F494001

General Info

Members Datasets Scaffolds Average Seq Length
1443 637 2886 86

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_101788189|Ga0070704_1017881891
Length 101
Sequence MAHKKGASSTRNGRDSNAQYLGVKRFGGQAVNAGEILVRQRGTHFHPGDGVGRGGDDTLFALVAGHVEFGRRRGRRVVNVTPTASEAASNSSEPAEATSAK

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003284 Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_16 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
30 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
124 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
125 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
126 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
127 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
128 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
129 3300013043 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
150 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
157 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
158 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
226 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
228 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
232 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
233 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
234 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
235 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
236 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
237 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
238 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
239 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
240 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
241 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
244 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
245 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
246 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
247 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
248 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
249 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
250 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
251 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
252 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
253 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
254 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
255 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
256 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
257 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
258 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
259 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
260 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
261 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
262 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
263 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
264 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
265 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
266 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
267 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
268 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
269 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
270 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
271 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
272 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
273 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
274 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
275 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
276 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
278 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
279 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
283 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
284 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
285 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
286 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
287 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
288 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
289 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
290 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
291 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
292 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
293 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
294 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
295 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
296 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
297 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
298 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
299 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
300 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
301 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
302 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
303 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
304 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
305 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
306 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
307 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
308 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
309 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
310 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
311 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
312 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
313 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
314 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
315 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
316 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
317 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
318 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
319 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
320 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
321 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
322 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
323 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
324 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
325 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
326 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
327 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
328 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
329 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
330 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
331 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
332 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
333 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
334 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
335 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
336 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
337 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
338 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
339 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
340 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
341 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
342 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
343 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
344 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
345 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
346 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
347 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
348 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
349 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
350 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
351 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
352 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
353 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
354 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
355 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
356 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
357 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
358 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
