacteria 1816
1125 Ga0466957_0608401 3300044842 Bacteria 765
1126 Ga0466957_0732249 3300044842 Bacteria 699
1127 Ga0466957_1334854 3300044842 Bacteria 521
1128 Ga0466960_0887854 3300044901 Bacteria 543
1129 Ga0466959_0030393 3300045049 Bacteria 3999
1130 Ga0466958_0020347 3300045836 Bacteria 3868
1131 Ga0466958_0298961 3300045836 Bacteria 1033
1132 Ga0466958_0655830 3300045836 Bacteria 683
1133 Ga0466967_1115467 3300045976 Bacteria 786
1134 Ga0466967_2500056 3300045976 Bacteria 511
1135 Ga0495627_084823 3300046453 Bacteria 915
1136 Ga0495627_099887 3300046453 Bacteria 829
1137 Ga0495590_0364510 3300046457 Bacteria 551
1138 Ga0495629_0842767 3300046459 Bacteria 603
1139 Ga0495638_0004617 3300046460 Bacteria 10422
1140 Ga0495638_0038151 3300046460 Bacteria 3055
1141 Ga0495638_0054219 3300046460 Bacteria 2493
1142 Ga0495638_0502409 3300046460 Bacteria 610
1143 Ga0495638_0560184 3300046460 Bacteria 567
1144 Ga0495650_0001317 3300046471 Bacteria 25056
1145 Ga0495639_0309034 3300046475 Bacteria 789
1146 Ga0495584_0111019 3300046491 Bacteria 1387
1147 Ga0495585_0133334 3300046492 Bacteria 1305
1148 Ga0495585_0277392 3300046492 Bacteria 829
1149 Ga0495585_0341219 3300046492 Bacteria 729
1150 Ga0495585_0588467 3300046492 Bacteria 524
1151 Ga0495596_0175517 3300046500 Bacteria 833
1152 Ga0495607_0408716 3300046501 Bacteria 616
1153 Ga0495583_0000766 3300046506 Bacteria 40320
1154 Ga0495583_0007683 3300046506 Bacteria 6720
1155 Ga0495583_0063474 3300046506 Bacteria 1641
1156 Ga0495583_0078340 3300046506 Bacteria 1439
1157 Ga0495583_0082064 3300046506 Bacteria 1399
1158 Ga0495583_0278645 3300046506 Bacteria 667
1159 Ga0495606_0023498 3300046507 Bacteria 4464
1160 Ga0495606_0042086 3300046507 Bacteria 3058
1161 Ga0495606_0097880 3300046507 Bacteria 1791
1162 Ga0495606_0214158 3300046507 Bacteria 1089
1163 Ga0495606_0545327 3300046507 Bacteria 578
1164 Ga0495610_0371230 3300046512 Bacteria 534
1165 Ga0495616_0129000 3300046513 Bacteria 1160
1166 Ga0495616_0373886 3300046513 Bacteria 590
1167 Ga0495620_0132850 3300046515 Bacteria 976
1168 Ga0495631_0046334 3300046518 Bacteria 1912
1169 Ga0495631_0474017 3300046518 Bacteria 533
1170 Ga0495632_0206744 3300046519 Bacteria 892
1171 Ga0495632_0367474 3300046519 Bacteria 631
1172 Ga0495632_0462517 3300046519 Bacteria 549
1173 Ga0495637_0118426 3300046520 Bacteria 1021
1174 Ga0495637_0123343 3300046520 Bacteria 995
1175 Ga0495643_0008456 3300046522 Bacteria 6513
1176 Ga0495643_0011725 3300046522 Bacteria 5321
1177 Ga0495643_0057255 3300046522 Bacteria 2078
1178 Ga0495643_0449081 3300046522 Bacteria 561
1179 Ga0495643_0460848 3300046522 Bacteria 552
1180 Ga0495648_0000507 3300046524 Bacteria 41960
1181 Ga0495648_0166532 3300046524 Bacteria 1134
1182 Ga0495648_0338835 3300046524 Bacteria 691
1183 Ga0495663_0002619 3300046525 Bacteria 5363
1184 Ga0495663_0123542 3300046525 Bacteria 868
1185 Ga0495642_0431045 3300046528 Bacteria 582
1186 Ga0495652_0326049 3300046529 Bacteria 1108
1187 Ga0495654_0004604 3300046530 Bacteria 8143
1188 Ga0495654_0036570 3300046530 Bacteria 2467
1189 Ga0495654_0131481 3300046530 Bacteria 1123
1190 Ga0495654_0342787 3300046530 Bacteria 602
1191 Ga0495654_0447958 3300046530 Bacteria 508
1192 Ga0495598_0008568 3300046537 Bacteria 2387
1193 Ga0495609_0423917 3300046538 Bacteria 531
1194 Ga0495597_0063768 3300046542 Bacteria 1601
1195 Ga0495597_0193287 3300046542 Bacteria 818
1196 Ga0495597_0425513 3300046542 Bacteria 503
1197 Ga0495622_0048141 3300046557 Bacteria 1981
1198 Ga0495633_0028185 3300046558 Bacteria 2739
1199 Ga0495633_0070471 3300046558 Bacteria 1631
1200 Ga0495668_0000015 3300046616 Bacteria 441932
1201 Ga0495668_0000016 3300046616 Bacteria 438197
1202 Ga0495668_0019898 3300046616 Bacteria 3863
1203 Ga0495668_0033266 3300046616 Bacteria 2897
1204 Ga0495668_0311375 3300046616 Bacteria 863
1205 Ga0495668_0440036 3300046616 Bacteria 717
1206 Ga0495668_0556016 3300046616 Bacteria 633
1207 Ga0495668_0652397 3300046616 Bacteria 582
1208 Ga0495611_0020624 3300046648 Bacteria 2838
1209 Ga0495611_0158187 3300046648 Bacteria 1058
1210 Ga0495611_0296985 3300046648 Bacteria 745
1211 Ga0495611_0314971 3300046648 Bacteria 720
1212 Ga0495625_0000072 3300046660 Bacteria 166439
1213 Ga0495625_0004430 3300046660 Bacteria 13282
1214 Ga0495625_0007474 3300046660 Bacteria 9501
1215 Ga0495625_0075318 3300046660 Bacteria 2361
1216 Ga0495625_0169691 3300046660 Bacteria 1457
1217 Ga0495625_0265515 3300046660 Bacteria 1109
1218 Ga0495625_0269124 3300046660 Bacteria 1100
1219 Ga0495625_0402133 3300046660 Bacteria 855
1220 Ga0495625_0555976 3300046660 Bacteria 694
1221 Ga0495625_0591105 3300046660 Bacteria 667
1222 Ga0495625_0665985 3300046660 Bacteria 618
1223 Ga0495661_0011622 3300046665 Bacteria 5969
1224 Ga0495661_0116274 3300046665 Bacteria 1484
1225 Ga0495661_0572121 3300046665 Bacteria 533
1226 Ga0495669_0000529 3300046684 Bacteria 17238
1227 Ga0495613_0831096 3300046689 Bacteria 601
1228 Ga0495670_0000015 3300046691 Bacteria 131137
1229 Ga0495670_0008829 3300046691 Bacteria 4959
1230 Ga0495670_0015640 3300046691 Bacteria 3729
1231 Ga0495670_0467011 3300046691 Bacteria 684
1232 Ga0495671_0063051 3300046692 Bacteria 1826
1233 Ga0495649_0148846 3300046694 Bacteria 1230
1234 Ga0495649_0249991 3300046694 Bacteria 911
1235 Ga0495649_0425440 3300046694 Bacteria 665
1236 Ga0495589_0133912 3300046794 Bacteria 1189
1237 Ga0495600_0009109 3300046809 Bacteria 6121
1238 Ga0495660_0430779 3300046810 Bacteria 573
1239 Ga0495683_0116301 3300047323 Bacteria 1272
1240 Ga0495683_0122323 3300047323 Bacteria 1234
1241 Ga0495687_000649 3300047443 Bacteria 39837
1242 Ga0495687_004871 3300047443 Bacteria 8814
1243 Ga0495687_062746 3300047443 Bacteria 1524
1244 Ga0495677_0021122 3300047445 Bacteria 2360
1245 Ga0495677_0036383 3300047445 Bacteria 1798
1246 Ga0495673_0019216 3300047469 Bacteria 3427
1247 Ga0495681_0011958 3300047470 Bacteria 5128
1248 Ga0495681_0041622 3300047470 Bacteria 2229
1249 Ga0495681_0309730 3300047470 Bacteria 609
1250 Ga0495686_0000530 3300047472 Bacteria 54741
1251 Ga0495686_0000723 3300047472 Bacteria 44178
1252 Ga0495686_0001008 3300047472 Bacteria 34224
1253 Ga0495686_0024914 3300047472 Bacteria 3925
1254 Ga0495686_0070575 3300047472 Bacteria 2152
1255 Ga0495686_0182374 3300047472 Bacteria 1215
1256 Ga0495686_0279442 3300047472 Bacteria 928
1257 Ga0495686_0659667 3300047472 Bacteria 537
1258 Ga0496100_0561651 3300048903 Bacteria 884
1259 Ga0496101_0915559 3300048904 Bacteria 690
1260 Ga0496102_0003035 3300048905 Bacteria 14220
1261 Ga0496102_0003155 3300048905 Bacteria 13978
1262 Ga0496102_0757323 3300048905 Bacteria 894
1263 Ga0496102_1378167 3300048905 Bacteria 624
1264 Ga0496102_1627729 3300048905 Bacteria 564
1265 Ga0496103_0000903 3300048906 Bacteria 21301
1266 Ga0496103_0001742 3300048906 Bacteria 14206
1267 Ga0496104_0082332 3300048907 Bacteria 3069
1268 Ga0496105_0005151 3300048908 Bacteria 9912
1269 Ga0496105_0197990 3300048908 Bacteria 1640
1270 Ga0496106_0182822 3300048909 Bacteria 1665
1271 Ga0496107_0194779 3300048910 Bacteria 1506
1272 Ga0496107_0580837 3300048910 Bacteria 829
1273 Ga0496108_0519986 3300048911 Bacteria 1039
1274 Ga0496108_1257974 3300048911 Bacteria 624
1275 Ga0496109_0296717 3300048912 Bacteria 1524
1276 Ga0496109_0882846 3300048912 Bacteria 832
1277 Ga0496110_0774142 3300048913 Bacteria 863
1278 Ga0496111_0009790 3300048914 Bacteria 6408
1279 Ga0496111_0129586 3300048914 Bacteria 1866
1280 Ga0496111_1045338 3300048914 Bacteria 584
1281 Ga0496112_1451392 3300048915 Bacteria 600
1282 Ga0496113_0811620 3300048916 Bacteria 743
1283 Ga0496113_1336816 3300048916 Bacteria 556
1284 Ga0496114_0007549 3300048917 Bacteria 8603
1285 Ga0496115_0002111 3300048918 Bacteria 14223
1286 Ga0496115_0002506 3300048918 Bacteria 13194
1287 Ga0496116_0024085 3300048919 Bacteria 4511
1288 Ga0496116_0091775 3300048919 Bacteria 1844
1289 Ga0496116_0483207 3300048919 Bacteria 520
1290 Ga0496117_0000324 3300048920 Bacteria 83876
1291 Ga0496117_0005438 3300048920 Bacteria 13377
1292 Ga0496117_0034695 3300048920 Bacteria 3798
1293 Ga0496117_0062804 3300048920 Bacteria 2543
1294 Ga0496117_0117705 3300048920 Bacteria 1639
1295 Ga0496118_0002151 3300048921 Bacteria 27486
1296 Ga0496118_0004152 3300048921 Bacteria 17499
1297 Ga0496118_0017136 3300048921 Bacteria 6610
1298 Ga0496118_0019807 3300048921 Bacteria 6000
1299 Ga0496118_0117741 3300048921 Bacteria 1741
1300 Ga0496119_0006610 3300048922 Bacteria 10677
1301 Ga0496119_0047821 3300048922 Bacteria 2658
1302 Ga0496119_0329689 3300048922 Bacteria 745
1303 Ga0496120_0093468 3300048923 Bacteria 1602
1304 Ga0496120_0275078 3300048923 Bacteria 780
1305 Ga0496120_0439828 3300048923 Bacteria 569
1306 Ga0496121_0001314 3300048924 Bacteria 42592
1307 Ga0496121_0002794 3300048924 Bacteria 25864
1308 Ga0496121_0038248 3300048924 Bacteria 4253
1309 Ga0496121_0040520 3300048924 Bacteria 4084
1310 Ga0496121_0050670 3300048924 Bacteria 3504
1311 Ga0496121_0052395 3300048924 Bacteria 3428
1312 Ga0496121_0276551 3300048924 Bacteria 1151
1313 Ga0496122_0001531 3300048925 Bacteria 36790
1314 Ga0496122_0055074 3300048925 Bacteria 2979
1315 Ga0496122_0112139 3300048925 Bacteria 1786
1316 Ga0496122_0256430 3300048925 Bacteria 974
1317 Ga0496122_0360994 3300048925 Bacteria 754
1318 Ga0496123_0001418 3300048926 Bacteria 33502
1319 Ga0496123_0016952 3300048926 Bacteria 5884
1320 Ga0496123_0022246 3300048926 Bacteria 4893
1321 Ga0496123_0070087 3300048926 Bacteria 2196
1322 Ga0496123_0176423 3300048926 Bacteria 1121
1323 Ga0496123_0294026 3300048926 Bacteria 778
1324 Ga0496123_0431617 3300048926 Bacteria 591
1325 Ga0496124_0000351 3300048927 Bacteria 84021
1326 Ga0496124_0005829 3300048927 Bacteria 13673
1327 Ga0496124_0014083 3300048927 Bacteria 7755
1328 Ga0496124_0040538 3300048927 Bacteria 4026
1329 Ga0496124_0052819 3300048927 Bacteria 3451
1330 Ga0496124_0085511 3300048927 Bacteria 2584
1331 Ga0496124_0744331 3300048927 Bacteria 615
1332 Ga0496125_0003470 3300048928 Bacteria 19085
1333 Ga0496125_0198394 3300048928 Bacteria 1317
1334 Ga0496125_0729088 3300048928 Bacteria 522
1335 Ga0496126_0002155 3300048929 Bacteria 27384
1336 Ga0496126_0127852 3300048929 Bacteria 2198
1337 Ga0496126_0304599 3300048929 Bacteria 1313
1338 Ga0496126_0542348 3300048929 Bacteria 924
1339 Ga0496126_0609894 3300048929 Bacteria 859
1340 Ga0496126_0855323 3300048929 Bacteria 693
1341 Ga0496126_0886973 3300048929 Bacteria 677
1342 Ga0496126_1093170 3300048929 Bacteria 593
1343 Ga0496126_1276051 3300048929 Bacteria 536
1344 Ga0501306_063096 3300049127 Bacteria 613
1345 Ga0501308_086036 3300049128 Bacteria 506
1346 Ga0495678_068202 3300049459 Bacteria 1312
1347 Ga0495678_088048 3300049459 Bacteria 1100
1348 Ga0495682_0008950 3300049460 Bacteria 3927
1349 Ga0501290_000352 3300049513 Bacteria 7476
1350 Ga0501290_006382 3300049513 Bacteria 1477
1351 Ga0501292_000088 3300049515 Bacteria 16990
1352 Ga0501294_000241 3300049517 Bacteria 6800
1353 Ga0501299_092320 3300049522 Bacteria 690
1354 Ga0501300_003094 3300049523 Bacteria 2482
1355 Ga0501300_006532 3300049523 Bacteria 1714
1356 Ga0501314_000002 3300049530 Bacteria 13192
1357 Ga0501314_013552 3300049530 Bacteria 791
1358 Ga0501315_002307 3300049531 Bacteria 1774
1359 Ga0501315_012821 3300049531 Bacteria 1042
1360 Ga0501315_051550 3300049531 Bacteria 647
1361 Ga0501317_001577 3300049533 Bacteria 1992
1362 Ga0501317_018595 3300049533 Bacteria 920
1363 Ga0501318_029866 3300049534 Bacteria 737
1364 Ga0501321_068786 3300049537 Bacteria 547
1365 Ga0501323_001589 3300049539 Bacteria 2057
1366 Ga0501324_027655 3300049540 Bacteria 607
1367 Ga0501333_008957 3300049549 Bacteria 697
1368 Ga0501334_14279 3300049550 Bacteria 601
1369 Ga0501335_038136 3300049551 Bacteria 560
1370 Ga0501335_047919 3300049551 Bacteria 516
1371 Ga0501338_09186 3300049554 Bacteria 655
1372 Ga0501338_12382 3300049554 Bacteria 589
1373 Ga0501031_0035501 3300049568 Bacteria 3252
1374 Ga0501032_0011615 3300049569 Bacteria 6316
1375 Ga0501032_0901662 3300049569 Bacteria 557
1376 Ga0501033_0133191 3300049570 Bacteria 1799
1377 Ga0501033_0649458 3300049570 Bacteria 721
1378 Ga0501034_0007538 3300049571 Bacteria 11575
1379 Ga0501034_0027253 3300049571 Bacteria 5813
1380 Ga0501034_0082782 3300049571 Bacteria 3211
1381 Ga0501034_0647934 3300049571 Bacteria 958
1382 Ga0501034_0982730 3300049571 Bacteria 729
1383 Ga0501036_0050187 3300049572 Bacteria 3533
1384 Ga0501036_1539549 3300049572 Bacteria 538
1385 Ga0501037_0046965 3300049573 Bacteria 3165
1386 Ga0501038_0052443 3300049574 Bacteria 3516
1387 Ga0501039_0005639 3300049575 Bacteria 9478
1388 Ga0501043_0075885 3300049579 Bacteria 2640
1389 Ga0501043_0885135 3300049579 Bacteria 641
1390 Ga0501046_0389609 3300049580 Bacteria 1007
1391 Ga0501047_0032215 3300049581 Bacteria 5059
1392 Ga0501047_0144807 3300049581 Bacteria 2253
1393 Ga0501047_0427174 3300049581 Bacteria 1156
1394 Ga0501047_0850754 3300049581 Bacteria 726
1395 Ga0501048_0109379 3300049582 Bacteria 1951
1396 Ga0501069_0035055 3300049585 Bacteria 2763
1397 Ga0501070_0027529 3300049586 Bacteria 4768
1398 Ga0501071_1605970 3300049587 Bacteria 502
1399 Ga0501206_000112 3300049653 Bacteria 8412
1400 Ga0501222_000376 3300049662 Bacteria 6857
1401 Ga0501223_002540 3300049663 Bacteria 4039
1402 Ga0501223_019504 3300049663 Bacteria 1332
1403 Ga0501223_036026 3300049663 Bacteria 962
1404 Ga0501224_000009 3300049664 Bacteria 107191
1405 Ga0501224_000219 3300049664 Bacteria 6508
1406 Ga0501227_008045 3300049665 Bacteria 2263
1407 Ga0501233_000279 3300049668 Bacteria 7827
1408 Ga0501235_000736 3300049669 Bacteria 6680
1409 Ga0501235_002385 3300049669 Bacteria 4050
1410 Ga0501257_000052 3300049686 Bacteria 32874
1411 Ga0501261_000417 3300049690 Bacteria 5575
1412 Ga0501225_0000094 3300049705 Bacteria 28402
1413 Ga0501241_025197 3300049758 Bacteria 1107
1414 Ga0501276_009720 3300049773 Bacteria 800
1415 Ga0501279_000074 3300049775 Bacteria 16852
1416 Ga0501280_000191 3300049776 Bacteria 15378
1417 Ga0501280_012759 3300049776 Bacteria 1183
1418 Ga0501281_00081 3300049777 Bacteria 11133
1419 Ga0501282_000381 3300049778 Bacteria 5364
1420 Ga0501282_001529 3300049778 Bacteria 2555
