F494461

General Info

Members Datasets Scaffolds Average Seq Length
1509 445 1500 366

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0071943|Ga0501075_0071943_314_1429
Length 361
Sequence MSRVRLLVGTRKGAFVLTSDGKRERWDVGGPHFGGWEIYHLKGSPVDQDRLYASQSSGWFGQIVQRSRDGGKTWEAVGNKFVYDGVPGTHQWYDGTPHPWEFARVWHLEPSLTDPDTVYAGVEDAALFRTQDGGQTWHELPALRSHPSGASWQPGAGGMCLHTILLDPRRPGRIFIAISAAGVFRVNRGLRSEGIPDPAAEVGHCVHRIAMHRSRPDVLFMQKHWDVMRSDDAGESWREVSGNLPSDFGFPIDVHAHEPETIYVVPIKSDSEHYPPDGTLRVYRSRTGGNEWEALTNGLPQRHCYVNVLRDAMAVDALDPCGVYFGTSGGQVYGSADAGDRWTPIVRDLPAVVSVEAQTLP

Samples

Sample ID Description Type Environment
1 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
2 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
3 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
4 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
5 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
6 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
7 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
8 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
9 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
10 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
11 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
12 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
142 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
149 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
230 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
231 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
232 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
233 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
234 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
235 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
236 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
237 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
238 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
239 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
240 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
241 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
244 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
245 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
246 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
247 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
248 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
249 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
250 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
251 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
252 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
253 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
263 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
264 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
265 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
266 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
268 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
269 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
270 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
271 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
272 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
273 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
274 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
275 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
276 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
277 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
279 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
280 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
281 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
282 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
283 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
286 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
287 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
288 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
289 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
290 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
291 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
292 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
293 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
294 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
295 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
296 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
297 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
298 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
299 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
300 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
301 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
302 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
303 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
304 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
305 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
306 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
307 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
308 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
309 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
310 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
311 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
312 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
313 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
314 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
315 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
316 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
317 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
318 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
319 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
320 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
321 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
322 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
323 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
324 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
325 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
326 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
327 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
328 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
329 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
330 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
331 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
332 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
333 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
334 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
335 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
336 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
337 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
338 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
339 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
340 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
341 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
342 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
343 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
344 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
345 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
346 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
347 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
348 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
349 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
350 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
351 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
352 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
353 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
354 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
355 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
356 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
357 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
358 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
359 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
360 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
361 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
362 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
363 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
364 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
365 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
366 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
367 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
368 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
369 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
370 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
371 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
372 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
373 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
374 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
375 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
376 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
377 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
378 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
379 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
380 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
381 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
382 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
383 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
384 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
385 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
386 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
387 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
403 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
404 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
405 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
406 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
407 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
408 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
409 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
410 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
411 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
412 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
413 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
414 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
415 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
416 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
417 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
418 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
419 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
420 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
423 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
424 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
425 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
426 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
427 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
428 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
429 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
430 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
431 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
432 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
433 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
434 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
435 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
436 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
437 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
438 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
439 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
440 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
441 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
442 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
444 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
445 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.14
Metatranscriptomes 1.26
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 6.36
Rhizosphere 91.25
Stem 0
Stem Tuber 0.07
Unclassified 2.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000035 3300000545 Bacteria 28845
2 JGI24743J22301_10000992 3300001991 Bacteria 3708
3 JGI24035J26624_1001136 3300002126 Bacteria 2519
4 JGI25406J46586_10000325 3300003203 Bacteria 21471
5 JGI25406J46586_10000541 3300003203 Bacteria 17699
6 Ga0058863_11825713 3300004799 Bacteria 1236
7 Ga0058861_10011440 3300004800 Bacteria 1957
8 Ga0058861_12031188 3300004800 Bacteria 1302
9 Ga0058862_10025361 3300004803 Bacteria 3708
10 Ga0065712_10000625 3300005290 Bacteria 9379
11 Ga0065712_10011464 3300005290 Bacteria 2626
12 Ga0065712_10098998 3300005290 Bacteria 2087
13 Ga0065712_10119669 3300005290 Bacteria 1689
14 Ga0065712_10123381 3300005290 Bacteria 1634
15 Ga0065715_10032425 3300005293 Bacteria 2250
16 Ga0065715_10102208 3300005293 Bacteria 3112
17 Ga0065707_10010640 3300005295 Bacteria 2834
18 Ga0065707_10139243 3300005295 Bacteria 1795
19 Ga0070658_10042817 3300005327 Bacteria 3657
20 Ga0070676_10029185 3300005328 Bacteria 3137
21 Ga0070676_10031165 3300005328 Bacteria 3045
22 Ga0070683_100101142 3300005329 Bacteria 2714
23 Ga0070690_100021087 3300005330 Bacteria 3975
24 Ga0070690_100029296 3300005330 Bacteria 3413
25 Ga0070690_100035310 3300005330 Bacteria 3137
26 Ga0070690_100059680 3300005330 Bacteria 2453
27 Ga0070690_100228249 3300005330 Bacteria 1308
28 Ga0070670_100001059 3300005331 Bacteria 21806
29 Ga0070670_100007091 3300005331 Bacteria 9489
30 Ga0070677_10113419 3300005333 Bacteria 1213
31 Ga0068869_100014309 3300005334 Bacteria 5298
32 Ga0070666_10061740 3300005335 Bacteria 2538
33 Ga0070680_100035035 3300005336 Bacteria 4051
34 Ga0070682_100014401 3300005337 Bacteria 4569
35 Ga0068868_100187050 3300005338 Bacteria 1721
36 Ga0070660_100047711 3300005339 Bacteria 3287
37 Ga0070660_100057893 3300005339 Bacteria 3004
38 Ga0070660_100161359 3300005339 Bacteria 1806
39 Ga0070689_100003430 3300005340 Bacteria 10547
40 Ga0070689_100024392 3300005340 Bacteria 4536
41 Ga0070689_100069464 3300005340 Bacteria 2748
42 Ga0070689_100205320 3300005340 Bacteria 1610
43 Ga0070687_100052085 3300005343 Bacteria 2123
44 Ga0070687_100107394 3300005343 Bacteria 1574
45 Ga0070661_100000337 3300005344 Bacteria 37436
46 Ga0070661_100143681 3300005344 Bacteria 1800
47 Ga0070668_100010876 3300005347 Bacteria 6771
48 Ga0070668_100024862 3300005347 Bacteria 4540
49 Ga0070668_100046833 3300005347 Bacteria 3322
50 Ga0070669_100010503 3300005353 Bacteria 6576
51 Ga0070669_100039144 3300005353 Bacteria 3444
52 Ga0070669_100079540 3300005353 Bacteria 2438
53 Ga0070669_100193746 3300005353 Bacteria 1595
54 Ga0070675_100010980 3300005354 Bacteria 7090
55 Ga0070675_100012576 3300005354 Bacteria 6635
56 Ga0070675_100035704 3300005354 Bacteria 4041
57 Ga0070675_100039523 3300005354 Bacteria 3850
58 Ga0070675_100146753 3300005354 Bacteria 2020
59 Ga0070675_100198407 3300005354 Bacteria 1741
60 Ga0070671_100039917 3300005355 Bacteria 3897
61 Ga0070671_100069236 3300005355 Bacteria 2943
62 Ga0070671_100132563 3300005355 Bacteria 2099
63 Ga0070674_100004778 3300005356 Bacteria 7762
64 Ga0070674_100102822 3300005356 Bacteria 2084
65 Ga0070674_100115095 3300005356 Bacteria 1982
66 Ga0070674_100213277 3300005356 Bacteria 1498
67 Ga0070673_100007361 3300005364 Bacteria 7250
68 Ga0070673_100019496 3300005364 Bacteria 4869
69 Ga0070673_100025049 3300005364 Bacteria 4384
70 Ga0070673_100049666 3300005364 Bacteria 3276
71 Ga0070673_100213346 3300005364 Bacteria 1668
72 Ga0070688_100004677 3300005365 Bacteria 7145
73 Ga0070688_100029494 3300005365 Bacteria 3285
74 Ga0070688_100103943 3300005365 Bacteria 1878
75 Ga0070659_100000509 3300005366 Bacteria 28530
76 Ga0070659_100067384 3300005366 Bacteria 2839
77 Ga0070659_100094328 3300005366 Bacteria 2403
78 Ga0070659_100190094 3300005366 Bacteria 1687
79 Ga0070667_100070574 3300005367 Bacteria 2973
80 Ga0070667_100291071 3300005367 Bacteria 1469
81 Ga0070709_10023132 3300005434 Bacteria 3645
82 Ga0070714_100018316 3300005435 Bacteria 5686
83 Ga0070714_100044243 3300005435 Bacteria 3769
84 Ga0070714_100082531 3300005435 Bacteria 2800
85 Ga0070714_100184892 3300005435 Bacteria 1898
86 Ga0070714_100267156 3300005435 Bacteria 1585
87 Ga0070714_100407190 3300005435 Bacteria 1287
88 Ga0070713_100000077 3300005436 Bacteria 61320
89 Ga0070713_100016796 3300005436 Bacteria 5512
90 Ga0070713_100024503 3300005436 Bacteria 4701
91 Ga0070713_100271354 3300005436 Bacteria 1553
92 Ga0070710_10152289 3300005437 Bacteria 1427
93 Ga0070701_10006980 3300005438 Bacteria 4789
94 Ga0070701_10103728 3300005438 Bacteria 1579
95 Ga0070711_100030475 3300005439 Bacteria 3571
96 Ga0070711_100039183 3300005439 Bacteria 3190
97 Ga0070711_100044079 3300005439 Bacteria 3026
98 Ga0070711_100206445 3300005439 Bacteria 1519
99 Ga0070705_100004129 3300005440 Bacteria 7095
100 Ga0070705_100043715 3300005440 Bacteria 2569
101 Ga0070705_100070806 3300005440 Bacteria 2107
102 Ga0070705_100088589 3300005440 Bacteria 1921
103 Ga0070705_100117502 3300005440 Bacteria 1711
104 Ga0070700_100002366 3300005441 Bacteria 9601
105 Ga0070700_100030821 3300005441 Bacteria 3208
106 Ga0070700_100155911 3300005441 Bacteria 1567
107 Ga0070694_100014576 3300005444 Bacteria 4921
108 Ga0070694_100015620 3300005444 Bacteria 4772
109 Ga0070694_100020386 3300005444 Bacteria 4226
110 Ga0070694_100022522 3300005444 Bacteria 4037
111 Ga0070694_100039993 3300005444 Bacteria 3124
112 Ga0070708_100001673 3300005445 Bacteria 17014
113 Ga0070708_100008042 3300005445 Bacteria 8452
114 Ga0070708_100017607 3300005445 Bacteria 5965
115 Ga0070708_100018256 3300005445 Bacteria 5868
116 Ga0070708_100033722 3300005445 Bacteria 4448
117 Ga0070708_100034056 3300005445 Bacteria 4429
118 Ga0070708_100052228 3300005445 Bacteria 3624
119 Ga0070708_100055684 3300005445 Bacteria 3517
120 Ga0070708_100066254 3300005445 Bacteria 3241
121 Ga0070708_100066383 3300005445 Bacteria 3239
122 Ga0070708_100097022 3300005445 Bacteria 2694
123 Ga0070708_100152820 3300005445 Bacteria 2147
124 Ga0070708_100210729 3300005445 Bacteria 1820
125 Ga0070708_100284188 3300005445 Bacteria 1557
126 Ga0070708_100323273 3300005445 Bacteria 1453
127 Ga0070708_100409544 3300005445 Bacteria 1279
128 Ga0070708_100445789 3300005445 Bacteria 1221
129 Ga0070663_100028858 3300005455 Bacteria 3783
130 Ga0070663_100172716 3300005455 Bacteria 1672
131 Ga0070678_100035823 3300005456 Bacteria 3469
132 Ga0070678_100038155 3300005456 Bacteria 3380
133 Ga0070678_100054297 3300005456 Bacteria 2918
134 Ga0070678_100136871 3300005456 Bacteria 1954
135 Ga0070678_100228058 3300005456 Bacteria 1551
136 Ga0070662_100034116 3300005457 Bacteria 3587
137 Ga0070662_100177528 3300005457 Bacteria 1677
138 Ga0070681_10046107 3300005458 Bacteria 4358
139 Ga0070681_10101418 3300005458 Bacteria 2824
140 Ga0070681_10317849 3300005458 Bacteria 1466
141 Ga0068867_100002998 3300005459 Bacteria 11900
142 Ga0068867_100060613 3300005459 Bacteria 2807
143 Ga0068867_100098812 3300005459 Bacteria 2226
144 Ga0068867_100282356 3300005459 Bacteria 1362
145 Ga0070685_10021980 3300005466 Bacteria 3471
146 Ga0070685_10041552 3300005466 Bacteria 2620
147 Ga0070685_10094953 3300005466 Bacteria 1812
148 Ga0070706_100000571 3300005467 Bacteria 42982
149 Ga0070706_100002551 3300005467 Bacteria 18305
150 Ga0070706_100004311 3300005467 Bacteria 13777
151 Ga0070706_100006789 3300005467 Bacteria 10806
152 Ga0070706_100007618 3300005467 Bacteria 10132
153 Ga0070706_100009596 3300005467 Bacteria 8999
154 Ga0070706_100015345 3300005467 Bacteria 7074
155 Ga0070706_100033654 3300005467 Bacteria 4731
156 Ga0070706_100035268 3300005467 Bacteria 4620
157 Ga0070706_100126089 3300005467 Bacteria 2387
158 Ga0070706_100136278 3300005467 Bacteria 2292
159 Ga0070706_100165017 3300005467 Bacteria 2068
160 Ga0070707_100000150 3300005468 Bacteria 67233
161 Ga0070707_100000531 3300005468 Bacteria 38031
162 Ga0070707_100002793 3300005468 Bacteria 16615
163 Ga0070707_100004339 3300005468 Bacteria 13286
164 Ga0070707_100008884 3300005468 Bacteria 9320
165 Ga0070707_100012849 3300005468 Bacteria 7819
166 Ga0070707_100013492 3300005468 Bacteria 7643
167 Ga0070707_100015375 3300005468 Bacteria 7182
168 Ga0070707_100016485 3300005468 Bacteria 6933
169 Ga0070707_100021175 3300005468 Bacteria 6144
170 Ga0070707_100026868 3300005468 Bacteria 5469
171 Ga0070707_100044136 3300005468 Bacteria 4267
172 Ga0070707_100049964 3300005468 Bacteria 4009
173 Ga0070707_100051235 3300005468 Bacteria 3957
174 Ga0070707_100085212 3300005468 Bacteria 3054
175 Ga0070707_100091644 3300005468 Bacteria 2942
176 Ga0070707_100221053 3300005468 Bacteria 1845
177 Ga0070707_100235352 3300005468 Bacteria 1783
178 Ga0070707_100290153 3300005468 Bacteria 1589
179 Ga0070707_100455127 3300005468 Bacteria 1240
180 Ga0070698_100001980 3300005471 Bacteria 22745
181 Ga0070698_100002655 3300005471 Bacteria 19721
182 Ga0070698_100003191 3300005471 Bacteria 18080
183 Ga0070698_100004799 3300005471 Bacteria 14837
184 Ga0070698_100005264 3300005471 Bacteria 14152
185 Ga0070698_100010196 3300005471 Bacteria 10039
186 Ga0070698_100012331 3300005471 Bacteria 9051
187 Ga0070698_100025477 3300005471 Bacteria 6166
188 Ga0070698_100026845 3300005471 Bacteria 5989
189 Ga0070698_100028534 3300005471 Bacteria 5795
190 Ga0070698_100031940 3300005471 Bacteria 5456
191 Ga0070698_100038683 3300005471 Bacteria 4914
192 Ga0070698_100070349 3300005471 Bacteria 3511
193 Ga0070698_100073239 3300005471 Bacteria 3432
194 Ga0070698_100074984 3300005471 Bacteria 3387
195 Ga0070698_100114398 3300005471 Bacteria 2663
196 Ga0070698_100120065 3300005471 Bacteria 2589
197 Ga0070698_100122616 3300005471 Bacteria 2557
198 Ga0070698_100172721 3300005471 Bacteria 2102
199 Ga0070698_100208912 3300005471 Bacteria 1887
200 Ga0070698_100254077 3300005471 Bacteria 1690
201 Ga0070698_100293923 3300005471 Bacteria 1555
202 Ga0070698_100384682 3300005471 Bacteria 1336
203 Ga0070699_100000246 3300005518 Bacteria 53347
204 Ga0070699_100000445 3300005518 Bacteria 39754
205 Ga0070699_100011353 3300005518 Bacteria 7690
206 Ga0070699_100013190 3300005518 Bacteria 7126
207 Ga0070699_100014176 3300005518 Bacteria 6858
208 Ga0070699_100079689 3300005518 Bacteria 2853
209 Ga0070699_100110006 3300005518 Bacteria 2419
210 Ga0070699_100113468 3300005518 Bacteria 2380
211 Ga0070699_100113839 3300005518 Bacteria 2376
212 Ga0070699_100153348 3300005518 Bacteria 2038
213 Ga0070679_100023887 3300005530 Bacteria 5989