359 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
360 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
361 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
362 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
363 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
364 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
365 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
366 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
367 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
368 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
369 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
370 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
371 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
372 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
373 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
374 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
375 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
376 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
377 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
378 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
379 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
380 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
381 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
382 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
383 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
384 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
385 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
386 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
387 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
388 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
389 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
390 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
391 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
392 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
393 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
394 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
395 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
396 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
397 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
398 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
399 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
400 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
401 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
402 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
403 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
404 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
405 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
406 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
407 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
408 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
409 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
410 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
411 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
412 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
413 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
414 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
415 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
416 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
417 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
418 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
419 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
420 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
421 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
422 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
423 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
424 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
425 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
426 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
427 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
428 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
429 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
430 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
431 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
432 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
433 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
434 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
435 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
436 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
437 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
438 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
439 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
440 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
441 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
442 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
443 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
444 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
445 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
446 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
447 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
448 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
449 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
450 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
451 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
452 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
453 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
454 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
455 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
456 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
457 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
458 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
459 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
460 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
461 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
462 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
463 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
464 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
465 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
466 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
467 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
468 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
469 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
470 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
471 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
472 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
473 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
495 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
497 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
503 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
504 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
508 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
509 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
510 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
511 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
512 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
513 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
514 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
515 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
516 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
517 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
518 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
519 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
520 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
521 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
522 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
523 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
524 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
525 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
526 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
527 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
528 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
529 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
530 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