1421 Ga0501035_0013966 3300049822 Bacteria 7408
1422 Ga0501035_0492686 3300049822 Bacteria 1009
1423 Ga0501035_0886643 3300049822 Bacteria 707
1424 Ga0501035_1498850 3300049822 Bacteria 514
1425 Ga0501044_0055624 3300049823 Bacteria 4064
1426 Ga0501044_0102207 3300049823 Bacteria 2882
1427 Ga0501044_0324206 3300049823 Bacteria 1464
1428 Ga0501044_0633561 3300049823 Bacteria 959
1429 Ga0501045_0671437 3300049824 Bacteria 765
1430 Ga0501226_000076 3300049853 Bacteria 29950
1431 nmdc:mga03683_313206_c1 3300050489 Bacteria 738
1432 nmdc:mga00v17_3387_c2 3300050491 Bacteria 5533
1433 nmdc:mga00v17_538492_c1 3300050491 Bacteria 755
1434 nmdc:mga00v17_784798_c1 3300050491 Bacteria 607
1435 nmdc:mga0yw44_1193152_c1 3300050492 Bacteria 513
1436 nmdc:mga0k408_30694_c1 3300050493 Bacteria 3065
1437 nmdc:mga0k408_398724_c1 3300050493 Bacteria 819
1438 nmdc:mga0k408_501721_c1 3300050493 Bacteria 719
1439 nmdc:mga0k408_748769_c1 3300050493 Bacteria 571
1440 nmdc:mga07m45_16117_c1 3300050496 Bacteria 3999
1441 nmdc:mga07m45_186221_c1 3300050496 Bacteria 1207
1442 nmdc:mga07m45_84920_c1 3300050496 Bacteria 1810
1443 nmdc:mga05p37_847024_c1 3300050507 Bacteria 993
1444 nmdc:mga0qj67_1518855_c1 3300050509 Bacteria 515
1445 nmdc:mga0n895_418106_c1 3300050512 Bacteria 1355
1446 nmdc:mga0n895_823850_c1 3300050512 Bacteria 917
1447 nmdc:mga0sz30_105445_c1 3300050516 Bacteria 1233
1448 nmdc:mga0sz30_99383_c1 3300050516 Bacteria 1270
1449 Ga0500610_0000216 3300053079 Bacteria 17601
1450 Ga0500643_000134 3300053087 Bacteria 75321
1451 Ga0500643_003488 3300053087 Bacteria 7555
1452 Ga0500643_005556 3300053087 Bacteria 5412
1453 Ga0500643_026980 3300053087 Bacteria 1791
1454 Ga0500643_088711 3300053087 Bacteria 844
1455 Ga0500643_088712 3300053087 Bacteria 844
1456 Ga0500643_137458 3300053087 Bacteria 657
1457 Ga0500644_0260304 3300053088 Bacteria 734
1458 Ga0500646_0091936 3300053090 Bacteria 940
1459 Ga0500647_0213226 3300053091 Bacteria 869
1460 Ga0500651_0120217 3300053093 Bacteria 1595
1461 Ga0500651_0352155 3300053093 Bacteria 835
1462 Ga0500566_0039514 3300053094 Bacteria 2728
1463 Ga0500555_001780 3300053103 Bacteria 6438
1464 Ga0500556_0246324 3300053104 Bacteria 704
1465 Ga0500556_0315331 3300053104 Bacteria 610
1466 Ga0500592_001405 3300053116 Bacteria 3894
1467 Ga0500592_001411 3300053116 Bacteria 3886
1468 Ga0500592_010909 3300053116 Bacteria 1450
1469 Ga0500592_054166 3300053116 Bacteria 653
1470 Ga0500595_017021 3300053119 Bacteria 2695
1471 Ga0500618_017029 3300053125 Bacteria 1812
1472 Ga0500655_000265 3300053133 Bacteria 12247
1473 Ga0500658_0004652 3300053134 Bacteria 5122
1474 Ga0500658_0036311 3300053134 Bacteria 1954
1475 Ga0500658_0070509 3300053134 Bacteria 1473
1476 Ga0500658_0503432 3300053134 Bacteria 548
1477 Ga0500559_0343820 3300053136 Bacteria 698
1478 Ga0500568_0013737 3300053139 Bacteria 3681
1479 Ga0500568_0022667 3300053139 Bacteria 2682
1480 Ga0500568_0033063 3300053139 Bacteria 2124
1481 Ga0500573_0000559 3300053140 Bacteria 16226
1482 Ga0500573_0327745 3300053140 Bacteria 753
1483 Ga0500573_0409230 3300053140 Bacteria 640
1484 Ga0500573_0456536 3300053140 Bacteria 589
1485 Ga0500577_0504599 3300053142 Bacteria 528
1486 Ga0500590_004805 3300053148 Bacteria 6438
1487 Ga0500604_0000014 3300053151 Bacteria 92128
1488 Ga0500604_0017943 3300053151 Bacteria 1966
1489 Ga0500604_0299102 3300053151 Bacteria 558
1490 Ga0500604_0315302 3300053151 Bacteria 543
1491 Ga0500616_0000591 3300053153 Bacteria 44073
1492 Ga0500616_0030468 3300053153 Bacteria 2963
1493 Ga0500616_0083831 3300053153 Bacteria 1596
1494 Ga0500619_136027 3300053154 Bacteria 837
1495 Ga0500627_0000009 3300053158 Bacteria 153203
1496 Ga0500627_0000899 3300053158 Bacteria 7974
1497 Ga0500627_0027229 3300053158 Bacteria 2364
1498 Ga0500627_0042078 3300053158 Bacteria 1965
1499 Ga0500627_0378000 3300053158 Bacteria 607
1500 Ga0500636_0047080 3300053177 Bacteria 2541
1501 Ga0500636_0539332 3300053177 Bacteria 507
1502 Ga0500645_000002 3300053730 Bacteria 388892
1503 Ga0500645_162740 3300053730 Bacteria 611
1504 Ga0587084_022267 3300059477 Bacteria 957
1505 Ga0587084_041804 3300059477 Bacteria 782
1506 Ga0587070_116903 3300059491 Bacteria 633
1507 Ga0587077_060294 3300059493 Bacteria 820
1508 Ga0587077_085234 3300059493 Bacteria 733
1509 Ga0587077_106908 3300059493 Bacteria 680
1510 Ga0587077_188520 3300059493 Bacteria 563
1511 Ga0587090_135625 3300059510 Bacteria 546
1512 Ga0587098_014146 3300059604 Bacteria 937
1513 Ga0587106_030729 3300059605 Bacteria 861
1514 Ga0587101_102335 3300059623 Bacteria 571
1515 Ga0587062_043481 3300059639 Bacteria 737
1516 Ga0587069_047511 3300059642 Bacteria 753
1517 Ga0587072_051597 3300059643 Bacteria 825
1518 Ga0587076_052651 3300059645 Bacteria 798
1519 Ga0587078_042375 3300059646 Bacteria 646
1520 Ga0587102_016703 3300059649 Bacteria 792
1521 Ga0587107_030945 3300059652 Bacteria 814
1522 Ga0587108_025880 3300059653 Bacteria 580
1523 Ga0587071_088394 3300060344 Bacteria 700
1524 Ga0587111_0148151 3300060346 Bacteria 628
1525 Ga0587111_0211339 3300060346 Bacteria 555
1526 Ga0587111_0275893 3300060346 Bacteria 506
1527 Ga0501082_1880845 3300060353 Bacteria 522
1528 Ga0466962_0357974 3300061719 Bacteria 727

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041463 Ga0451804_0292217 Ga0451804_0292217_246_422 56
2 3300053140 Ga0500573_0327745 Ga0500573_0327745_225_401 56
3 3300002067 JGI24735J21928_10164286 JGI24735J21928_101642862 57
4 3300005577 Ga0068857_100066375 Ga0068857_1000663755 57
5 3300005614 Ga0068856_100060779 Ga0068856_1000607796 57
6 3300005616 Ga0068852_100098053 Ga0068852_1000980533 57
7 3300009545 Ga0105237_10469740 Ga0105237_104697403 57
8 3300009551 Ga0105238_10541365 Ga0105238_105413652 57
9 3300011119 Ga0105246_10588517 Ga0105246_105885172 57
10 3300013307 Ga0157372_10084779 Ga0157372_100847794 57
11 3300025914 Ga0207671_10552124 Ga0207671_105521242 57
12 3300025918 Ga0207662_11065466 Ga0207662_110654661 57
13 3300025924 Ga0207694_10659746 Ga0207694_106597462 57
14 3300026078 Ga0207702_10006302 Ga0207702_1000630210 57
15 3300026116 Ga0207674_10095821 Ga0207674_100958213 57
16 3300026116 Ga0207674_10197887 Ga0207674_101978872 57
17 3300026142 Ga0207698_10000496 Ga0207698_1000049629 57
18 3300044658 Ga0466972_0022049 Ga0466972_0022049_1332_1511 57
19 3300044684 Ga0466966_0224862 Ga0466966_0224862_750_929 57
20 3300044693 Ga0466961_0076990 Ga0466961_0076990_1406_1585 57
21 3300044706 Ga0466964_0641459 Ga0466964_0641459_91_270 57
22 3300044719 Ga0466971_0531987 Ga0466971_0531987_49_228 57
23 3300044735 Ga0466968_0457697 Ga0466968_0457697_399_578 57
24 3300044765 Ga0466970_0075472 Ga0466970_0075472_1036_1215 57
25 3300044842 Ga0466957_0608401 Ga0466957_0608401_105_284 57
26 3300044842 Ga0466957_1334854 Ga0466957_1334854_26_205 57
27 3300044901 Ga0466960_0887854 Ga0466960_0887854_287_466 57
28 3300045049 Ga0466959_0030393 Ga0466959_0030393_2674_2853 57
29 3300045836 Ga0466958_0298961 Ga0466958_0298961_472_651 57
30 3300045836 Ga0466958_0655830 Ga0466958_0655830_306_485 57
31 3300045976 Ga0466967_1115467 Ga0466967_1115467_342_521 57
32 3300046460 Ga0495638_0054219 Ga0495638_0054219_987_1166 57
33 3300046506 Ga0495583_0000766 Ga0495583_0000766_332_511 57
34 3300046512 Ga0495610_0371230 Ga0495610_0371230_175_354 57
35 3300046515 Ga0495620_0132850 Ga0495620_0132850_153_335 57
36 3300046648 Ga0495611_0020624 Ga0495611_0020624_1701_1880 57
37 3300046665 Ga0495661_0011622 Ga0495661_0011622_2593_2772 57
38 3300046691 Ga0495670_0008829 Ga0495670_0008829_2029_2208 57
39 3300046692 Ga0495671_0063051 Ga0495671_0063051_1118_1297 57
40 3300047469 Ga0495673_0019216 Ga0495673_0019216_3139_3318 57
41 3300048903 Ga0496100_0561651 Ga0496100_0561651_324_503 57
42 3300048911 Ga0496108_1257974 Ga0496108_1257974_45_221 57
43 3300048926 Ga0496123_0431617 Ga0496123_0431617_149_328 57
44 3300048927 Ga0496124_0744331 Ga0496124_0744331_113_292 57
45 3300049460 Ga0495682_0008950 Ga0495682_0008950_940_1119 57
46 3300053103 Ga0500555_001780 Ga0500555_001780_2866_3045 57
47 3300061719 Ga0466962_0357974 Ga0466962_0357974_336_515 57
48 3300001904 JGI24736J21556_1000064 JGI24736J21556_100006411 58
49 3300001904 JGI24736J21556_1009108 JGI24736J21556_10091082 58
50 3300001904 JGI24736J21556_1017419 JGI24736J21556_10174192 58
51 3300001915 JGI24741J21665_1001255 JGI24741J21665_10012559 58
52 3300001915 JGI24741J21665_1011514 JGI24741J21665_10115144 58
53 3300001976 JGI24752J21851_1000348 JGI24752J21851_10003481 58
54 3300001976 JGI24752J21851_1000507 JGI24752J21851_10005074 58
55 3300001979 JGI24740J21852_10001392 JGI24740J21852_1000139210 58
56 3300001979 JGI24740J21852_10002955 JGI24740J21852_1000295517 58
57 3300001979 JGI24740J21852_10036607 JGI24740J21852_100366073 58
58 3300001979 JGI24740J21852_10038021 JGI24740J21852_100380212 58
59 3300001979 JGI24740J21852_10120951 JGI24740J21852_101209511 58
60 3300001989 JGI24739J22299_10003209 JGI24739J22299_100032092 58
61 3300001989 JGI24739J22299_10004443 JGI24739J22299_100044432 58
62 3300001989 JGI24739J22299_10009935 JGI24739J22299_100099353 58
63 3300001989 JGI24739J22299_10021051 JGI24739J22299_100210513 58
64 3300001989 JGI24739J22299_10029358 JGI24739J22299_100293583 58
65 3300001989 JGI24739J22299_10051500 JGI24739J22299_100515002 58
66 3300001989 JGI24739J22299_10134404 JGI24739J22299_101344042 58
67 3300001989 JGI24739J22299_10157074 JGI24739J22299_101570742 58
68 3300001990 JGI24737J22298_10001590 JGI24737J22298_100015906 58
69 3300001990 JGI24737J22298_10003732 JGI24737J22298_100037325 58
70 3300001990 JGI24737J22298_10027060 JGI24737J22298_100270602 58
71 3300001990 JGI24737J22298_10036959 JGI24737J22298_100369592 58
72 3300001990 JGI24737J22298_10041158 JGI24737J22298_100411582 58
73 3300001990 JGI24737J22298_10061695 JGI24737J22298_100616952 58
74 3300001990 JGI24737J22298_10068351 JGI24737J22298_100683511 58
75 3300001990 JGI24737J22298_10069519 JGI24737J22298_100695192 58
76 3300001990 JGI24737J22298_10085395 JGI24737J22298_100853952 58
77 3300001990 JGI24737J22298_10117018 JGI24737J22298_101170182 58
78 3300001991 JGI24743J22301_10122747 JGI24743J22301_101227472 58
79 3300002067 JGI24735J21928_10001961 JGI24735J21928_100019616 58
80 3300002067 JGI24735J21928_10013354 JGI24735J21928_100133543 58
81 3300002067 JGI24735J21928_10020484 JGI24735J21928_100204844 58
82 3300002067 JGI24735J21928_10037139 JGI24735J21928_100371392 58
83 3300002067 JGI24735J21928_10050720 JGI24735J21928_100507202 58
84 3300002067 JGI24735J21928_10087919 JGI24735J21928_100879191 58
85 3300002067 JGI24735J21928_10122964 JGI24735J21928_101229642 58
86 3300002067 JGI24735J21928_10251458 JGI24735J21928_102514581 58
87 3300002070 JGI24750J21931_1000199 JGI24750J21931_10001996 58
88 3300002074 JGI24748J21848_1000070 JGI24748J21848_100007043 58
89 3300002074 JGI24748J21848_1012787 JGI24748J21848_10127872 58
90 3300002075 JGI24738J21930_10001288 JGI24738J21930_100012884 58
91 3300002075 JGI24738J21930_10004666 JGI24738J21930_100046662 58
92 3300002075 JGI24738J21930_10132714 JGI24738J21930_101327141 58
93 3300002076 JGI24749J21850_1000118 JGI24749J21850_10001184 58
94 3300002077 JGI24744J21845_10005787 JGI24744J21845_100057873 58
95 3300002155 JGI24033J26618_1073154 JGI24033J26618_10731542 58
96 3300002239 JGI24034J26672_10000038 JGI24034J26672_1000003810 58
97 3300002239 JGI24034J26672_10012171 JGI24034J26672_100121712 58
98 3300002244 JGI24742J22300_10128925 JGI24742J22300_101289252 58
99 3300002459 JGI24751J29686_10000379 JGI24751J29686_1000037912 58
100 3300002741 JGI25157J39369_1026112 JGI25157J39369_10261122 58
101 3300003214 JGI25165J46597_1000021 JGI25165J46597_100002171 58
102 3300003214 JGI25165J46597_1000023 JGI25165J46597_1000023115 58
103 3300003215 JGI25153J46596_10000173 JGI25153J46596_1000017318 58
104 3300003759 Ga0055525_1000012 Ga0055525_1000012132 58
105 3300003762 Ga0055542_1000025 Ga0055542_10000252 58
106 3300003762 Ga0055542_1013672 Ga0055542_10136722 58
107 3300003763 Ga0055529_1000014 Ga0055529_1000014251 58
108 3300003763 Ga0055529_1012053 Ga0055529_10120532 58
109 3300003911 JGI25405J52794_10009841 JGI25405J52794_100098414 58
110 3300005288 Ga0065714_10315197 Ga0065714_103151972 58
111 3300005289 Ga0065704_10278800 Ga0065704_102788001 58
112 3300005289 Ga0065704_10314217 Ga0065704_103142172 58
113 3300005293 Ga0065715_10782746 Ga0065715_107827462 58
114 3300005295 Ga0065707_10000576 Ga0065707_1000057612 58
115 3300005295 Ga0065707_10091874 Ga0065707_100918745 58
116 3300005295 Ga0065707_10211558 Ga0065707_102115582 58
117 3300005295 Ga0065707_10274776 Ga0065707_102747763 58
118 3300005295 Ga0065707_10452404 Ga0065707_104524042 58
119 3300005327 Ga0070658_10001786 Ga0070658_1000178618 58
120 3300005327 Ga0070658_10010598 Ga0070658_100105986 58
121 3300005327 Ga0070658_10293600 Ga0070658_102936002 58
122 3300005327 Ga0070658_10340516 Ga0070658_103405162 58
123 3300005327 Ga0070658_10441688 Ga0070658_104416882 58
124 3300005327 Ga0070658_10661252 Ga0070658_106612522 58
125 3300005327 Ga0070658_10829423 Ga0070658_108294231 58
126 3300005327 Ga0070658_10947640 Ga0070658_109476401 58
127 3300005328 Ga0070676_10209264 Ga0070676_102092641 58
128 3300005328 Ga0070676_10323450 Ga0070676_103234501 58
129 3300005329 Ga0070683_100204503 Ga0070683_1002045032 58
130 3300005329 Ga0070683_100277426 Ga0070683_1002774262 58
131 3300005329 Ga0070683_101594646 Ga0070683_1015946462 58
132 3300005329 Ga0070683_102166812 Ga0070683_1021668122 58
133 3300005330 Ga0070690_100000097 Ga0070690_10000009727 58
134 3300005331 Ga0070670_100000075 Ga0070670_10000007562 58
135 3300005331 Ga0070670_100000093 Ga0070670_1000000939 58
136 3300005331 Ga0070670_100010675 Ga0070670_10001067518 58
137 3300005331 Ga0070670_100093304 Ga0070670_1000933043 58
138 3300005331 Ga0070670_100687098 Ga0070670_1006870981 58
139 3300005333 Ga0070677_10069925 Ga0070677_100699252 58
140 3300005333 Ga0070677_10083489 Ga0070677_100834892 58
141 3300005334 Ga0068869_100000029 Ga0068869_10000002942 58
142 3300005334 Ga0068869_100056174 Ga0068869_1000561741 58
143 3300005334 Ga0068869_100556697 Ga0068869_1005566972 58