214 Ga0070679_100063439 3300005530 Bacteria 3682
215 Ga0070684_100020105 3300005535 Bacteria 5538
216 Ga0070684_100214364 3300005535 Bacteria 1755
217 Ga0070684_100235683 3300005535 Bacteria 1671
218 Ga0070697_100000019 3300005536 Bacteria 139695
219 Ga0070697_100000525 3300005536 Bacteria 28781
220 Ga0070697_100007674 3300005536 Bacteria 8401
221 Ga0070697_100011794 3300005536 Bacteria 6839
222 Ga0070697_100035410 3300005536 Bacteria 4027
223 Ga0070697_100048929 3300005536 Bacteria 3429
224 Ga0070697_100147384 3300005536 Bacteria 1982
225 Ga0070697_100293123 3300005536 Bacteria 1398
226 Ga0070697_100305763 3300005536 Bacteria 1367
227 Ga0070697_100322514 3300005536 Bacteria 1330
228 Ga0068853_100023963 3300005539 Bacteria 5115
229 Ga0070672_100001416 3300005543 Bacteria 14815
230 Ga0070672_100009621 3300005543 Bacteria 6671
231 Ga0070672_100024202 3300005543 Bacteria 4484
232 Ga0070672_100050038 3300005543 Bacteria 3254
233 Ga0070672_100154118 3300005543 Bacteria 1902
234 Ga0070686_100004046 3300005544 Bacteria 8066
235 Ga0070686_100006465 3300005544 Bacteria 6515
236 Ga0070686_100024037 3300005544 Bacteria 3649
237 Ga0070686_100034774 3300005544 Bacteria 3108
238 Ga0070695_100006514 3300005545 Bacteria 6900
239 Ga0070695_100013686 3300005545 Bacteria 4876
240 Ga0070695_100036877 3300005545 Bacteria 3078
241 Ga0070695_100037157 3300005545 Bacteria 3068
242 Ga0070695_100042779 3300005545 Bacteria 2877
243 Ga0070696_100016551 3300005546 Bacteria 4969
244 Ga0070696_100050310 3300005546 Bacteria 2896
245 Ga0070696_100283757 3300005546 Bacteria 1263
246 Ga0070693_100023474 3300005547 Bacteria 3297
247 Ga0070665_100000918 3300005548 Bacteria 37791
248 Ga0070665_100001433 3300005548 Bacteria 27947
249 Ga0070665_100004176 3300005548 Bacteria 15191
250 Ga0070665_100025742 3300005548 Bacteria 5927
251 Ga0070665_100048970 3300005548 Bacteria 4241
252 Ga0070665_100071173 3300005548 Bacteria 3484
253 Ga0070704_100000100 3300005549 Bacteria 29970
254 Ga0070704_100006743 3300005549 Bacteria 6796
255 Ga0070704_100007918 3300005549 Bacteria 6342
256 Ga0070704_100018236 3300005549 Bacteria 4482
257 Ga0070704_100024859 3300005549 Bacteria 3935
258 Ga0070704_100037383 3300005549 Bacteria 3317
259 Ga0070704_100038084 3300005549 Bacteria 3291
260 Ga0070704_100081032 3300005549 Bacteria 2389
261 Ga0070704_100098344 3300005549 Bacteria 2198
262 Ga0070704_100164309 3300005549 Bacteria 1759
263 Ga0070704_100236209 3300005549 Bacteria 1494
264 Ga0070704_100243860 3300005549 Bacteria 1472
265 Ga0070704_100317116 3300005549 Bacteria 1305
266 Ga0068855_100074450 3300005563 Bacteria 3944
267 Ga0068855_100092653 3300005563 Bacteria 3484
268 Ga0068855_100110247 3300005563 Bacteria 3160
269 Ga0068855_100269417 3300005563 Bacteria 1894
270 Ga0068855_100446460 3300005563 Bacteria 1412
271 Ga0070664_100037540 3300005564 Bacteria 4074
272 Ga0070664_100045174 3300005564 Bacteria 3720
273 Ga0070664_100049731 3300005564 Bacteria 3545
274 Ga0070664_100063126 3300005564 Bacteria 3158
275 Ga0070664_100113217 3300005564 Bacteria 2370
276 Ga0068857_100358803 3300005577 Bacteria 1351
277 Ga0068854_100025868 3300005578 Bacteria 4028
278 Ga0068854_100147798 3300005578 Bacteria 1809
279 Ga0068854_100251059 3300005578 Bacteria 1412
280 Ga0068856_100062923 3300005614 Bacteria 3665
281 Ga0068856_100075014 3300005614 Bacteria 3350
282 Ga0068852_100185820 3300005616 Bacteria 1957
283 Ga0068852_100219193 3300005616 Bacteria 1809
284 Ga0068852_100311489 3300005616 Bacteria 1526
285 Ga0068859_100007870 3300005617 Bacteria 10815
286 Ga0068859_100019974 3300005617 Bacteria 6726
287 Ga0068859_100028777 3300005617 Bacteria 5571
288 Ga0068859_100185346 3300005617 Bacteria 2165
289 Ga0068859_100392275 3300005617 Bacteria 1484
290 Ga0068864_100004327 3300005618 Bacteria 11669
291 Ga0068864_100044062 3300005618 Bacteria 3822
292 Ga0068864_100098562 3300005618 Bacteria 2589
293 Ga0068864_100116775 3300005618 Bacteria 2381
294 Ga0068864_100134310 3300005618 Bacteria 2226
295 Ga0068866_10117806 3300005718 Bacteria 1492
296 Ga0068861_100203888 3300005719 Bacteria 1662
297 Ga0068851_10068406 3300005834 Bacteria 1833
298 Ga0068863_100001650 3300005841 Bacteria 22068
299 Ga0068863_100011064 3300005841 Bacteria 8751
300 Ga0068863_100121253 3300005841 Bacteria 2493
301 Ga0068858_100011766 3300005842 Bacteria 8254
302 Ga0068858_100096599 3300005842 Bacteria 2753
303 Ga0068858_100118665 3300005842 Bacteria 2473
304 Ga0068858_100218096 3300005842 Bacteria 1806
305 Ga0068858_100362135 3300005842 Bacteria 1390
306 Ga0068860_100000861 3300005843 Bacteria 33835
307 Ga0068860_100017471 3300005843 Bacteria 6989
308 Ga0068860_100027324 3300005843 Bacteria 5497
309 Ga0068860_100044987 3300005843 Bacteria 4208
310 Ga0068860_100366730 3300005843 Bacteria 1420
311 Ga0068860_100499029 3300005843 Bacteria 1215
312 Ga0068862_100005233 3300005844 Bacteria 10886
313 Ga0068862_100024910 3300005844 Bacteria 5022
314 Ga0068862_100051601 3300005844 Bacteria 3518
315 Ga0068862_100124592 3300005844 Bacteria 2274
316 Ga0068862_100151576 3300005844 Bacteria 2064
317 Ga0068862_100190929 3300005844 Bacteria 1843
318 Ga0068862_100220130 3300005844 Bacteria 1718
319 Ga0081455_10000425 3300005937 Bacteria 55362
320 Ga0081455_10001083 3300005937 Bacteria 34289
321 Ga0081455_10001235 3300005937 Bacteria 31954
322 Ga0081455_10001674 3300005937 Bacteria 26876
323 Ga0081455_10003380 3300005937 Bacteria 18388
324 Ga0081455_10007016 3300005937 Bacteria 11968
325 Ga0081455_10029910 3300005937 Bacteria 4959
326 Ga0081455_10122376 3300005937 Bacteria 2048
327 Ga0081538_10067805 3300005981 Bacteria 1989
328 Ga0081540_1000477 3300005983 Bacteria 39216
329 Ga0081540_1014252 3300005983 Bacteria 5105
330 Ga0081540_1035576 3300005983 Bacteria 2668
331 Ga0081540_1038749 3300005983 Bacteria 2508
332 Ga0081539_10000002 3300005985 Bacteria 601032
333 Ga0081539_10000287 3300005985 Bacteria 113988
334 Ga0081539_10000313 3300005985 Bacteria 108469
335 Ga0081539_10000424 3300005985 Bacteria 89967
336 Ga0081539_10000561 3300005985 Bacteria 76621
337 Ga0081539_10008861 3300005985 Bacteria 8599
338 Ga0070717_10003706 3300006028 Bacteria 10981
339 Ga0070717_10004049 3300006028 Bacteria 10560
340 Ga0070717_10004374 3300006028 Bacteria 10195
341 Ga0070717_10010889 3300006028 Bacteria 6884
342 Ga0070717_10012289 3300006028 Bacteria 6527
343 Ga0070717_10040441 3300006028 Bacteria 3797
344 Ga0070717_10076738 3300006028 Bacteria 2797
345 Ga0070717_10133746 3300006028 Bacteria 2134
346 Ga0070717_10139567 3300006028 Bacteria 2089
347 Ga0070717_10164355 3300006028 Bacteria 1927
348 Ga0070715_10031606 3300006163 Bacteria 2150
349 Ga0070716_100007830 3300006173 Bacteria 5281
350 Ga0070716_100010129 3300006173 Bacteria 4719
351 Ga0070716_100120694 3300006173 Bacteria 1640
352 Ga0070712_100015499 3300006175 Bacteria 4913
353 Ga0070712_100018001 3300006175 Bacteria 4582
354 Ga0070712_100218155 3300006175 Bacteria 1508
355 Ga0075366_10027222 3300006195 Bacteria 3353
356 Ga0097621_100029738 3300006237 Bacteria 4318
357 Ga0097621_100030890 3300006237 Bacteria 4244
358 Ga0097621_100033528 3300006237 Bacteria 4090
359 Ga0097621_100084870 3300006237 Bacteria 2641
360 Ga0068871_100004188 3300006358 Bacteria 9987
361 Ga0068871_100026825 3300006358 Bacteria 4499
362 Ga0068871_100184539 3300006358 Bacteria 1794
363 Ga0068871_100210842 3300006358 Bacteria 1680
364 Ga0075428_100000401 3300006844 Bacteria 42962
365 Ga0075428_100010609 3300006844 Bacteria 10239
366 Ga0075428_100011838 3300006844 Bacteria 9708
367 Ga0075428_100012867 3300006844 Bacteria 9311
368 Ga0075428_100024409 3300006844 Bacteria 6691
369 Ga0075428_100027686 3300006844 Bacteria 6270
370 Ga0075428_100048156 3300006844 Bacteria 4680
371 Ga0075428_100049839 3300006844 Bacteria 4594
372 Ga0075428_100119298 3300006844 Bacteria 2872
373 Ga0075428_100163964 3300006844 Bacteria 2411
374 Ga0075428_100204043 3300006844 Bacteria 2137
375 Ga0075430_100000131 3300006846 Bacteria 47675
376 Ga0075430_100001915 3300006846 Bacteria 17076
377 Ga0075430_100040815 3300006846 Bacteria 3927
378 Ga0075430_100071367 3300006846 Bacteria 2913
379 Ga0075430_100074539 3300006846 Bacteria 2845
380 Ga0075430_100154801 3300006846 Bacteria 1909
381 Ga0075430_100302523 3300006846 Bacteria 1323
382 Ga0075431_100000085 3300006847 Bacteria 56381
383 Ga0075431_100000425 3300006847 Bacteria 34412
384 Ga0075431_100003237 3300006847 Bacteria 15770
385 Ga0075431_100004963 3300006847 Bacteria 13091
386 Ga0075431_100007491 3300006847 Bacteria 10869
387 Ga0075431_100008883 3300006847 Bacteria 10068
388 Ga0075431_100009399 3300006847 Bacteria 9814
389 Ga0075431_100016282 3300006847 Bacteria 7544
390 Ga0075431_100016598 3300006847 Bacteria 7473
391 Ga0075431_100027958 3300006847 Bacteria 5788
392 Ga0075431_100035701 3300006847 Bacteria 5118
393 Ga0075431_100162756 3300006847 Bacteria 2294
394 Ga0075433_10000962 3300006852 Bacteria 20381
395 Ga0075433_10001097 3300006852 Bacteria 19542
396 Ga0075433_10002569 3300006852 Bacteria 13824
397 Ga0075433_10006605 3300006852 Bacteria 9182
398 Ga0075433_10008164 3300006852 Bacteria 8337
399 Ga0075433_10021647 3300006852 Bacteria 5393
400 Ga0075433_10041200 3300006852 Bacteria 4000
401 Ga0075433_10042835 3300006852 Bacteria 3929
402 Ga0075433_10048881 3300006852 Bacteria 3679
403 Ga0075433_10052512 3300006852 Bacteria 3552
404 Ga0075433_10095753 3300006852 Bacteria 2627
405 Ga0075433_10103909 3300006852 Bacteria 2517
406 Ga0075434_100004439 3300006871 Bacteria 12643
407 Ga0075434_100004776 3300006871 Bacteria 12269
408 Ga0075434_100012440 3300006871 Bacteria 8069
409 Ga0075434_100019782 3300006871 Bacteria 6518
410 Ga0075434_100028787 3300006871 Bacteria 5463
411 Ga0075434_100039235 3300006871 Bacteria 4692
412 Ga0075434_100040943 3300006871 Bacteria 4588
413 Ga0075434_100049812 3300006871 Bacteria 4160
414 Ga0075434_100056895 3300006871 Bacteria 3886
415 Ga0075434_100096643 3300006871 Bacteria 2959
416 Ga0075434_100139616 3300006871 Bacteria 2442
417 Ga0075434_100147164 3300006871 Bacteria 2376
418 Ga0075434_100285691 3300006871 Bacteria 1669
419 Ga0075434_100337107 3300006871 Bacteria 1528
420 Ga0075429_100004928 3300006880 Bacteria 11503
421 Ga0075429_100007104 3300006880 Bacteria 9722
422 Ga0075429_100021653 3300006880 Bacteria 5573
423 Ga0075429_100032694 3300006880 Bacteria 4521
424 Ga0075429_100037922 3300006880 Bacteria 4195
425 Ga0075429_100051493 3300006880 Bacteria 3583
426 Ga0075429_100077339 3300006880 Bacteria 2899
427 Ga0068865_100021859 3300006881 Bacteria 4165
428 Ga0068865_100038619 3300006881 Bacteria 3233
429 Ga0068865_100131206 3300006881 Bacteria 1878
430 Ga0068865_100151693 3300006881 Bacteria 1759
431 Ga0075436_100015407 3300006914 Bacteria 5236
432 Ga0075436_100016463 3300006914 Bacteria 5060
433 Ga0075436_100039240 3300006914 Bacteria 3268
434 Ga0075436_100040616 3300006914 Bacteria 3210
435 Ga0075436_100052968 3300006914 Bacteria 2801
436 Ga0075436_100092473 3300006914 Bacteria 2103
437 Ga0075436_100132669 3300006914 Bacteria 1747
438 Ga0097620_100007870 3300006931 Bacteria 10815
439 Ga0097620_100019974 3300006931 Bacteria 6726
440 Ga0097620_100028775 3300006931 Bacteria 5571
441 Ga0097620_100185343 3300006931 Bacteria 2165
442 Ga0097620_100392314 3300006931 Bacteria 1484
443 Ga0075435_100016549 3300007076 Bacteria 5561
444 Ga0075435_100031014 3300007076 Bacteria 4208
445 Ga0075435_100140957 3300007076 Bacteria 2023
446 Ga0075435_100173742 3300007076 Bacteria 1818
447 Ga0075435_100233646 3300007076 Bacteria 1562
448 Ga0099794_10000268 3300007265 Bacteria 18058
449 Ga0099794_10003365 3300007265 Bacteria 6091
450 Ga0099795_10022013 3300007788 Bacteria 2099
451 Ga0105240_10345316 3300009093 Bacteria 1690
452 Ga0111539_10003751 3300009094 Bacteria 20000
453 Ga0111539_10004383 3300009094 Bacteria 18467
454 Ga0111539_10007269 3300009094 Bacteria 14180
455 Ga0111539_10024126 3300009094 Bacteria 7469
456 Ga0111539_10054153 3300009094 Bacteria 4774
457 Ga0111539_10057337 3300009094 Bacteria 4626
458 Ga0111539_10061439 3300009094 Bacteria 4451
459 Ga0111539_10075485 3300009094 Bacteria 3971
460 Ga0111539_10235652 3300009094 Bacteria 2131
461 Ga0111539_10237348 3300009094 Bacteria 2122
462 Ga0111539_10531246 3300009094 Bacteria 1370
463 Ga0105245_10011757 3300009098 Bacteria 7616
464 Ga0105245_10040053 3300009098 Bacteria 4172
465 Ga0105245_10238742 3300009098 Bacteria 1761
466 Ga0114129_10000682 3300009147 Bacteria 42836
467 Ga0114129_10001123 3300009147 Bacteria 35345
468 Ga0114129_10001543 3300009147 Bacteria 31208
469 Ga0114129_10002419 3300009147 Bacteria 25908
470 Ga0114129_10002600 3300009147 Bacteria 25101
471 Ga0114129_10003362 3300009147 Bacteria 22463
472 Ga0114129_10005161 3300009147 Bacteria 18376
473 Ga0114129_10005584 3300009147 Bacteria 17793
474 Ga0114129_10006387 3300009147 Bacteria 16714
475 Ga0114129_10014289 3300009147 Bacteria 11313
476 Ga0114129_10014798 3300009147 Bacteria 11115
477 Ga0114129_10018829 3300009147 Bacteria 9833
478 Ga0114129_10021815 3300009147 Bacteria 9090
479 Ga0114129_10024305 3300009147 Bacteria 8584
480 Ga0114129_10066823 3300009147 Bacteria 5014
481 Ga0114129_10067494 3300009147 Bacteria 4988
482 Ga0114129_10072458 3300009147 Bacteria 4802
483 Ga0114129_10138710 3300009147 Bacteria 3335
484 Ga0114129_10154935 3300009147 Bacteria 3134
485 Ga0114129_10160536 3300009147 Bacteria 3071
486 Ga0114129_10186779 3300009147 Bacteria 2816
487 Ga0114129_10189302 3300009147 Bacteria 2795
488 Ga0114129_10203128 3300009147 Bacteria 2683
489 Ga0114129_10314759 3300009147 Bacteria 2083
490 Ga0105243_10006844 3300009148 Bacteria 8789
491 Ga0105243_10129009 3300009148 Bacteria 2143
492 Ga0105243_10145138 3300009148 Bacteria 2030
493 Ga0105243_10231426 3300009148 Bacteria 1640
494 Ga0105241_10055773 3300009174 Bacteria 3028
495 Ga0105242_10002999 3300009176 Bacteria 13211
496 Ga0105242_10003810 3300009176 Bacteria 11729
497 Ga0105242_10105223 3300009176 Bacteria 2396
498 Ga0105248_10010985 3300009177 Bacteria 9991
499 Ga0105248_10015346 3300009177 Bacteria 8448
500 Ga0105248_10015864 3300009177 Bacteria 8303
501 Ga0105248_10052621 3300009177 Bacteria 4569
502 Ga0105248_10125052 3300009177 Bacteria 2901
503 Ga0105248_10139439 3300009177 Bacteria 2735
504 Ga0105238_10006590 3300009551 Bacteria 11570
505 Ga0105238_10168881 3300009551 Bacteria 2164
506 Ga0105238_10342897 3300009551 Bacteria 1482
507 Ga0105249_10039257 3300009553 Bacteria 4298
508 Ga0105249_10093221 3300009553 Bacteria 2821
509 Ga0105249_10096558 3300009553 Bacteria 2773
510 Ga0105249_10109435 3300009553 Bacteria 2610
511 Ga0105249_10191150 3300009553 Bacteria 1998
512 Ga0105239_10005652 3300010375 Bacteria 14612
513 Ga0105239_10006994 3300010375 Bacteria 12987
514 Ga0105239_10308791 3300010375 Bacteria 1782
515 Ga0105239_10373615 3300010375 Bacteria 1611
516 Ga0105246_10007920 3300011119 Bacteria 6521
517 Ga0105246_10249414 3300011119 Bacteria 1408
518 Ga0157371_10020283 3300013102 Bacteria 4892
519 Ga0157371_10070978 3300013102 Bacteria 2466
520 Ga0157371_10103776 3300013102 Bacteria 2017
521 Ga0157371_10173187 3300013102 Bacteria 1542
522 Ga0157370_10038299 3300013104 Bacteria 4638
523 Ga0157370_10131857 3300013104 Bacteria 2331
524 Ga0157370_10195621 3300013104 Bacteria 1877
525 Ga0157369_10043901 3300013105 Bacteria 4869
526 Ga0157369_10099659 3300013105 Bacteria 3097
527 Ga0157369_10113086 3300013105 Bacteria 2884
528 Ga0157369_10132179 3300013105 Bacteria 2644
529 Ga0157374_10008509 3300013296 Bacteria 8778
530 Ga0157374_10038850 3300013296 Bacteria 4377
531 Ga0157374_10054885 3300013296 Bacteria 3717
532 Ga0157374_10122397 3300013296 Bacteria 2512
533 Ga0157374_10127668 3300013296 Bacteria 2459
534 Ga0157374_10168956 3300013296 Bacteria 2132
535 Ga0157378_10233805 3300013297 Bacteria 1753
536 Ga0163162_10013043 3300013306 Bacteria 8112
537 Ga0163162_10096906 3300013306 Bacteria 3038
538 Ga0163162_10365645 3300013306 Bacteria 1575
539 Ga0157372_10095387 3300013307 Bacteria 3389
540 Ga0157372_10133903 3300013307 Bacteria 2853
541 Ga0157375_10160280 3300013308 Bacteria 2391
542 Ga0157375_10197260 3300013308 Bacteria 2168
543 Ga0157375_10325481 3300013308 Bacteria 1702
544 Ga0157375_10422519 3300013308 Bacteria 1499
545 Ga0163163_10058045 3300014325 Bacteria 3827
546 Ga0163163_10190153 3300014325 Bacteria 2101
547 Ga0157380_10050546 3300014326 Bacteria 3284
548 Ga0157380_10065204 3300014326 Bacteria 2926
549 Ga0157380_10086056 3300014326 Bacteria 2582
550 Ga0157380_10088736 3300014326 Bacteria 2545
551 Ga0157380_10156361 3300014326 Bacteria 1976
552 Ga0157380_10350742 3300014326 Bacteria 1381
553 Ga0157379_10180862 3300014968 Bacteria 1905
554 Ga0157379_10333050 3300014968 Bacteria 1387
555 Ga0157376_10227698 3300014969 Bacteria 1730
556 Ga0163161_10001322 3300017792 Bacteria 18441
557 Ga0163161_10008101 3300017792 Bacteria 7267
558 Ga0163161_10086624 3300017792 Bacteria 2312
559 Ga0197907_10808747 3300020069 Bacteria 4460
560 Ga0197907_11017334 3300020069 Bacteria 1912
561 Ga0206356_10010578 3300020070 Bacteria 4712
562 Ga0206349_1326472 3300020075 Bacteria 1738
563 Ga0206355_1340865 3300020076 Bacteria 2865
564 Ga0206352_10036172 3300020078 Bacteria 1315
565 Ga0206350_11224050 3300020080 Bacteria 3853
566 Ga0206350_11293820 3300020080 Bacteria 1615
567 Ga0206354_10150820 3300020081 Bacteria 6621
568 Ga0206353_10682319 3300020082 Bacteria 1883
569 Ga0206353_11207105 3300020082 Bacteria 4653
570 Ga0213873_10006779 3300021358 Bacteria 2266
571 Ga0213876_10007022 3300021384 Bacteria 6138
572 Ga0213876_10097039 3300021384 Bacteria 1562
573 Ga0213875_10000073 3300021388 Bacteria 119027
574 Ga0213875_10000709 3300021388 Bacteria 25572
575 Ga0213875_10042463 3300021388 Bacteria 2136
576 Ga0213875_10063499 3300021388 Bacteria 1726
577 Ga0224712_10002051 3300022467 Bacteria 4891
578 Ga0224712_10026175 3300022467 Bacteria 2059
579 Ga0224712_10031533 3300022467 Bacteria 1924
580 Ga0207697_10000679 3300025315 Bacteria 19342
581 Ga0207697_10000854 3300025315 Bacteria 17240
582 Ga0207692_10102474 3300025898 Bacteria 1574
583 Ga0207642_10069559 3300025899 Bacteria 1670
584 Ga0207642_10126147 3300025899 Bacteria 1328
585 Ga0207710_10029554 3300025900 Bacteria 2386
586 Ga0207688_10004833 3300025901 Bacteria 7338
587 Ga0207688_10035037 3300025901 Bacteria 2780
588 Ga0207680_10010354 3300025903 Bacteria 4662
589 Ga0207680_10015145 3300025903 Bacteria 4017
590 Ga0207680_10077915 3300025903 Bacteria 2074
591 Ga0207680_10197383 3300025903 Bacteria 1369
592 Ga0207647_10049472 3300025904 Bacteria 2607
593 Ga0207685_10034634 3300025905 Bacteria 1836
594 Ga0207699_10020124 3300025906 Bacteria 3571
595 Ga0207699_10028298 3300025906 Bacteria 3113
596 Ga0207645_10009259 3300025907 Bacteria 6823
597 Ga0207645_10010292 3300025907 Bacteria 6425
598 Ga0207645_10020522 3300025907 Bacteria 4324
599 Ga0207643_10002627 3300025908 Bacteria 9725
600 Ga0207643_10041603 3300025908 Bacteria 2590
601 Ga0207705_10015206 3300025909 Bacteria 5529
602 Ga0207705_10103581 3300025909 Bacteria 2096
603 Ga0207684_10000005 3300025910 Bacteria 736617
604 Ga0207684_10003260 3300025910 Bacteria 15924
605 Ga0207684_10004441 3300025910 Bacteria 13222
606 Ga0207684_10005617 3300025910 Bacteria 11534
607 Ga0207684_10009354 3300025910 Bacteria 8656
608 Ga0207684_10012753 3300025910 Bacteria 7289
609 Ga0207684_10025084 3300025910 Bacteria 5080
610 Ga0207684_10028101 3300025910 Bacteria 4791
611 Ga0207684_10028940 3300025910 Bacteria 4719
612 Ga0207684_10029611 3300025910 Bacteria 4660
613 Ga0207684_10036843 3300025910 Bacteria 4151
614 Ga0207684_10038792 3300025910 Bacteria 4042
615 Ga0207684_10069533 3300025910 Bacteria 2992
616 Ga0207684_10083858 3300025910 Bacteria 2714
617 Ga0207684_10218140 3300025910 Bacteria 1646
618 Ga0207684_10306439 3300025910 Bacteria 1369
619 Ga0207684_10350141 3300025910 Bacteria 1271
620 Ga0207707_10009889 3300025912 Bacteria 8270
621 Ga0207707_10011546 3300025912 Bacteria 7690
622 Ga0207707_10161872 3300025912 Bacteria 1956
623 Ga0207671_10007049 3300025914 Bacteria 9841
624 Ga0207693_10005749 3300025915 Bacteria 10291
625 Ga0207693_10046489 3300025915 Bacteria 3409
626 Ga0207663_10010383 3300025916 Bacteria 4957
627 Ga0207663_10016144 3300025916 Bacteria 4134
628 Ga0207663_10065598 3300025916 Bacteria 2321
629 Ga0207663_10070749 3300025916 Bacteria 2249
630 Ga0207663_10083237 3300025916 Bacteria 2101
631 Ga0207660_10028343 3300025917 Bacteria 3830
632 Ga0207662_10006837 3300025918 Bacteria 6174
633 Ga0207657_10057083 3300025919 Bacteria 3366
634 Ga0207657_10070945 3300025919 Bacteria 2951
635 Ga0207657_10081955 3300025919 Bacteria 2709
636 Ga0207649_10000481 3300025920 Bacteria 28440
637 Ga0207652_10027355 3300025921 Bacteria 4751
638 Ga0207646_10000306 3300025922 Bacteria 66698
639 Ga0207646_10000904 3300025922 Bacteria 38211
640 Ga0207646_10001068 3300025922 Bacteria 34893
641 Ga0207646_10001878 3300025922 Bacteria 25344
642 Ga0207646_10001879 3300025922 Bacteria 25340
643 Ga0207646_10002018 3300025922 Bacteria 24426
644 Ga0207646_10003799 3300025922 Bacteria 16802
645 Ga0207646_10008690 3300025922 Bacteria 10138
646 Ga0207646_10014232 3300025922 Bacteria 7563
647 Ga0207646_10019117 3300025922 Bacteria 6371
648 Ga0207646_10019967 3300025922 Bacteria 6216
649 Ga0207646_10020928 3300025922 Bacteria 6051
650 Ga0207646_10027578 3300025922 Bacteria 5178
651 Ga0207646_10039602 3300025922 Bacteria 4242
652 Ga0207646_10040603 3300025922 Bacteria 4184
653 Ga0207646_10040605 3300025922 Bacteria 4183
654 Ga0207646_10079040 3300025922 Bacteria 2940
655 Ga0207646_10081664 3300025922 Bacteria 2890
656 Ga0207646_10098422 3300025922 Bacteria 2621
657 Ga0207646_10125094 3300025922 Bacteria 2311
658 Ga0207646_10133779 3300025922 Bacteria 2232
659 Ga0207646_10142668 3300025922 Bacteria 2158
660 Ga0207646_10230493 3300025922 Bacteria 1673
661 Ga0207646_10337962 3300025922 Bacteria 1360
662 Ga0207681_10005829 3300025923 Bacteria 7555
663 Ga0207681_10017371 3300025923 Bacteria 4517
664 Ga0207681_10233504 3300025923 Bacteria 1429
665 Ga0207694_10061724 3300025924 Bacteria 2917
666 Ga0207650_10012436 3300025925 Bacteria 5877
667 Ga0207650_10132390 3300025925 Bacteria 1953
668 Ga0207650_10239137 3300025925 Bacteria 1467
669 Ga0207659_10006304 3300025926 Bacteria 7257
670 Ga0207659_10022477 3300025926 Bacteria 4199
671 Ga0207659_10140352 3300025926 Bacteria 1875
672 Ga0207687_10083882 3300025927 Bacteria 2308
673 Ga0207687_10104946 3300025927 Bacteria 2087
674 Ga0207687_10120910 3300025927 Bacteria 1958
675 Ga0207700_10013335 3300025928 Bacteria 5343
676 Ga0207700_10022927 3300025928 Bacteria 4292
677 Ga0207700_10036339 3300025928 Bacteria 3556