531 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
532 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
533 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
534 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
535 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
536 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
537 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
538 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
539 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
540 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
541 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
542 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
543 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
544 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
545 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
546 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
547 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
548 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
549 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
550 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
551 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
552 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
553 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
554 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
555 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
556 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
557 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
558 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
559 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
560 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
561 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
562 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
563 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
564 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
565 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
566 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
567 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
568 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
569 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
570 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
571 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
572 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
573 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
574 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
575 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
576 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
577 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
578 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
579 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
580 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
581 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
582 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
583 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
584 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
585 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
586 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
587 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
588 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
589 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
592 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
593 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
594 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
595 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
596 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
597 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
598 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
599 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
600 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
601 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
602 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
603 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
604 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
605 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
606 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
613 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
619 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
620 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
621 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
622 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
623 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
624 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
625 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
626 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
627 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
628 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
629 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
630 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
631 2517572101 Frankia sp. DC12 Isolate Nodule
632 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
633 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
634 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
635 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
636 8002784119 Frankia sp. AgB1.9 Isolate Nodule
637 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.06
Metatranscriptomes 15.45
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.99
Nodule 0.28
Rhizoplane 5.13
Rhizosphere 84.41
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_101788189 3300005549 Bacteria 568
2 LJQas_1014194 3300000549 Bacteria 935
3 LJQas_1033148 3300000549 Bacteria 606
4 JGI24740J21852_10073190 3300001979 Bacteria 913
5 JGI24740J21852_10093328 3300001979 Bacteria 774
6 JGI24739J22299_10068165 3300001989 Bacteria 1111
7 JGI24737J22298_10015151 3300001990 Bacteria 2496
8 JGI24735J21928_10055434 3300002067 Bacteria 1142
9 JGI24738J21930_10014762 3300002075 Bacteria 1671
10 Ga0006779J45831_101096 3300003160 Bacteria 793
11 Ga0006778J45830_1019160 3300003162 Bacteria 827
12 Ga0006773J48901_12202 3300003284 Bacteria 780
13 Ga0006770J48903_1012779 3300003305 Bacteria 726
14 Ga0006777J48905_1032659 3300003308 Bacteria 832
15 rootL2_10032547 3300003322 Bacteria 2145
16 JGI25160J50197_1043295 3300003354 Bacteria 1015
17 Ga0007427J51700_100683 3300003559 Bacteria 2769
18 Ga0006781J51513_1001670 3300003568 Bacteria 2451
19 Ga0007410J51695_1035599 3300003574 Bacteria 638
20 Ga0007416J51690_1037339 3300003577 Bacteria 660
21 Ga0006562J51391_1011694 3300003578 Bacteria 638
22 Ga0006562J51391_1176296 3300003578 Bacteria 1490
23 Ga0007429J51699_1009559 3300003579 Bacteria 1136
24 JGI25404J52841_10002732 3300003659 Bacteria 3385
25 Ga0032354_1025483 3300003693 Bacteria 1074
26 Ga0006780_1012767 3300003735 Bacteria 5668
27 Ga0055527_1000001 3300003760 Bacteria 850044
28 Ga0055529_1000065 3300003763 Bacteria 173112
29 JGI25405J52794_10008681 3300003911 Bacteria 1904
30 Ga0058863_11676597 3300004799 Bacteria 775
31 Ga0058863_11874610 3300004799 Bacteria 691
32 Ga0058863_11935272 3300004799 Bacteria 655
33 Ga0058861_10049278 3300004800 Bacteria 547
34 Ga0058860_10003778 3300004801 Bacteria 772
35 Ga0058862_10078798 3300004803 Bacteria 805
36 Ga0058862_10118426 3300004803 Bacteria 739
37 Ga0070658_10000092 3300005327 Bacteria 81151
38 Ga0070658_10002776 3300005327 Bacteria 14551
39 Ga0070658_10205552 3300005327 Bacteria 1663
40 Ga0070658_10470811 3300005327 Bacteria 1084
41 Ga0070658_11562738 3300005327 Bacteria 572
42 Ga0070683_100100946 3300005329 Bacteria 2717
43 Ga0070683_100515091 3300005329 Bacteria 1143
44 Ga0070683_100592340 3300005329 Bacteria 1061
45 Ga0070683_100667241 3300005329 Bacteria 996
46 Ga0070683_100871583 3300005329 Bacteria 863
47 Ga0070683_101476081 3300005329 Bacteria 654
48 Ga0070690_101627338 3300005330 Bacteria 524
49 Ga0068869_100265062 3300005334 Bacteria 1376
50 Ga0070680_100000403 3300005336 Bacteria 29539
51 Ga0070680_100211817 3300005336 Bacteria 1635
52 Ga0070682_100167871 3300005337 Bacteria 1522
53 Ga0070682_100305834 3300005337 Bacteria 1169