144 3300005334 Ga0068869_100619997 Ga0068869_1006199972 58
145 3300005334 Ga0068869_102032265 Ga0068869_1020322651 58
146 3300005335 Ga0070666_10000004 Ga0070666_10000004306 58
147 3300005335 Ga0070666_10150584 Ga0070666_101505843 58
148 3300005335 Ga0070666_10514357 Ga0070666_105143572 58
149 3300005335 Ga0070666_10788306 Ga0070666_107883062 58
150 3300005335 Ga0070666_11000859 Ga0070666_110008592 58
151 3300005336 Ga0070680_100021258 Ga0070680_1000212588 58
152 3300005336 Ga0070680_100933788 Ga0070680_1009337882 58
153 3300005337 Ga0070682_100076023 Ga0070682_1000760233 58
154 3300005337 Ga0070682_100710784 Ga0070682_1007107842 58
155 3300005338 Ga0068868_100003973 Ga0068868_10000397314 58
156 3300005338 Ga0068868_100501188 Ga0068868_1005011882 58
157 3300005338 Ga0068868_100841095 Ga0068868_1008410952 58
158 3300005338 Ga0068868_101749607 Ga0068868_1017496072 58
159 3300005339 Ga0070660_100016618 Ga0070660_1000166182 58
160 3300005339 Ga0070660_100061300 Ga0070660_1000613004 58
161 3300005339 Ga0070660_100125410 Ga0070660_1001254103 58
162 3300005339 Ga0070660_100173748 Ga0070660_1001737482 58
163 3300005339 Ga0070660_100240844 Ga0070660_1002408443 58
164 3300005339 Ga0070660_100286815 Ga0070660_1002868151 58
165 3300005339 Ga0070660_100559437 Ga0070660_1005594372 58
166 3300005339 Ga0070660_100594981 Ga0070660_1005949812 58
167 3300005340 Ga0070689_100050883 Ga0070689_1000508832 58
168 3300005340 Ga0070689_100919983 Ga0070689_1009199832 58
169 3300005341 Ga0070691_10456170 Ga0070691_104561702 58
170 3300005343 Ga0070687_100420059 Ga0070687_1004200592 58
171 3300005344 Ga0070661_100020393 Ga0070661_1000203934 58
172 3300005344 Ga0070661_100031335 Ga0070661_1000313352 58
173 3300005344 Ga0070661_100230723 Ga0070661_1002307233 58
174 3300005344 Ga0070661_100377865 Ga0070661_1003778652 58
175 3300005344 Ga0070661_100808839 Ga0070661_1008088392 58
176 3300005344 Ga0070661_100862778 Ga0070661_1008627782 58
177 3300005344 Ga0070661_101126156 Ga0070661_1011261562 58
178 3300005345 Ga0070692_10841793 Ga0070692_108417931 58
179 3300005347 Ga0070668_100000831 Ga0070668_10000083121 58
180 3300005347 Ga0070668_100017594 Ga0070668_1000175946 58
181 3300005347 Ga0070668_100719613 Ga0070668_1007196132 58
182 3300005347 Ga0070668_100732995 Ga0070668_1007329952 58
183 3300005353 Ga0070669_100000115 Ga0070669_1000001159 58
184 3300005353 Ga0070669_100000296 Ga0070669_10000029627 58
185 3300005353 Ga0070669_100854356 Ga0070669_1008543561 58
186 3300005353 Ga0070669_100934560 Ga0070669_1009345602 58
187 3300005353 Ga0070669_100991154 Ga0070669_1009911542 58
188 3300005354 Ga0070675_100098854 Ga0070675_1000988542 58
189 3300005354 Ga0070675_100126421 Ga0070675_1001264213 58
190 3300005354 Ga0070675_101302178 Ga0070675_1013021782 58
191 3300005355 Ga0070671_100024172 Ga0070671_1000241727 58
192 3300005355 Ga0070671_100145848 Ga0070671_1001458484 58
193 3300005355 Ga0070671_100287990 Ga0070671_1002879902 58
194 3300005355 Ga0070671_100436300 Ga0070671_1004363002 58
195 3300005355 Ga0070671_100488119 Ga0070671_1004881191 58
196 3300005355 Ga0070671_100615864 Ga0070671_1006158642 58
197 3300005356 Ga0070674_100058209 Ga0070674_1000582093 58
198 3300005356 Ga0070674_100829410 Ga0070674_1008294102 58
199 3300005356 Ga0070674_100861718 Ga0070674_1008617181 58
200 3300005364 Ga0070673_100000019 Ga0070673_100000019113 58
201 3300005364 Ga0070673_100286720 Ga0070673_1002867202 58
202 3300005364 Ga0070673_101102375 Ga0070673_1011023752 58
203 3300005364 Ga0070673_101841538 Ga0070673_1018415382 58
204 3300005364 Ga0070673_102297973 Ga0070673_1022979731 58
205 3300005365 Ga0070688_100004740 Ga0070688_1000047402 58
206 3300005365 Ga0070688_100955353 Ga0070688_1009553531 58
207 3300005366 Ga0070659_100095005 Ga0070659_1000950053 58
208 3300005366 Ga0070659_100140885 Ga0070659_1001408852 58
209 3300005366 Ga0070659_100221271 Ga0070659_1002212713 58
210 3300005366 Ga0070659_100222739 Ga0070659_1002227393 58
211 3300005366 Ga0070659_100704189 Ga0070659_1007041892 58
212 3300005366 Ga0070659_101377798 Ga0070659_1013777982 58
213 3300005366 Ga0070659_101819905 Ga0070659_1018199052 58
214 3300005366 Ga0070659_102069681 Ga0070659_1020696811 58
215 3300005367 Ga0070667_100000039 Ga0070667_10000003935 58
216 3300005367 Ga0070667_100013671 Ga0070667_1000136719 58
217 3300005367 Ga0070667_100044820 Ga0070667_1000448203 58
218 3300005367 Ga0070667_100188643 Ga0070667_1001886431 58
219 3300005367 Ga0070667_101768041 Ga0070667_1017680411 58
220 3300005367 Ga0070667_102150848 Ga0070667_1021508481 58
221 3300005438 Ga0070701_10673112 Ga0070701_106731122 58
222 3300005444 Ga0070694_101003286 Ga0070694_1010032861 58
223 3300005455 Ga0070663_100081755 Ga0070663_1000817553 58
224 3300005455 Ga0070663_100148712 Ga0070663_1001487122 58
225 3300005455 Ga0070663_100225700 Ga0070663_1002257003 58
226 3300005455 Ga0070663_100420899 Ga0070663_1004208992 58
227 3300005455 Ga0070663_100669376 Ga0070663_1006693762 58
228 3300005456 Ga0070678_100006601 Ga0070678_10000660115 58
229 3300005456 Ga0070678_100040527 Ga0070678_1000405271 58
230 3300005456 Ga0070678_101189213 Ga0070678_1011892132 58
231 3300005456 Ga0070678_101574103 Ga0070678_1015741032 58
232 3300005457 Ga0070662_100020163 Ga0070662_1000201635 58
233 3300005457 Ga0070662_100024536 Ga0070662_1000245364 58
234 3300005457 Ga0070662_100044582 Ga0070662_1000445822 58
235 3300005457 Ga0070662_100358188 Ga0070662_1003581882 58
236 3300005457 Ga0070662_100377085 Ga0070662_1003770852 58
237 3300005457 Ga0070662_100436172 Ga0070662_1004361721 58
238 3300005457 Ga0070662_100519772 Ga0070662_1005197721 58
239 3300005457 Ga0070662_100811721 Ga0070662_1008117211 58
240 3300005457 Ga0070662_101285102 Ga0070662_1012851021 58
241 3300005457 Ga0070662_101615296 Ga0070662_1016152962 58
242 3300005457 Ga0070662_101777111 Ga0070662_1017771112 58
243 3300005457 Ga0070662_101986251 Ga0070662_1019862511 58
244 3300005458 Ga0070681_10078394 Ga0070681_100783947 58
245 3300005458 Ga0070681_10131424 Ga0070681_101314241 58
246 3300005459 Ga0068867_100000014 Ga0068867_100000014117 58
247 3300005459 Ga0068867_100083516 Ga0068867_1000835161 58
248 3300005459 Ga0068867_101459937 Ga0068867_1014599372 58
249 3300005466 Ga0070685_10000806 Ga0070685_100008069 58
250 3300005467 Ga0070706_101846410 Ga0070706_1018464101 58
251 3300005530 Ga0070679_100000873 Ga0070679_10000087322 58
252 3300005530 Ga0070679_100651895 Ga0070679_1006518952 58
253 3300005530 Ga0070679_101959785 Ga0070679_1019597851 58
254 3300005535 Ga0070684_100136074 Ga0070684_1001360742 58
255 3300005535 Ga0070684_100204115 Ga0070684_1002041154 58
256 3300005535 Ga0070684_101536557 Ga0070684_1015365572 58
257 3300005539 Ga0068853_100000960 Ga0068853_1000009605 58
258 3300005539 Ga0068853_100202129 Ga0068853_1002021292 58
259 3300005539 Ga0068853_100282094 Ga0068853_1002820941 58
260 3300005539 Ga0068853_100306801 Ga0068853_1003068012 58
261 3300005539 Ga0068853_100337575 Ga0068853_1003375752 58
262 3300005539 Ga0068853_100618322 Ga0068853_1006183222 58
263 3300005539 Ga0068853_100656641 Ga0068853_1006566412 58
264 3300005539 Ga0068853_101091271 Ga0068853_1010912712 58
265 3300005539 Ga0068853_102037210 Ga0068853_1020372102 58
266 3300005543 Ga0070672_100182037 Ga0070672_1001820373 58
267 3300005543 Ga0070672_100534380 Ga0070672_1005343802 58
268 3300005544 Ga0070686_100000061 Ga0070686_10000006162 58
269 3300005544 Ga0070686_100006821 Ga0070686_10000682114 58
270 3300005544 Ga0070686_100561102 Ga0070686_1005611022 58
271 3300005544 Ga0070686_101857804 Ga0070686_1018578041 58
272 3300005547 Ga0070693_100211135 Ga0070693_1002111352 58
273 3300005547 Ga0070693_100435491 Ga0070693_1004354911 58
274 3300005547 Ga0070693_100802929 Ga0070693_1008029292 58
275 3300005548 Ga0070665_100000004 Ga0070665_100000004684 58
276 3300005548 Ga0070665_100000109 Ga0070665_10000010919 58
277 3300005548 Ga0070665_100001527 Ga0070665_1000015272 58
278 3300005548 Ga0070665_100010005 Ga0070665_10001000513 58
279 3300005548 Ga0070665_100126607 Ga0070665_1001266072 58
280 3300005548 Ga0070665_100255203 Ga0070665_1002552032 58
281 3300005563 Ga0068855_100010206 Ga0068855_1000102065 58
282 3300005563 Ga0068855_100237795 Ga0068855_1002377952 58
283 3300005563 Ga0068855_100361015 Ga0068855_1003610152 58
284 3300005563 Ga0068855_100456541 Ga0068855_1004565413 58
285 3300005563 Ga0068855_100491032 Ga0068855_1004910322 58
286 3300005563 Ga0068855_100508392 Ga0068855_1005083922 58
287 3300005563 Ga0068855_100822833 Ga0068855_1008228332 58
288 3300005563 Ga0068855_100855046 Ga0068855_1008550462 58
289 3300005563 Ga0068855_101257490 Ga0068855_1012574902 58
290 3300005563 Ga0068855_102579830 Ga0068855_1025798302 58
291 3300005564 Ga0070664_100063876 Ga0070664_1000638763 58
292 3300005564 Ga0070664_100145529 Ga0070664_1001455294 58
293 3300005564 Ga0070664_100698762 Ga0070664_1006987621 58
294 3300005564 Ga0070664_101529857 Ga0070664_1015298572 58
295 3300005564 Ga0070664_101765256 Ga0070664_1017652562 58
296 3300005577 Ga0068857_100055851 Ga0068857_1000558518 58
297 3300005577 Ga0068857_100167943 Ga0068857_1001679432 58
298 3300005577 Ga0068857_100233827 Ga0068857_1002338272 58
299 3300005577 Ga0068857_101240083 Ga0068857_1012400832 58
300 3300005577 Ga0068857_101884696 Ga0068857_1018846962 58
301 3300005578 Ga0068854_100031424 Ga0068854_1000314248 58
302 3300005578 Ga0068854_100074235 Ga0068854_1000742354 58
303 3300005578 Ga0068854_100092457 Ga0068854_1000924573 58
304 3300005578 Ga0068854_100410357 Ga0068854_1004103572 58
305 3300005578 Ga0068854_100465647 Ga0068854_1004656472 58
306 3300005578 Ga0068854_100845579 Ga0068854_1008455792 58
307 3300005578 Ga0068854_101759412 Ga0068854_1017594121 58
308 3300005614 Ga0068856_100262174 Ga0068856_1002621743 58
309 3300005614 Ga0068856_100338965 Ga0068856_1003389652 58
310 3300005614 Ga0068856_100372649 Ga0068856_1003726492 58
311 3300005614 Ga0068856_100443696 Ga0068856_1004436962 58
312 3300005614 Ga0068856_100480227 Ga0068856_1004802271 58
313 3300005614 Ga0068856_100620097 Ga0068856_1006200971 58
314 3300005616 Ga0068852_100185948 Ga0068852_1001859482 58
315 3300005616 Ga0068852_100239696 Ga0068852_1002396964 58
316 3300005616 Ga0068852_100262271 Ga0068852_1002622712 58
317 3300005616 Ga0068852_100443711 Ga0068852_1004437112 58
318 3300005616 Ga0068852_101031550 Ga0068852_1010315501 58
319 3300005616 Ga0068852_101812706 Ga0068852_1018127062 58
320 3300005616 Ga0068852_102499611 Ga0068852_1024996111 58
321 3300005616 Ga0068852_102720078 Ga0068852_1027200781 58
322 3300005617 Ga0068859_100001416 Ga0068859_10000141623 58
323 3300005617 Ga0068859_100009835 Ga0068859_1000098356 58
324 3300005617 Ga0068859_100058681 Ga0068859_1000586811 58
325 3300005617 Ga0068859_100166281 Ga0068859_1001662812 58
326 3300005617 Ga0068859_100173979 Ga0068859_1001739793 58
327 3300005617 Ga0068859_100505472 Ga0068859_1005054722 58
328 3300005617 Ga0068859_100798469 Ga0068859_1007984692 58
329 3300005618 Ga0068864_100000016 Ga0068864_100000016175 58
330 3300005618 Ga0068864_100000087 Ga0068864_1000000879 58
331 3300005618 Ga0068864_100002567 Ga0068864_1000025673 58
332 3300005618 Ga0068864_102434270 Ga0068864_1024342702 58
333 3300005718 Ga0068866_11085482 Ga0068866_110854822 58
334 3300005719 Ga0068861_100000040 Ga0068861_1000000403 58
335 3300005719 Ga0068861_100006640 Ga0068861_10000664013 58
336 3300005719 Ga0068861_100635023 Ga0068861_1006350232 58
337 3300005719 Ga0068861_101939186 Ga0068861_1019391861 58
338 3300005719 Ga0068861_102125254 Ga0068861_1021252542 58
339 3300005834 Ga0068851_10010412 Ga0068851_100104122 58
340 3300005834 Ga0068851_10056665 Ga0068851_100566652 58
341 3300005834 Ga0068851_10329818 Ga0068851_103298182 58
342 3300005834 Ga0068851_11038818 Ga0068851_110388181 58
343 3300005840 Ga0068870_10096183 Ga0068870_100961831 58
344 3300005840 Ga0068870_10558785 Ga0068870_105587852 58
345 3300005841 Ga0068863_100000013 Ga0068863_100000013230 58
346 3300005841 Ga0068863_100000017 Ga0068863_100000017235 58
347 3300005841 Ga0068863_100000033 Ga0068863_10000003329 58
348 3300005841 Ga0068863_100008320 Ga0068863_10000832020 58
349 3300005841 Ga0068863_100140643 Ga0068863_1001406432 58
350 3300005841 Ga0068863_100234419 Ga0068863_1002344193 58
351 3300005841 Ga0068863_100358661 Ga0068863_1003586613 58
352 3300005842 Ga0068858_100000664 Ga0068858_10000066434 58
353 3300005842 Ga0068858_100004566 Ga0068858_1000045664 58
354 3300005842 Ga0068858_100708504 Ga0068858_1007085042 58
355 3300005842 Ga0068858_102283401 Ga0068858_1022834012 58
356 3300005843 Ga0068860_100000009 Ga0068860_100000009305 58
357 3300005843 Ga0068860_100028829 Ga0068860_1000288297 58
358 3300005843 Ga0068860_100053483 Ga0068860_1000534833 58
359 3300005843 Ga0068860_100264367 Ga0068860_1002643672 58
360 3300005844 Ga0068862_100000032 Ga0068862_100000032142 58
361 3300005844 Ga0068862_100000040 Ga0068862_10000004028 58
362 3300005844 Ga0068862_100000466 Ga0068862_1000004669 58
363 3300005844 Ga0068862_100001446 Ga0068862_1000014466 58
364 3300005844 Ga0068862_100105127 Ga0068862_1001051272 58
365 3300005844 Ga0068862_101080627 Ga0068862_1010806272 58
366 3300005937 Ga0081455_10000215 Ga0081455_1000021525 58
367 3300006051 Ga0075364_10001520 Ga0075364_100015204 58
368 3300006051 Ga0075364_11177761 Ga0075364_111777612 58
369 3300006177 Ga0075362_10167624 Ga0075362_101676242 58
370 3300006186 Ga0075369_10031638 Ga0075369_100316382 58
371 3300006186 Ga0075369_10084853 Ga0075369_100848532 58
372 3300006186 Ga0075369_10337703 Ga0075369_103377032 58
373 3300006195 Ga0075366_10130637 Ga0075366_101306373 58
374 3300006195 Ga0075366_10182388 Ga0075366_101823882 58
375 3300006195 Ga0075366_10233689 Ga0075366_102336892 58
376 3300006195 Ga0075366_10759202 Ga0075366_107592022 58
377 3300006195 Ga0075366_11042173 Ga0075366_110421732 58
378 3300006237 Ga0097621_100240098 Ga0097621_1002400982 58
379 3300006237 Ga0097621_101343528 Ga0097621_1013435282 58
380 3300006237 Ga0097621_101467576 Ga0097621_1014675762 58
381 3300006237 Ga0097621_101723020 Ga0097621_1017230202 58
382 3300006237 Ga0097621_101868557 Ga0097621_1018685572 58
383 3300006237 Ga0097621_102103718 Ga0097621_1021037182 58