678 Ga0207664_10018945 3300025929 Bacteria 5077
679 Ga0207664_10035650 3300025929 Bacteria 3840
680 Ga0207664_10035676 3300025929 Bacteria 3839
681 Ga0207664_10189481 3300025929 Bacteria 1770
682 Ga0207644_10016798 3300025931 Bacteria 4929
683 Ga0207644_10037426 3300025931 Bacteria 3413
684 Ga0207644_10175141 3300025931 Bacteria 1678
685 Ga0207690_10062376 3300025932 Bacteria 2537
686 Ga0207690_10070686 3300025932 Bacteria 2405
687 Ga0207706_10057744 3300025933 Bacteria 3418
688 Ga0207706_10063640 3300025933 Bacteria 3247
689 Ga0207706_10116308 3300025933 Bacteria 2352
690 Ga0207706_10176804 3300025933 Bacteria 1875
691 Ga0207686_10005513 3300025934 Bacteria 6788
692 Ga0207686_10108448 3300025934 Bacteria 1868
693 Ga0207670_10023671 3300025936 Bacteria 3826
694 Ga0207669_10025096 3300025937 Bacteria 3214
695 Ga0207669_10027263 3300025937 Bacteria 3124
696 Ga0207669_10094392 3300025937 Bacteria 1957
697 Ga0207704_10003374 3300025938 Bacteria 7248
698 Ga0207704_10153778 3300025938 Bacteria 1627
699 Ga0207704_10206479 3300025938 Bacteria 1442
700 Ga0207665_10001209 3300025939 Bacteria 17430
701 Ga0207665_10017373 3300025939 Bacteria 4728
702 Ga0207691_10000719 3300025940 Bacteria 32701
703 Ga0207691_10006661 3300025940 Bacteria 11146
704 Ga0207691_10007536 3300025940 Bacteria 10474
705 Ga0207691_10035655 3300025940 Bacteria 4615
706 Ga0207691_10087000 3300025940 Bacteria 2803
707 Ga0207691_10124980 3300025940 Bacteria 2277
708 Ga0207711_10052135 3300025941 Bacteria 3505
709 Ga0207711_10305272 3300025941 Bacteria 1468
710 Ga0207711_10321455 3300025941 Bacteria 1430
711 Ga0207711_10372225 3300025941 Bacteria 1325
712 Ga0207689_10008872 3300025942 Bacteria 8727
713 Ga0207689_10066838 3300025942 Bacteria 2955
714 Ga0207689_10112337 3300025942 Bacteria 2240
715 Ga0207661_10183688 3300025944 Bacteria 1829
716 Ga0207661_10336795 3300025944 Bacteria 1359
717 Ga0207679_10018603 3300025945 Bacteria 4657
718 Ga0207667_10254348 3300025949 Bacteria 1797
719 Ga0207667_10305740 3300025949 Bacteria 1624
720 Ga0207667_10539705 3300025949 Bacteria 1180
721 Ga0207651_10019976 3300025960 Bacteria 4030
722 Ga0207651_10031516 3300025960 Bacteria 3390
723 Ga0207651_10031869 3300025960 Bacteria 3376
724 Ga0207651_10064541 3300025960 Bacteria 2563
725 Ga0207712_10053826 3300025961 Bacteria 2825
726 Ga0207712_10073921 3300025961 Bacteria 2460
727 Ga0207712_10198301 3300025961 Bacteria 1590
728 Ga0207668_10014626 3300025972 Bacteria 4859
729 Ga0207668_10018163 3300025972 Bacteria 4419
730 Ga0207668_10039088 3300025972 Bacteria 3190
731 Ga0207640_10030210 3300025981 Bacteria 3335
732 Ga0207640_10196025 3300025981 Bacteria 1526
733 Ga0207640_10276004 3300025981 Bacteria 1318
734 Ga0207658_10009327 3300025986 Bacteria 6655
735 Ga0207658_10083665 3300025986 Bacteria 2453
736 Ga0207703_10009990 3300026035 Bacteria 7445
737 Ga0207703_10096361 3300026035 Bacteria 2498
738 Ga0207703_10144447 3300026035 Bacteria 2068
739 Ga0207703_10159246 3300026035 Bacteria 1976
740 Ga0207703_10161344 3300026035 Bacteria 1964
741 Ga0207703_10214119 3300026035 Bacteria 1719
742 Ga0207703_10368781 3300026035 Bacteria 1326
743 Ga0207678_10007236 3300026067 Bacteria 9841
744 Ga0207678_10019308 3300026067 Bacteria 5987
745 Ga0207678_10033052 3300026067 Bacteria 4508
746 Ga0207678_10167138 3300026067 Bacteria 1878
747 Ga0207708_10007840 3300026075 Bacteria 7909
748 Ga0207708_10040242 3300026075 Bacteria 3563
749 Ga0207708_10045031 3300026075 Bacteria 3363
750 Ga0207708_10179926 3300026075 Bacteria 1679
751 Ga0207702_10090526 3300026078 Bacteria 2677
752 Ga0207702_10099207 3300026078 Bacteria 2567
753 Ga0207641_10009942 3300026088 Bacteria 7829
754 Ga0207641_10132098 3300026088 Bacteria 2243
755 Ga0207641_10251221 3300026088 Bacteria 1652
756 Ga0207648_10007992 3300026089 Bacteria 10318
757 Ga0207648_10015603 3300026089 Bacteria 6979
758 Ga0207648_10018397 3300026089 Bacteria 6328
759 Ga0207648_10047616 3300026089 Bacteria 3757
760 Ga0207648_10057851 3300026089 Bacteria 3382
761 Ga0207648_10162881 3300026089 Bacteria 1970
762 Ga0207676_10000817 3300026095 Bacteria 24260
763 Ga0207676_10003276 3300026095 Bacteria 11510
764 Ga0207676_10018645 3300026095 Bacteria 5051
765 Ga0207676_10024607 3300026095 Bacteria 4458
766 Ga0207676_10035277 3300026095 Bacteria 3795
767 Ga0207676_10147420 3300026095 Bacteria 2022
768 Ga0207674_10008460 3300026116 Bacteria 11885
769 Ga0207674_10200832 3300026116 Bacteria 1943
770 Ga0207675_100017933 3300026118 Bacteria 6602
771 Ga0207675_100034452 3300026118 Bacteria 4722
772 Ga0207683_10005401 3300026121 Bacteria 10949
773 Ga0207683_10012242 3300026121 Bacteria 7323
774 Ga0207683_10108782 3300026121 Bacteria 2481
775 Ga0207683_10200653 3300026121 Bacteria 1813
776 Ga0209969_1000694 3300027360 Bacteria 4514
777 Ga0209981_1002338 3300027378 Bacteria 2409
778 Ga0209996_1000221 3300027395 Bacteria 7351
779 Ga0209984_1001938 3300027424 Bacteria 2283
780 Ga0209968_1000718 3300027526 Bacteria 5102
781 Ga0209999_1001534 3300027543 Bacteria 3973
782 Ga0209982_1000703 3300027552 Bacteria 4268
783 Ga0209970_1004361 3300027614 Bacteria 2352
784 Ga0210002_1001800 3300027617 Bacteria 3053
785 Ga0209983_1008071 3300027665 Bacteria 2152
786 Ga0209588_1000042 3300027671 Bacteria 59013
787 Ga0209588_1000551 3300027671 Bacteria 9632
788 Ga0209971_1000037 3300027682 Bacteria 45920
789 Ga0209966_1001107 3300027695 Bacteria 4852
790 Ga0209998_10000042 3300027717 Bacteria 51743
791 Ga0209974_10003125 3300027876 Bacteria 5996
792 Ga0207428_10023759 3300027907 Bacteria 5149
793 Ga0207428_10071496 3300027907 Bacteria 2725
794 Ga0207428_10135386 3300027907 Bacteria 1884
795 Ga0265356_1000014 3300028017 Bacteria 28261
796 Ga0268266_10000144 3300028379 Bacteria 135508
797 Ga0268266_10001474 3300028379 Bacteria 27938
798 Ga0268266_10009438 3300028379 Bacteria 8588
799 Ga0268266_10038515 3300028379 Bacteria 4069
800 Ga0268266_10062679 3300028379 Bacteria 3210
801 Ga0268265_10017356 3300028380 Bacteria 4965
802 Ga0268265_10042547 3300028380 Bacteria 3372
803 Ga0268265_10047694 3300028380 Bacteria 3211
804 Ga0268265_10051356 3300028380 Bacteria 3112
805 Ga0268265_10211464 3300028380 Bacteria 1690
806 Ga0268264_10000257 3300028381 Bacteria 96251
807 Ga0265319_1008416 3300028563 Bacteria 4521
808 Ga0265318_10000563 3300028577 Bacteria 26166
809 Ga0265336_10002162 3300028666 Bacteria 8304
810 Ga0265338_10005213 3300028800 Bacteria 17044
811 Ga0265338_10098315 3300028800 Bacteria 2395
812 Ga0265324_10002494 3300029957 Bacteria 9343
813 Ga0265332_10006760 3300031238 Bacteria 5197
814 Ga0265320_10000328 3300031240 Bacteria 38910
815 Ga0265320_10011378 3300031240 Bacteria 5239
816 Ga0265329_10000518 3300031242 Bacteria 19897
817 Ga0265340_10011233 3300031247 Bacteria 4768
818 Ga0265339_10001696 3300031249 Bacteria 16254
819 Ga0265339_10002679 3300031249 Bacteria 12656
820 Ga0265331_10000021 3300031250 Bacteria 242632
821 Ga0265316_10003604 3300031344 Bacteria 15612
822 Ga0265316_10010196 3300031344 Bacteria 8581
823 Ga0265316_10017275 3300031344 Bacteria 6242
824 Ga0307513_10078776 3300031456 Bacteria 3407
825 Ga0307408_100040831 3300031548 Bacteria 3287
826 Ga0307408_100139665 3300031548 Bacteria 1900
827 Ga0307408_100210302 3300031548 Bacteria 1580
828 Ga0265313_10000730 3300031595 Bacteria 33796
829 Ga0316575_10012678 3300031665 Bacteria 3139
830 Ga0316579_10045935 3300031691 Bacteria 2037
831 Ga0265314_10000714 3300031711 Bacteria 40123
832 Ga0265314_10012056 3300031711 Bacteria 7086
833 Ga0265342_10000032 3300031712 Bacteria 150633
834 Ga0265342_10012485 3300031712 Bacteria 5752
835 Ga0265342_10047705 3300031712 Bacteria 2570
836 Ga0316578_10157651 3300031728 Bacteria 1368
837 Ga0307405_10010527 3300031731 Bacteria 4800
838 Ga0307405_10062971 3300031731 Bacteria 2351
839 Ga0316577_10132362 3300031733 Bacteria 1403
840 Ga0307413_10000706 3300031824 Bacteria 11455
841 Ga0307413_10098143 3300031824 Bacteria 1928
842 Ga0307413_10121186 3300031824 Bacteria 1772
843 Ga0307413_10141983 3300031824 Bacteria 1661
844 Ga0307410_10007237 3300031852 Bacteria 6060
845 Ga0307410_10034567 3300031852 Bacteria 3275
846 Ga0307410_10047798 3300031852 Bacteria 2862
847 Ga0307410_10068439 3300031852 Bacteria 2452
848 Ga0307410_10071045 3300031852 Bacteria 2413
849 Ga0326468_10001123 3300031889 Bacteria 2465
850 Ga0307406_10068626 3300031901 Bacteria 2315
851 Ga0307406_10074082 3300031901 Bacteria 2241
852 Ga0307407_10025199 3300031903 Bacteria 3131
853 Ga0307407_10031047 3300031903 Bacteria 2889
854 Ga0307407_10054402 3300031903 Bacteria 2308
855 Ga0307407_10055546 3300031903 Bacteria 2289
856 Ga0307412_10002301 3300031911 Bacteria 10575
857 Ga0307412_10067334 3300031911 Bacteria 2431
858 Ga0307412_10222922 3300031911 Bacteria 1446
859 Ga0307409_100020122 3300031995 Bacteria 4540
860 Ga0307409_100023306 3300031995 Bacteria 4286
861 Ga0307409_100095140 3300031995 Bacteria 2453
862 Ga0307409_100098678 3300031995 Bacteria 2416
863 Ga0307416_100000731 3300032002 Bacteria 17101
864 Ga0307416_100010701 3300032002 Bacteria 6078
865 Ga0307416_100022831 3300032002 Bacteria 4526
866 Ga0307416_100036567 3300032002 Bacteria 3767
867 Ga0307416_100050355 3300032002 Bacteria 3319
868 Ga0307416_100245947 3300032002 Bacteria 1737
869 Ga0307416_100282787 3300032002 Bacteria 1637
870 Ga0307414_10014074 3300032004 Bacteria 4781
871 Ga0307414_10028084 3300032004 Bacteria 3645
872 Ga0307414_10184890 3300032004 Bacteria 1680
873 Ga0307411_10008080 3300032005 Bacteria 5423
874 Ga0307411_10010265 3300032005 Bacteria 4980
875 Ga0307411_10036238 3300032005 Bacteria 3089
876 Ga0307411_10133724 3300032005 Bacteria 1817
877 Ga0307415_100051543 3300032126 Bacteria 2793
878 Ga0307415_100136852 3300032126 Bacteria 1864
879 Ga0307510_10103880 3300033180 Bacteria 2617
880 Ga0373926_0000212 3300035083 Bacteria 13622
881 Ga0373940_0003892 3300035088 Bacteria 3102
882 Ga0373932_0015243 3300035112 Bacteria 1946
883 Ga0373932_0051314 3300035112 Bacteria 1225
884 Ga0373936_0015258 3300035113 Bacteria 2942
885 Ga0373941_0019538 3300035115 Bacteria 1888
886 Ga0373953_0000010 3300035117 Bacteria 47815
887 Ga0373953_0004418 3300035117 Bacteria 4483
888 Ga0373956_0000605 3300035119 Bacteria 14705
889 Ga0373957_0000044 3300035120 Bacteria 32547
890 Ga0373957_0018881 3300035120 Bacteria 2419
891 Ga0373960_0009615 3300035121 Bacteria 2347
892 Ga0373960_0012237 3300035121 Bacteria 2129
893 Ga0373960_0022120 3300035121 Bacteria 1699
894 Ga0373960_0037485 3300035121 Bacteria 1386
895 Ga0373943_0083077 3300035170 Bacteria 1646
896 Ga0373955_0000022 3300035172 Bacteria 61667
897 Ga0373955_0095709 3300035172 Bacteria 1699
898 Ga0316574_0003426 3300035398 Bacteria 8175
899 Ga0316574_0022931 3300035398 Unclassified 3722
900 Ga0373924_0000255 3300035410 Bacteria 16400
901 Ga0373931_0114233 3300035691 Bacteria 1536
902 Ga0373935_0001002 3300035692 Bacteria 15360
903 Ga0373935_0026021 3300035692 Bacteria 3607
904 Ga0373935_0060339 3300035692 Bacteria 2426
905 Ga0373927_0209016 3300035695 Bacteria 1282
906 Ga0373933_0000023 3300035724 Bacteria 94091
907 Ga0373947_0000051 3300035725 Bacteria 59272
908 Ga0373937_0000091 3300036401 Bacteria 83145
909 Ga0316582_0012184 3300036647 Bacteria 4788
910 Ga0316582_0021198 3300036647 Bacteria 3835
911 Ga0316584_0096753 3300036712 Bacteria 2210
912 Ga0316584_0186786 3300036712 Bacteria 1533
913 Ga0373925_0007606 3300037068 Bacteria 7893
914 Ga0373925_0147056 3300037068 Bacteria 1848
915 Ga0395899_0165776 3300037312 Bacteria 1559
916 Ga0395900_0002978 3300037418 Bacteria 18424
917 Ga0395900_0004019 3300037418 Bacteria 15697
918 Ga0395900_0104573 3300037418 Bacteria 2909
919 Ga0395900_0105528 3300037418 Bacteria 2895
920 Ga0395900_0206153 3300037418 Bacteria 1987
921 Ga0395900_0447029 3300037418 Bacteria 1249
922 Ga0395898_0048743 3300037466 Bacteria 4153
923 Ga0395898_0254375 3300037466 Bacteria 1675
924 Ga0395898_0336597 3300037466 Bacteria 1439
925 Ga0395905_0006812 3300037471 Bacteria 11443
926 Ga0395905_0045484 3300037471 Bacteria 4117
927 Ga0395905_0204128 3300037471 Bacteria 1853
928 Ga0316581_0004634 3300037588 Bacteria 3522
929 Ga0316581_0026076 3300037588 Bacteria 1742
930 Ga0436364_0273345 3300037853 Bacteria 2794207
931 Ga0436364_0290389 3300037853 Bacteria 159315
932 Ga0436364_0394521 3300037853 Bacteria 1964
933 Ga0436364_0413399 3300037853 Bacteria 3736
934 Ga0436364_0711490 3300037853 Bacteria 21692
935 Ga0436364_0830486 3300037853 Bacteria 46812
936 Ga0395901_0000632 3300038443 Bacteria 40925
937 Ga0395901_0244606 3300038443 Bacteria 1870
938 Ga0436365_0340359 3300039437 Bacteria 6060
939 Ga0436365_0598584 3300039437 Bacteria 7202
940 Ga0436365_1083552 3300039437 Bacteria 2279
941 Ga0436365_1227182 3300039437 Bacteria 25559
942 Ga0436365_1624907 3300039437 Bacteria 1944
943 Ga0436360_0866133 3300039438 Bacteria 2703
944 Ga0436361_0017732 3300039447 Bacteria 10618
945 Ga0436361_0825301 3300039447 Bacteria 14226
946 Ga0436361_1168137 3300039447 Bacteria 1402
947 Ga0436363_0384313 3300039450 Bacteria 4613
948 Ga0436363_0916663 3300039450 Bacteria 1516
949 Ga0436363_0917829 3300039450 Bacteria 1874
950 Ga0436362_0194955 3300039453 Bacteria 3802
951 Ga0436362_0925701 3300039453 Bacteria 3626
952 Ga0436362_0945875 3300039453 Bacteria 2451
953 Ga0436362_1112396 3300039453 Bacteria 1979
954 Ga0451798_0296048 3300041458 Bacteria 1655
955 Ga0451804_0287274 3300041463 Bacteria 2870
956 Ga0451807_0164003 3300041486 Bacteria 4572
957 Ga0451835_0443333 3300041492 Bacteria 5038
958 Ga0451845_0965238 3300041501 Bacteria 3100
959 Ga0451849_0647552 3300041505 Bacteria 1571
960 Ga0451855_0829026 3300041511 Bacteria 2278
961 Ga0451853_0159403 3300041512 Bacteria 6114
962 Ga0450889_003072 3300042144 Bacteria 1650
963 Ga0439458_0007203 3300042157 Bacteria 2475
964 Ga0439435_0009668 3300042436 Bacteria 2268
965 Ga0439460_0004907 3300042461 Bacteria 3268
966 Ga0450918_002582 3300042531 Bacteria 3425
967 Ga0451577_0000295 3300042876 Bacteria 96993
968 Ga0451577_0002725 3300042876 Bacteria 20541
969 Ga0451577_0014229 3300042876 Bacteria 7416
970 Ga0451577_0071971 3300042876 Bacteria 3083
971 Ga0466972_0051981 3300044658 Bacteria 1976
972 Ga0466972_0093895 3300044658 Bacteria 1422
973 Ga0453683_0024013 3300044673 Bacteria 3882
974 Ga0453683_0076361 3300044673 Bacteria 2097
975 Ga0453683_0092386 3300044673 Bacteria 1897
976 Ga0453683_0137979 3300044673 Bacteria 1538
977 Ga0466966_0043491 3300044684 Bacteria 2879
978 Ga0466961_0165271 3300044693 Bacteria 1378
979 Ga0466963_0000147 3300044694 Bacteria 27926
980 Ga0466963_0033120 3300044694 Bacteria 3352
981 Ga0466964_0004854 3300044706 Bacteria 4970
982 Ga0466964_0064496 3300044706 Bacteria 1532
983 Ga0453684_0000012 3300044712 Bacteria 1062512
984 Ga0453684_0000169 3300044712 Bacteria 289762
985 Ga0453684_0000564 3300044712 Bacteria 139611
986 Ga0453684_0003491 3300044712 Bacteria 35316
987 Ga0453684_0003992 3300044712 Bacteria 32219
988 Ga0453684_0007847 3300044712 Bacteria 19434
989 Ga0453684_0016307 3300044712 Bacteria 11633
990 Ga0453684_0026404 3300044712 Bacteria 8389
991 Ga0453684_0095727 3300044712 Bacteria 3648
992 Ga0453684_0188363 3300044712 Bacteria 2415
993 Ga0466968_0001371 3300044735 Bacteria 8707
994 Ga0466968_0035820 3300044735 Bacteria 2078
995 Ga0466970_0072908 3300044765 Bacteria 1848
996 Ga0466957_0002573 3300044842 Bacteria 9761
997 Ga0466960_0003141 3300044901 Bacteria 6334
998 Ga0466960_0070903 3300044901 Bacteria 1734
999 Ga0466959_0012028 3300045049 Bacteria 6243
1000 Ga0466959_0079386 3300045049 Bacteria 2366
1001 Ga0451576_0000009 3300045051 Bacteria 712666
1002 Ga0451576_0004398 3300045051 Bacteria 18344
1003 Ga0451576_0010179 3300045051 Bacteria 10813
1004 Ga0451576_0133598 3300045051 Bacteria 2587
1005 Ga0451576_0165388 3300045051 Unclassified 2308
1006 Ga0451576_0317118 3300045051 Bacteria 1631
1007 Ga0451576_0335230 3300045051 Bacteria 1583
1008 Ga0466958_0000845 3300045836 Bacteria 13587
1009 Ga0466958_0115978 3300045836 Bacteria 1674
1010 Ga0466967_0016308 3300045976 Bacteria 5855
1011 Ga0466967_0037691 3300045976 Bacteria 4140
1012 Ga0466967_0165975 3300045976 Bacteria 2075
1013 Ga0495592_0000066 3300046454 Bacteria 95762
1014 Ga0495592_0063402 3300046454 Bacteria 2711
1015 Ga0495629_0001099 3300046459 Bacteria 21423
1016 Ga0495629_0008424 3300046459 Bacteria 7588
1017 Ga0495641_0005969 3300046461 Bacteria 8026
1018 Ga0495651_0000062 3300046462 Bacteria 80165
1019 Ga0495651_0021723 3300046462 Bacteria 4988
1020 Ga0495653_0001563 3300046463 Bacteria 17910
1021 Ga0495653_0022730 3300046463 Bacteria 5073
1022 Ga0495650_0033561 3300046471 Bacteria 2283
1023 Ga0495582_0011615 3300046473 Bacteria 4854
1024 Ga0495639_0005202 3300046475 Bacteria 5590
1025 Ga0495662_0010535 3300046476 Bacteria 4523
1026 Ga0495664_0001695 3300046477 Bacteria 11711
1027 Ga0495584_0060814 3300046491 Bacteria 1899
1028 Ga0495594_0006555 3300046499 Bacteria 5988
1029 Ga0495608_0000052 3300046511 Bacteria 94085
1030 Ga0495608_0028826 3300046511 Bacteria 3772
1031 Ga0495608_0186605 3300046511 Bacteria 1310
1032 Ga0495618_0165430 3300046514 Bacteria 1408
1033 Ga0495628_0000341 3300046516 Bacteria 42338
1034 Ga0495630_0013891 3300046517 Bacteria 5857
1035 Ga0495642_0030910 3300046528 Bacteria 2145
1036 Ga0495652_0000727 3300046529 Bacteria 38196
1037 Ga0495652_0185090 3300046529 Bacteria 1594
1038 Ga0495665_0019211 3300046531 Bacteria 3673
1039 Ga0495586_0003596 3300046535 Bacteria 8303
1040 Ga0495586_0087441 3300046535 Bacteria 1718
1041 Ga0495587_0000059 3300046536 Bacteria 94063
1042 Ga0495587_0052430 3300046536 Bacteria 2407
1043 Ga0495598_0004342 3300046537 Bacteria 3063
1044 Ga0495645_0008372 3300046543 Bacteria 7220
1045 Ga0495645_0040174 3300046543 Bacteria 3413
1046 Ga0495667_0000119 3300046559 Bacteria 56812
1047 Ga0495634_0012928 3300046642 Bacteria 6039
1048 Ga0495635_0005233 3300046663 Bacteria 9027
1049 Ga0495659_0008944 3300046664 Bacteria 3190
1050 Ga0495659_0032152 3300046664 Bacteria 1835
1051 Ga0495659_0034158 3300046664 Bacteria 1788
1052 Ga0495657_0000062 3300046675 Bacteria 96063
1053 Ga0495657_0048825 3300046675 Bacteria 2854
1054 Ga0495599_0000116 3300046678 Bacteria 53236
1055 Ga0495623_0000060 3300046679 Bacteria 67734
1056 Ga0495623_0054461 3300046679 Bacteria 2523
1057 Ga0495646_0003166 3300046680 Bacteria 10215
1058 Ga0495658_0002224 3300046683 Bacteria 9809
1059 Ga0495669_0008295 3300046684 Bacteria 4363
1060 Ga0495669_0020388 3300046684 Bacteria 2868
1061 Ga0495613_0002740 3300046689 Bacteria 13235
1062 Ga0495613_0013863 3300046689 Bacteria 5980
1063 Ga0495624_0011121 3300046690 Bacteria 6191
1064 Ga0495624_0152128 3300046690 Bacteria 1415
1065 Ga0495671_0114049 3300046692 Bacteria 1320
1066 Ga0495600_0003968 3300046809 Bacteria 8788
1067 Ga0495581_0003301 3300047315 Bacteria 9269
1068 Ga0495581_0004247 3300047315 Bacteria 8263
1069 Ga0495604_0000059 3300047317 Bacteria 96063
1070 Ga0495604_0160573 3300047317 Bacteria 1588
1071 Ga0495636_0042487 3300047318 Bacteria 1889
1072 Ga0495674_0260147 3300047319 Bacteria 1426
1073 Ga0495674_0332827 3300047319 Bacteria 1235
1074 Ga0495680_0000125 3300047322 Bacteria 75140
1075 Ga0495680_0001823 3300047322 Bacteria 22500
1076 Ga0495675_0001638 3300047444 Bacteria 13445
1077 Ga0495675_0053631 3300047444 Bacteria 2559
1078 Ga0495593_0004457 3300047673 Bacteria 8322
1079 Ga0495602_0000193 3300048088 Bacteria 57395
1080 Ga0495602_0168573 3300048088 Bacteria 1701
1081 Ga0496100_0015256 3300048903 Bacteria 4483
1082 Ga0496100_0036655 3300048903 Unclassified 3096
1083 Ga0496100_0046213 3300048903 Bacteria 2798
1084 Ga0496101_0013434 3300048904 Bacteria 5486
1085 Ga0496101_0014201 3300048904 Bacteria 5350
1086 Ga0496101_0056243 3300048904 Bacteria 2844
1087 Ga0496102_0005374 3300048905 Bacteria 10876
1088 Ga0496102_0025002 3300048905 Bacteria 5313
1089 Ga0496102_0032855 3300048905 Bacteria 4663
1090 Ga0496102_0039429 3300048905 Bacteria 4269
1091 Ga0496102_0110874 3300048905 Bacteria 2558
1092 Ga0496102_0144225 3300048905 Bacteria 2234
1093 Ga0496102_0152597 3300048905 Bacteria 2171
1094 Ga0496102_0160279 3300048905 Bacteria 2116
1095 Ga0496102_0411605 3300048905 Bacteria 1270
1096 Ga0496103_0008229 3300048906 Bacteria 6192
1097 Ga0496103_0023018 3300048906 Bacteria 3755
1098 Ga0496103_0045628 3300048906 Bacteria 2704
1099 Ga0496104_0006116 3300048907 Bacteria 10567
1100 Ga0496104_0007687 3300048907 Bacteria 9543
1101 Ga0496104_0008644 3300048907 Bacteria 9058
1102 Ga0496104_0030987 3300048907 Bacteria 4971
1103 Ga0496104_0047881 3300048907 Bacteria 4030
1104 Ga0496104_0056789 3300048907 Bacteria 3703
1105 Ga0496104_0089504 3300048907 Bacteria 2940
1106 Ga0496105_0003072 3300048908 Bacteria 12270
1107 Ga0496105_0033676 3300048908 Bacteria 4209
1108 Ga0496105_0051652 3300048908 Bacteria 3396
1109 Ga0496106_0002638 3300048909 Bacteria 13335
1110 Ga0496106_0022234 3300048909 Bacteria 4710
1111 Ga0496106_0027205 3300048909 Bacteria 4259
1112 Ga0496106_0107123 3300048909 Bacteria 2173
1113 Ga0496107_0022831 3300048910 Bacteria 4423
1114 Ga0496107_0031116 3300048910 Bacteria 3806
1115 Ga0496107_0041057 3300048910 Bacteria 3322
1116 Ga0496108_0002133 3300048911 Bacteria 15845
1117 Ga0496108_0004282 3300048911 Bacteria 11486
1118 Ga0496108_0006877 3300048911 Bacteria 9205
1119 Ga0496108_0008961 3300048911 Bacteria 8109
1120 Ga0496108_0078893 3300048911 Bacteria 2787
1121 Ga0496108_0082127 3300048911 Bacteria 2732
1122 Ga0496108_0118690 3300048911 Bacteria 2267
1123 Ga0496108_0163098 3300048911 Bacteria 1927
1124 Ga0496109_0002708 3300048912 Bacteria 14847
1125 Ga0496109_0004347 3300048912 Bacteria 11841
1126 Ga0496109_0005698 3300048912 Bacteria 10427
1127 Ga0496109_0005786 3300048912 Bacteria 10348
1128 Ga0496109_0020508 3300048912 Bacteria 5838
1129 Ga0496109_0204661 3300048912 Bacteria 1856
1130 Ga0496110_0002856 3300048913 Bacteria 13037
1131 Ga0496110_0023245 3300048913 Bacteria 5270
1132 Ga0496110_0050482 3300048913 Bacteria 3652
1133 Ga0496110_0138237 3300048913 Bacteria 2202
1134 Ga0496110_0182789 3300048913 Bacteria 1904
1135 Ga0496110_0220363 3300048913 Bacteria 1725
1136 Ga0496111_0000451 3300048914 Bacteria 20900
1137 Ga0496111_0020534 3300048914 Bacteria 4599
1138 Ga0496111_0053830 3300048914 Bacteria 2908
1139 Ga0496111_0065484 3300048914 Bacteria 2638
1140 Ga0496111_0213954 3300048914 Bacteria 1432
1141 Ga0496112_0005762 3300048915 Bacteria 10773
1142 Ga0496112_0009919 3300048915 Bacteria 8615
1143 Ga0496112_0011204 3300048915 Bacteria 8177
1144 Ga0496112_0034784 3300048915 Bacteria 4903
1145 Ga0496112_0034922 3300048915 Bacteria 4893
1146 Ga0496112_0035434 3300048915 Bacteria 4862
1147 Ga0496112_0045971 3300048915 Bacteria 4280