54 Ga0070682_100376963 3300005337 Bacteria 1066
55 Ga0070682_100661753 3300005337 Bacteria 833
56 Ga0070682_100723148 3300005337 Bacteria 801
57 Ga0070682_100903230 3300005337 Bacteria 726
58 Ga0068868_100471448 3300005338 Bacteria 1095
59 Ga0068868_100606395 3300005338 Bacteria 970
60 Ga0070660_100308392 3300005339 Bacteria 1298
61 Ga0070689_102080247 3300005340 Bacteria 520
62 Ga0070691_10987020 3300005341 Bacteria 525
63 Ga0070687_100092980 3300005343 Bacteria 1672
64 Ga0070692_10369427 3300005345 Bacteria 897
65 Ga0070668_100314078 3300005347 Bacteria 1318
66 Ga0070668_100726423 3300005347 Bacteria 877
67 Ga0070675_100190511 3300005354 Bacteria 1777
68 Ga0070675_101435953 3300005354 Bacteria 636
69 Ga0070671_100002585 3300005355 Bacteria 14021
70 Ga0070674_100186377 3300005356 Bacteria 1593
71 Ga0070674_100895236 3300005356 Bacteria 773
72 Ga0070667_100164713 3300005367 Bacteria 1955
73 Ga0070709_10355995 3300005434 Bacteria 1083
74 Ga0070714_100001465 3300005435 Bacteria 17196
75 Ga0070714_100905124 3300005435 Bacteria 857
76 Ga0070714_102136128 3300005435 Bacteria 545
77 Ga0070713_100184035 3300005436 Bacteria 1879
78 Ga0070710_10266242 3300005437 Bacteria 1107
79 Ga0070711_100111244 3300005439 Bacteria 2011
80 Ga0070700_100586016 3300005441 Bacteria 872
81 Ga0070694_100770397 3300005444 Bacteria 787
82 Ga0070663_100184012 3300005455 Bacteria 1622
83 Ga0070663_100500907 3300005455 Bacteria 1008
84 Ga0070663_100604636 3300005455 Bacteria 923
85 Ga0070678_100568466 3300005456 Bacteria 1008
86 Ga0070678_100936525 3300005456 Bacteria 793
87 Ga0070678_102121013 3300005456 Bacteria 533
88 Ga0070662_100853253 3300005457 Bacteria 776
89 Ga0070681_10018417 3300005458 Bacteria 6979
90 Ga0070681_10032811 3300005458 Bacteria 5213
91 Ga0068867_101495604 3300005459 Bacteria 629
92 Ga0070685_10172560 3300005466 Bacteria 1387
93 Ga0070685_10275792 3300005466 Bacteria 1124
94 Ga0070698_100050203 3300005471 Bacteria 4254
95 Ga0070698_100816766 3300005471 Bacteria 877
96 Ga0070679_100000591 3300005530 Bacteria 30747
97 Ga0070679_100003323 3300005530 Bacteria 14728
98 Ga0070679_100943019 3300005530 Bacteria 807
99 Ga0070684_100266548 3300005535 Bacteria 1567
100 Ga0070684_100644801 3300005535 Bacteria 986
101 Ga0068853_100091750 3300005539 Bacteria 2672
102 Ga0070672_100261184 3300005543 Bacteria 1460
103 Ga0070686_100782642 3300005544 Bacteria 768
104 Ga0070693_100309508 3300005547 Bacteria 1068
105 Ga0070665_100005910 3300005548 Bacteria 12537
106 Ga0070665_100963511 3300005548 Bacteria 865
107 Ga0070665_101117060 3300005548 Bacteria 800
108 Ga0068855_100805807 3300005563 Bacteria 998
109 Ga0068855_100941078 3300005563 Bacteria 911
110 Ga0068855_101468847 3300005563 Bacteria 701
111 Ga0068855_101637704 3300005563 Bacteria 658
112 Ga0070664_100161857 3300005564 Bacteria 1980
113 Ga0070664_100716853 3300005564 Bacteria 933
114 Ga0068857_100213364 3300005577 Bacteria 1762
115 Ga0068857_100215916 3300005577 Bacteria 1751
116 Ga0068857_101956741 3300005577 Bacteria 575
117 Ga0068854_100488666 3300005578 Bacteria 1035
118 Ga0068856_101071637 3300005614 Bacteria 824
119 Ga0068856_101084728 3300005614 Bacteria 818
120 Ga0068856_101446489 3300005614 Bacteria 701
121 Ga0070702_100261013 3300005615 Bacteria 1179
122 Ga0068852_100267376 3300005616 Bacteria 1644
123 Ga0068852_100308948 3300005616 Bacteria 1532
124 Ga0068852_100802122 3300005616 Bacteria 956
125 Ga0068852_100931236 3300005616 Bacteria 887
126 Ga0068859_100385328 3300005617 Bacteria 1497
127 Ga0068859_100981114 3300005617 Bacteria 927
128 Ga0068859_102212824 3300005617 Bacteria 607
129 Ga0068866_11326965 3300005718 Bacteria 523
130 Ga0068861_100330214 3300005719 Bacteria 1331
131 Ga0068861_100722345 3300005719 Bacteria 928
132 Ga0068851_10343743 3300005834 Bacteria 866
133 Ga0068870_10216843 3300005840 Bacteria 1169
134 Ga0068870_10586055 3300005840 Bacteria 756
135 Ga0068863_100002283 3300005841 Bacteria 19063
136 Ga0068863_101244520 3300005841 Bacteria 750
137 Ga0068860_100041221 3300005843 Bacteria 4410
138 Ga0068860_100560823 3300005843 Bacteria 1145
139 Ga0068862_100386362 3300005844 Bacteria 1307
140 Ga0068862_100686570 3300005844 Bacteria 991
141 Ga0081455_10001106 3300005937 Bacteria 33914
142 Ga0081455_10930696 3300005937 Bacteria 540
143 Ga0081538_10275024 3300005981 Bacteria 628
144 Ga0081540_1000405 3300005983 Bacteria 42553
145 Ga0081540_1002965 3300005983 Bacteria 13603
146 Ga0070717_10054864 3300006028 Bacteria 3287
147 Ga0070717_11369484 3300006028 Bacteria 643
148 Ga0075363_100407546 3300006048 Bacteria 799
149 Ga0075432_10041263 3300006058 Bacteria 1612
150 Ga0070715_10318394 3300006163 Bacteria 839
151 Ga0070712_100015788 3300006175 Bacteria 4869
152 Ga0075370_10038886 3300006353 Bacteria 2678
153 Ga0075370_10313016 3300006353 Bacteria 935
154 Ga0075428_100026617 3300006844 Bacteria 6404
155 Ga0075428_100107082 3300006844 Bacteria 3047
156 Ga0075430_100250162 3300006846 Bacteria 1469
157 Ga0075430_101739128 3300006846 Bacteria 512
158 Ga0075431_100126596 3300006847 Bacteria 2636
159 Ga0075433_10194652 3300006852 Bacteria 1803
160 Ga0075433_11167486 3300006852 Bacteria 669
161 Ga0075434_100526456 3300006871 Bacteria 1202
162 Ga0075434_101401699 3300006871 Bacteria 709
163 Ga0075429_100051179 3300006880 Bacteria 3594
164 Ga0075429_100557017 3300006880 Bacteria 1005
165 Ga0075429_101404488 3300006880 Bacteria 608
166 Ga0068865_100413367 3300006881 Bacteria 1107
167 Ga0075436_100071720 3300006914 Bacteria 2395
168 Ga0097620_100385341 3300006931 Bacteria 1497
169 Ga0097620_100981123 3300006931 Bacteria 927
170 Ga0097620_102213027 3300006931 Bacteria 607
171 Ga0099826_10070429 3300006948 Bacteria 2224
172 Ga0075435_100084339 3300007076 Bacteria 2614
173 Ga0099795_10175062 3300007788 Bacteria 893
174 Ga0105251_10046141 3300009011 Bacteria 2098
175 Ga0105251_10127611 3300009011 Bacteria 1154
176 Ga0105244_10075453 3300009036 Bacteria 1675
177 Ga0105250_10158816 3300009092 Bacteria 943
178 Ga0105240_12053242 3300009093 Bacteria 594
179 Ga0111539_10104076 3300009094 Bacteria 3331
180 Ga0111539_10635837 3300009094 Bacteria 1242
181 Ga0111539_12434729 3300009094 Bacteria 607
182 Ga0105245_10022104 3300009098 Bacteria 5584
183 Ga0105245_10441200 3300009098 Bacteria 1308
184 Ga0105245_10647593 3300009098 Bacteria 1087
185 Ga0105245_11469337 3300009098 Bacteria 732
186 Ga0105247_10261583 3300009101 Bacteria 1186
187 Ga0105247_10779596 3300009101 Bacteria 727
188 Ga0114129_10110200 3300009147 Bacteria 3800
189 Ga0114129_11052873 3300009147 Bacteria 1021
190 Ga0105243_10015409 3300009148 Bacteria 5779
191 Ga0105243_10198180 3300009148 Bacteria 1759
192 Ga0105243_10466530 3300009148 Bacteria 1188
193 Ga0105243_12509205 3300009148 Bacteria 555
194 Ga0105243_13041843 3300009148 Bacteria 508
195 Ga0105241_10779767 3300009174 Bacteria 879
196 Ga0105242_10700149 3300009176 Bacteria 991
197 Ga0105248_10048505 3300009177 Bacteria 4764
198 Ga0105248_10996709 3300009177 Bacteria 946
199 Ga0105248_11440999 3300009177 Bacteria 779
200 Ga0105248_11753747 3300009177 Bacteria 704
201 Ga0105237_10567703 3300009545 Bacteria 1141
202 Ga0105237_10927228 3300009545 Bacteria 878
203 Ga0105238_11473407 3300009551 Bacteria 709
204 Ga0105238_11642336 3300009551 Bacteria 673
205 Ga0105238_11718653 3300009551 Bacteria 659
206 Ga0105238_12779377 3300009551 Bacteria 526
207 Ga0105249_11626505 3300009553 Bacteria 718
208 Ga0105249_11690895 3300009553 Bacteria 705
209 Ga0105249_11839859 3300009553 Bacteria 678
210 Ga0105249_13005227 3300009553 Bacteria 541
211 Ga0105035_109087 3300009988 Bacteria 858
212 Ga0105239_10399074 3300010375 Bacteria 1556
213 Ga0105239_10564734 3300010375 Bacteria 1296
214 Ga0105239_10918934 3300010375 Bacteria 1005
215 Ga0105246_10121802 3300011119 Bacteria 1934
216 Ga0105246_10516710 3300011119 Bacteria 1017
217 Ga0105246_11114804 3300011119 Bacteria 721
218 Ga0105246_11206286 3300011119 Bacteria 697
219 Ga0105246_11689503 3300011119 Bacteria 601
220 Ga0105246_12459318 3300011119 Bacteria 512
221 Ga0157328_1010435 3300012478 Bacteria 643
222 Ga0157318_1024565 3300012482 Bacteria 559
223 Ga0157343_1006504 3300012488 Bacteria 790
224 Ga0157345_1020668 3300012498 Bacteria 668
225 Ga0157324_1017785 3300012506 Bacteria 691