384 3300006353 Ga0075370_10008629 Ga0075370_100086297 58
385 3300006353 Ga0075370_10023057 Ga0075370_100230574 58
386 3300006353 Ga0075370_10412683 Ga0075370_104126832 58
387 3300006353 Ga0075370_10664875 Ga0075370_106648752 58
388 3300006358 Ga0068871_100261117 Ga0068871_1002611172 58
389 3300006358 Ga0068871_100587711 Ga0068871_1005877112 58
390 3300006358 Ga0068871_101186315 Ga0068871_1011863152 58
391 3300006846 Ga0075430_101078196 Ga0075430_1010781961 58
392 3300006871 Ga0075434_100255877 Ga0075434_1002558773 58
393 3300006881 Ga0068865_100000018 Ga0068865_1000000183 58
394 3300006931 Ga0097620_100001416 Ga0097620_10000141619 58
395 3300006931 Ga0097620_100009835 Ga0097620_1000098359 58
396 3300006931 Ga0097620_100058681 Ga0097620_1000586819 58
397 3300006931 Ga0097620_100166292 Ga0097620_1001662922 58
398 3300006931 Ga0097620_100173972 Ga0097620_1001739723 58
399 3300006931 Ga0097620_100505473 Ga0097620_1005054732 58
400 3300006931 Ga0097620_100798483 Ga0097620_1007984832 58
401 3300009011 Ga0105251_10004716 Ga0105251_1000471618 58
402 3300009011 Ga0105251_10155260 Ga0105251_101552602 58
403 3300009036 Ga0105244_10297884 Ga0105244_102978841 58
404 3300009093 Ga0105240_10001116 Ga0105240_1000111647 58
405 3300009093 Ga0105240_10024394 Ga0105240_100243948 58
406 3300009093 Ga0105240_10191747 Ga0105240_101917472 58
407 3300009093 Ga0105240_10610797 Ga0105240_106107971 58
408 3300009093 Ga0105240_10749955 Ga0105240_107499552 58
409 3300009093 Ga0105240_12393971 Ga0105240_123939712 58
410 3300009093 Ga0105240_12490842 Ga0105240_124908422 58
411 3300009098 Ga0105245_10002967 Ga0105245_100029672 58
412 3300009098 Ga0105245_10005275 Ga0105245_100052755 58
413 3300009098 Ga0105245_10406216 Ga0105245_104062162 58
414 3300009098 Ga0105245_11568913 Ga0105245_115689132 58
415 3300009101 Ga0105247_10018821 Ga0105247_100188212 58
416 3300009101 Ga0105247_10086839 Ga0105247_100868394 58
417 3300009101 Ga0105247_10091941 Ga0105247_100919412 58
418 3300009148 Ga0105243_10000076 Ga0105243_1000007612 58
419 3300009148 Ga0105243_10003106 Ga0105243_100031068 58
420 3300009148 Ga0105243_10358718 Ga0105243_103587182 58
421 3300009148 Ga0105243_10522486 Ga0105243_105224862 58
422 3300009148 Ga0105243_10693651 Ga0105243_106936512 58
423 3300009148 Ga0105243_11675996 Ga0105243_116759961 58
424 3300009148 Ga0105243_11796911 Ga0105243_117969111 58
425 3300009148 Ga0105243_13135099 Ga0105243_131350992 58
426 3300009174 Ga0105241_10004308 Ga0105241_1000430818 58
427 3300009174 Ga0105241_10090211 Ga0105241_100902114 58
428 3300009174 Ga0105241_10407073 Ga0105241_104070732 58
429 3300009174 Ga0105241_10417038 Ga0105241_104170382 58
430 3300009174 Ga0105241_11874660 Ga0105241_118746601 58
431 3300009174 Ga0105241_11879984 Ga0105241_118799842 58
432 3300009176 Ga0105242_10009804 Ga0105242_1000980412 58
433 3300009176 Ga0105242_11353886 Ga0105242_113538862 58
434 3300009177 Ga0105248_10000021 Ga0105248_10000021141 58
435 3300009177 Ga0105248_10003987 Ga0105248_1000398715 58
436 3300009177 Ga0105248_10006062 Ga0105248_100060628 58
437 3300009177 Ga0105248_10008689 Ga0105248_100086897 58
438 3300009177 Ga0105248_10255282 Ga0105248_102552823 58
439 3300009177 Ga0105248_10504523 Ga0105248_105045231 58
440 3300009545 Ga0105237_10011259 Ga0105237_100112594 58
441 3300009545 Ga0105237_10045964 Ga0105237_100459647 58
442 3300009545 Ga0105237_10082257 Ga0105237_100822573 58
443 3300009545 Ga0105237_10114196 Ga0105237_101141963 58
444 3300009545 Ga0105237_10200169 Ga0105237_102001692 58
445 3300009545 Ga0105237_11204749 Ga0105237_112047492 58
446 3300009545 Ga0105237_11486404 Ga0105237_114864041 58
447 3300009545 Ga0105237_12270548 Ga0105237_122705481 58
448 3300009551 Ga0105238_10103849 Ga0105238_101038493 58
449 3300009551 Ga0105238_10108749 Ga0105238_101087493 58
450 3300009551 Ga0105238_10138886 Ga0105238_101388862 58
451 3300009551 Ga0105238_10157495 Ga0105238_101574953 58
452 3300009551 Ga0105238_10214234 Ga0105238_102142341 58
453 3300009551 Ga0105238_10373621 Ga0105238_103736214 58
454 3300009551 Ga0105238_10421717 Ga0105238_104217172 58
455 3300009551 Ga0105238_10521037 Ga0105238_105210372 58
456 3300009551 Ga0105238_10843372 Ga0105238_108433722 58
457 3300009551 Ga0105238_11477082 Ga0105238_114770822 58
458 3300009551 Ga0105238_12385496 Ga0105238_123854962 58
459 3300009551 Ga0105238_12416452 Ga0105238_124164522 58
460 3300009551 Ga0105238_12548021 Ga0105238_125480212 58
461 3300009551 Ga0105238_12971625 Ga0105238_129716252 58
462 3300009553 Ga0105249_10000006 Ga0105249_1000000659 58
463 3300009553 Ga0105249_10000017 Ga0105249_10000017139 58
464 3300009553 Ga0105249_10001881 Ga0105249_1000188112 58
465 3300009553 Ga0105249_10203829 Ga0105249_102038292 58
466 3300009553 Ga0105249_10249779 Ga0105249_102497793 58
467 3300009553 Ga0105249_12218491 Ga0105249_122184912 58
468 3300010375 Ga0105239_10000546 Ga0105239_1000054649 58
469 3300010375 Ga0105239_10070988 Ga0105239_100709883 58
470 3300010375 Ga0105239_10379102 Ga0105239_103791023 58
471 3300010375 Ga0105239_11008231 Ga0105239_110082312 58
472 3300010375 Ga0105239_11166215 Ga0105239_111662152 58
473 3300010375 Ga0105239_12076595 Ga0105239_120765952 58
474 3300010375 Ga0105239_12764741 Ga0105239_127647412 58
475 3300010375 Ga0105239_13631876 Ga0105239_136318762 58
476 3300011119 Ga0105246_10161931 Ga0105246_101619312 58
477 3300011119 Ga0105246_10851547 Ga0105246_108515472 58
478 3300011119 Ga0105246_11219958 Ga0105246_112199582 58
479 3300012475 Ga0157317_1023388 Ga0157317_10233882 58
480 3300012508 Ga0157315_1007765 Ga0157315_10077652 58
481 3300012513 Ga0157326_1079519 Ga0157326_10795191 58
482 3300013100 Ga0157373_10081148 Ga0157373_100811482 58
483 3300013100 Ga0157373_10660838 Ga0157373_106608382 58
484 3300013100 Ga0157373_10662801 Ga0157373_106628012 58
485 3300013100 Ga0157373_10798128 Ga0157373_107981282 58
486 3300013100 Ga0157373_11528879 Ga0157373_115288791 58
487 3300013102 Ga0157371_10000059 Ga0157371_1000005921 58
488 3300013102 Ga0157371_10089328 Ga0157371_100893282 58
489 3300013102 Ga0157371_10342701 Ga0157371_103427012 58
490 3300013102 Ga0157371_10606382 Ga0157371_106063822 58
491 3300013104 Ga0157370_10327199 Ga0157370_103271991 58
492 3300013104 Ga0157370_10370331 Ga0157370_103703312 58
493 3300013104 Ga0157370_10415992 Ga0157370_104159923 58
494 3300013104 Ga0157370_11249102 Ga0157370_112491022 58
495 3300013105 Ga0157369_10073353 Ga0157369_100733533 58
496 3300013105 Ga0157369_10083235 Ga0157369_100832353 58
497 3300013105 Ga0157369_10211906 Ga0157369_102119062 58
498 3300013105 Ga0157369_10281167 Ga0157369_102811672 58
499 3300013105 Ga0157369_10298220 Ga0157369_102982201 58
500 3300013105 Ga0157369_10312143 Ga0157369_103121433 58
501 3300013105 Ga0157369_10444995 Ga0157369_104449953 58
502 3300013105 Ga0157369_10840300 Ga0157369_108403002 58
503 3300013105 Ga0157369_11229243 Ga0157369_112292432 58
504 3300013105 Ga0157369_11658669 Ga0157369_116586691 58
505 3300013105 Ga0157369_12017709 Ga0157369_120177092 58
506 3300013105 Ga0157369_12583312 Ga0157369_125833122 58
507 3300013296 Ga0157374_10412425 Ga0157374_104124252 58
508 3300013297 Ga0157378_10000504 Ga0157378_1000050445 58
509 3300013297 Ga0157378_10107742 Ga0157378_101077422 58
510 3300013297 Ga0157378_10539715 Ga0157378_105397152 58
511 3300013297 Ga0157378_10950271 Ga0157378_109502712 58
512 3300013297 Ga0157378_11480740 Ga0157378_114807402 58
513 3300013297 Ga0157378_11587366 Ga0157378_115873662 58
514 3300013306 Ga0163162_10092290 Ga0163162_100922907 58
515 3300013306 Ga0163162_10421093 Ga0163162_104210932 58
516 3300013306 Ga0163162_11521886 Ga0163162_115218862 58
517 3300013306 Ga0163162_12218841 Ga0163162_122188412 58
518 3300013307 Ga0157372_10573559 Ga0157372_105735591 58
519 3300013307 Ga0157372_11126859 Ga0157372_111268592 58
520 3300013307 Ga0157372_11317178 Ga0157372_113171782 58
521 3300013307 Ga0157372_11994999 Ga0157372_119949992 58
522 3300013307 Ga0157372_12178074 Ga0157372_121780742 58
523 3300013308 Ga0157375_10082591 Ga0157375_100825917 58
524 3300013308 Ga0157375_10446526 Ga0157375_104465262 58
525 3300013308 Ga0157375_11409902 Ga0157375_114099022 58
526 3300013308 Ga0157375_13608339 Ga0157375_136083392 58
527 3300014325 Ga0163163_10465584 Ga0163163_104655842 58
528 3300014325 Ga0163163_11563685 Ga0163163_115636852 58
529 3300014325 Ga0163163_11777425 Ga0163163_117774251 58
530 3300014325 Ga0163163_12645250 Ga0163163_126452501 58
531 3300014326 Ga0157380_10000157 Ga0157380_1000015715 58
532 3300014326 Ga0157380_10002166 Ga0157380_100021668 58
533 3300014326 Ga0157380_10006678 Ga0157380_100066787 58
534 3300014326 Ga0157380_10812507 Ga0157380_108125072 58
535 3300014326 Ga0157380_11992912 Ga0157380_119929122 58
536 3300014497 Ga0182008_10166668 Ga0182008_101666682 58
537 3300014745 Ga0157377_10082035 Ga0157377_100820353 58
538 3300014745 Ga0157377_10180500 Ga0157377_101805002 58
539 3300014745 Ga0157377_10583524 Ga0157377_105835242 58
540 3300014968 Ga0157379_10001735 Ga0157379_1000173527 58
541 3300014968 Ga0157379_10051816 Ga0157379_100518163 58
542 3300014968 Ga0157379_11466984 Ga0157379_114669842 58
543 3300014968 Ga0157379_12505109 Ga0157379_125051092 58
544 3300014969 Ga0157376_10000092 Ga0157376_1000009244 58
545 3300014969 Ga0157376_10492886 Ga0157376_104928862 58
546 3300014969 Ga0157376_10716193 Ga0157376_107161932 58
547 3300014969 Ga0157376_11441483 Ga0157376_114414832 58
548 3300014969 Ga0157376_11622424 Ga0157376_116224242 58
549 3300015689 Ga0183360_10368 Ga0183360_103682 58
550 3300015690 Ga0183363_1006 Ga0183363_100629 58
551 3300017792 Ga0163161_10000208 Ga0163161_1000020821 58
552 3300017792 Ga0163161_10144828 Ga0163161_101448283 58
553 3300017792 Ga0163161_10167645 Ga0163161_101676453 58
554 3300017792 Ga0163161_10541954 Ga0163161_105419542 58
555 3300017792 Ga0163161_10943367 Ga0163161_109433672 58
556 3300020069 Ga0197907_10274206 Ga0197907_102742061 58
557 3300020070 Ga0206356_10317151 Ga0206356_103171512 58
558 3300020075 Ga0206349_1668694 Ga0206349_16686942 58
559 3300020082 Ga0206353_11808888 Ga0206353_118088884 58
560 3300021384 Ga0213876_10016636 Ga0213876_100166369 58
561 3300025226 Ga0209674_101560 Ga0209674_1015603 58
562 3300025230 Ga0209563_100030 Ga0209563_100030316 58
563 3300025231 Ga0207427_104026 Ga0207427_1040263 58
564 3300025233 Ga0209437_123370 Ga0209437_1233702 58
565 3300025246 Ga0209646_1020951 Ga0209646_10209512 58
566 3300025250 Ga0209026_1000352 Ga0209026_100035237 58
567 3300025250 Ga0209026_1013989 Ga0209026_10139892 58
568 3300025250 Ga0209026_1031029 Ga0209026_10310292 58
569 3300025253 Ga0209677_105325 Ga0209677_1053257 58
570 3300025254 Ga0209148_1000011 Ga0209148_1000011255 58
571 3300025254 Ga0209148_1000243 Ga0209148_100024393 58
572 3300025254 Ga0209148_1005193 Ga0209148_10051934 58
573 3300025261 Ga0209233_1000003 Ga0209233_1000003954 58
574 3300025261 Ga0209233_1000065 Ga0209233_100006571 58
575 3300025261 Ga0209233_1006188 Ga0209233_10061883 58
576 3300025272 Ga0209455_1000006 Ga0209455_1000006939 58
577 3300025272 Ga0209455_1002555 Ga0209455_10025555 58
578 3300025272 Ga0209455_1031389 Ga0209455_10313892 58
579 3300025297 Ga0209758_1000001 Ga0209758_1000001643 58
580 3300025297 Ga0209758_1169594 Ga0209758_11695942 58
581 3300025298 Ga0209050_1035962 Ga0209050_10359622 58
582 3300025302 Ga0207426_1140179 Ga0207426_11401792 58
583 3300025321 Ga0207656_10004180 Ga0207656_100041805 58
584 3300025321 Ga0207656_10023916 Ga0207656_100239163 58
585 3300025321 Ga0207656_10229427 Ga0207656_102294272 58
586 3300025321 Ga0207656_10302528 Ga0207656_103025281 58
587 3300025893 Ga0207682_10001453 Ga0207682_100014532 58
588 3300025893 Ga0207682_10407906 Ga0207682_104079062 58
589 3300025893 Ga0207682_10474015 Ga0207682_104740152 58
590 3300025898 Ga0207692_10992207 Ga0207692_109922071 58
591 3300025899 Ga0207642_10869034 Ga0207642_108690342 58
592 3300025900 Ga0207710_10004955 Ga0207710_100049554 58
593 3300025900 Ga0207710_10008017 Ga0207710_100080172 58
594 3300025900 Ga0207710_10066752 Ga0207710_100667521 58
595 3300025901 Ga0207688_10302991 Ga0207688_103029912 58
596 3300025901 Ga0207688_10449418 Ga0207688_104494181 58
597 3300025901 Ga0207688_11080046 Ga0207688_110800461 58
598 3300025903 Ga0207680_10000010 Ga0207680_10000010102 58
599 3300025903 Ga0207680_10559990 Ga0207680_105599902 58
600 3300025903 Ga0207680_10775750 Ga0207680_107757502 58
601 3300025903 Ga0207680_10792934 Ga0207680_107929342 58
602 3300025903 Ga0207680_11343394 Ga0207680_113433941 58
603 3300025904 Ga0207647_10000069 Ga0207647_1000006912 58
604 3300025904 Ga0207647_10009251 Ga0207647_100092512 58
605 3300025904 Ga0207647_10035876 Ga0207647_100358764 58
606 3300025904 Ga0207647_10068151 Ga0207647_100681512 58
607 3300025904 Ga0207647_10137710 Ga0207647_101377103 58
608 3300025904 Ga0207647_10168495 Ga0207647_101684952 58
609 3300025907 Ga0207645_10014111 Ga0207645_100141117 58
610 3300025907 Ga0207645_10021253 Ga0207645_100212539 58
611 3300025907 Ga0207645_10372006 Ga0207645_103720062 58
612 3300025909 Ga0207705_10000084 Ga0207705_10000084123 58
613 3300025909 Ga0207705_10000243 Ga0207705_1000024317 58
614 3300025909 Ga0207705_10000511 Ga0207705_100005113 58
615 3300025909 Ga0207705_10002954 Ga0207705_1000295422 58
616 3300025909 Ga0207705_10049162 Ga0207705_100491622 58
617 3300025909 Ga0207705_10841844 Ga0207705_108418442 58
618 3300025909 Ga0207705_10862539 Ga0207705_108625392 58
619 3300025909 Ga0207705_11032938 Ga0207705_110329382 58
620 3300025910 Ga0207684_11444845 Ga0207684_114448452 58
621 3300025911 Ga0207654_10000796 Ga0207654_1000079610 58
622 3300025911 Ga0207654_10000810 Ga0207654_100008104 58
623 3300025911 Ga0207654_10195143 Ga0207654_101951432 58
624 3300025912 Ga0207707_10045078 Ga0207707_100450781 58
625 3300025913 Ga0207695_10000288 Ga0207695_10000288116 58
626 3300025913 Ga0207695_10003496 Ga0207695_1000349610 58
627 3300025913 Ga0207695_10006167 Ga0207695_100061675 58
628 3300025913 Ga0207695_10095035 Ga0207695_100950353 58
629 3300025913 Ga0207695_10103895 Ga0207695_101038955 58
630 3300025913 Ga0207695_10171402 Ga0207695_101714022 58