1148 Ga0496112_0047502 3300048915 Bacteria 4211
1149 Ga0496112_0095053 3300048915 Bacteria 2951
1150 Ga0496112_0096960 3300048915 Bacteria 2919
1151 Ga0496112_0130976 3300048915 Bacteria 2479
1152 Ga0496112_0195410 3300048915 Bacteria 1984
1153 Ga0496112_0234516 3300048915 Bacteria 1789
1154 Ga0496112_0280007 3300048915 Bacteria 1615
1155 Ga0496113_0001491 3300048916 Bacteria 13090
1156 Ga0496113_0014627 3300048916 Bacteria 5362
1157 Ga0496113_0036024 3300048916 Bacteria 3623
1158 Ga0496113_0082646 3300048916 Bacteria 2463
1159 Ga0496113_0102953 3300048916 Bacteria 2214
1160 Ga0496113_0176422 3300048916 Bacteria 1693
1161 Ga0496113_0301755 3300048916 Bacteria 1282
1162 Ga0496114_0001126 3300048917 Bacteria 20197
1163 Ga0496114_0005674 3300048917 Bacteria 9789
1164 Ga0496114_0009291 3300048917 Bacteria 7802
1165 Ga0496114_0035897 3300048917 Bacteria 4096
1166 Ga0496114_0039963 3300048917 Bacteria 3882
1167 Ga0496114_0067733 3300048917 Bacteria 2995
1168 Ga0496114_0162668 3300048917 Bacteria 1942
1169 Ga0496115_0011160 3300048918 Bacteria 6730
1170 Ga0496115_0014127 3300048918 Bacteria 6042
1171 Ga0496115_0018207 3300048918 Bacteria 5388
1172 Ga0496115_0204646 3300048918 Bacteria 1630
1173 Ga0496115_0222524 3300048918 Bacteria 1557
1174 Ga0501031_0018229 3300049568 Bacteria 4568
1175 Ga0501032_0003033 3300049569 Bacteria 13019
1176 Ga0501032_0003383 3300049569 Bacteria 12235
1177 Ga0501032_0036382 3300049569 Bacteria 3360
1178 Ga0501032_0193020 3300049569 Bacteria 1331
1179 Ga0501033_0006909 3300049570 Bacteria 8861
1180 Ga0501033_0007700 3300049570 Bacteria 8356
1181 Ga0501033_0061340 3300049570 Bacteria 2772
1182 Ga0501034_0000349 3300049571 Bacteria 79675
1183 Ga0501034_0027970 3300049571 Bacteria 5733
1184 Ga0501034_0074847 3300049571 Bacteria 3394
1185 Ga0501034_0183138 3300049571 Bacteria 2059
1186 Ga0501034_0189379 3300049571 Bacteria 2020
1187 Ga0501034_0302382 3300049571 Bacteria 1536
1188 Ga0501036_0011871 3300049572 Bacteria 7220
1189 Ga0501036_0025917 3300049572 Bacteria 4947
1190 Ga0501036_0037388 3300049572 Bacteria 4107
1191 Ga0501036_0040976 3300049572 Bacteria 3919
1192 Ga0501036_0109704 3300049572 Bacteria 2332
1193 Ga0501036_0119634 3300049572 Bacteria 2224
1194 Ga0501036_0190753 3300049572 Bacteria 1724
1195 Ga0501036_0202789 3300049572 Bacteria 1668
1196 Ga0501036_0236403 3300049572 Bacteria 1532
1197 Ga0501037_0002059 3300049573 Bacteria 14585
1198 Ga0501037_0003998 3300049573 Bacteria 10688
1199 Ga0501038_0000194 3300049574 Bacteria 52581
1200 Ga0501038_0002739 3300049574 Bacteria 16418
1201 Ga0501038_0004476 3300049574 Bacteria 12994
1202 Ga0501038_0011652 3300049574 Bacteria 8019
1203 Ga0501038_0019954 3300049574 Bacteria 6033
1204 Ga0501038_0144855 3300049574 Bacteria 1940
1205 Ga0501038_0156056 3300049574 Bacteria 1858
1206 Ga0501039_0008614 3300049575 Bacteria 7775
1207 Ga0501039_0024142 3300049575 Bacteria 4669
1208 Ga0501039_0025545 3300049575 Bacteria 4539
1209 Ga0501039_0093033 3300049575 Bacteria 2350
1210 Ga0501039_0301256 3300049575 Bacteria 1260
1211 Ga0501040_0000201 3300049576 Bacteria 34643
1212 Ga0501040_0000736 3300049576 Bacteria 20265
1213 Ga0501040_0009508 3300049576 Bacteria 6339
1214 Ga0501040_0027369 3300049576 Bacteria 3838
1215 Ga0501040_0087333 3300049576 Bacteria 2166
1216 Ga0501040_0111579 3300049576 Bacteria 1912
1217 Ga0501040_0171050 3300049576 Bacteria 1538
1218 Ga0501041_0001652 3300049577 Bacteria 12472
1219 Ga0501041_0001679 3300049577 Bacteria 12398
1220 Ga0501041_0045372 3300049577 Bacteria 2672
1221 Ga0501042_0000136 3300049578 Bacteria 31946
1222 Ga0501042_0005358 3300049578 Bacteria 8250
1223 Ga0501042_0010070 3300049578 Bacteria 6320
1224 Ga0501042_0011987 3300049578 Bacteria 5860
1225 Ga0501042_0021094 3300049578 Bacteria 4536
1226 Ga0501042_0021270 3300049578 Bacteria 4518
1227 Ga0501042_0034067 3300049578 Bacteria 3612
1228 Ga0501042_0043005 3300049578 Bacteria 3216
1229 Ga0501042_0132836 3300049578 Bacteria 1794
1230 Ga0501043_0034274 3300049579 Bacteria 3993
1231 Ga0501043_0089788 3300049579 Bacteria 2415
1232 Ga0501043_0104493 3300049579 Bacteria 2226
1233 Ga0501046_0006646 3300049580 Bacteria 10217
1234 Ga0501046_0011474 3300049580 Bacteria 7572
1235 Ga0501046_0016161 3300049580 Bacteria 6258
1236 Ga0501046_0019262 3300049580 Bacteria 5660
1237 Ga0501046_0022694 3300049580 Bacteria 5169
1238 Ga0501046_0029689 3300049580 Bacteria 4444
1239 Ga0501046_0030288 3300049580 Bacteria 4393
1240 Ga0501046_0038871 3300049580 Bacteria 3816
1241 Ga0501046_0072456 3300049580 Bacteria 2674
1242 Ga0501046_0094309 3300049580 Bacteria 2300
1243 Ga0501047_0009484 3300049581 Bacteria 9197
1244 Ga0501047_0019101 3300049581 Bacteria 6576
1245 Ga0501047_0038159 3300049581 Bacteria 4646
1246 Ga0501047_0051539 3300049581 Bacteria 3978
1247 Ga0501047_0080691 3300049581 Bacteria 3127
1248 Ga0501047_0102699 3300049581 Bacteria 2738
1249 Ga0501047_0133037 3300049581 Bacteria 2367
1250 Ga0501048_0000746 3300049582 Bacteria 23814
1251 Ga0501048_0014166 3300049582 Bacteria 5909
1252 Ga0501048_0030914 3300049582 Bacteria 3875
1253 Ga0501048_0031622 3300049582 Bacteria 3828
1254 Ga0501048_0051704 3300049582 Bacteria 2924
1255 Ga0501048_0136663 3300049582 Bacteria 1732
1256 Ga0501067_0003282 3300049583 Bacteria 8908
1257 Ga0501067_0007264 3300049583 Bacteria 6151
1258 Ga0501067_0034562 3300049583 Bacteria 2805
1259 Ga0501068_0015278 3300049584 Bacteria 4406
1260 Ga0501068_0048138 3300049584 Bacteria 2573
1261 Ga0501068_0054315 3300049584 Bacteria 2427
1262 Ga0501068_0057085 3300049584 Bacteria 2366
1263 Ga0501068_0068543 3300049584 Bacteria 2162
1264 Ga0501068_0086469 3300049584 Bacteria 1930
1265 Ga0501069_0005632 3300049585 Bacteria 6517
1266 Ga0501069_0038958 3300049585 Bacteria 2624
1267 Ga0501070_0002988 3300049586 Bacteria 14711
1268 Ga0501070_0004715 3300049586 Bacteria 11683
1269 Ga0501070_0014953 3300049586 Bacteria 6529
1270 Ga0501070_0024433 3300049586 Bacteria 5069
1271 Ga0501071_0009794 3300049587 Bacteria 6395
1272 Ga0501071_0015913 3300049587 Bacteria 5167
1273 Ga0501071_0017791 3300049587 Bacteria 4910
1274 Ga0501071_0017977 3300049587 Bacteria 4889
1275 Ga0501071_0018406 3300049587 Bacteria 4835
1276 Ga0501071_0047035 3300049587 Bacteria 3099
1277 Ga0501071_0140324 3300049587 Bacteria 1799
1278 Ga0501071_0153464 3300049587 Bacteria 1719
1279 Ga0501071_0213716 3300049587 Bacteria 1450
1280 Ga0501072_0002154 3300049588 Bacteria 14707
1281 Ga0501072_0021126 3300049588 Bacteria 5050
1282 Ga0501072_0024988 3300049588 Bacteria 4651
1283 Ga0501072_0066999 3300049588 Bacteria 2833
1284 Ga0501072_0079703 3300049588 Bacteria 2593
1285 Ga0501072_0082953 3300049588 Bacteria 2541
1286 Ga0501072_0132127 3300049588 Bacteria 1990
1287 Ga0501073_0016233 3300049589 Bacteria 5397
1288 Ga0501073_0017742 3300049589 Bacteria 5151
1289 Ga0501073_0036911 3300049589 Bacteria 3471
1290 Ga0501073_0056749 3300049589 Bacteria 2739
1291 Ga0501073_0071880 3300049589 Bacteria 2410
1292 Ga0501073_0233871 3300049589 Bacteria 1269
1293 Ga0501074_0001411 3300049590 Bacteria 16000
1294 Ga0501074_0013238 3300049590 Bacteria 5998
1295 Ga0501074_0016444 3300049590 Bacteria 5372
1296 Ga0501074_0016629 3300049590 Bacteria 5338
1297 Ga0501074_0017399 3300049590 Bacteria 5215
1298 Ga0501074_0017824 3300049590 Bacteria 5160
1299 Ga0501074_0035170 3300049590 Bacteria 3629
1300 Ga0501074_0169699 3300049590 Bacteria 1558
1301 Ga0501075_0000083 3300049591 Bacteria 43108
1302 Ga0501075_0012164 3300049591 Bacteria 6111
1303 Ga0501075_0018914 3300049591 Bacteria 4993
1304 Ga0501075_0027422 3300049591 Bacteria 4198
1305 Ga0501075_0027650 3300049591 Bacteria 4181
1306 Ga0501075_0053275 3300049591 Bacteria 3043
1307 Ga0501075_0068919 3300049591 Bacteria 2673
1308 Ga0501075_0071943 3300049591 Bacteria 2614
1309 Ga0501075_0080870 3300049591 Bacteria 2460
1310 Ga0501075_0107743 3300049591 Bacteria 2118
1311 Ga0501075_0198291 3300049591 Bacteria 1531
1312 Ga0501075_0201364 3300049591 Bacteria 1518
1313 Ga0501075_0214054 3300049591 Bacteria 1470
1314 Ga0501076_0001623 3300049592 Bacteria 15183
1315 Ga0501076_0002288 3300049592 Bacteria 13104
1316 Ga0501076_0154502 3300049592 Bacteria 1867
1317 Ga0501076_0204415 3300049592 Bacteria 1613
1318 Ga0501076_0208975 3300049592 Bacteria 1594
1319 Ga0501076_0248932 3300049592 Bacteria 1454
1320 Ga0501077_0001472 3300049593 Bacteria 14179
1321 Ga0501077_0038239 3300049593 Bacteria 3055
1322 Ga0501077_0042658 3300049593 Bacteria 2884
1323 Ga0501077_0045850 3300049593 Bacteria 2777
1324 Ga0501233_004561 3300049668 Bacteria 2544
1325 Ga0501236_005167 3300049670 Bacteria 1573
1326 Ga0501079_0001112 3300049741 Bacteria 18689
1327 Ga0501079_0004103 3300049741 Bacteria 10774
1328 Ga0501079_0014061 3300049741 Bacteria 6102
1329 Ga0501079_0015829 3300049741 Bacteria 5762
1330 Ga0501079_0018896 3300049741 Bacteria 5267
1331 Ga0501079_0024449 3300049741 Bacteria 4635
1332 Ga0501079_0024988 3300049741 Bacteria 4583
1333 Ga0501079_0042214 3300049741 Bacteria 3523
1334 Ga0501079_0096850 3300049741 Bacteria 2287
1335 Ga0501079_0197608 3300049741 Bacteria 1570
1336 Ga0501080_0006054 3300049742 Bacteria 10845
1337 Ga0501080_0014632 3300049742 Bacteria 7227
1338 Ga0501080_0019749 3300049742 Bacteria 6239
1339 Ga0501080_0052003 3300049742 Bacteria 3812
1340 Ga0501080_0057753 3300049742 Bacteria 3612
1341 Ga0501080_0081593 3300049742 Bacteria 3004
1342 Ga0501081_0000945 3300049743 Bacteria 17260
1343 Ga0501081_0010712 3300049743 Bacteria 5987
1344 Ga0501081_0027865 3300049743 Bacteria 3809
1345 Ga0501081_0048358 3300049743 Bacteria 2927
1346 Ga0501081_0048929 3300049743 Bacteria 2910
1347 Ga0501081_0088390 3300049743 Bacteria 2177
1348 Ga0501081_0109940 3300049743 Bacteria 1956
1349 Ga0501083_0014829 3300049744 Bacteria 5450
1350 Ga0501083_0030497 3300049744 Bacteria 3705
1351 Ga0501083_0036667 3300049744 Bacteria 3343
1352 Ga0501083_0067869 3300049744 Bacteria 2373
1353 Ga0501273_001166 3300049770 Bacteria 2424
1354 Ga0501035_0000755 3300049822 Bacteria 34825
1355 Ga0501035_0004329 3300049822 Bacteria 13477
1356 Ga0501035_0009513 3300049822 Bacteria 9038
1357 Ga0501035_0074224 3300049822 Bacteria 3009
1358 Ga0501035_0080199 3300049822 Bacteria 2882
1359 Ga0501035_0287449 3300049822 Bacteria 1388
1360 Ga0501044_0006098 3300049823 Bacteria 13299
1361 Ga0501044_0012276 3300049823 Bacteria 9274
1362 Ga0501044_0066467 3300049823 Bacteria 3676
1363 Ga0501044_0119802 3300049823 Bacteria 2633
1364 Ga0501045_0001624 3300049824 Bacteria 15074
1365 Ga0501045_0007990 3300049824 Bacteria 7369
1366 Ga0501045_0008508 3300049824 Bacteria 7153
1367 Ga0501045_0016077 3300049824 Bacteria 5309
1368 Ga0501045_0023147 3300049824 Bacteria 4451
1369 Ga0501045_0033291 3300049824 Bacteria 3737
1370 Ga0501045_0049837 3300049824 Bacteria 3054
1371 Ga0501045_0157630 3300049824 Bacteria 1689
1372 Ga0501045_0201795 3300049824 Bacteria 1482
1373 Ga0501045_0231797 3300049824 Bacteria 1374
1374 nmdc:mga0k408_35784_c1 3300050493 Unclassified 2847
1375 nmdc:mga05p37_102127_c1 3300050507 Bacteria 3531
1376 nmdc:mga05p37_105024_c1 3300050507 Bacteria 3475
1377 nmdc:mga05p37_13002_c1 3300050507 Bacteria 9961
1378 nmdc:mga05p37_13146_c1 3300050507 Bacteria 9910
1379 nmdc:mga05p37_14093_c1 3300050507 Bacteria 9595
1380 nmdc:mga05p37_17008_c1 3300050507 Bacteria 8771
1381 nmdc:mga05p37_1893_c1 3300050507 Bacteria 24382
1382 nmdc:mga05p37_21012_c1 3300050507 Bacteria 7901
1383 nmdc:mga05p37_254961_c1 3300050507 Bacteria 2103
1384 nmdc:mga05p37_45591_c1 3300050507 Bacteria 5391
1385 nmdc:mga05p37_5046_c1 3300050507 Bacteria 15471
1386 nmdc:mga05p37_61686_c1 3300050507 Bacteria 4615
1387 nmdc:mga05p37_633_c1 3300050507 Bacteria 38921
1388 nmdc:mga05p37_65048_c1 3300050507 Bacteria 4487
1389 nmdc:mga05p37_723_c1 3300050507 Bacteria 36579
1390 nmdc:mga05p37_84246_c1 3300050507 Bacteria 3917
1391 nmdc:mga05p37_87511_c1 3300050507 Bacteria 3839
1392 nmdc:mga05p37_98_c1 3300050507 Bacteria 78110
1393 nmdc:mga09592_10597_c1 3300050508 Bacteria 7505
1394 nmdc:mga09592_142708_c1 3300050508 Bacteria 2065
1395 nmdc:mga09592_5571_c1 3300050508 Bacteria 10252
1396 nmdc:mga09592_69908_c1 3300050508 Bacteria 2978
1397 nmdc:mga09592_8125_c1 3300050508 Bacteria 8533
1398 nmdc:mga09592_94585_c1 3300050508 Bacteria 2555
1399 nmdc:mga09592_95505_c1 3300050508 Bacteria 2543
1400 nmdc:mga0qj67_164119_c1 3300050509 Bacteria 1803
1401 nmdc:mga0qj67_176559_c1 3300050509 Bacteria 1735
1402 nmdc:mga0qj67_2777_c1 3300050509 Bacteria 12560
1403 nmdc:mga0qj67_301201_c1 3300050509 Bacteria 1299
1404 nmdc:mga0qj67_563_c1 3300050509 Bacteria 25259
1405 nmdc:mga0qj67_61269_c1 3300050509 Bacteria 2987
1406 nmdc:mga0qj67_7159_c1 3300050509 Bacteria 8229
1407 nmdc:mga06r32_155381_c1 3300050510 Bacteria 2269
1408 nmdc:mga06r32_156881_c1 3300050510 Bacteria 2257
1409 nmdc:mga06r32_3643_c1 3300050510 Bacteria 13758
1410 nmdc:mga06r32_387571_c1 3300050510 Bacteria 1380
1411 nmdc:mga06r32_39732_c1 3300050510 Bacteria 4465
1412 nmdc:mga06r32_450835_c1 3300050510 Bacteria 1266
1413 nmdc:mga06r32_4843_c1 3300050510 Bacteria 12122
1414 nmdc:mga06r32_5444_c1 3300050510 Bacteria 11462
1415 nmdc:mga06r32_55823_c1 3300050510 Bacteria 3790
1416 nmdc:mga06r32_89238_c1 3300050510 Bacteria 3010
1417 nmdc:mga06r32_9427_c1 3300050510 Bacteria 8807
1418 nmdc:mga08y16_118696_c1 3300050511 Bacteria 2753
1419 nmdc:mga08y16_124703_c1 3300050511 Bacteria 1778
1420 nmdc:mga08y16_126208_c1 3300050511 Bacteria 2662
1421 nmdc:mga08y16_146515_c1 3300050511 Bacteria 2455
1422 nmdc:mga08y16_15153_c1 3300050511 Bacteria 8105
1423 nmdc:mga08y16_155759_c1 3300050511 Bacteria 2374
1424 nmdc:mga08y16_242206_c1 3300050511 Bacteria 1864
1425 nmdc:mga08y16_27678_c1 3300050511 Bacteria 5972
1426 nmdc:mga08y16_3043_c1 3300050511 Bacteria 17318
1427 nmdc:mga08y16_3320_c1 3300050511 Bacteria 16654
1428 nmdc:mga08y16_43032_c1 3300050511 Bacteria 4731
1429 nmdc:mga08y16_63226_c1 3300050511 Bacteria 3865
1430 nmdc:mga08y16_67789_c1 3300050511 Bacteria 3722
1431 nmdc:mga0n895_11084_c1 3300050512 Bacteria 8020
1432 nmdc:mga0n895_1397_c1 3300050512 Bacteria 17994
1433 nmdc:mga0n895_14384_c1 3300050512 Bacteria 7184
1434 nmdc:mga0n895_160226_c1 3300050512 Bacteria 2282
1435 nmdc:mga0n895_235240_c1 3300050512 Bacteria 1859
1436 nmdc:mga0n895_2532_c1 3300050512 Bacteria 14309
1437 nmdc:mga0n895_286305_c1 3300050512 Bacteria 1671
1438 nmdc:mga0n895_362748_c1 3300050512 Bacteria 1467
1439 nmdc:mga0n895_72164_c1 3300050512 Bacteria 3425
1440 nmdc:mga0n895_7298_c1 3300050512 Bacteria 9473
1441 nmdc:mga0n895_88402_c1 3300050512 Bacteria 3098
1442 nmdc:mga0rr50_117297_c1 3300050513 Bacteria 2114
1443 nmdc:mga0rr50_3929_c1 3300050513 Bacteria 8644
1444 nmdc:mga0rr50_7820_c1 3300050513 Bacteria 6628
1445 nmdc:mga08x19_13846_c1 3300050514 Bacteria 4886
1446 nmdc:mga08x19_14531_c1 3300050514 Bacteria 4776
1447 nmdc:mga08x19_2184_c1 3300050514 Bacteria 11955
1448 nmdc:mga08x19_23330_c1 3300050514 Bacteria 3838
1449 nmdc:mga08x19_23569_c1 3300050514 Bacteria 3819
1450 nmdc:mga08x19_38651_c1 3300050514 Bacteria 3031
1451 nmdc:mga0a205_11026_c1 3300050515 Bacteria 8319
1452 nmdc:mga0a205_23212_c1 3300050515 Bacteria 5883
1453 nmdc:mga0a205_28317_c1 3300050515 Bacteria 3219
1454 nmdc:mga0a205_294476_c1 3300050515 Bacteria 1497
1455 nmdc:mga0a205_3320_c1 3300050515 Bacteria 14328
1456 nmdc:mga0a205_5927_c1 3300050515 Bacteria 11015
1457 nmdc:mga0a205_6923_c1 3300050515 Bacteria 5600
1458 nmdc:mga0a205_694_c1 3300050515 Bacteria 18029
1459 nmdc:mga0a205_73406_c2 3300050515 Bacteria 2688
1460 nmdc:mga0a205_85184_c1 3300050515 Bacteria 3052
1461 Ga0495601_0005513 3300053077 Bacteria 7381
1462 Ga0495601_0079126 3300053077 Bacteria 2107
1463 Ga0495612_0033145 3300053078 Bacteria 2089
1464 Ga0495595_0139629 3300053084 Bacteria 1188
1465 Ga0495619_0002333 3300053085 Bacteria 12496
1466 Ga0495619_0020182 3300053085 Bacteria 4241
1467 Ga0501084_0006471 3300054114 Bacteria 9632
1468 Ga0501084_0013262 3300054114 Bacteria 6820
1469 Ga0501084_0019513 3300054114 Bacteria 5648
1470 Ga0501084_0023164 3300054114 Bacteria 5184
1471 Ga0501084_0027738 3300054114 Bacteria 4731
1472 Ga0501084_0052104 3300054114 Bacteria 3425
1473 Ga0501084_0074012 3300054114 Bacteria 2852
1474 Ga0501084_0097056 3300054114 Bacteria 2474
1475 Ga0500661_000345 3300055283 Bacteria 8445
1476 Ga0590071_002219 3300059421 Bacteria 4939
1477 Ga0590071_011471 3300059421 Bacteria 2073
1478 Ga0590075_005948 3300059424 Bacteria 2886
1479 Ga0590077_010166 3300059426 Bacteria 1935
1480 Ga0587067_017733 3300059640 Bacteria 1185
1481 Ga0501082_0001739 3300060353 Bacteria 19223
1482 Ga0501082_0003168 3300060353 Bacteria 14339
1483 Ga0501082_0024896 3300060353 Bacteria 5157
1484 Ga0501082_0027927 3300060353 Bacteria 4859
1485 Ga0501082_0034372 3300060353 Bacteria 4371
1486 Ga0501082_0034642 3300060353 Bacteria 4352
1487 Ga0501082_0036758 3300060353 Bacteria 4218
1488 Ga0501082_0042558 3300060353 Bacteria 3915
1489 Ga0466962_0000019 3300061719 Bacteria 94988
1490 Ga0466962_0003226 3300061719 Bacteria 7750
1491 Ga0466962_0008649 3300061719 Bacteria 4881
1492 Ga0530510_0000340 3300061734 Bacteria 30112
1493 Ga0530510_0009057 3300061734 Bacteria 6978
1494 Ga0530510_0009974 3300061734 Bacteria 6664
1495 Ga0530510_0012874 3300061734 Bacteria 5881
1496 Ga0530510_0013827 3300061734 Bacteria 5683
1497 Ga0530510_0060015 3300061734 Bacteria 2752
1498 Ga0530510_0084553 3300061734 Bacteria 2311
1499 Ga0530510_0090779 3300061734 Bacteria 2228
1500 Ga0530510_0108204 3300061734 Bacteria 2035

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002126 JGI24035J26624_1001136 JGI24035J26624_10011364 329
2 3300005290 Ga0065712_10000625 Ga0065712_100006258 329
3 3300005340 Ga0070689_100024392 Ga0070689_1000243925 329
4 3300005354 Ga0070675_100010980 Ga0070675_1000109805 329
5 3300005365 Ga0070688_100029494 Ga0070688_1000294944 329
6 3300005457 Ga0070662_100034116 Ga0070662_1000341165 329
7 3300005466 Ga0070685_10094953 Ga0070685_100949532 329
8 3300005535 Ga0070684_100020105 Ga0070684_1000201054 329
9 3300035695 Ga0373927_0209016 Ga0373927_0209016_28_1092 329
10 3300046692 Ga0495671_0114049 Ga0495671_0114049_29_1093 329
11 3300048911 Ga0496108_0006877 Ga0496108_0006877_2878_3942 329
12 3300048912 Ga0496109_0005698 Ga0496109_0005698_5270_6334 329
13 3300048913 Ga0496110_0220363 Ga0496110_0220363_277_1341 329
14 3300048915 Ga0496112_0095053 Ga0496112_0095053_1564_2628 329
15 3300048915 Ga0496112_0234516 Ga0496112_0234516_604_1671 329
16 3300050510 nmdc:mga06r32_450835_c1 nmdc:mga06r32_450835_c1_24_1091 329
17 3300013296 Ga0157374_10054885 Ga0157374_100548854 331
18 3300050512 nmdc:mga0n895_72164_c1 nmdc:mga0n895_72164_c1_1548_2612 331
19 3300005436 Ga0070713_100024503 Ga0070713_1000245035 342
20 3300025928 Ga0207700_10013335 Ga0207700_100133355 342
21 3300025929 Ga0207664_10035650 Ga0207664_100356504 342
22 3300037588 Ga0316581_0004634 Ga0316581_0004634_1698_2870 342
23 3300005536 Ga0070697_100048929 Ga0070697_1000489292 343
24 3300042531 Ga0450918_002582 Ga0450918_002582_1591_2826 343
25 3300005549 Ga0070704_100236209 Ga0070704_1002362092 344
26 3300014325 Ga0163163_10190153 Ga0163163_101901532 348
27 3300042144 Ga0450889_003072 Ga0450889_003072_60_1349 348
28 3300044901 Ga0466960_0003141 Ga0466960_0003141_3276_4391 348
29 3300048905 Ga0496102_0110874 Ga0496102_0110874_50_1339 348
30 3300001991 JGI24743J22301_10000992 JGI24743J22301_100009922 349
31 3300003203 JGI25406J46586_10000325 JGI25406J46586_1000032515 349
32 3300003203 JGI25406J46586_10000541 JGI25406J46586_100005418 349
33 3300004799 Ga0058863_11825713 Ga0058863_118257131 349
34 3300004800 Ga0058861_10011440 Ga0058861_100114403 349
35 3300004800 Ga0058861_12031188 Ga0058861_120311882 349
36 3300004803 Ga0058862_10025361 Ga0058862_100253615 349
37 3300005435 Ga0070714_100184892 Ga0070714_1001848923 349
38 3300005435 Ga0070714_100267156 Ga0070714_1002671561 349
39 3300005439 Ga0070711_100044079 Ga0070711_1000440794 349
40 3300005440 Ga0070705_100043715 Ga0070705_1000437153 349
41 3300005445 Ga0070708_100409544 Ga0070708_1004095442 349
42 3300005467 Ga0070706_100126089 Ga0070706_1001260892 349
43 3300005467 Ga0070706_100136278 Ga0070706_1001362782 349
44 3300005468 Ga0070707_100000150 Ga0070707_10000015071 349
45 3300005468 Ga0070707_100013492 Ga0070707_1000134929 349
46 3300005468 Ga0070707_100051235 Ga0070707_1000512353 349
47 3300005471 Ga0070698_100001980 Ga0070698_10000198028 349
48 3300005471 Ga0070698_100005264 Ga0070698_1000052649 349
49 3300005471 Ga0070698_100025477 Ga0070698_1000254774 349
50 3300005471 Ga0070698_100031940 Ga0070698_1000319406 349
51 3300005471 Ga0070698_100074984 Ga0070698_1000749844 349
52 3300005518 Ga0070699_100153348 Ga0070699_1001533481 349
53 3300005530 Ga0070679_100063439 Ga0070679_1000634391 349
54 3300005536 Ga0070697_100293123 Ga0070697_1002931232 349
55 3300005545 Ga0070695_100042779 Ga0070695_1000427794 349
56 3300005548 Ga0070665_100001433 Ga0070665_10000143324 349
57 3300005549 Ga0070704_100037383 Ga0070704_1000373831 349
58 3300005549 Ga0070704_100243860 Ga0070704_1002438601 349
59 3300005549 Ga0070704_100317116 Ga0070704_1003171162 349
60 3300005563 Ga0068855_100092653 Ga0068855_1000926531 349
61 3300005564 Ga0070664_100063126 Ga0070664_1000631263 349
62 3300005577 Ga0068857_100358803 Ga0068857_1003588031 349
63 3300005842 Ga0068858_100362135 Ga0068858_1003621351 349
64 3300005985 Ga0081539_10000287 Ga0081539_1000028734 349
65 3300005985 Ga0081539_10000313 Ga0081539_100003136 349
66 3300005985 Ga0081539_10000424 Ga0081539_1000042472 349
67 3300006028 Ga0070717_10004374 Ga0070717_100043744 349
68 3300006028 Ga0070717_10012289 Ga0070717_100122893 349
69 3300006028 Ga0070717_10139567 Ga0070717_101395672 349
70 3300006028 Ga0070717_10164355 Ga0070717_101643551 349
71 3300006175 Ga0070712_100018001 Ga0070712_1000180012 349
72 3300006175 Ga0070712_100218155 Ga0070712_1002181552 349
73 3300006195 Ga0075366_10027222 Ga0075366_100272222 349
74 3300006358 Ga0068871_100184539 Ga0068871_1001845392 349
75 3300006844 Ga0075428_100163964 Ga0075428_1001639643 349
76 3300006846 Ga0075430_100074539 Ga0075430_1000745392 349
77 3300006847 Ga0075431_100003237 Ga0075431_1000032376 349
78 3300006847 Ga0075431_100004963 Ga0075431_1000049637 349
79 3300006847 Ga0075431_100008883 Ga0075431_1000088834 349
80 3300006847 Ga0075431_100027958 Ga0075431_1000279588 349
81 3300006852 Ga0075433_10006605 Ga0075433_100066058 349
82 3300006852 Ga0075433_10008164 Ga0075433_100081648 349
83 3300006852 Ga0075433_10103909 Ga0075433_101039092 349
84 3300006871 Ga0075434_100028787 Ga0075434_1000287872 349
85 3300006871 Ga0075434_100049812 Ga0075434_1000498122 349