226 Ga0157338_1009093 3300012515 Bacteria 977
227 Ga0154018_104492 3300013043 Bacteria 647
228 Ga0154019_109330 3300013044 Bacteria 784
229 Ga0154012_169153 3300013059 Bacteria 850
230 Ga0154010_123501 3300013062 Bacteria 732
231 Ga0154010_150777 3300013062 Bacteria 630
232 Ga0157371_10798101 3300013102 Bacteria 711
233 Ga0157369_10001098 3300013105 Bacteria 33862
234 Ga0157369_10116316 3300013105 Bacteria 2840
235 Ga0157369_10130572 3300013105 Bacteria 2663
236 Ga0157369_10137927 3300013105 Bacteria 2581
237 Ga0157369_10204676 3300013105 Bacteria 2070
238 Ga0157369_10220252 3300013105 Bacteria 1987
239 Ga0157369_10313236 3300013105 Bacteria 1632
240 Ga0157369_10610401 3300013105 Bacteria 1126
241 Ga0157374_11824123 3300013296 Bacteria 634
242 Ga0157374_12494391 3300013296 Bacteria 544
243 Ga0163162_10842289 3300013306 Bacteria 1033
244 Ga0163162_11004345 3300013306 Bacteria 943
245 Ga0157372_10130144 3300013307 Bacteria 2895
246 Ga0157372_10130650 3300013307 Bacteria 2889
247 Ga0157372_10375382 3300013307 Bacteria 1657
248 Ga0157372_10380456 3300013307 Bacteria 1645
249 Ga0157372_10461374 3300013307 Bacteria 1480
250 Ga0157372_10514883 3300013307 Bacteria 1395
251 Ga0157372_13110834 3300013307 Bacteria 530
252 Ga0157375_10257655 3300013308 Bacteria 1906
253 Ga0157375_10649606 3300013308 Bacteria 1211
254 Ga0157375_10726443 3300013308 Bacteria 1146
255 Ga0157375_11204296 3300013308 Bacteria 888
256 Ga0157375_11464072 3300013308 Bacteria 805
257 Ga0157375_12058734 3300013308 Bacteria 679
258 Ga0163163_11298894 3300014325 Bacteria 790
259 Ga0163163_11395587 3300014325 Bacteria 762
260 Ga0157380_11559696 3300014326 Bacteria 715
261 Ga0182008_10347845 3300014497 Bacteria 785
262 Ga0157377_10112134 3300014745 Bacteria 1641
263 Ga0157377_10368252 3300014745 Bacteria 969
264 Ga0157379_10000011 3300014968 Bacteria 111920
265 Ga0157379_10004447 3300014968 Bacteria 12020
266 Ga0157379_10468608 3300014968 Bacteria 1165
267 Ga0157379_12679166 3300014968 Bacteria 500
268 Ga0157376_13100957 3300014969 Bacteria 503
269 Ga0163161_10397799 3300017792 Bacteria 1104
270 Ga0163161_10500830 3300017792 Bacteria 989
271 Ga0197907_10137431 3300020069 Bacteria 1024
272 Ga0197907_10164336 3300020069 Bacteria 3956
273 Ga0197907_10287841 3300020069 Bacteria 731
274 Ga0197907_10521472 3300020069 Bacteria 502
275 Ga0197907_10553372 3300020069 Bacteria 746
276 Ga0197907_10559923 3300020069 Bacteria 876
277 Ga0197907_10612753 3300020069 Bacteria 761
278 Ga0197907_10890214 3300020069 Bacteria 1979
279 Ga0197907_11323563 3300020069 Bacteria 647
280 Ga0206356_10075057 3300020070 Bacteria 3042
281 Ga0206356_10184148 3300020070 Bacteria 1147
282 Ga0206356_10566583 3300020070 Bacteria 890
283 Ga0206356_10801131 3300020070 Bacteria 613
284 Ga0206356_11542350 3300020070 Bacteria 4382
285 Ga0206349_1049575 3300020075 Bacteria 3992
286 Ga0206349_1145716 3300020075 Bacteria 692
287 Ga0206349_1191611 3300020075 Bacteria 1319
288 Ga0206349_1224460 3300020075 Bacteria 750
289 Ga0206355_1184113 3300020076 Bacteria 801
290 Ga0206355_1263721 3300020076 Bacteria 845
291 Ga0206355_1680853 3300020076 Bacteria 801
292 Ga0206355_1699297 3300020076 Bacteria 908
293 Ga0206351_10073110 3300020077 Bacteria 828
294 Ga0206351_10349151 3300020077 Bacteria 783
295 Ga0206351_10366779 3300020077 Bacteria 703
296 Ga0206351_10561642 3300020077 Bacteria 683
297 Ga0206351_10667073 3300020077 Bacteria 793
298 Ga0206351_10888640 3300020077 Bacteria 710
299 Ga0206352_10175716 3300020078 Bacteria 794
300 Ga0206352_10413355 3300020078 Bacteria 776
301 Ga0206352_10419825 3300020078 Bacteria 640
302 Ga0206352_10782919 3300020078 Bacteria 1378
303 Ga0206352_10817773 3300020078 Bacteria 1816
304 Ga0206352_11174969 3300020078 Bacteria 676
305 Ga0206350_10387192 3300020080 Bacteria 831
306 Ga0206350_10669342 3300020080 Bacteria 3987
307 Ga0206350_10717286 3300020080 Bacteria 788
308 Ga0206350_10939822 3300020080 Bacteria 1406
309 Ga0206354_10402312 3300020081 Bacteria 909
310 Ga0206354_11017929 3300020081 Bacteria 1669
311 Ga0206354_11061414 3300020081 Bacteria 2112
312 Ga0206354_11104228 3300020081 Bacteria 838
313 Ga0206354_11147171 3300020081 Bacteria 956
314 Ga0206354_11344924 3300020081 Bacteria 1087
315 Ga0206354_11651120 3300020081 Bacteria 4622
316 Ga0206353_10010990 3300020082 Bacteria 875
317 Ga0206353_10069880 3300020082 Bacteria 1274
318 Ga0206353_10389836 3300020082 Bacteria 19531
319 Ga0206353_10579675 3300020082 Bacteria 787
320 Ga0206353_10620362 3300020082 Bacteria 3239
321 Ga0206353_10760686 3300020082 Bacteria 687
322 Ga0206353_11142314 3300020082 Bacteria 555
323 Ga0206353_11145209 3300020082 Bacteria 1071
324 Ga0154015_1376143 3300020610 Bacteria 821
325 Ga0154015_1399765 3300020610 Bacteria 1056
326 Ga0154015_1569601 3300020610 Bacteria 710
327 Ga0213873_10149932 3300021358 Bacteria 701
328 Ga0213876_10000698 3300021384 Bacteria 23633
329 Ga0224712_10004236 3300022467 Bacteria 3845
330 Ga0224712_10030705 3300022467 Bacteria 1942
331 Ga0224712_10044601 3300022467 Bacteria 1692
332 Ga0224712_10057189 3300022467 Bacteria 1540
333 Ga0224712_10342901 3300022467 Bacteria 705
334 Ga0224712_10358259 3300022467 Bacteria 690
335 Ga0224712_10368829 3300022467 Bacteria 681
336 Ga0224712_10471188 3300022467 Bacteria 605
337 Ga0209672_100006 3300025228 Bacteria 1004497
338 Ga0209147_100870 3300025229 Bacteria 13946
339 Ga0209258_106149 3300025242 Bacteria 1919
340 Ga0209677_100623 3300025253 Bacteria 19023
341 Ga0209148_1000015 3300025254 Bacteria 850103
342 Ga0209455_1000013 3300025272 Bacteria 850103
343 Ga0209758_1043791 3300025297 Bacteria 1644
344 Ga0207426_1019038 3300025302 Bacteria 2407
345 Ga0207426_1073094 3300025302 Bacteria 950
346 Ga0207656_10218087 3300025321 Bacteria 926
347 Ga0207696_1032158 3300025711 Bacteria 1582
348 Ga0207655_1133466 3300025728 Bacteria 806
349 Ga0207713_1038256 3300025735 Bacteria 2037
350 Ga0207682_10102956 3300025893 Bacteria 1250
351 Ga0207692_10089777 3300025898 Bacteria 1664
352 Ga0207692_10992925 3300025898 Bacteria 554
353 Ga0207710_10294804 3300025900 Bacteria 818
354 Ga0207688_10063242 3300025901 Bacteria 2087
355 Ga0207688_10491877 3300025901 Bacteria 768
356 Ga0207647_10004777 3300025904 Bacteria 10032
357 Ga0207685_10324380 3300025905 Bacteria 769
358 Ga0207699_10630351 3300025906 Bacteria 782
359 Ga0207643_10040282 3300025908 Bacteria 2630
360 Ga0207643_10230242 3300025908 Bacteria 1136
361 Ga0207643_10895602 3300025908 Bacteria 575
362 Ga0207705_10000660 3300025909 Bacteria 28732
363 Ga0207705_10003405 3300025909 Bacteria 12092
364 Ga0207705_10364636 3300025909 Bacteria 1114
365 Ga0207705_10728763 3300025909 Bacteria 770
366 Ga0207654_11328679 3300025911 Bacteria 524
367 Ga0207707_10000764 3300025912 Bacteria 31604
368 Ga0207707_10089094 3300025912 Bacteria 2696
369 Ga0207693_10057860 3300025915 Bacteria 3037
370 Ga0207663_10072394 3300025916 Bacteria 2227
371 Ga0207660_10025359 3300025917 Bacteria 4023
372 Ga0207660_10045816 3300025917 Bacteria 3083
373 Ga0207662_10147625 3300025918 Bacteria 1494
374 Ga0207649_11163860 3300025920 Bacteria 609
375 Ga0207652_10000504 3300025921 Bacteria 39783
376 Ga0207652_10119072 3300025921 Bacteria 2348
377 Ga0207652_10812335 3300025921 Bacteria 830
378 Ga0207694_10277504 3300025924 Bacteria 1376
379 Ga0207694_11001737 3300025924 Bacteria 707
380 Ga0207694_11093018 3300025924 Bacteria 675
381 Ga0207650_11127761 3300025925 Bacteria 667
382 Ga0207659_10335280 3300025926 Bacteria 1251
383 Ga0207687_10068750 3300025927 Bacteria 2524
384 Ga0207687_10289517 3300025927 Bacteria 1316
385 Ga0207687_11191090 3300025927 Bacteria 655
386 Ga0207687_11322236 3300025927 Bacteria 620
387 Ga0207700_10326546 3300025928 Bacteria 1331
388 Ga0207664_10000625 3300025929 Bacteria 24520
389 Ga0207664_10584697 3300025929 Bacteria 1002
390 Ga0207664_11186877 3300025929 Bacteria 681
391 Ga0207644_10074847 3300025931 Bacteria 2486
392 Ga0207690_10431242 3300025932 Bacteria 1056
393 Ga0207690_11030540 3300025932 Bacteria 685
394 Ga0207706_10264937 3300025933 Bacteria 1500
395 Ga0207706_11411507 3300025933 Bacteria 571
396 Ga0207686_10612184 3300025934 Bacteria 858
397 Ga0207709_10143851 3300025935 Bacteria 1643
398 Ga0207709_11807970 3300025935 Bacteria 508