631 3300025914 Ga0207671_10002884 Ga0207671_1000288411 58
632 3300025914 Ga0207671_10003173 Ga0207671_1000317322 58
633 3300025914 Ga0207671_10022700 Ga0207671_100227009 58
634 3300025914 Ga0207671_10182611 Ga0207671_101826112 58
635 3300025917 Ga0207660_10001492 Ga0207660_100014928 58
636 3300025917 Ga0207660_11185096 Ga0207660_111850962 58
637 3300025919 Ga0207657_10028620 Ga0207657_100286207 58
638 3300025919 Ga0207657_10028866 Ga0207657_100288666 58
639 3300025919 Ga0207657_10028985 Ga0207657_100289856 58
640 3300025919 Ga0207657_10048886 Ga0207657_100488862 58
641 3300025919 Ga0207657_10085735 Ga0207657_100857352 58
642 3300025919 Ga0207657_10139728 Ga0207657_101397283 58
643 3300025919 Ga0207657_10214187 Ga0207657_102141873 58
644 3300025919 Ga0207657_10232634 Ga0207657_102326342 58
645 3300025919 Ga0207657_10276144 Ga0207657_102761442 58
646 3300025919 Ga0207657_10495134 Ga0207657_104951342 58
647 3300025919 Ga0207657_10632222 Ga0207657_106322222 58
648 3300025920 Ga0207649_10000212 Ga0207649_100002129 58
649 3300025920 Ga0207649_10003617 Ga0207649_100036175 58
650 3300025920 Ga0207649_10103905 Ga0207649_101039051 58
651 3300025920 Ga0207649_10197129 Ga0207649_101971292 58
652 3300025920 Ga0207649_10395053 Ga0207649_103950532 58
653 3300025920 Ga0207649_11186539 Ga0207649_111865392 58
654 3300025921 Ga0207652_10000008 Ga0207652_1000000811 58
655 3300025921 Ga0207652_10502029 Ga0207652_105020292 58
656 3300025923 Ga0207681_10000005 Ga0207681_1000000554 58
657 3300025923 Ga0207681_10000197 Ga0207681_1000019711 58
658 3300025923 Ga0207681_10684161 Ga0207681_106841612 58
659 3300025923 Ga0207681_11150961 Ga0207681_111509612 58
660 3300025924 Ga0207694_10002782 Ga0207694_1000278222 58
661 3300025924 Ga0207694_10016018 Ga0207694_100160185 58
662 3300025924 Ga0207694_10049198 Ga0207694_100491983 58
663 3300025924 Ga0207694_10124310 Ga0207694_101243104 58
664 3300025924 Ga0207694_10363345 Ga0207694_103633452 58
665 3300025924 Ga0207694_10382618 Ga0207694_103826182 58
666 3300025924 Ga0207694_11014525 Ga0207694_110145252 58
667 3300025924 Ga0207694_11894867 Ga0207694_118948672 58
668 3300025925 Ga0207650_10000004 Ga0207650_10000004667 58
669 3300025925 Ga0207650_10000069 Ga0207650_10000069101 58
670 3300025925 Ga0207650_10068635 Ga0207650_100686354 58
671 3300025925 Ga0207650_10208243 Ga0207650_102082433 58
672 3300025925 Ga0207650_10218925 Ga0207650_102189253 58
673 3300025926 Ga0207659_10009064 Ga0207659_100090643 58
674 3300025926 Ga0207659_10396469 Ga0207659_103964691 58
675 3300025926 Ga0207659_11003722 Ga0207659_110037222 58
676 3300025926 Ga0207659_11019975 Ga0207659_110199752 58
677 3300025927 Ga0207687_10003114 Ga0207687_1000311414 58
678 3300025927 Ga0207687_10079745 Ga0207687_100797452 58
679 3300025927 Ga0207687_10236428 Ga0207687_102364282 58
680 3300025927 Ga0207687_11118299 Ga0207687_111182992 58
681 3300025931 Ga0207644_10000145 Ga0207644_1000014554 58
682 3300025931 Ga0207644_10058536 Ga0207644_100585362 58
683 3300025931 Ga0207644_10163232 Ga0207644_101632322 58
684 3300025931 Ga0207644_10312997 Ga0207644_103129972 58
685 3300025931 Ga0207644_10611291 Ga0207644_106112912 58
686 3300025932 Ga0207690_10004341 Ga0207690_100043419 58
687 3300025932 Ga0207690_10066595 Ga0207690_100665953 58
688 3300025932 Ga0207690_10075431 Ga0207690_100754313 58
689 3300025932 Ga0207690_10480941 Ga0207690_104809412 58
690 3300025932 Ga0207690_10666319 Ga0207690_106663192 58
691 3300025932 Ga0207690_10725464 Ga0207690_107254642 58
692 3300025932 Ga0207690_11366109 Ga0207690_113661091 58
693 3300025933 Ga0207706_10022259 Ga0207706_100222594 58
694 3300025933 Ga0207706_10041508 Ga0207706_100415088 58
695 3300025933 Ga0207706_10180514 Ga0207706_101805142 58
696 3300025933 Ga0207706_10181057 Ga0207706_101810573 58
697 3300025933 Ga0207706_10229574 Ga0207706_102295743 58
698 3300025933 Ga0207706_10310239 Ga0207706_103102392 58
699 3300025933 Ga0207706_10344241 Ga0207706_103442412 58
700 3300025933 Ga0207706_10361163 Ga0207706_103611632 58
701 3300025933 Ga0207706_10702569 Ga0207706_107025691 58
702 3300025933 Ga0207706_10946056 Ga0207706_109460562 58
703 3300025933 Ga0207706_11181552 Ga0207706_111815521 58
704 3300025934 Ga0207686_10004287 Ga0207686_100042875 58
705 3300025934 Ga0207686_10156000 Ga0207686_101560002 58
706 3300025934 Ga0207686_11396709 Ga0207686_113967092 58
707 3300025935 Ga0207709_10000114 Ga0207709_1000011429 58
708 3300025935 Ga0207709_10000246 Ga0207709_1000024684 58
709 3300025935 Ga0207709_10462012 Ga0207709_104620122 58
710 3300025935 Ga0207709_10550523 Ga0207709_105505232 58
711 3300025935 Ga0207709_10703101 Ga0207709_107031012 58
712 3300025936 Ga0207670_10017586 Ga0207670_100175863 58
713 3300025936 Ga0207670_11740647 Ga0207670_117406471 58
714 3300025937 Ga0207669_10005822 Ga0207669_100058226 58
715 3300025937 Ga0207669_10017734 Ga0207669_100177345 58
716 3300025937 Ga0207669_10629947 Ga0207669_106299472 58
717 3300025937 Ga0207669_10946787 Ga0207669_109467872 58
718 3300025938 Ga0207704_10000008 Ga0207704_10000008113 58
719 3300025940 Ga0207691_10125275 Ga0207691_101252752 58
720 3300025940 Ga0207691_10473191 Ga0207691_104731912 58
721 3300025940 Ga0207691_10492740 Ga0207691_104927402 58
722 3300025940 Ga0207691_11152377 Ga0207691_111523772 58
723 3300025940 Ga0207691_11629418 Ga0207691_116294182 58
724 3300025941 Ga0207711_10000025 Ga0207711_10000025155 58
725 3300025941 Ga0207711_10001472 Ga0207711_1000147218 58
726 3300025941 Ga0207711_10005846 Ga0207711_100058469 58
727 3300025941 Ga0207711_10006762 Ga0207711_100067623 58
728 3300025941 Ga0207711_10015720 Ga0207711_100157203 58
729 3300025942 Ga0207689_10000608 Ga0207689_1000060837 58
730 3300025942 Ga0207689_10099854 Ga0207689_100998545 58
731 3300025942 Ga0207689_10280169 Ga0207689_102801693 58
732 3300025942 Ga0207689_10392332 Ga0207689_103923322 58
733 3300025942 Ga0207689_10716978 Ga0207689_107169782 58
734 3300025944 Ga0207661_10236839 Ga0207661_102368393 58
735 3300025944 Ga0207661_10536130 Ga0207661_105361302 58
736 3300025944 Ga0207661_10638479 Ga0207661_106384792 58
737 3300025944 Ga0207661_11430975 Ga0207661_114309752 58
738 3300025945 Ga0207679_10050964 Ga0207679_100509643 58
739 3300025945 Ga0207679_10157897 Ga0207679_101578972 58
740 3300025945 Ga0207679_10378715 Ga0207679_103787152 58
741 3300025945 Ga0207679_11301270 Ga0207679_113012702 58
742 3300025945 Ga0207679_11432425 Ga0207679_114324252 58
743 3300025949 Ga0207667_10000002 Ga0207667_10000002137 58
744 3300025949 Ga0207667_10000024 Ga0207667_10000024341 58
745 3300025949 Ga0207667_10004183 Ga0207667_1000418322 58
746 3300025949 Ga0207667_10206634 Ga0207667_102066343 58
747 3300025949 Ga0207667_10491059 Ga0207667_104910591 58
748 3300025949 Ga0207667_10553369 Ga0207667_105533692 58
749 3300025949 Ga0207667_10686476 Ga0207667_106864762 58
750 3300025949 Ga0207667_11598959 Ga0207667_115989592 58
751 3300025960 Ga0207651_10000008 Ga0207651_10000008111 58
752 3300025960 Ga0207651_10486602 Ga0207651_104866022 58
753 3300025960 Ga0207651_11659456 Ga0207651_116594562 58
754 3300025960 Ga0207651_11838274 Ga0207651_118382742 58
755 3300025961 Ga0207712_10000012 Ga0207712_10000012210 58
756 3300025961 Ga0207712_10000014 Ga0207712_10000014305 58
757 3300025961 Ga0207712_10005054 Ga0207712_1000505411 58
758 3300025961 Ga0207712_10074681 Ga0207712_100746813 58
759 3300025961 Ga0207712_10124290 Ga0207712_101242903 58
760 3300025972 Ga0207668_10000113 Ga0207668_100001133 58
761 3300025972 Ga0207668_10017274 Ga0207668_100172744 58
762 3300025972 Ga0207668_10817192 Ga0207668_108171921 58
763 3300025972 Ga0207668_11440424 Ga0207668_114404242 58
764 3300025972 Ga0207668_11921966 Ga0207668_119219661 58
765 3300025981 Ga0207640_10002027 Ga0207640_1000202720 58
766 3300025981 Ga0207640_10013183 Ga0207640_100131832 58
767 3300025981 Ga0207640_10100085 Ga0207640_101000853 58
768 3300025981 Ga0207640_10440941 Ga0207640_104409413 58
769 3300025981 Ga0207640_10608503 Ga0207640_106085032 58
770 3300025981 Ga0207640_10998134 Ga0207640_109981342 58
771 3300025981 Ga0207640_11205523 Ga0207640_112055232 58
772 3300025986 Ga0207658_10000428 Ga0207658_1000042813 58
773 3300025986 Ga0207658_10009141 Ga0207658_100091419 58
774 3300025986 Ga0207658_10010246 Ga0207658_100102465 58
775 3300025986 Ga0207658_11843379 Ga0207658_118433791 58
776 3300026023 Ga0207677_10000091 Ga0207677_1000009192 58
777 3300026023 Ga0207677_11302107 Ga0207677_113021072 58
778 3300026023 Ga0207677_11497990 Ga0207677_114979902 58
779 3300026035 Ga0207703_10002426 Ga0207703_100024266 58
780 3300026035 Ga0207703_10003828 Ga0207703_100038287 58
781 3300026035 Ga0207703_10994092 Ga0207703_109940921 58
782 3300026041 Ga0207639_10003616 Ga0207639_100036164 58
783 3300026041 Ga0207639_10013397 Ga0207639_100133972 58
784 3300026041 Ga0207639_10020428 Ga0207639_100204282 58
785 3300026041 Ga0207639_10020539 Ga0207639_100205394 58
786 3300026041 Ga0207639_10041198 Ga0207639_100411985 58
787 3300026041 Ga0207639_10119130 Ga0207639_101191302 58
788 3300026041 Ga0207639_10200720 Ga0207639_102007203 58
789 3300026041 Ga0207639_10272272 Ga0207639_102722722 58
790 3300026041 Ga0207639_10307772 Ga0207639_103077722 58
791 3300026041 Ga0207639_11098996 Ga0207639_110989962 58
792 3300026041 Ga0207639_11296198 Ga0207639_112961982 58
793 3300026067 Ga0207678_10004876 Ga0207678_1000487621 58
794 3300026067 Ga0207678_10016489 Ga0207678_100164896 58
795 3300026067 Ga0207678_10175338 Ga0207678_101753383 58
796 3300026067 Ga0207678_10301146 Ga0207678_103011463 58
797 3300026067 Ga0207678_10703703 Ga0207678_107037032 58
798 3300026067 Ga0207678_10909510 Ga0207678_109095102 58
799 3300026078 Ga0207702_10003021 Ga0207702_1000302122 58
800 3300026078 Ga0207702_10005062 Ga0207702_1000506218 58
801 3300026078 Ga0207702_10153725 Ga0207702_101537253 58
802 3300026078 Ga0207702_10192692 Ga0207702_101926922 58
803 3300026078 Ga0207702_10210284 Ga0207702_102102842 58
804 3300026078 Ga0207702_10274235 Ga0207702_102742353 58
805 3300026088 Ga0207641_10000002 Ga0207641_1000000229 58
806 3300026088 Ga0207641_10000036 Ga0207641_10000036230 58
807 3300026088 Ga0207641_10000099 Ga0207641_1000009919 58
808 3300026088 Ga0207641_10006011 Ga0207641_100060117 58
809 3300026088 Ga0207641_10112331 Ga0207641_101123312 58
810 3300026088 Ga0207641_10223420 Ga0207641_102234203 58
811 3300026088 Ga0207641_11260024 Ga0207641_112600242 58
812 3300026089 Ga0207648_10000009 Ga0207648_10000009111 58
813 3300026089 Ga0207648_10014717 Ga0207648_100147179 58
814 3300026089 Ga0207648_10603009 Ga0207648_106030092 58
815 3300026089 Ga0207648_10787837 Ga0207648_107878372 58
816 3300026095 Ga0207676_10000006 Ga0207676_1000000645 58
817 3300026095 Ga0207676_10000044 Ga0207676_10000044159 58
818 3300026095 Ga0207676_10001345 Ga0207676_1000134525 58
819 3300026095 Ga0207676_10922563 Ga0207676_109225632 58
820 3300026095 Ga0207676_12417247 Ga0207676_124172471 58
821 3300026116 Ga0207674_10017839 Ga0207674_100178397 58
822 3300026116 Ga0207674_10050570 Ga0207674_100505707 58
823 3300026116 Ga0207674_10423883 Ga0207674_104238833 58
824 3300026116 Ga0207674_10536182 Ga0207674_105361821 58
825 3300026116 Ga0207674_11775389 Ga0207674_117753891 58
826 3300026116 Ga0207674_12056820 Ga0207674_120568202 58
827 3300026118 Ga0207675_100000157 Ga0207675_10000015766 58
828 3300026118 Ga0207675_100001117 Ga0207675_10000111715 58
829 3300026118 Ga0207675_100015082 Ga0207675_1000150822 58
830 3300026118 Ga0207675_100318652 Ga0207675_1003186522 58
831 3300026118 Ga0207675_102043211 Ga0207675_1020432112 58
832 3300026121 Ga0207683_10004633 Ga0207683_1000463312 58
833 3300026121 Ga0207683_10006500 Ga0207683_1000650019 58
834 3300026121 Ga0207683_10701972 Ga0207683_107019722 58
835 3300026121 Ga0207683_11689544 Ga0207683_116895441 58
836 3300026142 Ga0207698_10002491 Ga0207698_100024914 58
837 3300026142 Ga0207698_10005844 Ga0207698_1000584410 58
838 3300026142 Ga0207698_10215161 Ga0207698_102151612 58
839 3300026142 Ga0207698_10235827 Ga0207698_102358274 58
840 3300026142 Ga0207698_10308204 Ga0207698_103082042 58
841 3300026142 Ga0207698_10579932 Ga0207698_105799322 58
842 3300026142 Ga0207698_10826820 Ga0207698_108268202 58
843 3300026142 Ga0207698_11144138 Ga0207698_111441382 58
844 3300027717 Ga0209998_10068929 Ga0209998_100689292 58
845 3300027876 Ga0209974_10058972 Ga0209974_100589721 58
846 3300028379 Ga0268266_10000009 Ga0268266_10000009119 58
847 3300028379 Ga0268266_10000015 Ga0268266_10000015633 58
848 3300028379 Ga0268266_10000560 Ga0268266_1000056022 58
849 3300028379 Ga0268266_10008365 Ga0268266_1000836511 58
850 3300028379 Ga0268266_10157745 Ga0268266_101577454 58
851 3300028379 Ga0268266_10553148 Ga0268266_105531483 58
852 3300028380 Ga0268265_10000001 Ga0268265_100000011133 58
853 3300028380 Ga0268265_10000003 Ga0268265_10000003962 58
854 3300028380 Ga0268265_10000047 Ga0268265_10000047130 58
855 3300028380 Ga0268265_10000125 Ga0268265_1000012572 58
856 3300028380 Ga0268265_10231745 Ga0268265_102317453 58
857 3300028380 Ga0268265_12333057 Ga0268265_123330571 58
858 3300028381 Ga0268264_10000023 Ga0268264_1000002360 58
859 3300028381 Ga0268264_10014193 Ga0268264_100141934 58
860 3300028381 Ga0268264_10074867 Ga0268264_100748673 58
861 3300028381 Ga0268264_10205367 Ga0268264_102053672 58
862 3300028381 Ga0268264_11672397 Ga0268264_116723972 58
863 3300028794 Ga0307515_10341363 Ga0307515_103413632 58
864 3300028800 Ga0265338_10170208 Ga0265338_101702082 58
865 3300031456 Ga0307513_10032777 Ga0307513_100327772 58
866 3300031456 Ga0307513_10259144 Ga0307513_102591443 58
867 3300031456 Ga0307513_10504297 Ga0307513_105042972 58
868 3300031456 Ga0307513_10691202 Ga0307513_106912021 58
869 3300031456 Ga0307513_10745609 Ga0307513_107456092 58
870 3300031548 Ga0307408_100002738 Ga0307408_1000027386 58
871 3300031548 Ga0307408_101455450 Ga0307408_1014554502 58
872 3300031616 Ga0307508_10004384 Ga0307508_1000438418 58
873 3300031731 Ga0307405_10045306 Ga0307405_100453062 58
874 3300031731 Ga0307405_10064746 Ga0307405_100647463 58
875 3300031731 Ga0307405_10341476 Ga0307405_103414763 58
876 3300031731 Ga0307405_10464188 Ga0307405_104641882 58