86 3300006880 Ga0075429_100037922 Ga0075429_1000379225 349
87 3300006880 Ga0075429_100077339 Ga0075429_1000773393 349
88 3300006914 Ga0075436_100016463 Ga0075436_1000164634 349
89 3300006914 Ga0075436_100039240 Ga0075436_1000392403 349
90 3300007076 Ga0075435_100233646 Ga0075435_1002336462 349
91 3300009094 Ga0111539_10075485 Ga0111539_100754852 349
92 3300009147 Ga0114129_10001543 Ga0114129_1000154318 349
93 3300009147 Ga0114129_10005584 Ga0114129_1000558415 349
94 3300009147 Ga0114129_10021815 Ga0114129_100218156 349
95 3300009147 Ga0114129_10072458 Ga0114129_100724585 349
96 3300009147 Ga0114129_10160536 Ga0114129_101605364 349
97 3300009551 Ga0105238_10168881 Ga0105238_101688811 349
98 3300010375 Ga0105239_10006994 Ga0105239_100069943 349
99 3300013102 Ga0157371_10103776 Ga0157371_101037762 349
100 3300013104 Ga0157370_10131857 Ga0157370_101318572 349
101 3300025910 Ga0207684_10350141 Ga0207684_103501411 349
102 3300025941 Ga0207711_10372225 Ga0207711_103722251 349
103 3300035113 Ga0373936_0015258 Ga0373936_0015258_346_1464 349
104 3300035120 Ga0373957_0018881 Ga0373957_0018881_262_1380 349
105 3300035692 Ga0373935_0026021 Ga0373935_0026021_390_1508 349
106 3300039437 Ga0436365_0598584 Ga0436365_0598584_2447_3574 349
107 3300042876 Ga0451577_0000295 Ga0451577_0000295_53208_54392 349
108 3300044712 Ga0453684_0003992 Ga0453684_0003992_30252_31436 349
109 3300046459 Ga0495629_0008424 Ga0495629_0008424_5020_6138 349
110 3300046461 Ga0495641_0005969 Ga0495641_0005969_5581_6699 349
111 3300046462 Ga0495651_0021723 Ga0495651_0021723_2368_3486 349
112 3300046475 Ga0495639_0005202 Ga0495639_0005202_1018_2136 349
113 3300046476 Ga0495662_0010535 Ga0495662_0010535_1105_2223 349
114 3300046477 Ga0495664_0001695 Ga0495664_0001695_3001_4119 349
115 3300046514 Ga0495618_0165430 Ga0495618_0165430_259_1377 349
116 3300046531 Ga0495665_0019211 Ga0495665_0019211_590_1708 349
117 3300046536 Ga0495587_0052430 Ga0495587_0052430_913_2094 349
118 3300046543 Ga0495645_0008372 Ga0495645_0008372_3585_4703 349
119 3300046642 Ga0495634_0012928 Ga0495634_0012928_1921_3039 349
120 3300046679 Ga0495623_0054461 Ga0495623_0054461_1144_2262 349
121 3300046689 Ga0495613_0013863 Ga0495613_0013863_3528_4646 349
122 3300046690 Ga0495624_0011121 Ga0495624_0011121_4162_5280 349
123 3300047315 Ga0495581_0003301 Ga0495581_0003301_1334_2452 349
124 3300047317 Ga0495604_0160573 Ga0495604_0160573_334_1452 349
125 3300047444 Ga0495675_0053631 Ga0495675_0053631_1299_2417 349
126 3300047673 Ga0495593_0004457 Ga0495593_0004457_1298_2416 349
127 3300049568 Ga0501031_0018229 Ga0501031_0018229_1310_2428 349
128 3300049570 Ga0501033_0006909 Ga0501033_0006909_5920_7038 349
129 3300049571 Ga0501034_0027970 Ga0501034_0027970_1814_2932 349
130 3300049572 Ga0501036_0037388 Ga0501036_0037388_429_1547 349
131 3300049573 Ga0501037_0003998 Ga0501037_0003998_6279_7397 349
132 3300049574 Ga0501038_0002739 Ga0501038_0002739_2561_3679 349
133 3300049575 Ga0501039_0008614 Ga0501039_0008614_398_1516 349
134 3300049580 Ga0501046_0072456 Ga0501046_0072456_115_1233 349
135 3300049583 Ga0501067_0034562 Ga0501067_0034562_121_1239 349
136 3300049584 Ga0501068_0057085 Ga0501068_0057085_521_1639 349
137 3300049586 Ga0501070_0014953 Ga0501070_0014953_1936_3054 349
138 3300049587 Ga0501071_0009794 Ga0501071_0009794_3617_4735 349
139 3300049588 Ga0501072_0021126 Ga0501072_0021126_2211_3329 349
140 3300049589 Ga0501073_0016233 Ga0501073_0016233_2139_3257 349
141 3300049590 Ga0501074_0017399 Ga0501074_0017399_1296_2414 349
142 3300049741 Ga0501079_0024449 Ga0501079_0024449_1582_2700 349
143 3300049741 Ga0501079_0197608 Ga0501079_0197608_71_1252 349
144 3300049742 Ga0501080_0057753 Ga0501080_0057753_1415_2533 349
145 3300049743 Ga0501081_0088390 Ga0501081_0088390_302_1420 349
146 3300049744 Ga0501083_0030497 Ga0501083_0030497_152_1270 349
147 3300049824 Ga0501045_0007990 Ga0501045_0007990_274_1392 349
148 3300050515 nmdc:mga0a205_85184_c1 nmdc:mga0a205_85184_c1_1008_2171 349
149 3300053077 Ga0495601_0005513 Ga0495601_0005513_2734_3852 349
150 3300053078 Ga0495612_0033145 Ga0495612_0033145_800_1918 349
151 3300053085 Ga0495619_0020182 Ga0495619_0020182_2864_3982 349
152 3300054114 Ga0501084_0013262 Ga0501084_0013262_3413_4531 349
153 3300060353 Ga0501082_0027927 Ga0501082_0027927_394_1512 349
154 3300005290 Ga0065712_10011464 Ga0065712_100114642 350
155 3300005290 Ga0065712_10098998 Ga0065712_100989983 350
156 3300005290 Ga0065712_10119669 Ga0065712_101196692 350
157 3300005293 Ga0065715_10032425 Ga0065715_100324251 350
158 3300005293 Ga0065715_10102208 Ga0065715_101022084 350
159 3300005295 Ga0065707_10010640 Ga0065707_100106401 350
160 3300005295 Ga0065707_10139243 Ga0065707_101392433 350
161 3300005327 Ga0070658_10042817 Ga0070658_100428172 350
162 3300005328 Ga0070676_10031165 Ga0070676_100311653 350
163 3300005330 Ga0070690_100035310 Ga0070690_1000353103 350
164 3300005334 Ga0068869_100014309 Ga0068869_1000143094 350
165 3300005337 Ga0070682_100014401 Ga0070682_1000144013 350
166 3300005339 Ga0070660_100057893 Ga0070660_1000578933 350
167 3300005339 Ga0070660_100161359 Ga0070660_1001613593 350
168 3300005340 Ga0070689_100205320 Ga0070689_1002053201 350
169 3300005344 Ga0070661_100143681 Ga0070661_1001436813 350
170 3300005347 Ga0070668_100010876 Ga0070668_1000108764 350
171 3300005347 Ga0070668_100024862 Ga0070668_1000248623 350
172 3300005353 Ga0070669_100079540 Ga0070669_1000795401 350
173 3300005353 Ga0070669_100193746 Ga0070669_1001937462 350
174 3300005354 Ga0070675_100035704 Ga0070675_1000357043 350
175 3300005354 Ga0070675_100039523 Ga0070675_1000395234 350
176 3300005354 Ga0070675_100198407 Ga0070675_1001984072 350
177 3300005355 Ga0070671_100039917 Ga0070671_1000399174 350
178 3300005355 Ga0070671_100132563 Ga0070671_1001325633 350
179 3300005356 Ga0070674_100102822 Ga0070674_1001028222 350
180 3300005364 Ga0070673_100007361 Ga0070673_1000073614 350
181 3300005364 Ga0070673_100049666 Ga0070673_1000496662 350
182 3300005364 Ga0070673_100213346 Ga0070673_1002133462 350
183 3300005366 Ga0070659_100190094 Ga0070659_1001900943 350
184 3300005434 Ga0070709_10023132 Ga0070709_100231321 350
185 3300005440 Ga0070705_100004129 Ga0070705_1000041295 350
186 3300005440 Ga0070705_100088589 Ga0070705_1000885892 350
187 3300005441 Ga0070700_100002366 Ga0070700_1000023668 350
188 3300005441 Ga0070700_100030821 Ga0070700_1000308212 350
189 3300005441 Ga0070700_100155911 Ga0070700_1001559112 350
190 3300005445 Ga0070708_100033722 Ga0070708_1000337223 350
191 3300005445 Ga0070708_100052228 Ga0070708_1000522285 350
192 3300005445 Ga0070708_100066254 Ga0070708_1000662543 350
193 3300005445 Ga0070708_100066383 Ga0070708_1000663833 350
194 3300005445 Ga0070708_100210729 Ga0070708_1002107291 350
195 3300005455 Ga0070663_100028858 Ga0070663_1000288583 350
196 3300005456 Ga0070678_100228058 Ga0070678_1002280582 350
197 3300005457 Ga0070662_100177528 Ga0070662_1001775282 350
198 3300005459 Ga0068867_100002998 Ga0068867_1000029987 350
199 3300005466 Ga0070685_10041552 Ga0070685_100415522 350
200 3300005467 Ga0070706_100007618 Ga0070706_1000076189 350
201 3300005468 Ga0070707_100000531 Ga0070707_10000053137 350
202 3300005471 Ga0070698_100070349 Ga0070698_1000703494 350
203 3300005471 Ga0070698_100122616 Ga0070698_1001226163 350
204 3300005471 Ga0070698_100384682 Ga0070698_1003846821 350
205 3300005535 Ga0070684_100235683 Ga0070684_1002356832 350
206 3300005543 Ga0070672_100009621 Ga0070672_1000096219 350
207 3300005543 Ga0070672_100024202 Ga0070672_1000242023 350
208 3300005544 Ga0070686_100034774 Ga0070686_1000347743 350
209 3300005546 Ga0070696_100283757 Ga0070696_1002837571 350
210 3300005548 Ga0070665_100004176 Ga0070665_10000417613 350
211 3300005548 Ga0070665_100071173 Ga0070665_1000711733 350
212 3300005549 Ga0070704_100006743 Ga0070704_1000067438 350
213 3300005563 Ga0068855_100269417 Ga0068855_1002694172 350
214 3300005563 Ga0068855_100446460 Ga0068855_1004464602 350
215 3300005564 Ga0070664_100049731 Ga0070664_1000497313 350
216 3300005578 Ga0068854_100251059 Ga0068854_1002510592 350
217 3300005614 Ga0068856_100062923 Ga0068856_1000629232 350
218 3300005614 Ga0068856_100075014 Ga0068856_1000750143 350
219 3300005616 Ga0068852_100185820 Ga0068852_1001858202 350
220 3300005617 Ga0068859_100028777 Ga0068859_1000287773 350
221 3300005617 Ga0068859_100185346 Ga0068859_1001853463 350
222 3300005618 Ga0068864_100134310 Ga0068864_1001343103 350
223 3300005718 Ga0068866_10117806 Ga0068866_101178061 350
224 3300005841 Ga0068863_100001650 Ga0068863_10000165015 350
225 3300005841 Ga0068863_100121253 Ga0068863_1001212533 350
226 3300005842 Ga0068858_100011766 Ga0068858_1000117667 350
227 3300005842 Ga0068858_100218096 Ga0068858_1002180963 350
228 3300005843 Ga0068860_100000861 Ga0068860_10000086129 350
229 3300005844 Ga0068862_100024910 Ga0068862_1000249102 350
230 3300005937 Ga0081455_10001674 Ga0081455_100016744 350
231 3300005937 Ga0081455_10122376 Ga0081455_101223762 350
232 3300005985 Ga0081539_10008861 Ga0081539_100088613 350
233 3300006163 Ga0070715_10031606 Ga0070715_100316063 350
234 3300006173 Ga0070716_100007830 Ga0070716_1000078302 350
235 3300006173 Ga0070716_100120694 Ga0070716_1001206942 350
236 3300006844 Ga0075428_100000401 Ga0075428_10000040130 350
237 3300006844 Ga0075428_100011838 Ga0075428_1000118384 350
238 3300006844 Ga0075428_100024409 Ga0075428_1000244096 350
239 3300006844 Ga0075428_100027686 Ga0075428_1000276864 350
240 3300006844 Ga0075428_100204043 Ga0075428_1002040432 350
241 3300006846 Ga0075430_100001915 Ga0075430_1000019153 350
242 3300006847 Ga0075431_100000425 Ga0075431_10000042520 350
243 3300006847 Ga0075431_100007491 Ga0075431_1000074917 350
244 3300006847 Ga0075431_100016282 Ga0075431_1000162827 350
245 3300006847 Ga0075431_100035701 Ga0075431_1000357013 350
246 3300006852 Ga0075433_10000962 Ga0075433_1000096216 350
247 3300006852 Ga0075433_10002569 Ga0075433_100025692 350
248 3300006871 Ga0075434_100012440 Ga0075434_1000124407 350
249 3300006871 Ga0075434_100056895 Ga0075434_1000568952 350
250 3300006871 Ga0075434_100147164 Ga0075434_1001471642 350
251 3300006871 Ga0075434_100285691 Ga0075434_1002856912 350
252 3300006880 Ga0075429_100051493 Ga0075429_1000514933 350
253 3300006881 Ga0068865_100038619 Ga0068865_1000386194 350
254 3300006881 Ga0068865_100131206 Ga0068865_1001312063 350
255 3300006914 Ga0075436_100015407 Ga0075436_1000154073 350
256 3300006931 Ga0097620_100028775 Ga0097620_1000287754 350
257 3300006931 Ga0097620_100185343 Ga0097620_1001853433 350
258 3300007076 Ga0075435_100016549 Ga0075435_1000165494 350
259 3300007265 Ga0099794_10000268 Ga0099794_100002689 350
260 3300009094 Ga0111539_10007269 Ga0111539_1000726912 350
261 3300009094 Ga0111539_10061439 Ga0111539_100614392 350
262 3300009098 Ga0105245_10011757 Ga0105245_100117573 350
263 3300009098 Ga0105245_10040053 Ga0105245_100400533 350
264 3300009147 Ga0114129_10000682 Ga0114129_1000068221 350
265 3300009147 Ga0114129_10002600 Ga0114129_100026005 350
266 3300009147 Ga0114129_10005161 Ga0114129_100051619 350
267 3300009147 Ga0114129_10014289 Ga0114129_100142896 350
268 3300009147 Ga0114129_10154935 Ga0114129_101549353 350
269 3300009147 Ga0114129_10189302 Ga0114129_101893022 350
270 3300009148 Ga0105243_10006844 Ga0105243_100068447 350
271 3300009148 Ga0105243_10231426 Ga0105243_102314262 350
272 3300009176 Ga0105242_10105223 Ga0105242_101052233 350
273 3300009177 Ga0105248_10010985 Ga0105248_100109851 350
274 3300009177 Ga0105248_10125052 Ga0105248_101250521 350
275 3300009551 Ga0105238_10006590 Ga0105238_100065903 350
276 3300009553 Ga0105249_10093221 Ga0105249_100932213 350
277 3300010375 Ga0105239_10308791 Ga0105239_103087912 350
278 3300010375 Ga0105239_10373615 Ga0105239_103736152 350
279 3300011119 Ga0105246_10007920 Ga0105246_100079204 350
280 3300013102 Ga0157371_10020283 Ga0157371_100202832 350
281 3300013105 Ga0157369_10099659 Ga0157369_100996593 350
282 3300013105 Ga0157369_10113086 Ga0157369_101130863 350
283 3300013296 Ga0157374_10008509 Ga0157374_100085096 350
284 3300013296 Ga0157374_10168956 Ga0157374_101689562 350
285 3300013306 Ga0163162_10365645 Ga0163162_103656452 350
286 3300013307 Ga0157372_10095387 Ga0157372_100953873 350
287 3300014326 Ga0157380_10065204 Ga0157380_100652043 350
288 3300014326 Ga0157380_10088736 Ga0157380_100887363 350
289 3300014326 Ga0157380_10156361 Ga0157380_101563613 350
290 3300014326 Ga0157380_10350742 Ga0157380_103507421 350
291 3300014968 Ga0157379_10333050 Ga0157379_103330501 350
292 3300017792 Ga0163161_10008101 Ga0163161_100081013 350
293 3300017792 Ga0163161_10086624 Ga0163161_100866242 350
294 3300025315 Ga0207697_10000854 Ga0207697_100008547 350
295 3300025899 Ga0207642_10069559 Ga0207642_100695592 350
296 3300025899 Ga0207642_10126147 Ga0207642_101261472 350
297 3300025900 Ga0207710_10029554 Ga0207710_100295543 350
298 3300025903 Ga0207680_10010354 Ga0207680_100103543 350
299 3300025903 Ga0207680_10015145 Ga0207680_100151454 350
300 3300025904 Ga0207647_10049472 Ga0207647_100494723 350
301 3300025905 Ga0207685_10034634 Ga0207685_100346341 350
302 3300025906 Ga0207699_10028298 Ga0207699_100282981 350
303 3300025907 Ga0207645_10009259 Ga0207645_100092595 350
304 3300025908 Ga0207643_10002627 Ga0207643_100026273 350
305 3300025909 Ga0207705_10015206 Ga0207705_100152063 350
306 3300025910 Ga0207684_10028101 Ga0207684_100281011 350
307 3300025910 Ga0207684_10028940 Ga0207684_100289405 350
308 3300025910 Ga0207684_10029611 Ga0207684_100296116 350
309 3300025915 Ga0207693_10005749 Ga0207693_100057499 350
310 3300025916 Ga0207663_10065598 Ga0207663_100655983 350
311 3300025919 Ga0207657_10070945 Ga0207657_100709453 350
312 3300025919 Ga0207657_10081955 Ga0207657_100819552 350
313 3300025922 Ga0207646_10014232 Ga0207646_100142323 350
314 3300025922 Ga0207646_10142668 Ga0207646_101426682 350
315 3300025923 Ga0207681_10005829 Ga0207681_100058296 350
316 3300025923 Ga0207681_10017371 Ga0207681_100173714 350
317 3300025924 Ga0207694_10061724 Ga0207694_100617243 350
318 3300025926 Ga0207659_10006304 Ga0207659_100063044 350
319 3300025926 Ga0207659_10022477 Ga0207659_100224774 350
320 3300025927 Ga0207687_10083882 Ga0207687_100838823 350
321 3300025927 Ga0207687_10104946 Ga0207687_101049462 350
322 3300025928 Ga0207700_10022927 Ga0207700_100229273 350
323 3300025932 Ga0207690_10062376 Ga0207690_100623762 350
324 3300025933 Ga0207706_10116308 Ga0207706_101163082 350
325 3300025937 Ga0207669_10027263 Ga0207669_100272634 350
326 3300025938 Ga0207704_10003374 Ga0207704_100033745 350
327 3300025938 Ga0207704_10206479 Ga0207704_102064792 350
328 3300025940 Ga0207691_10007536 Ga0207691_1000753612 350
329 3300025940 Ga0207691_10035655 Ga0207691_100356553 350
330 3300025942 Ga0207689_10008872 Ga0207689_100088724 350
331 3300025942 Ga0207689_10066838 Ga0207689_100668382 350
332 3300025944 Ga0207661_10336795 Ga0207661_103367951 350
333 3300025949 Ga0207667_10254348 Ga0207667_102543481 350
334 3300025960 Ga0207651_10031869 Ga0207651_100318692 350
335 3300025960 Ga0207651_10064541 Ga0207651_100645412 350
336 3300025972 Ga0207668_10014626 Ga0207668_100146262 350
337 3300025972 Ga0207668_10039088 Ga0207668_100390883 350
338 3300025981 Ga0207640_10030210 Ga0207640_100302102 350
339 3300025986 Ga0207658_10009327 Ga0207658_100093278 350
340 3300025986 Ga0207658_10083665 Ga0207658_100836652 350
341 3300026035 Ga0207703_10009990 Ga0207703_100099904 350
342 3300026067 Ga0207678_10019308 Ga0207678_100193086 350
343 3300026075 Ga0207708_10007840 Ga0207708_100078404 350
344 3300026075 Ga0207708_10045031 Ga0207708_100450313 350
345 3300026075 Ga0207708_10179926 Ga0207708_101799261 350
346 3300026078 Ga0207702_10099207 Ga0207702_100992073 350
347 3300026088 Ga0207641_10009942 Ga0207641_100099424 350
348 3300026089 Ga0207648_10007992 Ga0207648_100079923 350
349 3300026089 Ga0207648_10047616 Ga0207648_100476162 350
350 3300026095 Ga0207676_10035277 Ga0207676_100352773 350
351 3300026095 Ga0207676_10147420 Ga0207676_101474202 350
352 3300026116 Ga0207674_10200832 Ga0207674_102008322 350
353 3300026118 Ga0207675_100034452 Ga0207675_1000344525 350
354 3300026121 Ga0207683_10200653 Ga0207683_102006532 350
355 3300027671 Ga0209588_1000042 Ga0209588_100004252 350
356 3300027907 Ga0207428_10023759 Ga0207428_100237593 350
357 3300028379 Ga0268266_10001474 Ga0268266_1000147412 350
358 3300028381 Ga0268264_10000257 Ga0268264_1000025791 350
359 3300031548 Ga0307408_100040831 Ga0307408_1000408313 350
360 3300031548 Ga0307408_100139665 Ga0307408_1001396653 350
361 3300031548 Ga0307408_100210302 Ga0307408_1002103022 350
362 3300031824 Ga0307413_10098143 Ga0307413_100981432 350
363 3300031824 Ga0307413_10121186 Ga0307413_101211863 350
364 3300031852 Ga0307410_10007237 Ga0307410_100072373 350
365 3300031901 Ga0307406_10074082 Ga0307406_100740822 350
366 3300031903 Ga0307407_10031047 Ga0307407_100310473 350
367 3300031903 Ga0307407_10055546 Ga0307407_100555463 350
368 3300031911 Ga0307412_10067334 Ga0307412_100673342 350
369 3300031911 Ga0307412_10222922 Ga0307412_102229222 350
370 3300032002 Ga0307416_100036567 Ga0307416_1000365673 350
371 3300032002 Ga0307416_100245947 Ga0307416_1002459472 350
372 3300032004 Ga0307414_10028084 Ga0307414_100280844 350
373 3300032005 Ga0307411_10036238 Ga0307411_100362382 350
374 3300032005 Ga0307411_10133724 Ga0307411_101337241 350
375 3300033180 Ga0307510_10103880 Ga0307510_101038803 350
376 3300035083 Ga0373926_0000212 Ga0373926_0000212_11020_12135 350
377 3300035115 Ga0373941_0019538 Ga0373941_0019538_519_1634 350
378 3300035117 Ga0373953_0004418 Ga0373953_0004418_1505_2623 350
379 3300035121 Ga0373960_0012237 Ga0373960_0012237_740_1855 350
380 3300035121 Ga0373960_0037485 Ga0373960_0037485_224_1339 350
381 3300035692 Ga0373935_0001002 Ga0373935_0001002_11038_12153 350
382 3300035692 Ga0373935_0060339 Ga0373935_0060339_458_1618 350
383 3300035725 Ga0373947_0000051 Ga0373947_0000051_11121_12236 350
384 3300037312 Ga0395899_0165776 Ga0395899_0165776_199_1314 350
385 3300037418 Ga0395900_0206153 Ga0395900_0206153_580_1695 350
386 3300037466 Ga0395898_0336597 Ga0395898_0336597_23_1138 350
387 3300037471 Ga0395905_0045484 Ga0395905_0045484_2024_3139 350
388 3300037853 Ga0436364_0413399 Ga0436364_0413399_1879_2994 350
389 3300037853 Ga0436364_0830486 Ga0436364_0830486_2034_3149 350
390 3300039437 Ga0436365_1083552 Ga0436365_1083552_425_1540 350
391 3300041458 Ga0451798_0296048 Ga0451798_0296048_399_1541 350
392 3300041463 Ga0451804_0287274 Ga0451804_0287274_1663_2805 350
393 3300041486 Ga0451807_0164003 Ga0451807_0164003_461_1576 350
394 3300041492 Ga0451835_0443333 Ga0451835_0443333_977_2119 350
395 3300041501 Ga0451845_0965238 Ga0451845_0965238_1064_2206 350
396 3300041505 Ga0451849_0647552 Ga0451849_0647552_383_1498 350
397 3300041512 Ga0451853_0159403 Ga0451853_0159403_750_1865 350
398 3300044673 Ga0453683_0024013 Ga0453683_0024013_2646_3761 350
399 3300044694 Ga0466963_0033120 Ga0466963_0033120_436_1551 350
400 3300044706 Ga0466964_0064496 Ga0466964_0064496_405_1520 350
401 3300045049 Ga0466959_0012028 Ga0466959_0012028_3486_4601 350
402 3300045976 Ga0466967_0037691 Ga0466967_0037691_1006_2121 350
403 3300046463 Ga0495653_0022730 Ga0495653_0022730_3532_4650 350
404 3300046491 Ga0495584_0060814 Ga0495584_0060814_481_1641 350
405 3300046511 Ga0495608_0028826 Ga0495608_0028826_2518_3636 350
406 3300046528 Ga0495642_0030910 Ga0495642_0030910_428_1588 350
407 3300046535 Ga0495586_0003596 Ga0495586_0003596_4185_5303 350
408 3300046537 Ga0495598_0004342 Ga0495598_0004342_1457_2617 350
409 3300046664 Ga0495659_0032152 Ga0495659_0032152_398_1558 350
410 3300046684 Ga0495669_0020388 Ga0495669_0020388_827_1987 350
411 3300048088 Ga0495602_0168573 Ga0495602_0168573_378_1496 350
412 3300048903 Ga0496100_0015256 Ga0496100_0015256_2989_4149 350
413 3300048904 Ga0496101_0013434 Ga0496101_0013434_1686_2846 350
414 3300048905 Ga0496102_0032855 Ga0496102_0032855_325_1440 350
415 3300048905 Ga0496102_0160279 Ga0496102_0160279_516_1631 350
416 3300048906 Ga0496103_0023018 Ga0496103_0023018_1456_2616 350
417 3300048907 Ga0496104_0006116 Ga0496104_0006116_8778_9893 350
418 3300048907 Ga0496104_0008644 Ga0496104_0008644_1278_2393 350
419 3300048907 Ga0496104_0047881 Ga0496104_0047881_324_1484 350
420 3300048907 Ga0496104_0056789 Ga0496104_0056789_1209_2324 350
421 3300048908 Ga0496105_0003072 Ga0496105_0003072_2633_3748 350
422 3300048909 Ga0496106_0002638 Ga0496106_0002638_6456_7616 350
423 3300048910 Ga0496107_0022831 Ga0496107_0022831_1406_2566 350
424 3300048910 Ga0496107_0041057 Ga0496107_0041057_2097_3212 350
425 3300048911 Ga0496108_0002133 Ga0496108_0002133_8221_9336 350
426 3300048911 Ga0496108_0004282 Ga0496108_0004282_5419_6534 350
427 3300048911 Ga0496108_0008961 Ga0496108_0008961_863_1978 350
428 3300048911 Ga0496108_0082127 Ga0496108_0082127_359_1480 350
429 3300048911 Ga0496108_0118690 Ga0496108_0118690_721_1836 350
430 3300048911 Ga0496108_0163098 Ga0496108_0163098_451_1611 350
431 3300048912 Ga0496109_0002708 Ga0496109_0002708_7858_8973 350
432 3300048912 Ga0496109_0004347 Ga0496109_0004347_5455_6570 350
433 3300048912 Ga0496109_0005786 Ga0496109_0005786_1304_2419 350
434 3300048913 Ga0496110_0002856 Ga0496110_0002856_8459_9574 350
435 3300048913 Ga0496110_0023245 Ga0496110_0023245_2966_4081 350
436 3300048913 Ga0496110_0182789 Ga0496110_0182789_145_1260 350
437 3300048914 Ga0496111_0000451 Ga0496111_0000451_6137_7252 350
438 3300048914 Ga0496111_0020534 Ga0496111_0020534_1888_3003 350
439 3300048914 Ga0496111_0065484 Ga0496111_0065484_303_1463 350
440 3300048914 Ga0496111_0213954 Ga0496111_0213954_188_1336 350
441 3300048915 Ga0496112_0005762 Ga0496112_0005762_4833_5948 350
442 3300048915 Ga0496112_0009919 Ga0496112_0009919_699_1814 350
443 3300048915 Ga0496112_0011204 Ga0496112_0011204_727_1848 350
444 3300048915 Ga0496112_0035434 Ga0496112_0035434_567_1727 350
445 3300048915 Ga0496112_0045971 Ga0496112_0045971_357_1472 350
446 3300048915 Ga0496112_0130976 Ga0496112_0130976_825_2000 350
447 3300048916 Ga0496113_0001491 Ga0496113_0001491_5397_6512 350
448 3300048916 Ga0496113_0036024 Ga0496113_0036024_1750_2865 350
449 3300048916 Ga0496113_0176422 Ga0496113_0176422_122_1237 350
450 3300048916 Ga0496113_0301755 Ga0496113_0301755_131_1246 350
451 3300048917 Ga0496114_0001126 Ga0496114_0001126_11091_12206 350
452 3300048917 Ga0496114_0067733 Ga0496114_0067733_1825_2985 350
453 3300048918 Ga0496115_0018207 Ga0496115_0018207_1896_3056 350
454 3300049569 Ga0501032_0003033 Ga0501032_0003033_11756_12871 350
455 3300049571 Ga0501034_0183138 Ga0501034_0183138_817_1932 350