399 Ga0207669_10265770 3300025937 Bacteria 1286
400 Ga0207669_10903036 3300025937 Bacteria 738
401 Ga0207669_11361784 3300025937 Bacteria 604
402 Ga0207704_10726401 3300025938 Bacteria 824
403 Ga0207704_11498368 3300025938 Bacteria 579
404 Ga0207665_10653929 3300025939 Bacteria 824
405 Ga0207691_10207817 3300025940 Bacteria 1702
406 Ga0207711_10001188 3300025941 Bacteria 24715
407 Ga0207711_11287656 3300025941 Bacteria 673
408 Ga0207689_10217264 3300025942 Bacteria 1579
409 Ga0207689_11630760 3300025942 Bacteria 536
410 Ga0207661_10308794 3300025944 Bacteria 1419
411 Ga0207661_10403977 3300025944 Bacteria 1239
412 Ga0207661_10575334 3300025944 Bacteria 1033
413 Ga0207661_11286164 3300025944 Bacteria 672
414 Ga0207679_10225105 3300025945 Bacteria 1580
415 Ga0207679_11031548 3300025945 Bacteria 754
416 Ga0207667_10568113 3300025949 Bacteria 1146
417 Ga0207667_10622360 3300025949 Bacteria 1087
418 Ga0207667_10632356 3300025949 Bacteria 1077
419 Ga0207667_11941271 3300025949 Bacteria 550
420 Ga0207712_10061281 3300025961 Bacteria 2670
421 Ga0207712_10929756 3300025961 Bacteria 770
422 Ga0207668_10085199 3300025972 Bacteria 2305
423 Ga0207668_11118483 3300025972 Bacteria 706
424 Ga0207668_11513760 3300025972 Bacteria 605
425 Ga0207640_10361078 3300025981 Bacteria 1170
426 Ga0207658_10985735 3300025986 Bacteria 769
427 Ga0207677_10268375 3300026023 Bacteria 1395
428 Ga0207703_10000066 3300026035 Bacteria 125891
429 Ga0207639_10434560 3300026041 Bacteria 1189
430 Ga0207639_10555307 3300026041 Bacteria 1055
431 Ga0207708_10103253 3300026075 Bacteria 2208
432 Ga0207702_10431755 3300026078 Bacteria 1275
433 Ga0207702_10626230 3300026078 Bacteria 1057
434 Ga0207702_11067804 3300026078 Bacteria 801
435 Ga0207702_11610440 3300026078 Bacteria 642
436 Ga0207702_12253068 3300026078 Bacteria 533
437 Ga0207641_10000419 3300026088 Bacteria 49566
438 Ga0207648_10137534 3300026089 Bacteria 2152
439 Ga0207676_11005363 3300026095 Bacteria 822
440 Ga0207674_10106532 3300026116 Bacteria 2781
441 Ga0207674_10209688 3300026116 Bacteria 1897
442 Ga0207674_10240599 3300026116 Bacteria 1757
443 Ga0207675_100292327 3300026118 Bacteria 1585
444 Ga0207675_101183950 3300026118 Bacteria 784
445 Ga0207675_101198448 3300026118 Bacteria 779
446 Ga0207683_10326067 3300026121 Bacteria 1407
447 Ga0207683_10920125 3300026121 Bacteria 812
448 Ga0207698_10306464 3300026142 Bacteria 1481
449 Ga0207698_10547514 3300026142 Bacteria 1133
450 Ga0209371_1046875 3300027312 Bacteria 847
451 Ga0209282_1298316 3300027666 Bacteria 686
452 Ga0209974_10460285 3300027876 Bacteria 506
453 Ga0207428_10101037 3300027907 Bacteria 2229
454 Ga0207428_10176902 3300027907 Bacteria 1613
455 Ga0268266_10002878 3300028379 Bacteria 17879
456 Ga0268266_11065758 3300028379 Bacteria 782
457 Ga0268266_11551220 3300028379 Bacteria 638
458 Ga0268265_10977018 3300028380 Bacteria 835
459 Ga0268264_10005396 3300028381 Bacteria 10824
460 Ga0268264_11808235 3300028381 Bacteria 621
461 Ga0265337_1022367 3300028556 Bacteria 1960
462 Ga0265319_1277202 3300028563 Bacteria 510
463 Ga0265334_10039799 3300028573 Unclassified 1844
464 Ga0307517_10004784 3300028786 Bacteria 20661
465 Ga0307515_10025160 3300028794 Bacteria 10317
466 Ga0307515_10275618 3300028794 Bacteria 1396
467 Ga0265338_10005572 3300028800 Bacteria 16380
468 Ga0265338_10083961 3300028800 Bacteria 2661
469 Ga0310981_1081140 3300029285 Bacteria 511
470 Ga0268256_1044084 3300030500 Bacteria 980
471 Ga0307511_10002017 3300030521 Bacteria 21302
472 Ga0307512_10008068 3300030522 Bacteria 10317
473 Ga0307512_10095303 3300030522 Bacteria 2048
474 Ga0265777_105402 3300030877 Bacteria 842
475 Ga0265761_108106 3300030889 Bacteria 584
476 Ga0265332_10283728 3300031238 Bacteria 684
477 Ga0265325_10055181 3300031241 Unclassified 2032
478 Ga0265325_10445309 3300031241 Bacteria 564
479 Ga0265340_10009688 3300031247 Bacteria 5163
480 Ga0265340_10347631 3300031247 Bacteria 655
481 Ga0265339_10039944 3300031249 Bacteria 2609
482 Ga0265339_10089235 3300031249 Unclassified 1618
483 Ga0265316_11001514 3300031344 Bacteria 581
484 Ga0307513_10083290 3300031456 Bacteria 3289
485 Ga0307513_10125628 3300031456 Bacteria 2521
486 Ga0307513_10931061 3300031456 Bacteria 577
487 Ga0307509_10089356 3300031507 Bacteria 3159
488 Ga0307509_10176128 3300031507 Bacteria 2011
489 Ga0307408_100765539 3300031548 Bacteria 873
490 Ga0307408_100890579 3300031548 Bacteria 814
491 Ga0307408_101022659 3300031548 Bacteria 763
492 Ga0265313_10054039 3300031595 Bacteria 1909
493 Ga0310103_117188 3300031614 Bacteria 943
494 Ga0307508_10014621 3300031616 Bacteria 7162
495 Ga0307508_10017412 3300031616 Bacteria 6532
496 Ga0307508_10019016 3300031616 Bacteria 6241
497 Ga0307508_10045682 3300031616 Bacteria 3912
498 Ga0307508_10826990 3300031616 Bacteria 545
499 Ga0307514_10003844 3300031649 Bacteria 14127
500 Ga0307514_10043049 3300031649 Bacteria 3548
501 Ga0307514_10059226 3300031649 Bacteria 2927
502 Ga0307514_10118712 3300031649 Bacteria 1851
503 Ga0307514_10206484 3300031649 Bacteria 1226
504 Ga0316575_10075152 3300031665 Bacteria 1360
505 Ga0316575_10391012 3300031665 Bacteria 595
506 Ga0316579_10086636 3300031691 Bacteria 1494
507 Ga0265342_10024150 3300031712 Bacteria 3840
508 Ga0316576_10158163 3300031727 Bacteria 1708
509 Ga0316576_10244994 3300031727 Bacteria 1346
510 Ga0316578_10019112 3300031728 Bacteria 3765
511 Ga0316578_10076370 3300031728 Bacteria 1989
512 Ga0307516_10001550 3300031730 Bacteria 31620
513 Ga0307516_10019048 3300031730 Bacteria 7120
514 Ga0307516_10393705 3300031730 Bacteria 1045
515 Ga0307405_10168909 3300031731 Bacteria 1558
516 Ga0307405_10602635 3300031731 Bacteria 897
517 Ga0307405_12051990 3300031731 Bacteria 512
518 Ga0316577_10098113 3300031733 Bacteria 1641
519 Ga0307413_10241094 3300031824 Bacteria 1335
520 Ga0307413_11615038 3300031824 Bacteria 576
521 Ga0307413_12014314 3300031824 Bacteria 521
522 Ga0307518_10534050 3300031838 Bacteria 588
523 Ga0307410_10132308 3300031852 Bacteria 1834
524 Ga0307410_11344552 3300031852 Bacteria 626
525 Ga0307410_12134000 3300031852 Bacteria 501
526 Ga0307406_10000344 3300031901 Bacteria 27059
527 Ga0307406_10070262 3300031901 Bacteria 2292
528 Ga0307406_10213767 3300031901 Bacteria 1428
529 Ga0307406_10788265 3300031901 Bacteria 801
530 Ga0307406_10986329 3300031901 Bacteria 722
531 Ga0307407_10123057 3300031903 Bacteria 1648
532 Ga0307407_10701034 3300031903 Bacteria 763
533 Ga0307412_10687832 3300031911 Bacteria 876
534 Ga0307412_12230513 3300031911 Bacteria 510
535 Ga0307409_100206366 3300031995 Bacteria 1762
536 Ga0307409_100522046 3300031995 Bacteria 1160
537 Ga0307409_100657511 3300031995 Bacteria 1043
538 Ga0307409_102693573 3300031995 Bacteria 525
539 Ga0307416_100107847 3300032002 Bacteria 2445
540 Ga0307416_100604868 3300032002 Bacteria 1176
541 Ga0307416_100839868 3300032002 Bacteria 1016
542 Ga0307416_101031276 3300032002 Bacteria 926
543 Ga0307416_101635237 3300032002 Bacteria 749
544 Ga0307411_10881073 3300032005 Bacteria 794
545 Ga0307411_10940885 3300032005 Bacteria 770
546 Ga0307411_11504924 3300032005 Bacteria 619
547 Ga0307415_101500411 3300032126 Bacteria 645
548 Ga0316583_10012793 3300032133 Bacteria 3028
549 Ga0316585_10029638 3300032137 Bacteria 1714
550 Ga0316580_10002100 3300032139 Bacteria 5415
551 Ga0316593_10133397 3300032168 Bacteria 897
552 Ga0307507_10296439 3300033179 Bacteria 995
553 Ga0307510_10098847 3300033180 Bacteria 2720
554 Ga0307510_10265031 3300033180 Bacteria 1197
555 Ga0307510_10355071 3300033180 Bacteria 915
556 Ga0307510_10394943 3300033180 Bacteria 826
557 Ga0316588_1024655 3300033528 Bacteria 1385
558 Ga0316587_1077595 3300033529 Bacteria 626
559 Ga0316587_1093269 3300033529 Bacteria 576
560 Ga0316596_1005006 3300033541 Bacteria 3004
561 Ga0316596_1047494 3300033541 Bacteria 1134
562 Ga0373938_0197387 3300034957 Bacteria 556
563 Ga0373934_0000413 3300035086 Bacteria 14982
564 Ga0373934_0011739 3300035086 Bacteria 3299
565 Ga0373949_0119484 3300035090 Bacteria 739
566 Ga0373923_0083385 3300035111 Bacteria 1389
567 Ga0373936_0071412 3300035113 Bacteria 1431
568 Ga0373953_0000551 3300035117 Bacteria 10390
569 Ga0373953_0093894 3300035117 Bacteria 1257
570 Ga0373954_0001878 3300035118 Bacteria 8667