877 3300031731 Ga0307405_10912860 Ga0307405_109128602 58
878 3300031731 Ga0307405_11445527 Ga0307405_114455271 58
879 3300031731 Ga0307405_11939894 Ga0307405_119398941 58
880 3300031824 Ga0307413_10074350 Ga0307413_100743503 58
881 3300031824 Ga0307413_10267957 Ga0307413_102679571 58
882 3300031824 Ga0307413_10876998 Ga0307413_108769982 58
883 3300031824 Ga0307413_11491805 Ga0307413_114918052 58
884 3300031852 Ga0307410_10020800 Ga0307410_100208009 58
885 3300031852 Ga0307410_10182426 Ga0307410_101824263 58
886 3300031852 Ga0307410_10757338 Ga0307410_107573382 58
887 3300031852 Ga0307410_11125492 Ga0307410_111254922 58
888 3300031901 Ga0307406_10022639 Ga0307406_100226398 58
889 3300031901 Ga0307406_10047398 Ga0307406_100473985 58
890 3300031901 Ga0307406_10271505 Ga0307406_102715052 58
891 3300031901 Ga0307406_10409954 Ga0307406_104099542 58
892 3300031901 Ga0307406_10431566 Ga0307406_104315662 58
893 3300031903 Ga0307407_10050253 Ga0307407_100502533 58
894 3300031903 Ga0307407_10202991 Ga0307407_102029912 58
895 3300031911 Ga0307412_10005437 Ga0307412_100054379 58
896 3300031911 Ga0307412_10031479 Ga0307412_100314795 58
897 3300031911 Ga0307412_10063499 Ga0307412_100634993 58
898 3300031911 Ga0307412_10069509 Ga0307412_100695095 58
899 3300031911 Ga0307412_10133634 Ga0307412_101336342 58
900 3300031911 Ga0307412_10731022 Ga0307412_107310221 58
901 3300031995 Ga0307409_100075828 Ga0307409_1000758282 58
902 3300031995 Ga0307409_101074060 Ga0307409_1010740602 58
903 3300031995 Ga0307409_101444973 Ga0307409_1014449732 58
904 3300032002 Ga0307416_100013642 Ga0307416_10001364212 58
905 3300032002 Ga0307416_100056646 Ga0307416_1000566467 58
906 3300032002 Ga0307416_100228529 Ga0307416_1002285294 58
907 3300032002 Ga0307416_100296789 Ga0307416_1002967891 58
908 3300032002 Ga0307416_101661728 Ga0307416_1016617282 58
909 3300032002 Ga0307416_101971073 Ga0307416_1019710732 58
910 3300032004 Ga0307414_10031754 Ga0307414_100317548 58
911 3300032004 Ga0307414_10342652 Ga0307414_103426522 58
912 3300032004 Ga0307414_12074244 Ga0307414_120742442 58
913 3300032005 Ga0307411_10069400 Ga0307411_100694003 58
914 3300032005 Ga0307411_10227412 Ga0307411_102274122 58
915 3300032005 Ga0307411_10877007 Ga0307411_108770072 58
916 3300032126 Ga0307415_100135597 Ga0307415_1001355972 58
917 3300032126 Ga0307415_100208297 Ga0307415_1002082972 58
918 3300032126 Ga0307415_101494312 Ga0307415_1014943122 58
919 3300032126 Ga0307415_101576380 Ga0307415_1015763802 58
920 3300033180 Ga0307510_10127422 Ga0307510_101274223 58
921 3300033180 Ga0307510_10608921 Ga0307510_106089212 58
922 3300035691 Ga0373931_0061226 Ga0373931_0061226_481_657 58
923 3300035692 Ga0373935_0588072 Ga0373935_0588072_313_489 58
924 3300035695 Ga0373927_0041187 Ga0373927_0041187_2272_2448 58
925 3300037068 Ga0373925_0449014 Ga0373925_0449014_784_960 58
926 3300037312 Ga0395899_0116591 Ga0395899_0116591_1203_1403 58
927 3300037312 Ga0395899_0134214 Ga0395899_0134214_803_994 58
928 3300037418 Ga0395900_0232480 Ga0395900_0232480_803_994 58
929 3300037418 Ga0395900_0265355 Ga0395900_0265355_158_334 58
930 3300037418 Ga0395900_0549404 Ga0395900_0549404_338_514 58
931 3300037466 Ga0395898_0804277 Ga0395898_0804277_90_281 58
932 3300037471 Ga0395905_0257057 Ga0395905_0257057_144_320 58
933 3300037471 Ga0395905_0501499 Ga0395905_0501499_130_321 58
934 3300037471 Ga0395905_0520966 Ga0395905_0520966_259_435 58
935 3300037471 Ga0395905_1136521 Ga0395905_1136521_98_298 58
936 3300037853 Ga0436364_0957806 Ga0436364_0957806_1817_1993 58
937 3300038443 Ga0395901_0318284 Ga0395901_0318284_391_567 58
938 3300038443 Ga0395901_0617526 Ga0395901_0617526_416_592 58
939 3300038705 Ga0237819_00478 Ga0237819_00478_824_1000 58
940 3300039145 Ga0237816_01697 Ga0237816_01697_519_695 58
941 3300039437 Ga0436365_1234023 Ga0436365_1234023_473_649 58
942 3300039437 Ga0436365_1437704 Ga0436365_1437704_110_286 58
943 3300039437 Ga0436365_1495591 Ga0436365_1495591_510_704 58
944 3300039453 Ga0436362_0379666 Ga0436362_0379666_523_699 58
945 3300041413 Ga0439465_0042157 Ga0439465_0042157_1259_1459 58
946 3300041443 Ga0451789_0548732 Ga0451789_0548732_169_369 58
947 3300041451 Ga0451791_0638383 Ga0451791_0638383_94_270 58
948 3300041451 Ga0451791_0752784 Ga0451791_0752784_196_372 58
949 3300041456 Ga0451795_0712337 Ga0451795_0712337_495_671 58
950 3300041456 Ga0451795_1707330 Ga0451795_1707330_513_689 58
951 3300041456 Ga0451795_1714707 Ga0451795_1714707_261_461 58
952 3300041459 Ga0451800_0368767 Ga0451800_0368767_123_323 58
953 3300041460 Ga0451802_0283989 Ga0451802_0283989_1150_1326 58
954 3300041460 Ga0451802_1024104 Ga0451802_1024104_160_336 58
955 3300041460 Ga0451802_2140950 Ga0451802_2140950_752_952 58
956 3300041461 Ga0451805_129527 Ga0451805_129527_324_509 58
957 3300041462 Ga0451806_203876 Ga0451806_203876_332_508 58
958 3300041462 Ga0451806_592453 Ga0451806_592453_32_208 58
959 3300041462 Ga0451806_758294 Ga0451806_758294_105_281 58
960 3300041463 Ga0451804_0246643 Ga0451804_0246643_432_608 58
961 3300041463 Ga0451804_0477757 Ga0451804_0477757_76_252 58
962 3300041486 Ga0451807_0470631 Ga0451807_0470631_203_379 58
963 3300041486 Ga0451807_2302565 Ga0451807_2302565_702_878 58
964 3300041486 Ga0451807_2545728 Ga0451807_2545728_114_314 58
965 3300041491 Ga0451833_1456891 Ga0451833_1456891_31_231 58
966 3300041498 Ga0451841_1289656 Ga0451841_1289656_189_365 58
967 3300041501 Ga0451845_0647259 Ga0451845_0647259_629_805 58
968 3300041509 Ga0451843_0868889 Ga0451843_0868889_67_267 58
969 3300041512 Ga0451853_1927772 Ga0451853_1927772_258_437 58
970 3300041512 Ga0451853_1977551 Ga0451853_1977551_733_933 58
971 3300042004 Ga0439445_0046001 Ga0439445_0046001_122_298 58
972 3300042004 Ga0439445_0057073 Ga0439445_0057073_271_447 58
973 3300042004 Ga0439445_0077090 Ga0439445_0077090_17_193 58
974 3300042005 Ga0439448_0001965 Ga0439448_0001965_1293_1469 58
975 3300042005 Ga0439448_0021597 Ga0439448_0021597_1148_1324 58
976 3300042005 Ga0439448_0034484 Ga0439448_0034484_184_378 58
977 3300042008 Ga0439450_143599 Ga0439450_143599_220_414 58
978 3300042012 Ga0439455_0003944 Ga0439455_0003944_1134_1310 58
979 3300042012 Ga0439455_0064401 Ga0439455_0064401_22_216 58
980 3300042157 Ga0439458_0001028 Ga0439458_0001028_6180_6356 58
981 3300042157 Ga0439458_0004227 Ga0439458_0004227_2604_2798 58
982 3300042439 Ga0439464_0179423 Ga0439464_0179423_43_243 58
983 3300042532 Ga0450893_0027173 Ga0450893_0027173_68_244 58
984 3300044694 Ga0466963_0015793 Ga0466963_0015793_2233_2427 58
985 3300044719 Ga0466971_0041189 Ga0466971_0041189_699_893 58
986 3300044842 Ga0466957_0732249 Ga0466957_0732249_248_442 58
987 3300045836 Ga0466958_0020347 Ga0466958_0020347_1324_1518 58
988 3300045976 Ga0466967_2500056 Ga0466967_2500056_211_402 58
989 3300046457 Ga0495590_0364510 Ga0495590_0364510_132_308 58
990 3300046459 Ga0495629_0842767 Ga0495629_0842767_70_270 58
991 3300046460 Ga0495638_0004617 Ga0495638_0004617_7563_7763 58
992 3300046460 Ga0495638_0038151 Ga0495638_0038151_2448_2624 58
993 3300046460 Ga0495638_0502409 Ga0495638_0502409_206_382 58
994 3300046460 Ga0495638_0560184 Ga0495638_0560184_316_516 58
995 3300046471 Ga0495650_0001317 Ga0495650_0001317_14016_14216 58
996 3300046475 Ga0495639_0309034 Ga0495639_0309034_78_278 58
997 3300046491 Ga0495584_0111019 Ga0495584_0111019_319_519 58
998 3300046492 Ga0495585_0133334 Ga0495585_0133334_1060_1260 58
999 3300046492 Ga0495585_0277392 Ga0495585_0277392_398_598 58
1000 3300046492 Ga0495585_0341219 Ga0495585_0341219_203_403 58
1001 3300046492 Ga0495585_0588467 Ga0495585_0588467_160_360 58
1002 3300046500 Ga0495596_0175517 Ga0495596_0175517_352_552 58
1003 3300046501 Ga0495607_0408716 Ga0495607_0408716_339_539 58
1004 3300046506 Ga0495583_0007683 Ga0495583_0007683_6429_6629 58
1005 3300046506 Ga0495583_0063474 Ga0495583_0063474_1069_1269 58
1006 3300046506 Ga0495583_0078340 Ga0495583_0078340_897_1097 58
1007 3300046506 Ga0495583_0082064 Ga0495583_0082064_823_1023 58
1008 3300046506 Ga0495583_0278645 Ga0495583_0278645_240_416 58
1009 3300046507 Ga0495606_0023498 Ga0495606_0023498_802_978 58
1010 3300046507 Ga0495606_0042086 Ga0495606_0042086_861_1061 58
1011 3300046507 Ga0495606_0097880 Ga0495606_0097880_277_477 58
1012 3300046507 Ga0495606_0214158 Ga0495606_0214158_808_984 58
1013 3300046507 Ga0495606_0545327 Ga0495606_0545327_297_491 58
1014 3300046513 Ga0495616_0129000 Ga0495616_0129000_653_832 58
1015 3300046513 Ga0495616_0373886 Ga0495616_0373886_47_247 58
1016 3300046518 Ga0495631_0046334 Ga0495631_0046334_772_972 58
1017 3300046518 Ga0495631_0474017 Ga0495631_0474017_269_445 58
1018 3300046519 Ga0495632_0206744 Ga0495632_0206744_438_614 58
1019 3300046519 Ga0495632_0462517 Ga0495632_0462517_242_418 58
1020 3300046520 Ga0495637_0118426 Ga0495637_0118426_756_956 58
1021 3300046520 Ga0495637_0123343 Ga0495637_0123343_449_649 58
1022 3300046522 Ga0495643_0008456 Ga0495643_0008456_1370_1546 58
1023 3300046522 Ga0495643_0011725 Ga0495643_0011725_4366_4566 58
1024 3300046522 Ga0495643_0449081 Ga0495643_0449081_225_425 58
1025 3300046522 Ga0495643_0460848 Ga0495643_0460848_93_269 58
1026 3300046524 Ga0495648_0000507 Ga0495648_0000507_2048_2248 58
1027 3300046524 Ga0495648_0166532 Ga0495648_0166532_902_1102 58
1028 3300046524 Ga0495648_0338835 Ga0495648_0338835_162_338 58
1029 3300046525 Ga0495663_0002619 Ga0495663_0002619_4853_5053 58
1030 3300046525 Ga0495663_0123542 Ga0495663_0123542_210_410 58
1031 3300046528 Ga0495642_0431045 Ga0495642_0431045_83_283 58
1032 3300046529 Ga0495652_0326049 Ga0495652_0326049_57_257 58
1033 3300046530 Ga0495654_0004604 Ga0495654_0004604_2450_2626 58
1034 3300046530 Ga0495654_0131481 Ga0495654_0131481_706_882 58
1035 3300046530 Ga0495654_0342787 Ga0495654_0342787_41_241 58
1036 3300046530 Ga0495654_0447958 Ga0495654_0447958_17_196 58
1037 3300046537 Ga0495598_0008568 Ga0495598_0008568_720_896 58
1038 3300046538 Ga0495609_0423917 Ga0495609_0423917_157_357 58
1039 3300046542 Ga0495597_0063768 Ga0495597_0063768_1385_1561 58
1040 3300046542 Ga0495597_0193287 Ga0495597_0193287_365_565 58
1041 3300046542 Ga0495597_0425513 Ga0495597_0425513_164_361 58
1042 3300046557 Ga0495622_0048141 Ga0495622_0048141_139_339 58
1043 3300046558 Ga0495633_0028185 Ga0495633_0028185_1246_1446 58
1044 3300046558 Ga0495633_0070471 Ga0495633_0070471_963_1163 58
1045 3300046616 Ga0495668_0000016 Ga0495668_0000016_133078_133278 58
1046 3300046616 Ga0495668_0019898 Ga0495668_0019898_2729_2905 58
1047 3300046616 Ga0495668_0033266 Ga0495668_0033266_2248_2448 58
1048 3300046616 Ga0495668_0311375 Ga0495668_0311375_295_471 58
1049 3300046616 Ga0495668_0440036 Ga0495668_0440036_136_312 58
1050 3300046616 Ga0495668_0556016 Ga0495668_0556016_213_389 58
1051 3300046616 Ga0495668_0652397 Ga0495668_0652397_32_208 58
1052 3300046648 Ga0495611_0158187 Ga0495611_0158187_682_882 58
1053 3300046648 Ga0495611_0296985 Ga0495611_0296985_400_600 58
1054 3300046648 Ga0495611_0314971 Ga0495611_0314971_246_446 58
1055 3300046660 Ga0495625_0000072 Ga0495625_0000072_5444_5644 58
1056 3300046660 Ga0495625_0007474 Ga0495625_0007474_2021_2218 58
1057 3300046660 Ga0495625_0075318 Ga0495625_0075318_1888_2088 58
1058 3300046660 Ga0495625_0169691 Ga0495625_0169691_1042_1242 58
1059 3300046660 Ga0495625_0265515 Ga0495625_0265515_644_844 58
1060 3300046660 Ga0495625_0269124 Ga0495625_0269124_528_728 58
1061 3300046660 Ga0495625_0402133 Ga0495625_0402133_95_271 58
1062 3300046660 Ga0495625_0555976 Ga0495625_0555976_289_489 58
1063 3300046660 Ga0495625_0591105 Ga0495625_0591105_417_593 58
1064 3300046660 Ga0495625_0665985 Ga0495625_0665985_272_448 58
1065 3300046665 Ga0495661_0116274 Ga0495661_0116274_123_323 58
1066 3300046684 Ga0495669_0000529 Ga0495669_0000529_14788_14988 58
1067 3300046689 Ga0495613_0831096 Ga0495613_0831096_345_545 58
1068 3300046691 Ga0495670_0000015 Ga0495670_0000015_114038_114214 58
1069 3300046691 Ga0495670_0015640 Ga0495670_0015640_1858_2061 58
1070 3300046691 Ga0495670_0467011 Ga0495670_0467011_271_471 58
1071 3300046694 Ga0495649_0148846 Ga0495649_0148846_122_322 58
1072 3300046694 Ga0495649_0249991 Ga0495649_0249991_482_658 58
1073 3300046694 Ga0495649_0425440 Ga0495649_0425440_215_415 58
1074 3300046794 Ga0495589_0133912 Ga0495589_0133912_728_904 58
1075 3300046809 Ga0495600_0009109 Ga0495600_0009109_4531_4731 58
1076 3300046810 Ga0495660_0430779 Ga0495660_0430779_278_478 58
1077 3300047323 Ga0495683_0116301 Ga0495683_0116301_436_636 58
1078 3300047323 Ga0495683_0122323 Ga0495683_0122323_792_968 58
1079 3300047443 Ga0495687_000649 Ga0495687_000649_2543_2743 58
1080 3300047443 Ga0495687_004871 Ga0495687_004871_2540_2740 58
1081 3300047443 Ga0495687_062746 Ga0495687_062746_1276_1452 58
1082 3300047445 Ga0495677_0021122 Ga0495677_0021122_1030_1230 58
1083 3300047445 Ga0495677_0036383 Ga0495677_0036383_1304_1504 58
1084 3300047470 Ga0495681_0041622 Ga0495681_0041622_29_229 58
1085 3300047470 Ga0495681_0309730 Ga0495681_0309730_79_255 58
1086 3300047472 Ga0495686_0000530 Ga0495686_0000530_4846_5022 58
1087 3300047472 Ga0495686_0000723 Ga0495686_0000723_38559_38762 58
1088 3300047472 Ga0495686_0001008 Ga0495686_0001008_12065_12241 58
1089 3300047472 Ga0495686_0024914 Ga0495686_0024914_2666_2842 58
1090 3300047472 Ga0495686_0070575 Ga0495686_0070575_1230_1430 58
1091 3300047472 Ga0495686_0182374 Ga0495686_0182374_973_1149 58
1092 3300047472 Ga0495686_0279442 Ga0495686_0279442_352_528 58
1093 3300047472 Ga0495686_0659667 Ga0495686_0659667_173_349 58
1094 3300048904 Ga0496101_0915559 Ga0496101_0915559_324_500 58
1095 3300048905 Ga0496102_0003035 Ga0496102_0003035_3981_4157 58
1096 3300048905 Ga0496102_0003155 Ga0496102_0003155_11219_11419 58
1097 3300048905 Ga0496102_0757323 Ga0496102_0757323_342_518 58
1098 3300048905 Ga0496102_1627729 Ga0496102_1627729_35_211 58
1099 3300048906 Ga0496103_0000903 Ga0496103_0000903_11032_11232 58
1100 3300048906 Ga0496103_0001742 Ga0496103_0001742_11263_11439 58
1101 3300048907 Ga0496104_0082332 Ga0496104_0082332_370_570 58
1102 3300048908 Ga0496105_0005151 Ga0496105_0005151_7993_8193 58
1103 3300048908 Ga0496105_0197990 Ga0496105_0197990_626_802 58