456 3300049572 Ga0501036_0025917 Ga0501036_0025917_2434_3549 350
457 3300049572 Ga0501036_0109704 Ga0501036_0109704_991_2106 350
458 3300049574 Ga0501038_0011652 Ga0501038_0011652_213_1328 350
459 3300049574 Ga0501038_0019954 Ga0501038_0019954_4905_6020 350
460 3300049575 Ga0501039_0025545 Ga0501039_0025545_2268_3383 350
461 3300049575 Ga0501039_0093033 Ga0501039_0093033_60_1175 350
462 3300049575 Ga0501039_0301256 Ga0501039_0301256_135_1250 350
463 3300049576 Ga0501040_0000736 Ga0501040_0000736_7916_9031 350
464 3300049576 Ga0501040_0111579 Ga0501040_0111579_366_1481 350
465 3300049576 Ga0501040_0171050 Ga0501040_0171050_230_1345 350
466 3300049577 Ga0501041_0001679 Ga0501041_0001679_2106_3221 350
467 3300049578 Ga0501042_0000136 Ga0501042_0000136_13480_14595 350
468 3300049578 Ga0501042_0021094 Ga0501042_0021094_2150_3268 350
469 3300049578 Ga0501042_0132836 Ga0501042_0132836_131_1246 350
470 3300049579 Ga0501043_0034274 Ga0501043_0034274_367_1482 350
471 3300049580 Ga0501046_0006646 Ga0501046_0006646_6292_7407 350
472 3300049580 Ga0501046_0022694 Ga0501046_0022694_3993_5108 350
473 3300049581 Ga0501047_0009484 Ga0501047_0009484_4625_5740 350
474 3300049581 Ga0501047_0019101 Ga0501047_0019101_3248_4468 350
475 3300049582 Ga0501048_0000746 Ga0501048_0000746_16456_17571 350
476 3300049582 Ga0501048_0031622 Ga0501048_0031622_1943_3058 350
477 3300049582 Ga0501048_0136663 Ga0501048_0136663_367_1482 350
478 3300049583 Ga0501067_0007264 Ga0501067_0007264_3314_4429 350
479 3300049585 Ga0501069_0005632 Ga0501069_0005632_2245_3363 350
480 3300049586 Ga0501070_0024433 Ga0501070_0024433_48_1163 350
481 3300049587 Ga0501071_0018406 Ga0501071_0018406_3062_4177 350
482 3300049587 Ga0501071_0047035 Ga0501071_0047035_309_1424 350
483 3300049587 Ga0501071_0153464 Ga0501071_0153464_308_1423 350
484 3300049588 Ga0501072_0024988 Ga0501072_0024988_413_1528 350
485 3300049588 Ga0501072_0079703 Ga0501072_0079703_1321_2436 350
486 3300049588 Ga0501072_0132127 Ga0501072_0132127_802_1917 350
487 3300049589 Ga0501073_0036911 Ga0501073_0036911_1460_2575 350
488 3300049590 Ga0501074_0016629 Ga0501074_0016629_3024_4139 350
489 3300049591 Ga0501075_0018914 Ga0501075_0018914_567_1682 350
490 3300049591 Ga0501075_0027650 Ga0501075_0027650_776_1891 350
491 3300049591 Ga0501075_0068919 Ga0501075_0068919_739_1854 350
492 3300049592 Ga0501076_0001623 Ga0501076_0001623_659_1774 350
493 3300049592 Ga0501076_0154502 Ga0501076_0154502_154_1269 350
494 3300049593 Ga0501077_0001472 Ga0501077_0001472_11236_12351 350
495 3300049668 Ga0501233_004561 Ga0501233_004561_1207_2325 350
496 3300049741 Ga0501079_0001112 Ga0501079_0001112_8101_9216 350
497 3300049741 Ga0501079_0024988 Ga0501079_0024988_2451_3566 350
498 3300049741 Ga0501079_0042214 Ga0501079_0042214_1937_3052 350
499 3300049742 Ga0501080_0006054 Ga0501080_0006054_7297_8412 350
500 3300049743 Ga0501081_0010712 Ga0501081_0010712_3671_4786 350
501 3300049743 Ga0501081_0048358 Ga0501081_0048358_155_1270 350
502 3300049744 Ga0501083_0036667 Ga0501083_0036667_1402_2517 350
503 3300049770 Ga0501273_001166 Ga0501273_001166_1259_2377 350
504 3300049822 Ga0501035_0004329 Ga0501035_0004329_4659_5774 350
505 3300049822 Ga0501035_0074224 Ga0501035_0074224_572_1792 350
506 3300049823 Ga0501044_0012276 Ga0501044_0012276_2054_3274 350
507 3300049824 Ga0501045_0016077 Ga0501045_0016077_1217_2332 350
508 3300049824 Ga0501045_0049837 Ga0501045_0049837_1589_2704 350
509 3300049824 Ga0501045_0231797 Ga0501045_0231797_77_1192 350
510 3300050507 nmdc:mga05p37_105024_c1 nmdc:mga05p37_105024_c1_891_2006 350
511 3300050507 nmdc:mga05p37_13002_c1 nmdc:mga05p37_13002_c1_3116_4231 350
512 3300050507 nmdc:mga05p37_13146_c1 nmdc:mga05p37_13146_c1_2602_3717 350
513 3300050507 nmdc:mga05p37_17008_c1 nmdc:mga05p37_17008_c1_7261_8376 350
514 3300050507 nmdc:mga05p37_61686_c1 nmdc:mga05p37_61686_c1_399_1514 350
515 3300050507 nmdc:mga05p37_633_c1 nmdc:mga05p37_633_c1_20847_21965 350
516 3300050508 nmdc:mga09592_69908_c1 nmdc:mga09592_69908_c1_354_1469 350
517 3300050509 nmdc:mga0qj67_7159_c1 nmdc:mga0qj67_7159_c1_4217_5335 350
518 3300050510 nmdc:mga06r32_387571_c1 nmdc:mga06r32_387571_c1_62_1177 350
519 3300050510 nmdc:mga06r32_5444_c1 nmdc:mga06r32_5444_c1_5398_6513 350
520 3300050510 nmdc:mga06r32_55823_c1 nmdc:mga06r32_55823_c1_440_1558 350
521 3300050511 nmdc:mga08y16_27678_c1 nmdc:mga08y16_27678_c1_2744_3859 350
522 3300050511 nmdc:mga08y16_43032_c1 nmdc:mga08y16_43032_c1_3314_4432 350
523 3300050511 nmdc:mga08y16_63226_c1 nmdc:mga08y16_63226_c1_653_1768 350
524 3300050512 nmdc:mga0n895_160226_c1 nmdc:mga0n895_160226_c1_72_1187 350
525 3300050512 nmdc:mga0n895_286305_c1 nmdc:mga0n895_286305_c1_328_1443 350
526 3300050512 nmdc:mga0n895_362748_c1 nmdc:mga0n895_362748_c1_92_1207 350
527 3300050512 nmdc:mga0n895_7298_c1 nmdc:mga0n895_7298_c1_1080_2195 350
528 3300050513 nmdc:mga0rr50_117297_c1 nmdc:mga0rr50_117297_c1_878_1993 350
529 3300050513 nmdc:mga0rr50_3929_c1 nmdc:mga0rr50_3929_c1_269_1384 350
530 3300050514 nmdc:mga08x19_14531_c1 nmdc:mga08x19_14531_c1_2152_3267 350
531 3300050514 nmdc:mga08x19_23330_c1 nmdc:mga08x19_23330_c1_1349_2464 350
532 3300050514 nmdc:mga08x19_23569_c1 nmdc:mga08x19_23569_c1_1572_2687 350
533 3300050515 nmdc:mga0a205_11026_c1 nmdc:mga0a205_11026_c1_4791_5906 350
534 3300050515 nmdc:mga0a205_3320_c1 nmdc:mga0a205_3320_c1_12945_14060 350
535 3300050515 nmdc:mga0a205_6923_c1 nmdc:mga0a205_6923_c1_4115_5230 350
536 3300054114 Ga0501084_0019513 Ga0501084_0019513_2362_3477 350
537 3300054114 Ga0501084_0027738 Ga0501084_0027738_1612_2727 350
538 3300055283 Ga0500661_000345 Ga0500661_000345_2829_3944 350
539 3300060353 Ga0501082_0034372 Ga0501082_0034372_2774_3889 350
540 3300060353 Ga0501082_0036758 Ga0501082_0036758_211_1326 350
541 3300061734 Ga0530510_0009057 Ga0530510_0009057_4466_5581 350
542 3300005328 Ga0070676_10029185 Ga0070676_100291853 351
543 3300005329 Ga0070683_100101142 Ga0070683_1001011422 351
544 3300005330 Ga0070690_100029296 Ga0070690_1000292963 351
545 3300005331 Ga0070670_100007091 Ga0070670_1000070918 351
546 3300005333 Ga0070677_10113419 Ga0070677_101134191 351
547 3300005335 Ga0070666_10061740 Ga0070666_100617402 351
548 3300005338 Ga0068868_100187050 Ga0068868_1001870502 351
549 3300005340 Ga0070689_100003430 Ga0070689_1000034305 351
550 3300005347 Ga0070668_100046833 Ga0070668_1000468333 351
551 3300005353 Ga0070669_100010503 Ga0070669_1000105037 351
552 3300005354 Ga0070675_100012576 Ga0070675_1000125767 351
553 3300005356 Ga0070674_100004778 Ga0070674_1000047787 351
554 3300005364 Ga0070673_100019496 Ga0070673_1000194963 351
555 3300005365 Ga0070688_100004677 Ga0070688_1000046773 351
556 3300005367 Ga0070667_100070574 Ga0070667_1000705743 351
557 3300005438 Ga0070701_10006980 Ga0070701_100069803 351
558 3300005440 Ga0070705_100117502 Ga0070705_1001175022 351
559 3300005444 Ga0070694_100014576 Ga0070694_1000145763 351
560 3300005456 Ga0070678_100038155 Ga0070678_1000381553 351
561 3300005458 Ga0070681_10046107 Ga0070681_100461076 351
562 3300005459 Ga0068867_100098812 Ga0068867_1000988122 351
563 3300005466 Ga0070685_10021980 Ga0070685_100219802 351
564 3300005467 Ga0070706_100033654 Ga0070706_1000336543 351
565 3300005471 Ga0070698_100026845 Ga0070698_1000268451 351
566 3300005543 Ga0070672_100001416 Ga0070672_10000141611 351
567 3300005544 Ga0070686_100006465 Ga0070686_1000064654 351
568 3300005548 Ga0070665_100048970 Ga0070665_1000489702 351
569 3300005549 Ga0070704_100018236 Ga0070704_1000182363 351
570 3300005844 Ga0068862_100220130 Ga0068862_1002201302 351
571 3300006358 Ga0068871_100210842 Ga0068871_1002108422 351
572 3300006852 Ga0075433_10048881 Ga0075433_100488812 351
573 3300006871 Ga0075434_100004439 Ga0075434_1000044397 351
574 3300013296 Ga0157374_10122397 Ga0157374_101223973 351
575 3300013306 Ga0163162_10013043 Ga0163162_100130432 351
576 3300013308 Ga0157375_10197260 Ga0157375_101972602 351
577 3300020076 Ga0206355_1340865 Ga0206355_13408654 351
578 3300025315 Ga0207697_10000679 Ga0207697_1000067913 351
579 3300025901 Ga0207688_10035037 Ga0207688_100350373 351
580 3300025907 Ga0207645_10020522 Ga0207645_100205223 351
581 3300025912 Ga0207707_10009889 Ga0207707_100098892 351
582 3300025922 Ga0207646_10125094 Ga0207646_101250943 351
583 3300025926 Ga0207659_10140352 Ga0207659_101403523 351
584 3300025936 Ga0207670_10023671 Ga0207670_100236713 351
585 3300025937 Ga0207669_10025096 Ga0207669_100250963 351
586 3300025940 Ga0207691_10000719 Ga0207691_1000071917 351
587 3300025944 Ga0207661_10183688 Ga0207661_101836882 351
588 3300025960 Ga0207651_10031516 Ga0207651_100315162 351
589 3300025972 Ga0207668_10018163 Ga0207668_100181633 351
590 3300026067 Ga0207678_10167138 Ga0207678_101671382 351
591 3300026089 Ga0207648_10018397 Ga0207648_100183973 351
592 3300026121 Ga0207683_10012242 Ga0207683_100122423 351
593 3300028379 Ga0268266_10038515 Ga0268266_100385152 351
594 3300028380 Ga0268265_10211464 Ga0268265_102114642 351
595 3300031731 Ga0307405_10062971 Ga0307405_100629712 351
596 3300039450 Ga0436363_0917829 Ga0436363_0917829_313_1434 351
597 3300042876 Ga0451577_0002725 Ga0451577_0002725_9866_10981 351
598 3300044673 Ga0453683_0092386 Ga0453683_0092386_189_1304 351
599 3300044712 Ga0453684_0000012 Ga0453684_0000012_1032183_1033298 351
600 3300044712 Ga0453684_0000169 Ga0453684_0000169_196502_197617 351
601 3300044712 Ga0453684_0003491 Ga0453684_0003491_19239_20354 351
602 3300044712 Ga0453684_0016307 Ga0453684_0016307_6395_7510 351
603 3300044765 Ga0466970_0072908 Ga0466970_0072908_99_1214 351
604 3300048915 Ga0496112_0280007 Ga0496112_0280007_234_1349 351
605 3300049581 Ga0501047_0080691 Ga0501047_0080691_1427_2542 351
606 3300049582 Ga0501048_0014166 Ga0501048_0014166_4766_5884 351
607 3300049584 Ga0501068_0015278 Ga0501068_0015278_1431_2549 351
608 3300049586 Ga0501070_0002988 Ga0501070_0002988_1859_2977 351
609 3300049590 Ga0501074_0017824 Ga0501074_0017824_864_1982 351
610 3300049743 Ga0501081_0109940 Ga0501081_0109940_627_1712 351
611 3300049744 Ga0501083_0014829 Ga0501083_0014829_4234_5352 351
612 3300050512 nmdc:mga0n895_2532_c1 nmdc:mga0n895_2532_c1_2392_3507 351
613 3300060353 Ga0501082_0042558 Ga0501082_0042558_2732_3850 351
614 3300005456 Ga0070678_100035823 Ga0070678_1000358232 352
615 3300005471 Ga0070698_100172721 Ga0070698_1001727212 352
616 3300005985 Ga0081539_10000561 Ga0081539_1000056152 352
617 3300013308 Ga0157375_10422519 Ga0157375_104225192 352
618 3300020078 Ga0206352_10036172 Ga0206352_100361721 352
619 3300026121 Ga0207683_10108782 Ga0207683_101087824 352
620 3300039447 Ga0436361_0825301 Ga0436361_0825301_12807_13922 352
621 3300044735 Ga0466968_0035820 Ga0466968_0035820_15_1079 352
622 3300050507 nmdc:mga05p37_65048_c1 nmdc:mga05p37_65048_c1_3286_4401 352
623 3300050510 nmdc:mga06r32_156881_c1 nmdc:mga06r32_156881_c1_305_1420 352
624 3300050511 nmdc:mga08y16_124703_c1 nmdc:mga08y16_124703_c1_384_1499 352
625 3300005339 Ga0070660_100047711 Ga0070660_1000477111 353
626 3300005366 Ga0070659_100000509 Ga0070659_1000005095 353
627 3300005545 Ga0070695_100037157 Ga0070695_1000371574 353
628 3300005618 Ga0068864_100044062 Ga0068864_1000440623 353
629 3300031665 Ga0316575_10012678 Ga0316575_100126784 353
630 3300031728 Ga0316578_10157651 Ga0316578_101576512 353
631 3300035121 Ga0373960_0022120 Ga0373960_0022120_304_1419 353
632 3300035398 Ga0316574_0003426 Ga0316574_0003426_2766_3881 353
633 3300036647 Ga0316582_0021198 Ga0316582_0021198_1404_2519 353
634 3300039447 Ga0436361_1168137 Ga0436361_1168137_246_1313 353
635 3300041511 Ga0451855_0829026 Ga0451855_0829026_48_1190 353
636 3300045051 Ga0451576_0000009 Ga0451576_0000009_663037_664152 353
637 3300046529 Ga0495652_0185090 Ga0495652_0185090_69_1184 353
638 3300049591 Ga0501075_0214054 Ga0501075_0214054_90_1157 353
639 3300049572 Ga0501036_0190753 Ga0501036_0190753_294_1499 354
640 3300049574 Ga0501038_0144855 Ga0501038_0144855_336_1541 354
641 3300049578 Ga0501042_0010070 Ga0501042_0010070_2036_3241 354
642 3300049580 Ga0501046_0030288 Ga0501046_0030288_1352_2557 354
643 3300049587 Ga0501071_0140324 Ga0501071_0140324_149_1354 354
644 3300049588 Ga0501072_0002154 Ga0501072_0002154_1920_3125 354
645 3300049590 Ga0501074_0013238 Ga0501074_0013238_4232_5437 354
646 3300049591 Ga0501075_0000083 Ga0501075_0000083_6587_7792 354
647 3300049592 Ga0501076_0002288 Ga0501076_0002288_11413_12618 354
648 3300049593 Ga0501077_0038239 Ga0501077_0038239_1472_2677 354
649 3300049741 Ga0501079_0014061 Ga0501079_0014061_479_1684 354
650 3300049742 Ga0501080_0019749 Ga0501080_0019749_468_1673 354
651 3300049743 Ga0501081_0027865 Ga0501081_0027865_376_1581 354
652 3300049824 Ga0501045_0033291 Ga0501045_0033291_1684_2889 354
653 3300060353 Ga0501082_0001739 Ga0501082_0001739_9441_10646 354
654 3300061734 Ga0530510_0000340 Ga0530510_0000340_20802_22007 354
655 3300005518 Ga0070699_100013190 Ga0070699_1000131902 355
656 3300005535 Ga0070684_100214364 Ga0070684_1002143641 355
657 3300025922 Ga0207646_10337962 Ga0207646_103379622 355
658 3300037418 Ga0395900_0002978 Ga0395900_0002978_13502_14668 355
659 3300037466 Ga0395898_0048743 Ga0395898_0048743_2787_3953 355
660 3300037471 Ga0395905_0006812 Ga0395905_0006812_9033_10199 355
661 3300038443 Ga0395901_0000632 Ga0395901_0000632_3272_4438 355
662 3300049592 Ga0501076_0204415 Ga0501076_0204415_82_1194 355
663 3300059421 Ga0590071_002219 Ga0590071_002219_676_1791 355
664 3300061734 Ga0530510_0108204 Ga0530510_0108204_445_1560 355
665 3300005435 Ga0070714_100407190 Ga0070714_1004071901 356
666 3300005842 Ga0068858_100096599 Ga0068858_1000965994 356
667 3300006237 Ga0097621_100033528 Ga0097621_1000335283 356
668 3300006237 Ga0097621_100084870 Ga0097621_1000848703 356
669 3300006358 Ga0068871_100004188 Ga0068871_1000041887 356
670 3300006881 Ga0068865_100021859 Ga0068865_1000218591 356
671 3300006914 Ga0075436_100132669 Ga0075436_1001326691 356
672 3300009176 Ga0105242_10002999 Ga0105242_100029998 356
673 3300009176 Ga0105242_10003810 Ga0105242_100038104 356
674 3300009177 Ga0105248_10139439 Ga0105248_101394393 356
675 3300014968 Ga0157379_10180862 Ga0157379_101808622 356
676 3300020069 Ga0197907_10808747 Ga0197907_108087471 356
677 3300020070 Ga0206356_10010578 Ga0206356_100105786 356
678 3300020080 Ga0206350_11224050 Ga0206350_112240501 356
679 3300020081 Ga0206354_10150820 Ga0206354_101508205 356
680 3300020082 Ga0206353_11207105 Ga0206353_112071054 356
681 3300022467 Ga0224712_10002051 Ga0224712_100020516 356
682 3300025934 Ga0207686_10005513 Ga0207686_100055135 356
683 3300025934 Ga0207686_10108448 Ga0207686_101084481 356
684 3300025938 Ga0207704_10153778 Ga0207704_101537782 356
685 3300026035 Ga0207703_10214119 Ga0207703_102141193 356
686 3300026088 Ga0207641_10132098 Ga0207641_101320982 356
687 3300026088 Ga0207641_10251221 Ga0207641_102512212 356
688 3300026089 Ga0207648_10057851 Ga0207648_100578512 356
689 3300028379 Ga0268266_10009438 Ga0268266_100094385 356
690 3300044658 Ga0466972_0093895 Ga0466972_0093895_209_1336 356
691 3300044693 Ga0466961_0165271 Ga0466961_0165271_31_1158 356
692 3300044706 Ga0466964_0004854 Ga0466964_0004854_2034_3161 356
693 3300044901 Ga0466960_0070903 Ga0466960_0070903_103_1230 356
694 3300048917 Ga0496114_0039963 Ga0496114_0039963_408_1523 356
695 3300048918 Ga0496115_0222524 Ga0496115_0222524_269_1390 356
696 3300013308 Ga0157375_10160280 Ga0157375_101602801 357
697 3300035170 Ga0373943_0083077 Ga0373943_0083077_285_1469 357
698 3300044735 Ga0466968_0001371 Ga0466968_0001371_2027_3142 357
699 3300048915 Ga0496112_0047502 Ga0496112_0047502_500_1684 357
700 3300007076 Ga0075435_100140957 Ga0075435_1001409572 358
701 3300049587 Ga0501071_0213716 Ga0501071_0213716_168_1280 358
702 3300005438 Ga0070701_10103728 Ga0070701_101037282 359
703 3300005985 Ga0081539_10000002 Ga0081539_10000002523 359
704 3300006852 Ga0075433_10052512 Ga0075433_100525124 359
705 3300009147 Ga0114129_10006387 Ga0114129_100063878 359
706 3300009553 Ga0105249_10191150 Ga0105249_101911502 359
707 3300021388 Ga0213875_10000709 Ga0213875_100007095 359
708 3300025961 Ga0207712_10198301 Ga0207712_101983012 359
709 3300037853 Ga0436364_0711490 Ga0436364_0711490_8001_9116 359
710 3300049591 Ga0501075_0071943 Ga0501075_0071943_314_1429 359
711 3300049592 Ga0501076_0248932 Ga0501076_0248932_148_1263 359
712 3300050507 nmdc:mga05p37_14093_c1 nmdc:mga05p37_14093_c1_2275_3390 359
713 3300050510 nmdc:mga06r32_9427_c1 nmdc:mga06r32_9427_c1_2912_4027 359
714 3300050515 nmdc:mga0a205_28317_c1 nmdc:mga0a205_28317_c1_1262_2377 359
715 3300061734 Ga0530510_0090779 Ga0530510_0090779_474_1589 359
716 3300005445 Ga0070708_100055684 Ga0070708_1000556844 360
717 3300005458 Ga0070681_10101418 Ga0070681_101014182 360
718 3300005468 Ga0070707_100012849 Ga0070707_1000128496 360
719 3300005471 Ga0070698_100028534 Ga0070698_1000285343 360
720 3300005983 Ga0081540_1035576 Ga0081540_10355763 360
721 3300025910 Ga0207684_10012753 Ga0207684_100127533 360
722 3300025912 Ga0207707_10161872 Ga0207707_101618722 360
723 3300025922 Ga0207646_10079040 Ga0207646_100790402 360
724 3300046664 Ga0495659_0008944 Ga0495659_0008944_1807_2922 360
725 3300050511 nmdc:mga08y16_155759_c1 nmdc:mga08y16_155759_c1_522_1640 360
726 3300005536 Ga0070697_100011794 Ga0070697_1000117945 361
727 3300006846 Ga0075430_100302523 Ga0075430_1003025231 361
728 3300006880 Ga0075429_100004928 Ga0075429_1000049282 361
729 3300009147 Ga0114129_10138710 Ga0114129_101387103 361
730 3300037853 Ga0436364_0273345 Ga0436364_0273345_322236_323351 361
731 3300050508 nmdc:mga09592_8125_c1 nmdc:mga09592_8125_c1_5582_6700 361
732 3300025910 Ga0207684_10005617 Ga0207684_100056176 362
733 3300037418 Ga0395900_0447029 Ga0395900_0447029_12_1106 362
734 3300046454 Ga0495592_0063402 Ga0495592_0063402_683_1777 362
735 3300005471 Ga0070698_100073239 Ga0070698_1000732395 363
736 3300005471 Ga0070698_100114398 Ga0070698_1001143983 363
737 3300006846 Ga0075430_100154801 Ga0075430_1001548012 363
738 3300009094 Ga0111539_10004383 Ga0111539_1000438314 363
739 3300021388 Ga0213875_10000073 Ga0213875_1000007337 363
740 3300037853 Ga0436364_0290389 Ga0436364_0290389_96290_97405 363
741 3300039437 Ga0436365_0340359 Ga0436365_0340359_151_1266 363
742 3300039438 Ga0436360_0866133 Ga0436360_0866133_750_1847 363
743 3300039453 Ga0436362_1112396 Ga0436362_1112396_283_1398 363
744 3300044694 Ga0466963_0000147 Ga0466963_0000147_21234_22349 363
745 3300044842 Ga0466957_0002573 Ga0466957_0002573_5690_6805 363
746 3300045836 Ga0466958_0000845 Ga0466958_0000845_1748_2863 363
747 3300045976 Ga0466967_0016308 Ga0466967_0016308_367_1482 363
748 3300045976 Ga0466967_0165975 Ga0466967_0165975_769_1866 363
749 3300049569 Ga0501032_0036382 Ga0501032_0036382_1030_2127 363
750 3300049572 Ga0501036_0236403 Ga0501036_0236403_181_1278 363
751 3300049578 Ga0501042_0021270 Ga0501042_0021270_2595_3692 363
752 3300049591 Ga0501075_0012164 Ga0501075_0012164_2836_3933 363
753 3300049822 Ga0501035_0287449 Ga0501035_0287449_201_1298 363
754 3300050509 nmdc:mga0qj67_301201_c1 nmdc:mga0qj67_301201_c1_76_1191 363
755 3300050511 nmdc:mga08y16_146515_c1 nmdc:mga08y16_146515_c1_175_1272 363
756 3300050511 nmdc:mga08y16_3320_c1 nmdc:mga08y16_3320_c1_11181_12293 363
757 3300061719 Ga0466962_0003226 Ga0466962_0003226_157_1272 363
758 3300009093 Ga0105240_10345316 Ga0105240_103453161 364
759 3300010375 Ga0105239_10005652 Ga0105239_1000565216 364
760 3300031824 Ga0307413_10141983 Ga0307413_101419832 364
761 3300036712 Ga0316584_0096753 Ga0316584_0096753_551_1648 364
762 3300045836 Ga0466958_0115978 Ga0466958_0115978_366_1565 364
763 3300046543 Ga0495645_0040174 Ga0495645_0040174_1984_3084 364
764 3300048903 Ga0496100_0046213 Ga0496100_0046213_477_1577 364
765 3300048904 Ga0496101_0014201 Ga0496101_0014201_2145_3245 364
766 3300048905 Ga0496102_0144225 Ga0496102_0144225_355_1455 364
767 3300048907 Ga0496104_0007687 Ga0496104_0007687_3030_4130 364
768 3300048910 Ga0496107_0031116 Ga0496107_0031116_640_1740 364
769 3300048917 Ga0496114_0009291 Ga0496114_0009291_1293_2393 364
770 3300049576 Ga0501040_0087333 Ga0501040_0087333_394_1494 364
771 3300049577 Ga0501041_0045372 Ga0501041_0045372_1381_2481 364
772 3300049580 Ga0501046_0094309 Ga0501046_0094309_1039_2139 364
773 3300049581 Ga0501047_0133037 Ga0501047_0133037_1115_2230 364
774 3300049587 Ga0501071_0017977 Ga0501071_0017977_418_1518 364
775 3300049592 Ga0501076_0208975 Ga0501076_0208975_479_1579 364
776 3300049823 Ga0501044_0006098 Ga0501044_0006098_6826_7941 364
777 3300060353 Ga0501082_0024896 Ga0501082_0024896_2242_3342 364
778 3300061719 Ga0466962_0008649 Ga0466962_0008649_2431_3630 364
779 iso_pu_bacteria 2791354901 2791916228 364
780 iso_pu_bacteria 2795385470 2795787128 365
781 iso_pu_bacteria 2816332139 2816511120 365
782 iso_pu_bacteria 2857481737 2857485227 365
783 iso_pu_bacteria 2866552031 2866552414 365
784 iso_pu_bacteria 2867302475 2867305750 365
785 iso_pu_bacteria 2899370129 2899376504 365
786 iso_pu_bacteria 2917736166 2917742976 365
787 iso_pu_bacteria 2920107658 2920110709 365
788 3300027665 Ga0209983_1008071 Ga0209983_10080712 367
789 3300005290 Ga0065712_10123381 Ga0065712_101233812 368
790 3300005330 Ga0070690_100021087 Ga0070690_1000210871 368
791 3300005331 Ga0070670_100001059 Ga0070670_10000105918 368
792 3300005340 Ga0070689_100069464 Ga0070689_1000694642 368
793 3300005343 Ga0070687_100107394 Ga0070687_1001073941 368
794 3300005354 Ga0070675_100146753 Ga0070675_1001467532 368
795 3300005355 Ga0070671_100069236 Ga0070671_1000692363 368
796 3300005364 Ga0070673_100025049 Ga0070673_1000250493 368
797 3300005365 Ga0070688_100103943 Ga0070688_1001039432 368
798 3300005459 Ga0068867_100060613 Ga0068867_1000606134 368
799 3300005467 Ga0070706_100009596 Ga0070706_1000095968 368
800 3300005468 Ga0070707_100008884 Ga0070707_1000088844 368
801 3300005471 Ga0070698_100003191 Ga0070698_10000319113 368
802 3300005543 Ga0070672_100050038 Ga0070672_1000500383 368
803 3300005544 Ga0070686_100004046 Ga0070686_1000040463 368
804 3300005544 Ga0070686_100024037 Ga0070686_1000240374 368
805 3300005548 Ga0070665_100000918 Ga0070665_10000091823 368
806 3300005549 Ga0070704_100164309 Ga0070704_1001643093 368
807 3300005564 Ga0070664_100045174 Ga0070664_1000451743 368
808 3300005578 Ga0068854_100025868 Ga0068854_1000258682 368
809 3300005578 Ga0068854_100147798 Ga0068854_1001477982 368
810 3300005618 Ga0068864_100004327 Ga0068864_1000043278 368
811 3300005719 Ga0068861_100203888 Ga0068861_1002038881 368
812 3300005843 Ga0068860_100044987 Ga0068860_1000449873 368
813 3300005843 Ga0068860_100499029 Ga0068860_1004990291 368