571 Ga0373954_0060776 3300035118 Bacteria 1783
572 Ga0373956_0000234 3300035119 Bacteria 22056
573 Ga0373956_0171675 3300035119 Bacteria 1023
574 Ga0373957_0000078 3300035120 Bacteria 23295
575 Ga0373957_0016711 3300035120 Bacteria 2545
576 Ga0373955_0000922 3300035172 Bacteria 12626
577 Ga0373955_0003954 3300035172 Bacteria 6541
578 Ga0316574_0054919 3300035398 Bacteria 2488
579 Ga0316574_0140592 3300035398 Bacteria 1555
580 Ga0316574_0421683 3300035398 Bacteria 838
581 Ga0373924_0205784 3300035410 Bacteria 868
582 Ga0373931_0329099 3300035691 Bacteria 951
583 Ga0373931_0496328 3300035691 Bacteria 787
584 Ga0373935_0943769 3300035692 Bacteria 640
585 Ga0373927_0968657 3300035695 Bacteria 561
586 Ga0373933_0000076 3300035724 Bacteria 61470
587 Ga0373933_0082049 3300035724 Bacteria 1978
588 Ga0373937_0000183 3300036401 Bacteria 61487
589 Ga0373937_0825168 3300036401 Bacteria 875
590 Ga0373937_1368803 3300036401 Bacteria 655
591 Ga0316582_0011385 3300036647 Bacteria 4913
592 Ga0316584_0063533 3300036712 Bacteria 2763
593 Ga0316584_0229780 3300036712 Bacteria 1360
594 Ga0395899_0046064 3300037312 Bacteria 3248
595 Ga0395899_0144378 3300037312 Bacteria 1691
596 Ga0395899_0173784 3300037312 Bacteria 1516
597 Ga0395900_0149873 3300037418 Bacteria 2383
598 Ga0395900_0498481 3300037418 Bacteria 1168
599 Ga0395900_1775311 3300037418 Bacteria 527
600 Ga0395898_0000622 3300037466 Bacteria 65033
601 Ga0395898_0015578 3300037466 Bacteria 7795
602 Ga0395898_0101510 3300037466 Bacteria 2762
603 Ga0395898_0175903 3300037466 Bacteria 2046
604 Ga0395898_0612000 3300037466 Bacteria 1032
605 Ga0395898_1312800 3300037466 Bacteria 653
606 Ga0316581_0170394 3300037588 Bacteria 671
607 Ga0436364_0062912 3300037853 Bacteria 47359
608 Ga0395901_0391216 3300038443 Bacteria 1429
609 Ga0395901_0456646 3300038443 Bacteria 1306
610 Ga0395901_1389266 3300038443 Bacteria 661
611 Ga0436365_0879580 3300039437 Bacteria 36654
612 Ga0436365_1225491 3300039437 Bacteria 5655
613 Ga0439436_0002018 3300041404 Bacteria 6034
614 Ga0439436_0015225 3300041404 Bacteria 2313
615 Ga0439436_0042742 3300041404 Bacteria 1295
616 Ga0439439_0000254 3300041406 Bacteria 8374
617 Ga0439453_0104439 3300041408 Bacteria 635
618 Ga0439466_0162495 3300041411 Bacteria 683
619 Ga0439465_0052642 3300041413 Bacteria 1336
620 Ga0439465_0061592 3300041413 Bacteria 1244
621 Ga0439465_0350606 3300041413 Bacteria 557
622 Ga0451792_12977 3300041445 Bacteria 724
623 Ga0451791_0235911 3300041451 Bacteria 921
624 Ga0451791_0453322 3300041451 Bacteria 561
625 Ga0451793_1275263 3300041452 Bacteria 1479
626 Ga0451797_0913809 3300041453 Bacteria 546
627 Ga0451797_1306607 3300041453 Bacteria 2014
628 Ga0451797_1364221 3300041453 Bacteria 801
629 Ga0451801_37017 3300041455 Bacteria 764
630 Ga0451795_1358716 3300041456 Bacteria 1332
631 Ga0451800_0254177 3300041459 Bacteria 1773
632 Ga0451802_0072948 3300041460 Bacteria 505
633 Ga0451802_0104636 3300041460 Bacteria 531
634 Ga0451802_0479341 3300041460 Bacteria 1586
635 Ga0451805_087420 3300041461 Bacteria 654
636 Ga0451835_1170188 3300041492 Bacteria 698
637 Ga0451841_0125492 3300041498 Bacteria 751
638 Ga0451841_0466799 3300041498 Bacteria 1061
639 Ga0451845_0239999 3300041501 Bacteria 953
640 Ga0451849_0924598 3300041505 Bacteria 1569
641 Ga0451853_0381932 3300041512 Bacteria 781
642 Ga0451853_1865502 3300041512 Bacteria 1122
643 Ga0451853_2603884 3300041512 Bacteria 916
644 Ga0451853_2920057 3300041512 Bacteria 545
645 Ga0451853_3360855 3300041512 Bacteria 537
646 Ga0451853_4033414 3300041512 Bacteria 861
647 Ga0439431_0105118 3300041997 Bacteria 778
648 Ga0439433_0006606 3300041999 Bacteria 2498
649 Ga0439442_002078 3300042002 Bacteria 3934
650 Ga0439448_0002469 3300042005 Bacteria 5039
651 Ga0439449_0001172 3300042007 Bacteria 10280
652 Ga0439449_0023539 3300042007 Bacteria 2302
653 Ga0439449_0089653 3300042007 Bacteria 1135
654 Ga0439449_0385676 3300042007 Bacteria 531
655 Ga0439454_028021 3300042011 Bacteria 868
656 Ga0439455_0020550 3300042012 Bacteria 1566
657 Ga0439457_000267 3300042014 Bacteria 14304
658 Ga0439457_002421 3300042014 Bacteria 5336
659 Ga0439462_0013751 3300042015 Bacteria 2076
660 Ga0450920_023536 3300042122 Bacteria 1194
661 Ga0450897_000435 3300042128 Bacteria 2289
662 Ga0450894_001474 3300042131 Bacteria 3367
663 Ga0450895_000962 3300042132 Bacteria 1875
664 Ga0450896_013852 3300042133 Bacteria 1149
665 Ga0450898_000247 3300042134 Bacteria 5940
666 Ga0450900_004404 3300042136 Bacteria 1617
667 Ga0450900_013068 3300042136 Bacteria 1094
668 Ga0450902_002079 3300042137 Bacteria 2811
669 Ga0450903_002022 3300042138 Bacteria 3655
670 Ga0450903_012578 3300042138 Bacteria 1351
671 Ga0450905_086170 3300042142 Bacteria 551
672 Ga0450906_023851 3300042145 Bacteria 1088
673 Ga0450907_017555 3300042146 Bacteria 1194
674 Ga0450910_095750 3300042147 Bacteria 529
675 Ga0439458_0000320 3300042157 Bacteria 11976
676 Ga0450908_019594 3300042184 Bacteria 1190
677 Ga0439435_0136108 3300042436 Bacteria 780
678 Ga0439460_0130240 3300042461 Bacteria 829
679 Ga0450901_005798 3300042533 Bacteria 1269
680 Ga0451577_0244007 3300042876 Bacteria 1626
681 Ga0451577_1418737 3300042876 Bacteria 616
682 Ga0466969_0050397 3300044656 Bacteria 2052
683 Ga0466972_0002764 3300044658 Bacteria 8692
684 Ga0466972_0010375 3300044658 Bacteria 4677
685 Ga0466972_0188741 3300044658 Bacteria 966
686 Ga0466972_0224264 3300044658 Bacteria 879
687 Ga0466972_0357153 3300044658 Bacteria 683
688 Ga0466972_0409741 3300044658 Bacteria 635
689 Ga0466972_0578774 3300044658 Bacteria 530
690 Ga0466965_0001075 3300044683 Bacteria 10619
691 Ga0466965_0026735 3300044683 Bacteria 2797
692 Ga0466965_0047862 3300044683 Bacteria 2117
693 Ga0466965_0049949 3300044683 Bacteria 2073
694 Ga0466965_0052477 3300044683 Bacteria 2025
695 Ga0466965_0136319 3300044683 Bacteria 1275
696 Ga0466965_0200096 3300044683 Bacteria 1059
697 Ga0466965_0381727 3300044683 Bacteria 776
698 Ga0466966_0004673 3300044684 Bacteria 9014
699 Ga0466966_0007573 3300044684 Bacteria 7193
700 Ga0466966_0324123 3300044684 Bacteria 925
701 Ga0466966_0460600 3300044684 Bacteria 764
702 Ga0466961_0013019 3300044693 Bacteria 5321
703 Ga0466961_0050391 3300044693 Bacteria 2659
704 Ga0466961_0070584 3300044693 Bacteria 2217
705 Ga0466961_0413151 3300044693 Bacteria 818
706 Ga0466961_0601969 3300044693 Bacteria 661
707 Ga0466961_0760318 3300044693 Bacteria 579
708 Ga0466961_0811470 3300044693 Bacteria 558
709 Ga0466963_0000829 3300044694 Bacteria 15494
710 Ga0466963_0135417 3300044694 Bacteria 1704
711 Ga0466963_0260838 3300044694 Bacteria 1217
712 Ga0466963_0351557 3300044694 Bacteria 1038
713 Ga0466963_0387633 3300044694 Bacteria 985
714 Ga0466963_0505195 3300044694 Bacteria 853
715 Ga0466963_0642272 3300044694 Bacteria 749
716 Ga0466963_1046114 3300044694 Bacteria 574
717 Ga0466964_0002067 3300044706 Bacteria 7063
718 Ga0466964_0048238 3300044706 Bacteria 1741
719 Ga0466964_0408371 3300044706 Bacteria 711
720 Ga0466971_0001565 3300044719 Bacteria 9658
721 Ga0466971_0101266 3300044719 Bacteria 1324
722 Ga0466971_0213277 3300044719 Bacteria 913
723 Ga0466971_0619884 3300044719 Bacteria 540
724 Ga0466968_0088124 3300044735 Bacteria 1372
725 Ga0466968_0356064 3300044735 Bacteria 712
726 Ga0466968_0449934 3300044735 Bacteria 637
727 Ga0466968_0533486 3300044735 Bacteria 587
728 Ga0466970_0001647 3300044765 Bacteria 10736
729 Ga0466970_0018545 3300044765 Bacteria 3603
730 Ga0466970_0034486 3300044765 Bacteria 2679
731 Ga0466970_0065227 3300044765 Bacteria 1953
732 Ga0466970_0067431 3300044765 Bacteria 1921
733 Ga0466970_0095485 3300044765 Bacteria 1616
734 Ga0466970_0854453 3300044765 Bacteria 534
735 Ga0466957_0000170 3300044842 Bacteria 29001
736 Ga0466957_0073024 3300044842 Bacteria 2125
737 Ga0466957_0093442 3300044842 Bacteria 1888
738 Ga0466957_0214611 3300044842 Bacteria 1268
739 Ga0466960_0008803 3300044901 Bacteria 4145
740 Ga0466960_0022810 3300044901 Bacteria 2802
741 Ga0466960_0038075 3300044901 Bacteria 2259
742 Ga0466960_0078312 3300044901 Bacteria 1659
743 Ga0466960_0095083 3300044901 Bacteria 1525
744 Ga0466960_0194556 3300044901 Bacteria 1105
745 Ga0466959_0000614 3300045049 Bacteria 20762
746 Ga0466959_0339825 3300045049 Bacteria 1024