1104 3300048909 Ga0496106_0182822 Ga0496106_0182822_349_525 58
1105 3300048910 Ga0496107_0194779 Ga0496107_0194779_34_210 58
1106 3300048910 Ga0496107_0580837 Ga0496107_0580837_388_588 58
1107 3300048911 Ga0496108_0519986 Ga0496108_0519986_671_871 58
1108 3300048912 Ga0496109_0296717 Ga0496109_0296717_856_1056 58
1109 3300048912 Ga0496109_0882846 Ga0496109_0882846_569_745 58
1110 3300048913 Ga0496110_0774142 Ga0496110_0774142_380_580 58
1111 3300048914 Ga0496111_0009790 Ga0496111_0009790_2660_2860 58
1112 3300048914 Ga0496111_0129586 Ga0496111_0129586_505_681 58
1113 3300048914 Ga0496111_1045338 Ga0496111_1045338_229_405 58
1114 3300048915 Ga0496112_1451392 Ga0496112_1451392_203_403 58
1115 3300048916 Ga0496113_0811620 Ga0496113_0811620_542_718 58
1116 3300048916 Ga0496113_1336816 Ga0496113_1336816_67_267 58
1117 3300048917 Ga0496114_0007549 Ga0496114_0007549_311_511 58
1118 3300048918 Ga0496115_0002506 Ga0496115_0002506_11177_11377 58
1119 3300048919 Ga0496116_0024085 Ga0496116_0024085_3987_4163 58
1120 3300048919 Ga0496116_0091775 Ga0496116_0091775_412_612 58
1121 3300048919 Ga0496116_0483207 Ga0496116_0483207_306_482 58
1122 3300048920 Ga0496117_0000324 Ga0496117_0000324_72481_72681 58
1123 3300048920 Ga0496117_0005438 Ga0496117_0005438_4241_4417 58
1124 3300048920 Ga0496117_0034695 Ga0496117_0034695_2448_2624 58
1125 3300048920 Ga0496117_0062804 Ga0496117_0062804_2101_2283 58
1126 3300048920 Ga0496117_0117705 Ga0496117_0117705_1328_1504 58
1127 3300048921 Ga0496118_0002151 Ga0496118_0002151_16166_16366 58
1128 3300048921 Ga0496118_0004152 Ga0496118_0004152_9133_9309 58
1129 3300048921 Ga0496118_0017136 Ga0496118_0017136_4036_4218 58
1130 3300048921 Ga0496118_0019807 Ga0496118_0019807_4452_4628 58
1131 3300048921 Ga0496118_0117741 Ga0496118_0117741_486_662 58
1132 3300048922 Ga0496119_0006610 Ga0496119_0006610_5946_6146 58
1133 3300048922 Ga0496119_0047821 Ga0496119_0047821_1943_2119 58
1134 3300048923 Ga0496120_0275078 Ga0496120_0275078_257_457 58
1135 3300048923 Ga0496120_0439828 Ga0496120_0439828_142_318 58
1136 3300048924 Ga0496121_0001314 Ga0496121_0001314_31405_31605 58
1137 3300048924 Ga0496121_0002794 Ga0496121_0002794_14465_14665 58
1138 3300048924 Ga0496121_0038248 Ga0496121_0038248_1750_1947 58
1139 3300048924 Ga0496121_0040520 Ga0496121_0040520_3039_3215 58
1140 3300048924 Ga0496121_0050670 Ga0496121_0050670_175_351 58
1141 3300048924 Ga0496121_0052395 Ga0496121_0052395_1190_1366 58
1142 3300048924 Ga0496121_0276551 Ga0496121_0276551_740_916 58
1143 3300048925 Ga0496122_0001531 Ga0496122_0001531_25411_25587 58
1144 3300048925 Ga0496122_0055074 Ga0496122_0055074_204_380 58
1145 3300048925 Ga0496122_0112139 Ga0496122_0112139_1444_1644 58
1146 3300048925 Ga0496122_0360994 Ga0496122_0360994_250_426 58
1147 3300048926 Ga0496123_0001418 Ga0496123_0001418_28519_28695 58
1148 3300048926 Ga0496123_0016952 Ga0496123_0016952_757_933 58
1149 3300048926 Ga0496123_0176423 Ga0496123_0176423_195_395 58
1150 3300048926 Ga0496123_0294026 Ga0496123_0294026_232_432 58
1151 3300048927 Ga0496124_0000351 Ga0496124_0000351_72571_72771 58
1152 3300048927 Ga0496124_0014083 Ga0496124_0014083_779_955 58
1153 3300048927 Ga0496124_0052819 Ga0496124_0052819_1896_2072 58
1154 3300048928 Ga0496125_0003470 Ga0496125_0003470_16071_16271 58
1155 3300048928 Ga0496125_0729088 Ga0496125_0729088_309_485 58
1156 3300048929 Ga0496126_0002155 Ga0496126_0002155_15998_16198 58
1157 3300048929 Ga0496126_0304599 Ga0496126_0304599_794_970 58
1158 3300048929 Ga0496126_0542348 Ga0496126_0542348_203_379 58
1159 3300048929 Ga0496126_0855323 Ga0496126_0855323_345_521 58
1160 3300048929 Ga0496126_0886973 Ga0496126_0886973_225_401 58
1161 3300048929 Ga0496126_1093170 Ga0496126_1093170_103_279 58
1162 3300048929 Ga0496126_1276051 Ga0496126_1276051_237_416 58
1163 3300049128 Ga0501308_086036 Ga0501308_086036_200_376 58
1164 3300049459 Ga0495678_068202 Ga0495678_068202_172_348 58
1165 3300049459 Ga0495678_088048 Ga0495678_088048_138_314 58
1166 3300049513 Ga0501290_000352 Ga0501290_000352_1864_2040 58
1167 3300049513 Ga0501290_006382 Ga0501290_006382_303_479 58
1168 3300049515 Ga0501292_000088 Ga0501292_000088_11583_11759 58
1169 3300049517 Ga0501294_000241 Ga0501294_000241_5828_6004 58
1170 3300049522 Ga0501299_092320 Ga0501299_092320_69_245 58
1171 3300049523 Ga0501300_003094 Ga0501300_003094_2211_2387 58
1172 3300049523 Ga0501300_006532 Ga0501300_006532_1153_1329 58
1173 3300049530 Ga0501314_013552 Ga0501314_013552_72_248 58
1174 3300049531 Ga0501315_002307 Ga0501315_002307_1295_1471 58
1175 3300049531 Ga0501315_012821 Ga0501315_012821_153_329 58
1176 3300049531 Ga0501315_051550 Ga0501315_051550_364_540 58
1177 3300049533 Ga0501317_018595 Ga0501317_018595_576_752 58
1178 3300049534 Ga0501318_029866 Ga0501318_029866_470_646 58
1179 3300049549 Ga0501333_008957 Ga0501333_008957_88_264 58
1180 3300049551 Ga0501335_038136 Ga0501335_038136_223_399 58
1181 3300049554 Ga0501338_12382 Ga0501338_12382_143_319 58
1182 3300049569 Ga0501032_0901662 Ga0501032_0901662_38_214 58
1183 3300049570 Ga0501033_0649458 Ga0501033_0649458_367_558 58
1184 3300049571 Ga0501034_0007538 Ga0501034_0007538_1925_2101 58
1185 3300049571 Ga0501034_0082782 Ga0501034_0082782_296_472 58
1186 3300049571 Ga0501034_0647934 Ga0501034_0647934_456_632 58
1187 3300049571 Ga0501034_0982730 Ga0501034_0982730_175_351 58
1188 3300049572 Ga0501036_1539549 Ga0501036_1539549_173_349 58
1189 3300049579 Ga0501043_0885135 Ga0501043_0885135_313_489 58
1190 3300049581 Ga0501047_0144807 Ga0501047_0144807_115_300 58
1191 3300049581 Ga0501047_0427174 Ga0501047_0427174_257_433 58
1192 3300049581 Ga0501047_0850754 Ga0501047_0850754_132_308 58
1193 3300049585 Ga0501069_0035055 Ga0501069_0035055_1874_2050 58
1194 3300049586 Ga0501070_0027529 Ga0501070_0027529_1775_1951 58
1195 3300049587 Ga0501071_1605970 Ga0501071_1605970_247_423 58
1196 3300049653 Ga0501206_000112 Ga0501206_000112_5838_6014 58
1197 3300049662 Ga0501222_000376 Ga0501222_000376_268_444 58
1198 3300049663 Ga0501223_019504 Ga0501223_019504_661_837 58
1199 3300049663 Ga0501223_036026 Ga0501223_036026_703_879 58
1200 3300049664 Ga0501224_000219 Ga0501224_000219_5899_6075 58
1201 3300049665 Ga0501227_008045 Ga0501227_008045_1733_1909 58
1202 3300049669 Ga0501235_000736 Ga0501235_000736_6095_6271 58
1203 3300049686 Ga0501257_000052 Ga0501257_000052_27757_27933 58
1204 3300049690 Ga0501261_000417 Ga0501261_000417_4977_5153 58
1205 3300049773 Ga0501276_009720 Ga0501276_009720_435_611 58
1206 3300049775 Ga0501279_000074 Ga0501279_000074_11578_11754 58
1207 3300049776 Ga0501280_000191 Ga0501280_000191_10103_10279 58
1208 3300049776 Ga0501280_012759 Ga0501280_012759_647_823 58
1209 3300049777 Ga0501281_00081 Ga0501281_00081_8475_8651 58
1210 3300049778 Ga0501282_000381 Ga0501282_000381_1231_1407 58
1211 3300049822 Ga0501035_0886643 Ga0501035_0886643_78_254 58
1212 3300049822 Ga0501035_1498850 Ga0501035_1498850_17_202 58
1213 3300049823 Ga0501044_0055624 Ga0501044_0055624_1941_2117 58
1214 3300049823 Ga0501044_0324206 Ga0501044_0324206_1247_1423 58
1215 3300050489 nmdc:mga03683_313206_c1 nmdc:mga03683_313206_c1_440_616 58
1216 3300050491 nmdc:mga00v17_3387_c2 nmdc:mga00v17_3387_c2_4095_4271 58
1217 3300050491 nmdc:mga00v17_538492_c1 nmdc:mga00v17_538492_c1_414_590 58
1218 3300050491 nmdc:mga00v17_784798_c1 nmdc:mga00v17_784798_c1_129_305 58
1219 3300050492 nmdc:mga0yw44_1193152_c1 nmdc:mga0yw44_1193152_c1_164_340 58
1220 3300050493 nmdc:mga0k408_30694_c1 nmdc:mga0k408_30694_c1_1669_1860 58
1221 3300050493 nmdc:mga0k408_398724_c1 nmdc:mga0k408_398724_c1_257_457 58
1222 3300050493 nmdc:mga0k408_501721_c1 nmdc:mga0k408_501721_c1_475_675 58
1223 3300050493 nmdc:mga0k408_748769_c1 nmdc:mga0k408_748769_c1_24_200 58
1224 3300050496 nmdc:mga07m45_16117_c1 nmdc:mga07m45_16117_c1_2579_2770 58
1225 3300050496 nmdc:mga07m45_186221_c1 nmdc:mga07m45_186221_c1_752_928 58
1226 3300050496 nmdc:mga07m45_84920_c1 nmdc:mga07m45_84920_c1_293_469 58
1227 3300050509 nmdc:mga0qj67_1518855_c1 nmdc:mga0qj67_1518855_c1_41_217 58
1228 3300050512 nmdc:mga0n895_823850_c1 nmdc:mga0n895_823850_c1_244_420 58
1229 3300050516 nmdc:mga0sz30_105445_c1 nmdc:mga0sz30_105445_c1_1019_1195 58
1230 3300053079 Ga0500610_0000216 Ga0500610_0000216_8519_8719 58
1231 3300053087 Ga0500643_000134 Ga0500643_000134_2420_2599 58
1232 3300053087 Ga0500643_003488 Ga0500643_003488_4280_4480 58
1233 3300053087 Ga0500643_005556 Ga0500643_005556_1673_1867 58
1234 3300053087 Ga0500643_088711 Ga0500643_088711_648_824 58
1235 3300053087 Ga0500643_088712 Ga0500643_088712_648_824 58
1236 3300053087 Ga0500643_137458 Ga0500643_137458_33_233 58
1237 3300053088 Ga0500644_0260304 Ga0500644_0260304_247_423 58
1238 3300053090 Ga0500646_0091936 Ga0500646_0091936_22_198 58
1239 3300053091 Ga0500647_0213226 Ga0500647_0213226_608_784 58
1240 3300053093 Ga0500651_0120217 Ga0500651_0120217_1243_1419 58
1241 3300053093 Ga0500651_0352155 Ga0500651_0352155_82_285 58
1242 3300053104 Ga0500556_0246324 Ga0500556_0246324_207_383 58
1243 3300053104 Ga0500556_0315331 Ga0500556_0315331_287_463 58
1244 3300053116 Ga0500592_001405 Ga0500592_001405_386_562 58
1245 3300053116 Ga0500592_010909 Ga0500592_010909_491_667 58
1246 3300053119 Ga0500595_017021 Ga0500595_017021_2166_2366 58
1247 3300053125 Ga0500618_017029 Ga0500618_017029_293_469 58
1248 3300053133 Ga0500655_000265 Ga0500655_000265_7228_7404 58
1249 3300053134 Ga0500658_0004652 Ga0500658_0004652_3285_3485 58
1250 3300053134 Ga0500658_0503432 Ga0500658_0503432_22_198 58
1251 3300053136 Ga0500559_0343820 Ga0500559_0343820_226_441 58
1252 3300053139 Ga0500568_0013737 Ga0500568_0013737_1520_1696 58
1253 3300053140 Ga0500573_0000559 Ga0500573_0000559_5836_6012 58
1254 3300053140 Ga0500573_0409230 Ga0500573_0409230_133_309 58
1255 3300053140 Ga0500573_0456536 Ga0500573_0456536_195_371 58
1256 3300053142 Ga0500577_0504599 Ga0500577_0504599_46_222 58
1257 3300053148 Ga0500590_004805 Ga0500590_004805_213_389 58
1258 3300053151 Ga0500604_0000014 Ga0500604_0000014_12330_12506 58
1259 3300053151 Ga0500604_0017943 Ga0500604_0017943_1324_1500 58
1260 3300053151 Ga0500604_0299102 Ga0500604_0299102_137_313 58
1261 3300053153 Ga0500616_0000591 Ga0500616_0000591_38988_39164 58
1262 3300053153 Ga0500616_0030468 Ga0500616_0030468_1841_2038 58
1263 3300053153 Ga0500616_0083831 Ga0500616_0083831_212_388 58
1264 3300053154 Ga0500619_136027 Ga0500619_136027_308_508 58
1265 3300053158 Ga0500627_0000899 Ga0500627_0000899_4550_4726 58
1266 3300053158 Ga0500627_0027229 Ga0500627_0027229_179_355 58
1267 3300053158 Ga0500627_0042078 Ga0500627_0042078_1748_1924 58
1268 3300053177 Ga0500636_0047080 Ga0500636_0047080_2083_2283 58
1269 3300053177 Ga0500636_0539332 Ga0500636_0539332_127_303 58
1270 3300053730 Ga0500645_000002 Ga0500645_000002_212504_212704 58
1271 3300053730 Ga0500645_162740 Ga0500645_162740_276_452 58
1272 3300059477 Ga0587084_022267 Ga0587084_022267_547_747 58
1273 3300059491 Ga0587070_116903 Ga0587070_116903_179_379 58
1274 3300059493 Ga0587077_085234 Ga0587077_085234_475_675 58
1275 3300059493 Ga0587077_106908 Ga0587077_106908_401_601 58
1276 3300059493 Ga0587077_188520 Ga0587077_188520_354_530 58
1277 3300059604 Ga0587098_014146 Ga0587098_014146_619_819 58
1278 3300059605 Ga0587106_030729 Ga0587106_030729_628_828 58
1279 3300059642 Ga0587069_047511 Ga0587069_047511_84_284 58
1280 3300059643 Ga0587072_051597 Ga0587072_051597_614_814 58
1281 3300059645 Ga0587076_052651 Ga0587076_052651_173_349 58
1282 3300059646 Ga0587078_042375 Ga0587078_042375_165_365 58
1283 3300059649 Ga0587102_016703 Ga0587102_016703_15_215 58
1284 3300059652 Ga0587107_030945 Ga0587107_030945_12_212 58
1285 3300060344 Ga0587071_088394 Ga0587071_088394_218_418 58
1286 3300060346 Ga0587111_0148151 Ga0587111_0148151_72_272 58
1287 3300060346 Ga0587111_0211339 Ga0587111_0211339_80_262 58
1288 3300060353 Ga0501082_1880845 Ga0501082_1880845_129_305 58
1289 3300000041 ARcpr5oldR_c003367 ARcpr5oldR_0033672 59
1290 3300000043 ARcpr5yngRDRAFT_c000513 ARcpr5yngRDRAFT_0005131 59
1291 3300002773 JGI25152J39213_1045210 JGI25152J39213_10452101 59
1292 3300002774 JGI25150J39212_1000365 JGI25150J39212_10003657 59
1293 3300002774 JGI25150J39212_1000837 JGI25150J39212_10008378 59
1294 3300003187 JGI25151J46595_10029327 JGI25151J46595_100293271 59
1295 3300003215 JGI25153J46596_10001359 JGI25153J46596_1000135914 59
1296 3300003215 JGI25153J46596_10087839 JGI25153J46596_100878391 59
1297 3300003771 Ga0055526_1001689 Ga0055526_100168923 59
1298 3300003773 Ga0055537_1002389 Ga0055537_100238914 59
1299 3300003773 Ga0055537_1013876 Ga0055537_10138762 59
1300 3300003775 Ga0055524_1000320 Ga0055524_100032051 59
1301 3300003775 Ga0055524_1000341 Ga0055524_10003413 59
1302 3300003781 Ga0055536_1004136 Ga0055536_100413616 59
1303 3300003781 Ga0055536_1024452 Ga0055536_10244523 59
1304 3300003781 Ga0055536_1046965 Ga0055536_10469652 59
1305 3300003784 Ga0055534_1019454 Ga0055534_10194542 59
1306 3300003790 Ga0055528_1076706 Ga0055528_10767061 59
1307 3300003790 Ga0055528_1078700 Ga0055528_10787002 59
1308 3300003791 Ga0055530_10001710 Ga0055530_1000171017 59
1309 3300003791 Ga0055530_10013813 Ga0055530_100138134 59
1310 3300003791 Ga0055530_10014457 Ga0055530_100144572 59
1311 3300003791 Ga0055530_10019749 Ga0055530_100197493 59
1312 3300003791 Ga0055530_10026068 Ga0055530_100260683 59
1313 3300003792 Ga0055540_1000723 Ga0055540_100072319 59
1314 3300003794 Ga0055531_10002727 Ga0055531_1000272712 59
1315 3300003794 Ga0055531_10012970 Ga0055531_100129702 59
1316 3300003794 Ga0055531_10025423 Ga0055531_100254233 59
1317 3300003794 Ga0055531_10025502 Ga0055531_100255023 59
1318 3300003794 Ga0055531_10032983 Ga0055531_100329833 59
1319 3300003794 Ga0055531_10034125 Ga0055531_100341253 59
1320 3300003794 Ga0055531_10041336 Ga0055531_100413362 59
1321 3300004625 Ga0055543_1014693 Ga0055543_10146932 59
1322 3300005262 Ga0065165_1015699 Ga0065165_10156992 59
1323 3300005262 Ga0065165_1069905 Ga0065165_10699051 59
1324 3300005262 Ga0065165_1094332 Ga0065165_10943322 59
1325 3300005262 Ga0065165_1167928 Ga0065165_11679281 59
1326 3300005327 Ga0070658_10517219 Ga0070658_105172193 59