814 3300005844 Ga0068862_100190929 Ga0068862_1001909293 368
815 3300006871 Ga0075434_100337107 Ga0075434_1003371072 368
816 3300009098 Ga0105245_10238742 Ga0105245_102387423 368
817 3300009148 Ga0105243_10145138 Ga0105243_101451382 368
818 3300009177 Ga0105248_10015346 Ga0105248_100153466 368
819 3300009553 Ga0105249_10096558 Ga0105249_100965583 368
820 3300025910 Ga0207684_10003260 Ga0207684_100032606 368
821 3300025916 Ga0207663_10016144 Ga0207663_100161444 368
822 3300025918 Ga0207662_10006837 Ga0207662_100068374 368
823 3300025925 Ga0207650_10012436 Ga0207650_100124364 368
824 3300025931 Ga0207644_10037426 Ga0207644_100374263 368
825 3300025931 Ga0207644_10175141 Ga0207644_101751412 368
826 3300025933 Ga0207706_10063640 Ga0207706_100636405 368
827 3300025940 Ga0207691_10087000 Ga0207691_100870003 368
828 3300025941 Ga0207711_10052135 Ga0207711_100521353 368
829 3300025960 Ga0207651_10019976 Ga0207651_100199762 368
830 3300025981 Ga0207640_10196025 Ga0207640_101960252 368
831 3300025981 Ga0207640_10276004 Ga0207640_102760041 368
832 3300026035 Ga0207703_10096361 Ga0207703_100963611 368
833 3300026075 Ga0207708_10040242 Ga0207708_100402423 368
834 3300026089 Ga0207648_10015603 Ga0207648_100156034 368
835 3300026095 Ga0207676_10003276 Ga0207676_100032763 368
836 3300028379 Ga0268266_10000144 Ga0268266_10000144108 368
837 3300037418 Ga0395900_0104573 Ga0395900_0104573_1659_2816 368
838 3300049589 Ga0501073_0233871 Ga0501073_0233871_15_1127 368
839 3300049744 Ga0501083_0067869 Ga0501083_0067869_452_1627 368
840 3300050507 nmdc:mga05p37_254961_c1 nmdc:mga05p37_254961_c1_380_1486 368
841 3300050508 nmdc:mga09592_5571_c1 nmdc:mga09592_5571_c1_8345_9451 368
842 3300050510 nmdc:mga06r32_4843_c1 nmdc:mga06r32_4843_c1_8588_9694 368
843 3300050511 nmdc:mga08y16_67789_c1 nmdc:mga08y16_67789_c1_97_1209 368
844 3300050512 nmdc:mga0n895_235240_c1 nmdc:mga0n895_235240_c1_343_1455 368
845 3300054114 Ga0501084_0052104 Ga0501084_0052104_1641_2816 368
846 3300061719 Ga0466962_0000019 Ga0466962_0000019_69505_70617 368
847 3300005330 Ga0070690_100059680 Ga0070690_1000596803 369
848 3300005330 Ga0070690_100228249 Ga0070690_1002282491 369
849 3300005336 Ga0070680_100035035 Ga0070680_1000350351 369
850 3300005343 Ga0070687_100052085 Ga0070687_1000520853 369
851 3300005344 Ga0070661_100000337 Ga0070661_10000033721 369
852 3300005353 Ga0070669_100039144 Ga0070669_1000391444 369
853 3300005356 Ga0070674_100115095 Ga0070674_1001150952 369
854 3300005356 Ga0070674_100213277 Ga0070674_1002132771 369
855 3300005366 Ga0070659_100067384 Ga0070659_1000673843 369
856 3300005366 Ga0070659_100094328 Ga0070659_1000943282 369
857 3300005367 Ga0070667_100291071 Ga0070667_1002910711 369
858 3300005435 Ga0070714_100018316 Ga0070714_1000183163 369
859 3300005435 Ga0070714_100044243 Ga0070714_1000442433 369
860 3300005435 Ga0070714_100082531 Ga0070714_1000825313 369
861 3300005436 Ga0070713_100000077 Ga0070713_10000007712 369
862 3300005436 Ga0070713_100016796 Ga0070713_1000167966 369
863 3300005436 Ga0070713_100271354 Ga0070713_1002713542 369
864 3300005437 Ga0070710_10152289 Ga0070710_101522891 369
865 3300005439 Ga0070711_100030475 Ga0070711_1000304753 369
866 3300005439 Ga0070711_100039183 Ga0070711_1000391832 369
867 3300005439 Ga0070711_100206445 Ga0070711_1002064452 369
868 3300005444 Ga0070694_100015620 Ga0070694_1000156202 369
869 3300005444 Ga0070694_100020386 Ga0070694_1000203867 369
870 3300005444 Ga0070694_100022522 Ga0070694_1000225225 369
871 3300005444 Ga0070694_100039993 Ga0070694_1000399934 369
872 3300005445 Ga0070708_100008042 Ga0070708_1000080423 369
873 3300005445 Ga0070708_100018256 Ga0070708_1000182564 369
874 3300005445 Ga0070708_100034056 Ga0070708_1000340563 369
875 3300005445 Ga0070708_100097022 Ga0070708_1000970224 369
876 3300005445 Ga0070708_100152820 Ga0070708_1001528201 369
877 3300005445 Ga0070708_100284188 Ga0070708_1002841881 369
878 3300005445 Ga0070708_100323273 Ga0070708_1003232731 369
879 3300005445 Ga0070708_100445789 Ga0070708_1004457891 369
880 3300005455 Ga0070663_100172716 Ga0070663_1001727162 369
881 3300005456 Ga0070678_100054297 Ga0070678_1000542973 369
882 3300005456 Ga0070678_100136871 Ga0070678_1001368712 369
883 3300005458 Ga0070681_10317849 Ga0070681_103178491 369
884 3300005459 Ga0068867_100282356 Ga0068867_1002823561 369
885 3300005467 Ga0070706_100000571 Ga0070706_10000057115 369
886 3300005467 Ga0070706_100002551 Ga0070706_10000255120 369
887 3300005467 Ga0070706_100006789 Ga0070706_1000067899 369
888 3300005467 Ga0070706_100015345 Ga0070706_1000153454 369
889 3300005467 Ga0070706_100035268 Ga0070706_1000352682 369
890 3300005467 Ga0070706_100165017 Ga0070706_1001650173 369
891 3300005468 Ga0070707_100002793 Ga0070707_10000279312 369
892 3300005468 Ga0070707_100004339 Ga0070707_1000043393 369
893 3300005468 Ga0070707_100015375 Ga0070707_1000153755 369
894 3300005468 Ga0070707_100016485 Ga0070707_1000164858 369
895 3300005468 Ga0070707_100021175 Ga0070707_1000211754 369
896 3300005468 Ga0070707_100044136 Ga0070707_1000441365 369
897 3300005468 Ga0070707_100085212 Ga0070707_1000852122 369
898 3300005468 Ga0070707_100091644 Ga0070707_1000916444 369
899 3300005468 Ga0070707_100221053 Ga0070707_1002210531 369
900 3300005468 Ga0070707_100290153 Ga0070707_1002901532 369
901 3300005468 Ga0070707_100455127 Ga0070707_1004551271 369
902 3300005471 Ga0070698_100002655 Ga0070698_10000265517 369
903 3300005471 Ga0070698_100004799 Ga0070698_1000047998 369
904 3300005471 Ga0070698_100010196 Ga0070698_10001019610 369
905 3300005471 Ga0070698_100012331 Ga0070698_1000123319 369
906 3300005471 Ga0070698_100038683 Ga0070698_1000386833 369
907 3300005471 Ga0070698_100120065 Ga0070698_1001200651 369
908 3300005471 Ga0070698_100208912 Ga0070698_1002089123 369
909 3300005471 Ga0070698_100254077 Ga0070698_1002540772 369
910 3300005471 Ga0070698_100293923 Ga0070698_1002939231 369
911 3300005518 Ga0070699_100000246 Ga0070699_10000024644 369
912 3300005518 Ga0070699_100000445 Ga0070699_10000044543 369
913 3300005518 Ga0070699_100011353 Ga0070699_1000113536 369
914 3300005518 Ga0070699_100079689 Ga0070699_1000796893 369
915 3300005518 Ga0070699_100110006 Ga0070699_1001100062 369
916 3300005518 Ga0070699_100113468 Ga0070699_1001134682 369
917 3300005518 Ga0070699_100113839 Ga0070699_1001138392 369
918 3300005530 Ga0070679_100023887 Ga0070679_1000238877 369
919 3300005536 Ga0070697_100000019 Ga0070697_10000001948 369
920 3300005536 Ga0070697_100000525 Ga0070697_1000005252 369
921 3300005536 Ga0070697_100007674 Ga0070697_1000076748 369
922 3300005536 Ga0070697_100035410 Ga0070697_1000354103 369
923 3300005536 Ga0070697_100147384 Ga0070697_1001473842 369
924 3300005536 Ga0070697_100305763 Ga0070697_1003057632 369
925 3300005536 Ga0070697_100322514 Ga0070697_1003225142 369
926 3300005539 Ga0068853_100023963 Ga0068853_1000239635 369
927 3300005543 Ga0070672_100154118 Ga0070672_1001541182 369
928 3300005545 Ga0070695_100006514 Ga0070695_1000065146 369
929 3300005545 Ga0070695_100013686 Ga0070695_1000136866 369
930 3300005545 Ga0070695_100036877 Ga0070695_1000368772 369
931 3300005546 Ga0070696_100016551 Ga0070696_1000165513 369
932 3300005546 Ga0070696_100050310 Ga0070696_1000503102 369
933 3300005547 Ga0070693_100023474 Ga0070693_1000234742 369
934 3300005548 Ga0070665_100025742 Ga0070665_1000257424 369
935 3300005549 Ga0070704_100000100 Ga0070704_10000010027 369
936 3300005549 Ga0070704_100007918 Ga0070704_1000079184 369
937 3300005549 Ga0070704_100024859 Ga0070704_1000248593 369
938 3300005549 Ga0070704_100038084 Ga0070704_1000380844 369
939 3300005549 Ga0070704_100081032 Ga0070704_1000810323 369
940 3300005563 Ga0068855_100074450 Ga0068855_1000744503 369
941 3300005563 Ga0068855_100110247 Ga0068855_1001102473 369
942 3300005564 Ga0070664_100037540 Ga0070664_1000375404 369
943 3300005564 Ga0070664_100113217 Ga0070664_1001132172 369
944 3300005616 Ga0068852_100219193 Ga0068852_1002191932 369
945 3300005616 Ga0068852_100311489 Ga0068852_1003114891 369
946 3300005617 Ga0068859_100007870 Ga0068859_10000787014 369
947 3300005617 Ga0068859_100019974 Ga0068859_1000199748 369
948 3300005617 Ga0068859_100392275 Ga0068859_1003922752 369
949 3300005618 Ga0068864_100098562 Ga0068864_1000985623 369
950 3300005618 Ga0068864_100116775 Ga0068864_1001167752 369
951 3300005834 Ga0068851_10068406 Ga0068851_100684062 369
952 3300005841 Ga0068863_100011064 Ga0068863_1000110642 369
953 3300005842 Ga0068858_100118665 Ga0068858_1001186653 369
954 3300005843 Ga0068860_100017471 Ga0068860_1000174717 369
955 3300005843 Ga0068860_100027324 Ga0068860_1000273244 369
956 3300005843 Ga0068860_100366730 Ga0068860_1003667302 369
957 3300005844 Ga0068862_100005233 Ga0068862_1000052334 369
958 3300005844 Ga0068862_100051601 Ga0068862_1000516013 369
959 3300005844 Ga0068862_100124592 Ga0068862_1001245923 369
960 3300005844 Ga0068862_100151576 Ga0068862_1001515761 369
961 3300005937 Ga0081455_10000425 Ga0081455_1000042542 369
962 3300005937 Ga0081455_10001083 Ga0081455_1000108316 369
963 3300005937 Ga0081455_10001235 Ga0081455_1000123514 369
964 3300005937 Ga0081455_10003380 Ga0081455_1000338014 369
965 3300005937 Ga0081455_10029910 Ga0081455_100299102 369
966 3300005983 Ga0081540_1000477 Ga0081540_100047736 369
967 3300005983 Ga0081540_1014252 Ga0081540_10142522 369
968 3300006028 Ga0070717_10003706 Ga0070717_100037063 369
969 3300006028 Ga0070717_10004049 Ga0070717_100040492 369
970 3300006028 Ga0070717_10010889 Ga0070717_100108894 369
971 3300006028 Ga0070717_10040441 Ga0070717_100404413 369
972 3300006028 Ga0070717_10076738 Ga0070717_100767384 369
973 3300006028 Ga0070717_10133746 Ga0070717_101337463 369
974 3300006173 Ga0070716_100010129 Ga0070716_1000101294 369
975 3300006175 Ga0070712_100015499 Ga0070712_1000154994 369
976 3300006237 Ga0097621_100029738 Ga0097621_1000297382 369
977 3300006237 Ga0097621_100030890 Ga0097621_1000308904 369
978 3300006358 Ga0068871_100026825 Ga0068871_1000268253 369
979 3300006844 Ga0075428_100012867 Ga0075428_1000128674 369
980 3300006844 Ga0075428_100119298 Ga0075428_1001192982 369
981 3300006846 Ga0075430_100000131 Ga0075430_10000013140 369
982 3300006846 Ga0075430_100040815 Ga0075430_1000408152 369
983 3300006847 Ga0075431_100000085 Ga0075431_10000008549 369
984 3300006847 Ga0075431_100016598 Ga0075431_1000165984 369
985 3300006847 Ga0075431_100162756 Ga0075431_1001627561 369
986 3300006852 Ga0075433_10001097 Ga0075433_1000109710 369
987 3300006852 Ga0075433_10021647 Ga0075433_100216475 369
988 3300006852 Ga0075433_10041200 Ga0075433_100412002 369
989 3300006852 Ga0075433_10042835 Ga0075433_100428353 369
990 3300006852 Ga0075433_10095753 Ga0075433_100957534 369
991 3300006871 Ga0075434_100004776 Ga0075434_1000047764 369
992 3300006871 Ga0075434_100019782 Ga0075434_1000197824 369
993 3300006871 Ga0075434_100039235 Ga0075434_1000392356 369
994 3300006871 Ga0075434_100040943 Ga0075434_1000409431 369
995 3300006871 Ga0075434_100139616 Ga0075434_1001396163 369
996 3300006880 Ga0075429_100021653 Ga0075429_1000216536 369
997 3300006881 Ga0068865_100151693 Ga0068865_1001516932 369
998 3300006914 Ga0075436_100040616 Ga0075436_1000406163 369
999 3300006914 Ga0075436_100092473 Ga0075436_1000924733 369
1000 3300006931 Ga0097620_100007870 Ga0097620_1000078704 369
1001 3300006931 Ga0097620_100019974 Ga0097620_1000199748 369
1002 3300006931 Ga0097620_100392314 Ga0097620_1003923142 369
1003 3300007076 Ga0075435_100031014 Ga0075435_1000310144 369
1004 3300007076 Ga0075435_100173742 Ga0075435_1001737423 369
1005 3300007265 Ga0099794_10003365 Ga0099794_100033657 369
1006 3300007788 Ga0099795_10022013 Ga0099795_100220133 369
1007 3300009094 Ga0111539_10003751 Ga0111539_1000375117 369
1008 3300009094 Ga0111539_10024126 Ga0111539_100241268 369
1009 3300009094 Ga0111539_10054153 Ga0111539_100541532 369
1010 3300009094 Ga0111539_10057337 Ga0111539_100573373 369
1011 3300009094 Ga0111539_10235652 Ga0111539_102356522 369
1012 3300009094 Ga0111539_10237348 Ga0111539_102373481 369
1013 3300009094 Ga0111539_10531246 Ga0111539_105312461 369
1014 3300009147 Ga0114129_10001123 Ga0114129_100011239 369
1015 3300009147 Ga0114129_10002419 Ga0114129_1000241916 369
1016 3300009147 Ga0114129_10003362 Ga0114129_1000336222 369
1017 3300009147 Ga0114129_10018829 Ga0114129_100188297 369
1018 3300009147 Ga0114129_10024305 Ga0114129_100243054 369
1019 3300009147 Ga0114129_10066823 Ga0114129_100668235 369
1020 3300009147 Ga0114129_10067494 Ga0114129_100674942 369
1021 3300009147 Ga0114129_10186779 Ga0114129_101867792 369
1022 3300009147 Ga0114129_10203128 Ga0114129_102031282 369
1023 3300009147 Ga0114129_10314759 Ga0114129_103147593 369
1024 3300009148 Ga0105243_10129009 Ga0105243_101290092 369
1025 3300009174 Ga0105241_10055773 Ga0105241_100557732 369
1026 3300009177 Ga0105248_10015864 Ga0105248_100158648 369
1027 3300009177 Ga0105248_10052621 Ga0105248_100526214 369
1028 3300009551 Ga0105238_10342897 Ga0105238_103428972 369
1029 3300009553 Ga0105249_10039257 Ga0105249_100392571 369
1030 3300009553 Ga0105249_10109435 Ga0105249_101094354 369
1031 3300011119 Ga0105246_10249414 Ga0105246_102494142 369
1032 3300013102 Ga0157371_10070978 Ga0157371_100709783 369
1033 3300013102 Ga0157371_10173187 Ga0157371_101731871 369
1034 3300013104 Ga0157370_10038299 Ga0157370_100382993 369
1035 3300013104 Ga0157370_10195621 Ga0157370_101956213 369
1036 3300013105 Ga0157369_10043901 Ga0157369_100439012 369
1037 3300013105 Ga0157369_10132179 Ga0157369_101321794 369
1038 3300013296 Ga0157374_10038850 Ga0157374_100388505 369
1039 3300013296 Ga0157374_10127668 Ga0157374_101276682 369
1040 3300013297 Ga0157378_10233805 Ga0157378_102338052 369
1041 3300013306 Ga0163162_10096906 Ga0163162_100969064 369
1042 3300013307 Ga0157372_10133903 Ga0157372_101339034 369
1043 3300013308 Ga0157375_10325481 Ga0157375_103254812 369
1044 3300014325 Ga0163163_10058045 Ga0163163_100580453 369
1045 3300014326 Ga0157380_10050546 Ga0157380_100505463 369
1046 3300014326 Ga0157380_10086056 Ga0157380_100860562 369
1047 3300014969 Ga0157376_10227698 Ga0157376_102276982 369
1048 3300017792 Ga0163161_10001322 Ga0163161_100013222 369
1049 3300020069 Ga0197907_11017334 Ga0197907_110173341 369
1050 3300020075 Ga0206349_1326472 Ga0206349_13264722 369
1051 3300020080 Ga0206350_11293820 Ga0206350_112938201 369
1052 3300020082 Ga0206353_10682319 Ga0206353_106823192 369
1053 3300021358 Ga0213873_10006779 Ga0213873_100067791 369
1054 3300021384 Ga0213876_10007022 Ga0213876_100070227 369
1055 3300021384 Ga0213876_10097039 Ga0213876_100970391 369
1056 3300021388 Ga0213875_10042463 Ga0213875_100424633 369
1057 3300021388 Ga0213875_10063499 Ga0213875_100634992 369
1058 3300022467 Ga0224712_10026175 Ga0224712_100261752 369
1059 3300022467 Ga0224712_10031533 Ga0224712_100315331 369
1060 3300025898 Ga0207692_10102474 Ga0207692_101024742 369
1061 3300025901 Ga0207688_10004833 Ga0207688_100048336 369
1062 3300025903 Ga0207680_10077915 Ga0207680_100779152 369
1063 3300025903 Ga0207680_10197383 Ga0207680_101973832 369
1064 3300025906 Ga0207699_10020124 Ga0207699_100201243 369
1065 3300025907 Ga0207645_10010292 Ga0207645_100102926 369
1066 3300025908 Ga0207643_10041603 Ga0207643_100416033 369
1067 3300025909 Ga0207705_10103581 Ga0207705_101035813 369
1068 3300025910 Ga0207684_10000005 Ga0207684_10000005457 369
1069 3300025910 Ga0207684_10004441 Ga0207684_100044412 369
1070 3300025910 Ga0207684_10009354 Ga0207684_100093546 369
1071 3300025910 Ga0207684_10025084 Ga0207684_100250843 369
1072 3300025910 Ga0207684_10036843 Ga0207684_100368431 369
1073 3300025910 Ga0207684_10038792 Ga0207684_100387923 369
1074 3300025910 Ga0207684_10069533 Ga0207684_100695334 369
1075 3300025910 Ga0207684_10218140 Ga0207684_102181402 369
1076 3300025910 Ga0207684_10306439 Ga0207684_103064391 369
1077 3300025912 Ga0207707_10011546 Ga0207707_100115468 369
1078 3300025915 Ga0207693_10046489 Ga0207693_100464893 369
1079 3300025916 Ga0207663_10010383 Ga0207663_100103835 369
1080 3300025916 Ga0207663_10070749 Ga0207663_100707492 369
1081 3300025916 Ga0207663_10083237 Ga0207663_100832372 369
1082 3300025917 Ga0207660_10028343 Ga0207660_100283435 369
1083 3300025919 Ga0207657_10057083 Ga0207657_100570832 369
1084 3300025920 Ga0207649_10000481 Ga0207649_1000048110 369
1085 3300025921 Ga0207652_10027355 Ga0207652_100273552 369
1086 3300025922 Ga0207646_10000306 Ga0207646_1000030674 369
1087 3300025922 Ga0207646_10000904 Ga0207646_1000090445 369
1088 3300025922 Ga0207646_10001068 Ga0207646_1000106834 369
1089 3300025922 Ga0207646_10001878 Ga0207646_1000187818 369
1090 3300025922 Ga0207646_10001879 Ga0207646_1000187922 369
1091 3300025922 Ga0207646_10002018 Ga0207646_1000201810 369
1092 3300025922 Ga0207646_10003799 Ga0207646_1000379918 369
1093 3300025922 Ga0207646_10008690 Ga0207646_100086908 369
1094 3300025922 Ga0207646_10019117 Ga0207646_100191174 369
1095 3300025922 Ga0207646_10019967 Ga0207646_100199672 369
1096 3300025922 Ga0207646_10020928 Ga0207646_100209285 369
1097 3300025922 Ga0207646_10027578 Ga0207646_100275788 369
1098 3300025922 Ga0207646_10039602 Ga0207646_100396023 369
1099 3300025922 Ga0207646_10081664 Ga0207646_100816643 369
1100 3300025922 Ga0207646_10098422 Ga0207646_100984223 369
1101 3300025922 Ga0207646_10133779 Ga0207646_101337792 369
1102 3300025922 Ga0207646_10230493 Ga0207646_102304932 369
1103 3300025923 Ga0207681_10233504 Ga0207681_102335042 369
1104 3300025925 Ga0207650_10132390 Ga0207650_101323902 369
1105 3300025925 Ga0207650_10239137 Ga0207650_102391372 369
1106 3300025928 Ga0207700_10036339 Ga0207700_100363393 369
1107 3300025929 Ga0207664_10018945 Ga0207664_100189455 369
1108 3300025929 Ga0207664_10035676 Ga0207664_100356764 369
1109 3300025929 Ga0207664_10189481 Ga0207664_101894812 369
1110 3300025931 Ga0207644_10016798 Ga0207644_100167985 369
1111 3300025932 Ga0207690_10070686 Ga0207690_100706862 369
1112 3300025933 Ga0207706_10057744 Ga0207706_100577443 369
1113 3300025933 Ga0207706_10176804 Ga0207706_101768042 369
1114 3300025937 Ga0207669_10094392 Ga0207669_100943922 369
1115 3300025939 Ga0207665_10001209 Ga0207665_1000120923 369
1116 3300025939 Ga0207665_10017373 Ga0207665_100173733 369
1117 3300025940 Ga0207691_10006661 Ga0207691_100066615 369
1118 3300025940 Ga0207691_10124980 Ga0207691_101249803 369
1119 3300025941 Ga0207711_10305272 Ga0207711_103052721 369
1120 3300025941 Ga0207711_10321455 Ga0207711_103214552 369
1121 3300025942 Ga0207689_10112337 Ga0207689_101123372 369
1122 3300025945 Ga0207679_10018603 Ga0207679_100186033 369
1123 3300025949 Ga0207667_10305740 Ga0207667_103057403 369
1124 3300025949 Ga0207667_10539705 Ga0207667_105397051 369
1125 3300025961 Ga0207712_10073921 Ga0207712_100739214 369
1126 3300026035 Ga0207703_10144447 Ga0207703_101444472 369
1127 3300026035 Ga0207703_10161344 Ga0207703_101613441 369
1128 3300026035 Ga0207703_10368781 Ga0207703_103687811 369
1129 3300026067 Ga0207678_10007236 Ga0207678_100072369 369
1130 3300026067 Ga0207678_10033052 Ga0207678_100330523 369
1131 3300026078 Ga0207702_10090526 Ga0207702_100905264 369
1132 3300026089 Ga0207648_10162881 Ga0207648_101628812 369
1133 3300026095 Ga0207676_10000817 Ga0207676_1000081723 369
1134 3300026095 Ga0207676_10018645 Ga0207676_100186453 369
1135 3300026095 Ga0207676_10024607 Ga0207676_100246073 369
1136 3300026116 Ga0207674_10008460 Ga0207674_100084605 369
1137 3300026118 Ga0207675_100017933 Ga0207675_1000179335 369
1138 3300026121 Ga0207683_10005401 Ga0207683_100054014 369
1139 3300027360 Ga0209969_1000694 Ga0209969_10006943 369
1140 3300027378 Ga0209981_1002338 Ga0209981_10023382 369
1141 3300027395 Ga0209996_1000221 Ga0209996_10002214 369
1142 3300027424 Ga0209984_1001938 Ga0209984_10019382 369
1143 3300027526 Ga0209968_1000718 Ga0209968_10007186 369
1144 3300027543 Ga0209999_1001534 Ga0209999_10015344 369
1145 3300027552 Ga0209982_1000703 Ga0209982_10007035 369
1146 3300027614 Ga0209970_1004361 Ga0209970_10043612 369
1147 3300027617 Ga0210002_1001800 Ga0210002_10018004 369
1148 3300027671 Ga0209588_1000551 Ga0209588_10005518 369
1149 3300027682 Ga0209971_1000037 Ga0209971_10000375 369
1150 3300027695 Ga0209966_1001107 Ga0209966_10011072 369
1151 3300027717 Ga0209998_10000042 Ga0209998_1000004251 369
1152 3300027876 Ga0209974_10003125 Ga0209974_100031256 369
1153 3300027907 Ga0207428_10071496 Ga0207428_100714963 369
1154 3300027907 Ga0207428_10135386 Ga0207428_101353862 369
1155 3300028017 Ga0265356_1000014 Ga0265356_100001423 369
1156 3300028379 Ga0268266_10062679 Ga0268266_100626792 369
1157 3300028380 Ga0268265_10017356 Ga0268265_100173563 369
1158 3300028380 Ga0268265_10042547 Ga0268265_100425472 369
1159 3300028380 Ga0268265_10047694 Ga0268265_100476945 369
1160 3300028380 Ga0268265_10051356 Ga0268265_100513564 369
1161 3300028563 Ga0265319_1008416 Ga0265319_10084164 369
1162 3300028577 Ga0265318_10000563 Ga0265318_100005639 369
1163 3300028666 Ga0265336_10002162 Ga0265336_100021629 369
1164 3300028800 Ga0265338_10005213 Ga0265338_1000521312 369
1165 3300028800 Ga0265338_10098315 Ga0265338_100983152 369
1166 3300029957 Ga0265324_10002494 Ga0265324_1000249411 369
1167 3300031238 Ga0265332_10006760 Ga0265332_100067602 369
1168 3300031240 Ga0265320_10000328 Ga0265320_1000032825 369
1169 3300031240 Ga0265320_10011378 Ga0265320_100113783 369
1170 3300031242 Ga0265329_10000518 Ga0265329_1000051816 369
1171 3300031247 Ga0265340_10011233 Ga0265340_100112333 369
1172 3300031249 Ga0265339_10001696 Ga0265339_1000169611 369
1173 3300031249 Ga0265339_10002679 Ga0265339_1000267916 369
1174 3300031250 Ga0265331_10000021 Ga0265331_10000021215 369
1175 3300031344 Ga0265316_10003604 Ga0265316_100036045 369
1176 3300031344 Ga0265316_10010196 Ga0265316_100101969 369
1177 3300031344 Ga0265316_10017275 Ga0265316_100172756 369
1178 3300031595 Ga0265313_10000730 Ga0265313_1000073010 369
1179 3300031691 Ga0316579_10045935 Ga0316579_100459353 369
1180 3300031711 Ga0265314_10000714 Ga0265314_1000071436 369
1181 3300031711 Ga0265314_10012056 Ga0265314_100120563 369
1182 3300031712 Ga0265342_10000032 Ga0265342_10000032137 369
1183 3300031712 Ga0265342_10012485 Ga0265342_100124855 369
1184 3300031712 Ga0265342_10047705 Ga0265342_100477052 369
1185 3300031731 Ga0307405_10010527 Ga0307405_100105277 369
1186 3300031733 Ga0316577_10132362 Ga0316577_101323622 369
1187 3300031824 Ga0307413_10000706 Ga0307413_100007066 369
1188 3300031852 Ga0307410_10034567 Ga0307410_100345671 369
1189 3300031852 Ga0307410_10047798 Ga0307410_100477983 369
1190 3300031852 Ga0307410_10068439 Ga0307410_100684393 369
1191 3300031852 Ga0307410_10071045 Ga0307410_100710453 369
1192 3300031889 Ga0326468_10001123 Ga0326468_100011233 369
1193 3300031901 Ga0307406_10068626 Ga0307406_100686263 369
1194 3300031903 Ga0307407_10025199 Ga0307407_100251993 369
1195 3300031903 Ga0307407_10054402 Ga0307407_100544023 369
1196 3300031911 Ga0307412_10002301 Ga0307412_100023014 369
1197 3300031995 Ga0307409_100020122 Ga0307409_1000201224 369
1198 3300031995 Ga0307409_100023306 Ga0307409_1000233067 369
1199 3300031995 Ga0307409_100095140 Ga0307409_1000951402 369
1200 3300031995 Ga0307409_100098678 Ga0307409_1000986783 369
1201 3300032002 Ga0307416_100000731 Ga0307416_1000007315 369
1202 3300032002 Ga0307416_100010701 Ga0307416_1000107015 369
1203 3300032002 Ga0307416_100022831 Ga0307416_1000228314 369
1204 3300032002 Ga0307416_100050355 Ga0307416_1000503557 369
1205 3300032002 Ga0307416_100282787 Ga0307416_1002827873 369
1206 3300032004 Ga0307414_10014074 Ga0307414_100140743 369
1207 3300032004 Ga0307414_10184890 Ga0307414_101848902 369
1208 3300032005 Ga0307411_10008080 Ga0307411_100080803 369
1209 3300032005 Ga0307411_10010265 Ga0307411_100102657 369
1210 3300032126 Ga0307415_100051543 Ga0307415_1000515433 369
1211 3300032126 Ga0307415_100136852 Ga0307415_1001368522 369
1212 3300035088 Ga0373940_0003892 Ga0373940_0003892_1638_2753 369
1213 3300035112 Ga0373932_0015243 Ga0373932_0015243_781_1896 369
1214 3300035112 Ga0373932_0051314 Ga0373932_0051314_65_1180 369
1215 3300035117 Ga0373953_0000010 Ga0373953_0000010_29571_30743 369
1216 3300035119 Ga0373956_0000605 Ga0373956_0000605_12650_13822 369
1217 3300035120 Ga0373957_0000044 Ga0373957_0000044_29457_30629 369
1218 3300035121 Ga0373960_0009615 Ga0373960_0009615_63_1178 369
1219 3300035172 Ga0373955_0000022 Ga0373955_0000022_29930_31102 369
1220 3300035172 Ga0373955_0095709 Ga0373955_0095709_53_1168 369
1221 3300035410 Ga0373924_0000255 Ga0373924_0000255_892_2064 369
1222 3300035691 Ga0373931_0114233 Ga0373931_0114233_176_1336 369
1223 3300035724 Ga0373933_0000023 Ga0373933_0000023_54206_55378 369
1224 3300036401 Ga0373937_0000091 Ga0373937_0000091_54224_55396 369
1225 3300037068 Ga0373925_0007606 Ga0373925_0007606_3280_4464 369
1226 3300037068 Ga0373925_0147056 Ga0373925_0147056_49_1164 369
1227 3300037418 Ga0395900_0004019 Ga0395900_0004019_3096_4256 369
1228 3300037418 Ga0395900_0105528 Ga0395900_0105528_995_2179 369
1229 3300037466 Ga0395898_0254375 Ga0395898_0254375_527_1642 369
1230 3300037471 Ga0395905_0204128 Ga0395905_0204128_583_1767 369
1231 3300037853 Ga0436364_0394521 Ga0436364_0394521_377_1492 369
1232 3300038443 Ga0395901_0244606 Ga0395901_0244606_215_1330 369
1233 3300039437 Ga0436365_1227182 Ga0436365_1227182_3980_5095 369
1234 3300039437 Ga0436365_1624907 Ga0436365_1624907_423_1538 369
1235 3300039447 Ga0436361_0017732 Ga0436361_0017732_2705_3820 369
1236 3300039450 Ga0436363_0384313 Ga0436363_0384313_1198_2313 369
1237 3300039450 Ga0436363_0916663 Ga0436363_0916663_291_1406 369
1238 3300039453 Ga0436362_0194955 Ga0436362_0194955_1297_2412 369
1239 3300039453 Ga0436362_0925701 Ga0436362_0925701_1863_2978 369
1240 3300039453 Ga0436362_0945875 Ga0436362_0945875_1321_2436 369
1241 3300042157 Ga0439458_0007203 Ga0439458_0007203_1085_2269 369
1242 3300042436 Ga0439435_0009668 Ga0439435_0009668_955_2070 369
1243 3300042461 Ga0439460_0004907 Ga0439460_0004907_1945_3060 369
1244 3300042876 Ga0451577_0014229 Ga0451577_0014229_629_1744 369
1245 3300044658 Ga0466972_0051981 Ga0466972_0051981_712_1827 369
1246 3300044673 Ga0453683_0076361 Ga0453683_0076361_23_1174 369
1247 3300044684 Ga0466966_0043491 Ga0466966_0043491_400_1515 369
1248 3300044712 Ga0453684_0007847 Ga0453684_0007847_7840_8955 369
1249 3300045049 Ga0466959_0079386 Ga0466959_0079386_996_2111 369
1250 3300045051 Ga0451576_0010179 Ga0451576_0010179_6725_7840 369
1251 3300045051 Ga0451576_0317118 Ga0451576_0317118_426_1541 369
1252 3300045051 Ga0451576_0335230 Ga0451576_0335230_162_1274 369
1253 3300046454 Ga0495592_0000066 Ga0495592_0000066_54206_55378 369
1254 3300046459 Ga0495629_0001099 Ga0495629_0001099_13013_14128 369
1255 3300046462 Ga0495651_0000062 Ga0495651_0000062_24788_25960 369
1256 3300046463 Ga0495653_0001563 Ga0495653_0001563_10498_11670 369
1257 3300046471 Ga0495650_0033561 Ga0495650_0033561_463_1581 369
1258 3300046473 Ga0495582_0011615 Ga0495582_0011615_2758_3873 369
1259 3300046499 Ga0495594_0006555 Ga0495594_0006555_1308_2423 369
1260 3300046511 Ga0495608_0000052 Ga0495608_0000052_54200_55372 369
1261 3300046511 Ga0495608_0186605 Ga0495608_0186605_116_1231 369
1262 3300046516 Ga0495628_0000341 Ga0495628_0000341_35989_37161 369
1263 3300046517 Ga0495630_0013891 Ga0495630_0013891_4241_5356 369
1264 3300046529 Ga0495652_0000727 Ga0495652_0000727_13095_14267 369
1265 3300046535 Ga0495586_0087441 Ga0495586_0087441_357_1472 369
1266 3300046536 Ga0495587_0000059 Ga0495587_0000059_54193_55365 369
1267 3300046559 Ga0495667_0000119 Ga0495667_0000119_16927_18099 369
1268 3300046663 Ga0495635_0005233 Ga0495635_0005233_3131_4246 369
1269 3300046664 Ga0495659_0034158 Ga0495659_0034158_429_1544 369
1270 3300046675 Ga0495657_0000062 Ga0495657_0000062_40686_41858 369
1271 3300046675 Ga0495657_0048825 Ga0495657_0048825_1473_2588 369
1272 3300046678 Ga0495599_0000116 Ga0495599_0000116_27374_28546 369
1273 3300046679 Ga0495623_0000060 Ga0495623_0000060_12357_13529 369
1274 3300046680 Ga0495646_0003166 Ga0495646_0003166_460_1632 369
1275 3300046683 Ga0495658_0002224 Ga0495658_0002224_3682_4797 369
1276 3300046684 Ga0495669_0008295 Ga0495669_0008295_1733_2848 369
1277 3300046689 Ga0495613_0002740 Ga0495613_0002740_2188_3303 369
1278 3300046690 Ga0495624_0152128 Ga0495624_0152128_118_1233 369
1279 3300046809 Ga0495600_0003968 Ga0495600_0003968_2000_3172 369
1280 3300047315 Ga0495581_0004247 Ga0495581_0004247_2410_3525 369
1281 3300047317 Ga0495604_0000059 Ga0495604_0000059_40686_41858 369
1282 3300047318 Ga0495636_0042487 Ga0495636_0042487_219_1334 369
1283 3300047319 Ga0495674_0260147 Ga0495674_0260147_75_1190 369
1284 3300047319 Ga0495674_0332827 Ga0495674_0332827_12_1127 369
1285 3300047322 Ga0495680_0000125 Ga0495680_0000125_54061_55233 369
1286 3300047322 Ga0495680_0001823 Ga0495680_0001823_14098_15213 369
1287 3300047444 Ga0495675_0001638 Ga0495675_0001638_3492_4664 369
1288 3300048088 Ga0495602_0000193 Ga0495602_0000193_17204_18376 369
1289 3300048903 Ga0496100_0036655 Ga0496100_0036655_630_1814 369
1290 3300048904 Ga0496101_0056243 Ga0496101_0056243_844_1959 369
1291 3300048905 Ga0496102_0005374 Ga0496102_0005374_6386_7501 369
1292 3300048905 Ga0496102_0025002 Ga0496102_0025002_2478_3593 369
1293 3300048905 Ga0496102_0039429 Ga0496102_0039429_1563_2678 369
1294 3300048905 Ga0496102_0152597 Ga0496102_0152597_525_1718 369
1295 3300048905 Ga0496102_0411605 Ga0496102_0411605_91_1206 369
1296 3300048906 Ga0496103_0008229 Ga0496103_0008229_3881_4996 369
1297 3300048906 Ga0496103_0045628 Ga0496103_0045628_1538_2653 369
1298 3300048907 Ga0496104_0030987 Ga0496104_0030987_3682_4797 369
1299 3300048907 Ga0496104_0089504 Ga0496104_0089504_1458_2573 369
1300 3300048908 Ga0496105_0033676 Ga0496105_0033676_1192_2307 369
1301 3300048908 Ga0496105_0051652 Ga0496105_0051652_2059_3174 369
1302 3300048909 Ga0496106_0022234 Ga0496106_0022234_2762_3877 369
1303 3300048909 Ga0496106_0027205 Ga0496106_0027205_2113_3306 369
1304 3300048909 Ga0496106_0107123 Ga0496106_0107123_849_1964 369
1305 3300048911 Ga0496108_0078893 Ga0496108_0078893_371_1486 369
1306 3300048912 Ga0496109_0020508 Ga0496109_0020508_586_1701 369
1307 3300048912 Ga0496109_0204661 Ga0496109_0204661_98_1258 369
1308 3300048913 Ga0496110_0050482 Ga0496110_0050482_1577_2692 369
1309 3300048913 Ga0496110_0138237 Ga0496110_0138237_774_1889 369
1310 3300048914 Ga0496111_0053830 Ga0496111_0053830_1503_2618 369
1311 3300048915 Ga0496112_0034784 Ga0496112_0034784_3031_4146 369
1312 3300048915 Ga0496112_0034922 Ga0496112_0034922_1254_2414 369
1313 3300048915 Ga0496112_0096960 Ga0496112_0096960_1457_2572 369
1314 3300048915 Ga0496112_0195410 Ga0496112_0195410_349_1467 369
1315 3300048916 Ga0496113_0014627 Ga0496113_0014627_1069_2253 369
1316 3300048916 Ga0496113_0082646 Ga0496113_0082646_1012_2127 369
1317 3300048916 Ga0496113_0102953 Ga0496113_0102953_721_1836 369
1318 3300048917 Ga0496114_0005674 Ga0496114_0005674_68_1183 369
1319 3300048917 Ga0496114_0035897 Ga0496114_0035897_1554_2669 369
1320 3300048917 Ga0496114_0162668 Ga0496114_0162668_814_1929 369
1321 3300048918 Ga0496115_0011160 Ga0496115_0011160_589_1734 369
1322 3300048918 Ga0496115_0014127 Ga0496115_0014127_2565_3749 369
1323 3300048918 Ga0496115_0204646 Ga0496115_0204646_244_1359 369
1324 3300049569 Ga0501032_0003383 Ga0501032_0003383_6411_7529 369
1325 3300049569 Ga0501032_0193020 Ga0501032_0193020_50_1165 369
1326 3300049570 Ga0501033_0007700 Ga0501033_0007700_554_1672 369
1327 3300049570 Ga0501033_0061340 Ga0501033_0061340_1645_2760 369
1328 3300049571 Ga0501034_0000349 Ga0501034_0000349_57347_58534 369
1329 3300049571 Ga0501034_0074847 Ga0501034_0074847_681_1796 369
1330 3300049571 Ga0501034_0189379 Ga0501034_0189379_378_1493 369
1331 3300049571 Ga0501034_0302382 Ga0501034_0302382_348_1463 369
1332 3300049572 Ga0501036_0011871 Ga0501036_0011871_2877_3995 369
1333 3300049572 Ga0501036_0040976 Ga0501036_0040976_1361_2476 369
1334 3300049572 Ga0501036_0119634 Ga0501036_0119634_535_1722 369
1335 3300049572 Ga0501036_0202789 Ga0501036_0202789_242_1429 369
1336 3300049573 Ga0501037_0002059 Ga0501037_0002059_1229_2347 369
1337 3300049574 Ga0501038_0000194 Ga0501038_0000194_22677_23792 369
1338 3300049574 Ga0501038_0004476 Ga0501038_0004476_7793_8911 369
1339 3300049574 Ga0501038_0156056 Ga0501038_0156056_687_1802 369
1340 3300049575 Ga0501039_0024142 Ga0501039_0024142_1041_2156 369
1341 3300049576 Ga0501040_0000201 Ga0501040_0000201_2053_3168 369
1342 3300049576 Ga0501040_0009508 Ga0501040_0009508_4040_5155 369
1343 3300049576 Ga0501040_0027369 Ga0501040_0027369_1408_2595 369
1344 3300049577 Ga0501041_0001652 Ga0501041_0001652_4887_6002 369
1345 3300049578 Ga0501042_0005358 Ga0501042_0005358_2723_3838 369
1346 3300049578 Ga0501042_0011987 Ga0501042_0011987_1084_2199 369
1347 3300049578 Ga0501042_0034067 Ga0501042_0034067_2046_3233 369
1348 3300049578 Ga0501042_0043005 Ga0501042_0043005_956_2071 369
1349 3300049579 Ga0501043_0089788 Ga0501043_0089788_715_1833 369
1350 3300049579 Ga0501043_0104493 Ga0501043_0104493_667_1782 369
1351 3300049580 Ga0501046_0011474 Ga0501046_0011474_6111_7226 369
1352 3300049580 Ga0501046_0016161 Ga0501046_0016161_2050_3165 369
1353 3300049580 Ga0501046_0019262 Ga0501046_0019262_3296_4414 369
1354 3300049580 Ga0501046_0029689 Ga0501046_0029689_786_1901 369
1355 3300049580 Ga0501046_0038871 Ga0501046_0038871_2228_3343 369
1356 3300049581 Ga0501047_0038159 Ga0501047_0038159_2649_3767 369
1357 3300049581 Ga0501047_0051539 Ga0501047_0051539_1899_3014 369
1358 3300049581 Ga0501047_0102699 Ga0501047_0102699_949_2064 369
1359 3300049582 Ga0501048_0030914 Ga0501048_0030914_1168_2286 369
1360 3300049582 Ga0501048_0051704 Ga0501048_0051704_1204_2319 369
1361 3300049583 Ga0501067_0003282 Ga0501067_0003282_2988_4103 369
1362 3300049584 Ga0501068_0048138 Ga0501068_0048138_725_1843 369
1363 3300049584 Ga0501068_0054315 Ga0501068_0054315_238_1425 369
1364 3300049584 Ga0501068_0068543 Ga0501068_0068543_570_1712 369
1365 3300049584 Ga0501068_0086469 Ga0501068_0086469_65_1180 369
1366 3300049585 Ga0501069_0038958 Ga0501069_0038958_934_2052 369
1367 3300049586 Ga0501070_0004715 Ga0501070_0004715_1229_2347 369
1368 3300049587 Ga0501071_0015913 Ga0501071_0015913_3556_4671 369
1369 3300049587 Ga0501071_0017791 Ga0501071_0017791_723_1910 369
1370 3300049588 Ga0501072_0066999 Ga0501072_0066999_1630_2748 369
1371 3300049588 Ga0501072_0082953 Ga0501072_0082953_1378_2493 369
1372 3300049589 Ga0501073_0017742 Ga0501073_0017742_738_1856 369
1373 3300049589 Ga0501073_0056749 Ga0501073_0056749_1225_2340 369
1374 3300049589 Ga0501073_0071880 Ga0501073_0071880_363_1478 369
1375 3300049590 Ga0501074_0001411 Ga0501074_0001411_12857_13972 369
1376 3300049590 Ga0501074_0016444 Ga0501074_0016444_3937_5079 369
1377 3300049590 Ga0501074_0035170 Ga0501074_0035170_1451_2569 369
1378 3300049590 Ga0501074_0169699 Ga0501074_0169699_299_1414 369
1379 3300049591 Ga0501075_0027422 Ga0501075_0027422_1055_2170 369
1380 3300049591 Ga0501075_0053275 Ga0501075_0053275_1530_2645 369
1381 3300049591 Ga0501075_0080870 Ga0501075_0080870_1294_2409 369
1382 3300049591 Ga0501075_0107743 Ga0501075_0107743_706_1821 369
1383 3300049591 Ga0501075_0198291 Ga0501075_0198291_78_1193 369
1384 3300049591 Ga0501075_0201364 Ga0501075_0201364_219_1406 369
1385 3300049593 Ga0501077_0042658 Ga0501077_0042658_758_1873 369
1386 3300049593 Ga0501077_0045850 Ga0501077_0045850_731_1846 369
1387 3300049670 Ga0501236_005167 Ga0501236_005167_424_1539 369
1388 3300049741 Ga0501079_0004103 Ga0501079_0004103_1983_3101 369
1389 3300049741 Ga0501079_0015829 Ga0501079_0015829_986_2101 369
1390 3300049741 Ga0501079_0018896 Ga0501079_0018896_3401_4588 369
1391 3300049741 Ga0501079_0096850 Ga0501079_0096850_572_1714 369
1392 3300049742 Ga0501080_0014632 Ga0501080_0014632_2784_3899 369
1393 3300049742 Ga0501080_0052003 Ga0501080_0052003_2649_3767 369
1394 3300049742 Ga0501080_0081593 Ga0501080_0081593_1199_2386 369
1395 3300049743 Ga0501081_0000945 Ga0501081_0000945_13389_14504 369
1396 3300049743 Ga0501081_0048929 Ga0501081_0048929_1322_2437 369
1397 3300049822 Ga0501035_0000755 Ga0501035_0000755_2777_3895 369
1398 3300049822 Ga0501035_0009513 Ga0501035_0009513_6048_7163 369
1399 3300049822 Ga0501035_0080199 Ga0501035_0080199_135_1250 369
1400 3300049823 Ga0501044_0066467 Ga0501044_0066467_1904_3019 369
1401 3300049823 Ga0501044_0119802 Ga0501044_0119802_716_1834 369
1402 3300049824 Ga0501045_0001624 Ga0501045_0001624_13690_14805 369
1403 3300049824 Ga0501045_0008508 Ga0501045_0008508_5034_6149 369
1404 3300049824 Ga0501045_0023147 Ga0501045_0023147_1810_2997 369
1405 3300049824 Ga0501045_0157630 Ga0501045_0157630_388_1575 369
1406 3300049824 Ga0501045_0201795 Ga0501045_0201795_71_1186 369
1407 3300050507 nmdc:mga05p37_102127_c1 nmdc:mga05p37_102127_c1_2018_3202 369
1408 3300050507 nmdc:mga05p37_1893_c1 nmdc:mga05p37_1893_c1_6285_7400 369
1409 3300050507 nmdc:mga05p37_21012_c1 nmdc:mga05p37_21012_c1_2837_3952 369
1410 3300050507 nmdc:mga05p37_45591_c1 nmdc:mga05p37_45591_c1_1252_2367 369
1411 3300050507 nmdc:mga05p37_723_c1 nmdc:mga05p37_723_c1_31318_32496 369
1412 3300050507 nmdc:mga05p37_84246_c1 nmdc:mga05p37_84246_c1_380_1495 369
1413 3300050507 nmdc:mga05p37_87511_c1 nmdc:mga05p37_87511_c1_1021_2136 369
1414 3300050507 nmdc:mga05p37_98_c1 nmdc:mga05p37_98_c1_23427_24542 369
1415 3300050508 nmdc:mga09592_142708_c1 nmdc:mga09592_142708_c1_635_1822 369
1416 3300050508 nmdc:mga09592_94585_c1 nmdc:mga09592_94585_c1_1098_2213 369
1417 3300050508 nmdc:mga09592_95505_c1 nmdc:mga09592_95505_c1_332_1447 369
1418 3300050509 nmdc:mga0qj67_164119_c1 nmdc:mga0qj67_164119_c1_471_1601 369
1419 3300050509 nmdc:mga0qj67_176559_c1 nmdc:mga0qj67_176559_c1_415_1530 369
1420 3300050509 nmdc:mga0qj67_2777_c1 nmdc:mga0qj67_2777_c1_10387_11517 369
1421 3300050509 nmdc:mga0qj67_563_c1 nmdc:mga0qj67_563_c1_3510_4625 369
1422 3300050510 nmdc:mga06r32_155381_c1 nmdc:mga06r32_155381_c1_1091_2206 369
1423 3300050510 nmdc:mga06r32_3643_c1 nmdc:mga06r32_3643_c1_76_1191 369
1424 3300050510 nmdc:mga06r32_39732_c1 nmdc:mga06r32_39732_c1_1604_2734 369
1425 3300050511 nmdc:mga08y16_118696_c1 nmdc:mga08y16_118696_c1_1176_2291 369
1426 3300050511 nmdc:mga08y16_126208_c1 nmdc:mga08y16_126208_c1_1233_2348 369
1427 3300050511 nmdc:mga08y16_15153_c1 nmdc:mga08y16_15153_c1_3406_4521 369
1428 3300050511 nmdc:mga08y16_242206_c1 nmdc:mga08y16_242206_c1_158_1273 369
1429 3300050511 nmdc:mga08y16_3043_c1 nmdc:mga08y16_3043_c1_13113_14231 369
1430 3300050512 nmdc:mga0n895_11084_c1 nmdc:mga0n895_11084_c1_3724_4839 369
1431 3300050512 nmdc:mga0n895_1397_c1 nmdc:mga0n895_1397_c1_6112_7290 369
1432 3300050512 nmdc:mga0n895_14384_c1 nmdc:mga0n895_14384_c1_2338_3453 369
1433 3300050512 nmdc:mga0n895_88402_c1 nmdc:mga0n895_88402_c1_1802_2917 369
1434 3300050513 nmdc:mga0rr50_7820_c1 nmdc:mga0rr50_7820_c1_2423_3538 369
1435 3300050514 nmdc:mga08x19_2184_c1 nmdc:mga08x19_2184_c1_4100_5266 369
1436 3300050514 nmdc:mga08x19_38651_c1 nmdc:mga08x19_38651_c1_1291_2406 369
1437 3300050515 nmdc:mga0a205_23212_c1 nmdc:mga0a205_23212_c1_3634_4749 369
1438 3300050515 nmdc:mga0a205_294476_c1 nmdc:mga0a205_294476_c1_343_1458 369
1439 3300050515 nmdc:mga0a205_5927_c1 nmdc:mga0a205_5927_c1_9641_10756 369
1440 3300050515 nmdc:mga0a205_694_c1 nmdc:mga0a205_694_c1_9710_10825 369
1441 3300050515 nmdc:mga0a205_73406_c2 nmdc:mga0a205_73406_c2_400_1515 369
1442 3300053077 Ga0495601_0079126 Ga0495601_0079126_849_1964 369
1443 3300053084 Ga0495595_0139629 Ga0495595_0139629_41_1156 369
1444 3300053085 Ga0495619_0002333 Ga0495619_0002333_251_1366 369
1445 3300054114 Ga0501084_0006471 Ga0501084_0006471_993_2108 369
1446 3300054114 Ga0501084_0023164 Ga0501084_0023164_2063_3250 369
1447 3300054114 Ga0501084_0074012 Ga0501084_0074012_1327_2445 369
1448 3300054114 Ga0501084_0097056 Ga0501084_0097056_373_1488 369
1449 3300059421 Ga0590071_011471 Ga0590071_011471_720_1835 369
1450 3300059424 Ga0590075_005948 Ga0590075_005948_1056_2171 369
1451 3300059426 Ga0590077_010166 Ga0590077_010166_66_1181 369
1452 3300059640 Ga0587067_017733 Ga0587067_017733_59_1174 369
1453 3300060353 Ga0501082_0003168 Ga0501082_0003168_11675_12793 369
1454 3300060353 Ga0501082_0034642 Ga0501082_0034642_2916_4058 369
1455 3300061734 Ga0530510_0009974 Ga0530510_0009974_1500_2615 369
1456 3300061734 Ga0530510_0013827 Ga0530510_0013827_2755_3870 369
1457 3300061734 Ga0530510_0060015 Ga0530510_0060015_1512_2627 369
1458 3300000545 CNXas_1000035 CNXas_100003518 370
1459 3300005440 Ga0070705_100070806 Ga0070705_1000708063 370
1460 3300005445 Ga0070708_100001673 Ga0070708_10000167312 370
1461 3300005445 Ga0070708_100017607 Ga0070708_1000176071 370
1462 3300005467 Ga0070706_100004311 Ga0070706_10000431112 370
1463 3300005468 Ga0070707_100026868 Ga0070707_1000268683 370
1464 3300005468 Ga0070707_100049964 Ga0070707_1000499642 370
1465 3300005468 Ga0070707_100235352 Ga0070707_1002353523 370
1466 3300005518 Ga0070699_100014176 Ga0070699_10001417610 370
1467 3300005549 Ga0070704_100098344 Ga0070704_1000983443 370
1468 3300005937 Ga0081455_10007016 Ga0081455_1000701612 370
1469 3300005981 Ga0081538_10067805 Ga0081538_100678052 370
1470 3300005983 Ga0081540_1038749 Ga0081540_10387493 370
1471 3300006844 Ga0075428_100010609 Ga0075428_1000106098 370
1472 3300006844 Ga0075428_100048156 Ga0075428_1000481565 370
1473 3300006844 Ga0075428_100049839 Ga0075428_1000498395 370
1474 3300006846 Ga0075430_100071367 Ga0075430_1000713674 370
1475 3300006847 Ga0075431_100009399 Ga0075431_1000093998 370
1476 3300006871 Ga0075434_100096643 Ga0075434_1000966433 370
1477 3300006880 Ga0075429_100007104 Ga0075429_1000071046 370
1478 3300006880 Ga0075429_100032694 Ga0075429_1000326943 370
1479 3300006914 Ga0075436_100052968 Ga0075436_1000529684 370
1480 3300009147 Ga0114129_10014798 Ga0114129_100147982 370
1481 3300025910 Ga0207684_10083858 Ga0207684_100838582 370
1482 3300025914 Ga0207671_10007049 Ga0207671_100070496 370
1483 3300025922 Ga0207646_10040603 Ga0207646_100406032 370
1484 3300025922 Ga0207646_10040605 Ga0207646_100406052 370
1485 3300025927 Ga0207687_10120910 Ga0207687_101209102 370
1486 3300025961 Ga0207712_10053826 Ga0207712_100538263 370
1487 3300026035 Ga0207703_10159246 Ga0207703_101592462 370
1488 3300031456 Ga0307513_10078776 Ga0307513_100787762 370
1489 3300035398 Ga0316574_0022931 Ga0316574_0022931_1541_2656 370
1490 3300036647 Ga0316582_0012184 Ga0316582_0012184_2707_3831 370
1491 3300036712 Ga0316584_0186786 Ga0316584_0186786_147_1262 370
1492 3300037588 Ga0316581_0026076 Ga0316581_0026076_295_1419 370
1493 3300042876 Ga0451577_0071971 Ga0451577_0071971_1095_2207 370
1494 3300044673 Ga0453683_0137979 Ga0453683_0137979_231_1343 370
1495 3300044712 Ga0453684_0000564 Ga0453684_0000564_25038_26153 370
1496 3300044712 Ga0453684_0026404 Ga0453684_0026404_1436_2551 370
1497 3300044712 Ga0453684_0095727 Ga0453684_0095727_1270_2385 370
1498 3300044712 Ga0453684_0188363 Ga0453684_0188363_991_2103 370
1499 3300045051 Ga0451576_0004398 Ga0451576_0004398_15427_16542 370
1500 3300045051 Ga0451576_0133598 Ga0451576_0133598_635_1750 370
1501 3300045051 Ga0451576_0165388 Ga0451576_0165388_396_1508 370
1502 3300050493 nmdc:mga0k408_35784_c1 nmdc:mga0k408_35784_c1_1560_2675 370
1503 3300050507 nmdc:mga05p37_5046_c1 nmdc:mga05p37_5046_c1_8154_9326 370
1504 3300050508 nmdc:mga09592_10597_c1 nmdc:mga09592_10597_c1_2193_3365 370
1505 3300050509 nmdc:mga0qj67_61269_c1 nmdc:mga0qj67_61269_c1_1188_2303 370
1506 3300050510 nmdc:mga06r32_89238_c1 nmdc:mga06r32_89238_c1_1343_2515 370
1507 3300050514 nmdc:mga08x19_13846_c1 nmdc:mga08x19_13846_c1_551_1666 370
1508 3300061734 Ga0530510_0012874 Ga0530510_0012874_353_1468 370
1509 3300061734 Ga0530510_0084553 Ga0530510_0084553_1066_2178 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02012

BNR

BNR/Asp-box repeat

65

76

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.9056 2 366
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.8843 2 366
4lg8-assembly1.cif.gz_A crystal structure of prpf19 wd40 repeats 0.7681 38 363
7mqa-assembly1.cif.gz_LJ cryo-em structure of the human ssu processome, state post-a1 0.7565 38 363
5wsg-assembly1.cif.gz_O cryo-em structure of the catalytic step ii spliceosome (c* complex) at 4.0 angstrom resolution 0.7529 36 351
ID Description Score Start End Superfamily
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8871 1 366 2.130.10.10
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8706 1 366 2.130.10.10
af_F1M8Z5_136_280_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7833 105 184 2.40.128.630
af_A0A1D6LLW6_250_394_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7668 6 185 2.130.10.10
af_Q9JMJ4_195_504_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7554 38 356 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A7W0KDR5-F1-model_v4 Exo-alpha-sialidase 1.001 260 370
AF-A0A3D1AQV5-F1-model_v4 Glycosyl hydrolase 1.001 233 338
AF-A0A2U3LQA5-F1-model_v4 BNR/Asp-box repeat protein 0.9996 237 370 GO:0000272
GO:0010411
GO:0016798
AF-A0A534WDT7-F1-model_v4 Exo-alpha-sialidase 0.998 172 370 GO:0000272
GO:0010411
GO:0016798
AF-A0A2H5YSX7-F1-model_v4 Exo-alpha-sialidase 0.9965 1 370 GO:0000272
GO:0010411
GO:0016798

Feature Viewer

pLDDT pTM Quality
95.48 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map