1327 3300005336 Ga0070680_101562058 Ga0070680_1015620581 59
1328 3300005366 Ga0070659_100246930 Ga0070659_1002469301 59
1329 3300005437 Ga0070710_10640199 Ga0070710_106401992 59
1330 3300005548 Ga0070665_100429143 Ga0070665_1004291432 59
1331 3300005548 Ga0070665_101247662 Ga0070665_1012476622 59
1332 3300005577 Ga0068857_100060023 Ga0068857_1000600238 59
1333 3300005578 Ga0068854_100051084 Ga0068854_1000510843 59
1334 3300005983 Ga0081540_1013216 Ga0081540_10132162 59
1335 3300006186 Ga0075369_10116166 Ga0075369_101161662 59
1336 3300006353 Ga0075370_10676786 Ga0075370_106767862 59
1337 3300009147 Ga0114129_12342286 Ga0114129_123422862 59
1338 3300009545 Ga0105237_10002858 Ga0105237_100028587 59
1339 3300013100 Ga0157373_10565416 Ga0157373_105654162 59
1340 3300013102 Ga0157371_11339788 Ga0157371_113397881 59
1341 3300013104 Ga0157370_10545838 Ga0157370_105458382 59
1342 3300021388 Ga0213875_10001626 Ga0213875_1000162621 59
1343 3300025245 Ga0207425_1000049 Ga0207425_1000049185 59
1344 3300025245 Ga0207425_1011898 Ga0207425_10118982 59
1345 3300025246 Ga0209646_1031500 Ga0209646_10315002 59
1346 3300025258 Ga0209129_1000471 Ga0209129_10004718 59
1347 3300025263 Ga0209565_1000008 Ga0209565_1000008694 59
1348 3300025263 Ga0209565_1000985 Ga0209565_100098516 59
1349 3300025273 Ga0209673_1004450 Ga0209673_100445014 59
1350 3300025273 Ga0209673_1023801 Ga0209673_10238012 59
1351 3300025291 Ga0209675_1000104 Ga0209675_100010427 59
1352 3300025292 Ga0209676_1000512 Ga0209676_100051258 59
1353 3300025292 Ga0209676_1000807 Ga0209676_100080741 59
1354 3300025292 Ga0209676_1001199 Ga0209676_100119926 59
1355 3300025292 Ga0209676_1009827 Ga0209676_10098272 59
1356 3300025292 Ga0209676_1021566 Ga0209676_10215664 59
1357 3300025292 Ga0209676_1029229 Ga0209676_10292293 59
1358 3300025294 Ga0209025_1000068 Ga0209025_1000068157 59
1359 3300025294 Ga0209025_1011083 Ga0209025_10110832 59
1360 3300025294 Ga0209025_1050489 Ga0209025_10504893 59
1361 3300025295 Ga0209564_1000335 Ga0209564_1000335100 59
1362 3300025295 Ga0209564_1016953 Ga0209564_10169531 59
1363 3300025295 Ga0209564_1085619 Ga0209564_10856191 59
1364 3300025297 Ga0209758_1000004 Ga0209758_100000456 59
1365 3300025297 Ga0209758_1017731 Ga0209758_10177314 59
1366 3300025298 Ga0209050_1000001 Ga0209050_10000011987 59
1367 3300025298 Ga0209050_1000286 Ga0209050_100028690 59
1368 3300025298 Ga0209050_1002774 Ga0209050_100277414 59
1369 3300025298 Ga0209050_1003389 Ga0209050_100338913 59
1370 3300025299 Ga0209256_1000009 Ga0209256_1000009175 59
1371 3300025299 Ga0209256_1000010 Ga0209256_100001099 59
1372 3300025303 Ga0209051_1000191 Ga0209051_100019182 59
1373 3300025303 Ga0209051_1038886 Ga0209051_10388863 59
1374 3300025304 Ga0209257_1000245 Ga0209257_10002457 59
1375 3300025304 Ga0209257_1000321 Ga0209257_10003212 59
1376 3300025304 Ga0209257_1000577 Ga0209257_100057762 59
1377 3300025304 Ga0209257_1000597 Ga0209257_100059762 59
1378 3300025304 Ga0209257_1003551 Ga0209257_100355112 59
1379 3300025304 Ga0209257_1004959 Ga0209257_100495919 59
1380 3300025304 Ga0209257_1016465 Ga0209257_10164652 59
1381 3300025304 Ga0209257_1026884 Ga0209257_10268842 59
1382 3300025304 Ga0209257_1028408 Ga0209257_10284082 59
1383 3300025304 Ga0209257_1035933 Ga0209257_10359332 59
1384 3300025914 Ga0207671_10003747 Ga0207671_1000374713 59
1385 3300025919 Ga0207657_10506335 Ga0207657_105063353 59
1386 3300025932 Ga0207690_11450002 Ga0207690_114500021 59
1387 3300025981 Ga0207640_10036573 Ga0207640_100365732 59
1388 3300026116 Ga0207674_10066644 Ga0207674_100666449 59
1389 3300028379 Ga0268266_11113731 Ga0268266_111137312 59
1390 3300028379 Ga0268266_11854022 Ga0268266_118540222 59
1391 3300030733 Ga0314311_1129629 Ga0314311_11296292 59
1392 3300030742 Ga0316183_1101809 Ga0316183_11018094 59
1393 3300031548 Ga0307408_100999629 Ga0307408_1009996292 59
1394 3300031731 Ga0307405_11717863 Ga0307405_117178632 59
1395 3300031824 Ga0307413_10923106 Ga0307413_109231062 59
1396 3300031824 Ga0307413_10989766 Ga0307413_109897662 59
1397 3300031901 Ga0307406_10040041 Ga0307406_100400413 59
1398 3300031901 Ga0307406_10198586 Ga0307406_101985863 59
1399 3300031901 Ga0307406_10900703 Ga0307406_109007032 59
1400 3300031901 Ga0307406_11616058 Ga0307406_116160582 59
1401 3300031911 Ga0307412_10000330 Ga0307412_1000033037 59
1402 3300031911 Ga0307412_10002114 Ga0307412_1000211412 59
1403 3300031911 Ga0307412_10032820 Ga0307412_100328203 59
1404 3300032002 Ga0307416_100024455 Ga0307416_1000244553 59
1405 3300032004 Ga0307414_10000117 Ga0307414_1000011730 59
1406 3300032004 Ga0307414_10000371 Ga0307414_1000037122 59
1407 3300032004 Ga0307414_10036610 Ga0307414_100366104 59
1408 3300032004 Ga0307414_10115431 Ga0307414_101154312 59
1409 3300032004 Ga0307414_10344197 Ga0307414_103441973 59
1410 3300032004 Ga0307414_10449790 Ga0307414_104497902 59
1411 3300032004 Ga0307414_10922789 Ga0307414_109227891 59
1412 3300032004 Ga0307414_11157305 Ga0307414_111573052 59
1413 3300032005 Ga0307411_10182421 Ga0307411_101824214 59
1414 3300032005 Ga0307411_10249025 Ga0307411_102490252 59
1415 3300035118 Ga0373954_0204433 Ga0373954_0204433_430_609 59
1416 3300037853 Ga0436364_1065372 Ga0436364_1065372_98488_98667 59
1417 3300037853 Ga0436364_1253875 Ga0436364_1253875_349_528 59
1418 3300038443 Ga0395901_0863371 Ga0395901_0863371_199_378 59
1419 3300039437 Ga0436365_1056819 Ga0436365_1056819_334_513 59
1420 3300041404 Ga0439436_0104422 Ga0439436_0104422_383_562 59
1421 3300041404 Ga0439436_0166421 Ga0439436_0166421_20_199 59
1422 3300041406 Ga0439439_0019879 Ga0439439_0019879_1216_1395 59
1423 3300041410 Ga0439461_0003935 Ga0439461_0003935_1343_1522 59
1424 3300041410 Ga0439461_0096709 Ga0439461_0096709_306_485 59
1425 3300041413 Ga0439465_0004239 Ga0439465_0004239_4230_4409 59
1426 3300041413 Ga0439465_0005674 Ga0439465_0005674_281_460 59
1427 3300041444 Ga0451790_23905 Ga0451790_23905_327_512 59
1428 3300041451 Ga0451791_0198074 Ga0451791_0198074_25_210 59
1429 3300041451 Ga0451791_0863431 Ga0451791_0863431_67_255 59
1430 3300041453 Ga0451797_1153188 Ga0451797_1153188_244_429 59
1431 3300041460 Ga0451802_0673154 Ga0451802_0673154_278_463 59
1432 3300041486 Ga0451807_1170541 Ga0451807_1170541_349_528 59
1433 3300041486 Ga0451807_1532452 Ga0451807_1532452_289_468 59
1434 3300041486 Ga0451807_2637162 Ga0451807_2637162_821_1006 59
1435 3300041494 Ga0451837_0903713 Ga0451837_0903713_122_307 59
1436 3300041494 Ga0451837_1313285 Ga0451837_1313285_347_532 59
1437 3300041509 Ga0451843_0561276 Ga0451843_0561276_80_265 59
1438 3300041511 Ga0451855_0464587 Ga0451855_0464587_43_222 59
1439 3300041512 Ga0451853_1470546 Ga0451853_1470546_375_560 59
1440 3300041997 Ga0439431_0003098 Ga0439431_0003098_3281_3460 59
1441 3300041997 Ga0439431_0139411 Ga0439431_0139411_432_611 59
1442 3300042004 Ga0439445_0001259 Ga0439445_0001259_1564_1743 59
1443 3300042004 Ga0439445_0064378 Ga0439445_0064378_450_629 59
1444 3300042006 Ga0439432_006259 Ga0439432_006259_323_502 59
1445 3300042010 Ga0439452_041030 Ga0439452_041030_14_193 59
1446 3300042015 Ga0439462_0004404 Ga0439462_0004404_1734_1913 59
1447 3300042015 Ga0439462_0004785 Ga0439462_0004785_3118_3297 59
1448 3300042131 Ga0450894_038137 Ga0450894_038137_463_642 59
1449 3300042156 Ga0439446_0019699 Ga0439446_0019699_449_628 59
1450 3300042435 Ga0439434_0000103 Ga0439434_0000103_19921_20100 59
1451 3300042435 Ga0439434_0075974 Ga0439434_0075974_665_844 59
1452 3300046453 Ga0495627_084823 Ga0495627_084823_219_398 59
1453 3300046453 Ga0495627_099887 Ga0495627_099887_394_579 59
1454 3300046519 Ga0495632_0367474 Ga0495632_0367474_182_364 59
1455 3300046522 Ga0495643_0057255 Ga0495643_0057255_68_253 59
1456 3300046530 Ga0495654_0036570 Ga0495654_0036570_2124_2309 59
1457 3300046616 Ga0495668_0000015 Ga0495668_0000015_11458_11643 59
1458 3300046660 Ga0495625_0004430 Ga0495625_0004430_4739_4924 59
1459 3300046665 Ga0495661_0572121 Ga0495661_0572121_106_285 59
1460 3300047470 Ga0495681_0011958 Ga0495681_0011958_198_377 59
1461 3300048905 Ga0496102_1378167 Ga0496102_1378167_173_352 59
1462 3300048918 Ga0496115_0002111 Ga0496115_0002111_13598_13777 59
1463 3300048922 Ga0496119_0329689 Ga0496119_0329689_301_480 59
1464 3300048923 Ga0496120_0093468 Ga0496120_0093468_1025_1204 59
1465 3300048925 Ga0496122_0256430 Ga0496122_0256430_17_196 59
1466 3300048926 Ga0496123_0022246 Ga0496123_0022246_495_674 59
1467 3300048926 Ga0496123_0070087 Ga0496123_0070087_1841_2020 59
1468 3300048927 Ga0496124_0005829 Ga0496124_0005829_5133_5312 59
1469 3300048927 Ga0496124_0040538 Ga0496124_0040538_1164_1343 59
1470 3300048927 Ga0496124_0085511 Ga0496124_0085511_106_285 59
1471 3300048928 Ga0496125_0198394 Ga0496125_0198394_949_1134 59
1472 3300048929 Ga0496126_0127852 Ga0496126_0127852_224_403 59
1473 3300048929 Ga0496126_0609894 Ga0496126_0609894_545_730 59
1474 3300049127 Ga0501306_063096 Ga0501306_063096_272_457 59
1475 3300049530 Ga0501314_000002 Ga0501314_000002_11505_11684 59
1476 3300049533 Ga0501317_001577 Ga0501317_001577_645_824 59
1477 3300049537 Ga0501321_068786 Ga0501321_068786_350_529 59
1478 3300049539 Ga0501323_001589 Ga0501323_001589_15_194 59
1479 3300049540 Ga0501324_027655 Ga0501324_027655_20_199 59
1480 3300049550 Ga0501334_14279 Ga0501334_14279_148_333 59
1481 3300049551 Ga0501335_047919 Ga0501335_047919_300_485 59
1482 3300049554 Ga0501338_09186 Ga0501338_09186_171_356 59
1483 3300049568 Ga0501031_0035501 Ga0501031_0035501_2291_2476 59
1484 3300049569 Ga0501032_0011615 Ga0501032_0011615_4984_5169 59
1485 3300049570 Ga0501033_0133191 Ga0501033_0133191_673_858 59
1486 3300049571 Ga0501034_0027253 Ga0501034_0027253_2396_2581 59
1487 3300049572 Ga0501036_0050187 Ga0501036_0050187_1577_1762 59
1488 3300049573 Ga0501037_0046965 Ga0501037_0046965_1089_1274 59
1489 3300049574 Ga0501038_0052443 Ga0501038_0052443_548_733 59
1490 3300049575 Ga0501039_0005639 Ga0501039_0005639_4460_4645 59
1491 3300049579 Ga0501043_0075885 Ga0501043_0075885_1976_2161 59
1492 3300049580 Ga0501046_0389609 Ga0501046_0389609_396_581 59
1493 3300049581 Ga0501047_0032215 Ga0501047_0032215_3866_4051 59
1494 3300049582 Ga0501048_0109379 Ga0501048_0109379_166_351 59
1495 3300049663 Ga0501223_002540 Ga0501223_002540_620_799 59
1496 3300049664 Ga0501224_000009 Ga0501224_000009_11230_11409 59
1497 3300049668 Ga0501233_000279 Ga0501233_000279_2034_2213 59
1498 3300049669 Ga0501235_002385 Ga0501235_002385_3319_3498 59
1499 3300049705 Ga0501225_0000094 Ga0501225_0000094_15736_15915 59
1500 3300049758 Ga0501241_025197 Ga0501241_025197_241_420 59
1501 3300049778 Ga0501282_001529 Ga0501282_001529_2166_2351 59
1502 3300049822 Ga0501035_0013966 Ga0501035_0013966_5452_5637 59
1503 3300049822 Ga0501035_0492686 Ga0501035_0492686_78_263 59
1504 3300049823 Ga0501044_0102207 Ga0501044_0102207_1689_1874 59
1505 3300049823 Ga0501044_0633561 Ga0501044_0633561_697_882 59
1506 3300049824 Ga0501045_0671437 Ga0501045_0671437_422_607 59
1507 3300049853 Ga0501226_000076 Ga0501226_000076_18851_19030 59
1508 3300050507 nmdc:mga05p37_847024_c1 nmdc:mga05p37_847024_c1_654_863 59
1509 3300050512 nmdc:mga0n895_418106_c1 nmdc:mga0n895_418106_c1_345_554 59
1510 3300050516 nmdc:mga0sz30_99383_c1 nmdc:mga0sz30_99383_c1_754_939 59
1511 3300053087 Ga0500643_026980 Ga0500643_026980_1304_1483 59
1512 3300053094 Ga0500566_0039514 Ga0500566_0039514_2180_2359 59
1513 3300053116 Ga0500592_001411 Ga0500592_001411_337_522 59
1514 3300053116 Ga0500592_054166 Ga0500592_054166_179_364 59
1515 3300053134 Ga0500658_0036311 Ga0500658_0036311_81_266 59
1516 3300053134 Ga0500658_0070509 Ga0500658_0070509_394_573 59
1517 3300053139 Ga0500568_0022667 Ga0500568_0022667_2403_2582 59
1518 3300053139 Ga0500568_0033063 Ga0500568_0033063_373_558 59
1519 3300053151 Ga0500604_0315302 Ga0500604_0315302_92_277 59
1520 3300053158 Ga0500627_0000009 Ga0500627_0000009_141445_141630 59
1521 3300053158 Ga0500627_0378000 Ga0500627_0378000_182_367 59
1522 3300059477 Ga0587084_041804 Ga0587084_041804_171_356 59
1523 3300059493 Ga0587077_060294 Ga0587077_060294_455_640 59
1524 3300059510 Ga0587090_135625 Ga0587090_135625_117_302 59
1525 3300059623 Ga0587101_102335 Ga0587101_102335_95_280 59
1526 3300059639 Ga0587062_043481 Ga0587062_043481_171_356 59
1527 3300059653 Ga0587108_025880 Ga0587108_025880_279_464 59
1528 3300060346 Ga0587111_0275893 Ga0587111_0275893_36_221 59

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

4

54

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6enu-assembly1.cif.gz_Z polyproline-stalled ribosome in the presence of elongation-factor p (ef-p) 0.9811 1 58
7ac7-assembly1.cif.gz_Z structure of accomodated trans-translation complex on e. coli stalled ribosome. 0.9794 4 58
8g34-assembly1.cif.gz_Z time-resolved cryo-em study of the 70s recycling by the hflx:1st intermediate 0.9768 1 58
7nhn-assembly1.cif.gz_3 vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9758 4 58
5kpw-assembly1.cif.gz_Y structure of rela bound to ribosome in presence of a/r trna (structure iii) 0.9752 1 58
ID Description Score Start End Superfamily
4wfbW00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9767 2 58 3.30.1390.20
5hl7W00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9712 2 58 3.30.1390.20
4tomZ00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.969 1 58 3.30.1390.20
af_B6SIL2_19_102_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9684 2 58 3.30.1390.20
af_P9WHA3_1_65_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9655 1 57 3.30.1390.20
ID Description Score Start End GO Terms
AF-A0A7Y6YUC8-F1-model_v4 Large ribosomal subunit protein uL30 1.008 2 58 GO:0003735
GO:0006412
GO:0022625
AF-A0A212RIZ1-F1-model_v4 Large ribosomal subunit protein uL30 1.007 2 58 GO:0003735
GO:0006412
GO:0022625
AF-Q98N39-F1-model_v4 Large ribosomal subunit protein uL30 (50S ribosomal protein L30) 1.006 3 58 GO:0003735
GO:0006412
GO:0022625
AF-A0A849I581-F1-model_v4 Large ribosomal subunit protein uL30 1.006 2 57 GO:0003735
GO:0006412
GO:0022625
AF-V4NU65-F1-model_v4 Large ribosomal subunit protein uL30 1.005 2 58 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
93.93 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map