747 Ga0466959_0636884 3300045049 Bacteria 716
748 Ga0466958_0007122 3300045836 Bacteria 6126
749 Ga0466958_0074578 3300045836 Bacteria 2079
750 Ga0466958_0099351 3300045836 Bacteria 1808
751 Ga0466958_0177545 3300045836 Bacteria 1351
752 Ga0466958_0291351 3300045836 Bacteria 1047
753 Ga0466958_0465798 3300045836 Bacteria 819
754 Ga0466958_0579046 3300045836 Bacteria 730
755 Ga0466967_0037190 3300045976 Bacteria 4163
756 Ga0466967_0129919 3300045976 Bacteria 2337
757 Ga0466967_0161606 3300045976 Bacteria 2103
758 Ga0466967_0193790 3300045976 Bacteria 1922
759 Ga0466967_0682896 3300045976 Bacteria 1016
760 Ga0466967_1431781 3300045976 Bacteria 688
761 Ga0466967_2520008 3300045976 Bacteria 509
762 Ga0495617_231551 3300046452 Bacteria 572
763 Ga0495627_213433 3300046453 Bacteria 530
764 Ga0495592_0000158 3300046454 Bacteria 59662
765 Ga0495592_0005337 3300046454 Bacteria 9485
766 Ga0495592_0119503 3300046454 Bacteria 1855
767 Ga0495592_0588043 3300046454 Bacteria 680
768 Ga0495603_0000831 3300046455 Bacteria 17724
769 Ga0495603_0005212 3300046455 Bacteria 7761
770 Ga0495603_0023663 3300046455 Bacteria 3715
771 Ga0495603_0051941 3300046455 Bacteria 2434
772 Ga0495603_0068830 3300046455 Bacteria 2082
773 Ga0495603_0423181 3300046455 Bacteria 763
774 Ga0495590_0227656 3300046457 Bacteria 690
775 Ga0495629_0033621 3300046459 Bacteria 3626
776 Ga0495629_0049312 3300046459 Bacteria 2951
777 Ga0495629_0051534 3300046459 Bacteria 2880
778 Ga0495629_0071827 3300046459 Bacteria 2415
779 Ga0495629_0257134 3300046459 Bacteria 1201
780 Ga0495629_0489101 3300046459 Bacteria 830
781 Ga0495629_0540583 3300046459 Bacteria 783
782 Ga0495629_0802193 3300046459 Bacteria 621
783 Ga0495638_0064630 3300046460 Bacteria 2254
784 Ga0495638_0066404 3300046460 Bacteria 2217
785 Ga0495638_0138853 3300046460 Bacteria 1420
786 Ga0495638_0185109 3300046460 Bacteria 1185
787 Ga0495638_0200061 3300046460 Bacteria 1128
788 Ga0495638_0675224 3300046460 Bacteria 500
789 Ga0495641_0210368 3300046461 Bacteria 872
790 Ga0495641_0445590 3300046461 Bacteria 589
791 Ga0495651_0000101 3300046462 Bacteria 62279
792 Ga0495651_0019714 3300046462 Bacteria 5227
793 Ga0495651_0028260 3300046462 Bacteria 4371
794 Ga0495651_0078880 3300046462 Bacteria 2490
795 Ga0495653_0008755 3300046463 Bacteria 8287
796 Ga0495653_0035480 3300046463 Bacteria 3935
797 Ga0495653_0038765 3300046463 Bacteria 3738
798 Ga0495653_0165169 3300046463 Bacteria 1533
799 Ga0495653_0372473 3300046463 Bacteria 914
800 Ga0495580_0071165 3300046472 Bacteria 2429
801 Ga0495582_0641847 3300046473 Bacteria 614
802 Ga0495605_0107632 3300046474 Bacteria 1275
803 Ga0495662_0000253 3300046476 Bacteria 22699
804 Ga0495662_0002995 3300046476 Bacteria 8525
805 Ga0495662_0052526 3300046476 Bacteria 1968
806 Ga0495662_0149933 3300046476 Bacteria 1148
807 Ga0495664_0001773 3300046477 Bacteria 11443
808 Ga0495664_0052658 3300046477 Bacteria 2419
809 Ga0495664_0315549 3300046477 Bacteria 943
810 Ga0495664_0562313 3300046477 Bacteria 679
811 Ga0495585_0040561 3300046492 Bacteria 2614
812 Ga0495585_0059828 3300046492 Bacteria 2098
813 Ga0495585_0193139 3300046492 Bacteria 1040
814 Ga0495594_0029780 3300046499 Bacteria 2951
815 Ga0495594_0034187 3300046499 Bacteria 2765
816 Ga0495594_0068118 3300046499 Bacteria 1976
817 Ga0495594_0090276 3300046499 Bacteria 1716
818 Ga0495607_0039647 3300046501 Bacteria 2812
819 Ga0495583_0201564 3300046506 Bacteria 808
820 Ga0495608_0000099 3300046511 Bacteria 61951
821 Ga0495608_0058479 3300046511 Bacteria 2541
822 Ga0495608_0067568 3300046511 Bacteria 2338
823 Ga0495608_0366264 3300046511 Bacteria 885
824 Ga0495608_0687765 3300046511 Bacteria 609
825 Ga0495610_0216925 3300046512 Bacteria 775
826 Ga0495618_0031633 3300046514 Bacteria 3311
827 Ga0495618_0354704 3300046514 Bacteria 903
828 Ga0495620_0223795 3300046515 Bacteria 720
829 Ga0495628_0004775 3300046516 Bacteria 11943
830 Ga0495628_0012392 3300046516 Bacteria 7191
831 Ga0495628_0293983 3300046516 Bacteria 1203
832 Ga0495628_0534353 3300046516 Bacteria 843
833 Ga0495630_0089968 3300046517 Bacteria 2319
834 Ga0495630_0165138 3300046517 Bacteria 1685
835 Ga0495630_0234434 3300046517 Bacteria 1402
836 Ga0495630_0625591 3300046517 Bacteria 825
837 Ga0495630_1473019 3300046517 Bacteria 511
838 Ga0495631_0263974 3300046518 Bacteria 733
839 Ga0495632_0153882 3300046519 Bacteria 1062
840 Ga0495643_0002222 3300046522 Bacteria 15767
841 Ga0495643_0112244 3300046522 Bacteria 1385
842 Ga0495644_0354065 3300046523 Bacteria 578
843 Ga0495666_0001455 3300046526 Bacteria 11535
844 Ga0495666_0348703 3300046526 Bacteria 667
845 Ga0495652_0000214 3300046529 Bacteria 66835
846 Ga0495652_0091389 3300046529 Bacteria 2488
847 Ga0495652_0119109 3300046529 Bacteria 2109
848 Ga0495652_0227458 3300046529 Bacteria 1397
849 Ga0495652_0838563 3300046529 Bacteria 610
850 Ga0495665_0006386 3300046531 Bacteria 6362
851 Ga0495640_0010020 3300046533 Bacteria 7347
852 Ga0495640_0261979 3300046533 Bacteria 1080
853 Ga0495640_0561378 3300046533 Bacteria 691
854 Ga0495586_0023992 3300046535 Bacteria 3257
855 Ga0495586_0041211 3300046535 Bacteria 2486
856 Ga0495586_0432525 3300046535 Bacteria 758
857 Ga0495587_0000108 3300046536 Bacteria 62874
858 Ga0495587_0001699 3300046536 Bacteria 14697
859 Ga0495587_0054325 3300046536 Bacteria 2360
860 Ga0495587_0109572 3300046536 Bacteria 1587
861 Ga0495587_0367198 3300046536 Bacteria 801
862 Ga0495645_0018186 3300046543 Bacteria 5046
863 Ga0495645_0020886 3300046543 Bacteria 4732
864 Ga0495645_0024352 3300046543 Bacteria 4391
865 Ga0495622_0036785 3300046557 Bacteria 2281
866 Ga0495622_0059627 3300046557 Bacteria 1767
867 Ga0495622_0138961 3300046557 Bacteria 1103
868 Ga0495633_0049233 3300046558 Bacteria 1989
869 Ga0495633_0182350 3300046558 Bacteria 966
870 Ga0495667_0000102 3300046559 Bacteria 61487
871 Ga0495667_0015573 3300046559 Bacteria 5140
872 Ga0495667_0103249 3300046559 Bacteria 1844
873 Ga0495667_0331498 3300046559 Bacteria 962
874 Ga0495667_0420163 3300046559 Bacteria 841
875 Ga0495668_0077855 3300046616 Bacteria 1821
876 Ga0495668_0779846 3300046616 Bacteria 529
877 Ga0495634_0006236 3300046642 Bacteria 9081
878 Ga0495634_0033911 3300046642 Bacteria 3504
879 Ga0495634_0293570 3300046642 Bacteria 984
880 Ga0495611_0017340 3300046648 Bacteria 3080
881 Ga0495611_0100048 3300046648 Bacteria 1346
882 Ga0495625_0240681 3300046660 Bacteria 1178
883 Ga0495625_0262017 3300046660 Bacteria 1118
884 Ga0495625_0452801 3300046660 Bacteria 793
885 Ga0495625_0542218 3300046660 Bacteria 705
886 Ga0495635_0010746 3300046663 Bacteria 6413
887 Ga0495635_0016801 3300046663 Bacteria 5111
888 Ga0495635_0189769 3300046663 Bacteria 1395
889 Ga0495635_0206992 3300046663 Bacteria 1329
890 Ga0495635_0693138 3300046663 Bacteria 661
891 Ga0495659_0154112 3300046664 Bacteria 924
892 Ga0495659_0495150 3300046664 Bacteria 535
893 Ga0495661_0107450 3300046665 Bacteria 1560
894 Ga0495661_0232433 3300046665 Bacteria 950
895 Ga0495588_0004867 3300046674 Bacteria 5949
896 Ga0495588_0026459 3300046674 Bacteria 2896
897 Ga0495588_0081666 3300046674 Bacteria 1687
898 Ga0495588_0190818 3300046674 Bacteria 1082
899 Ga0495657_0000311 3300046675 Bacteria 44641
900 Ga0495657_0019707 3300046675 Bacteria 4862
901 Ga0495657_0020748 3300046675 Bacteria 4723
902 Ga0495657_0052100 3300046675 Bacteria 2745
903 Ga0495657_0268029 3300046675 Bacteria 1024
904 Ga0495657_0407496 3300046675 Bacteria 799
905 Ga0495657_0472542 3300046675 Bacteria 733
906 Ga0495599_0000275 3300046678 Bacteria 31815
907 Ga0495599_0085201 3300046678 Bacteria 1973
908 Ga0495599_0345462 3300046678 Bacteria 893
909 Ga0495623_0000402 3300046679 Bacteria 28670
910 Ga0495623_0008769 3300046679 Bacteria 6565
911 Ga0495623_0060775 3300046679 Bacteria 2371
912 Ga0495623_0186627 3300046679 Bacteria 1201
913 Ga0495646_0003307 3300046680 Bacteria 10030
914 Ga0495646_0098581 3300046680 Bacteria 1678
915 Ga0495646_0710755 3300046680 Bacteria 505
916 Ga0495647_0397078 3300046681 Bacteria 633
917 Ga0495658_0021173 3300046683 Bacteria 3425
918 Ga0495658_0500522 3300046683 Bacteria 777
919 Ga0495658_0689341 3300046683 Bacteria 654
920 Ga0495658_0808887 3300046683 Bacteria 600
921 Ga0495658_0932510 3300046683 Bacteria 555
922 Ga0495613_0009048 3300046689 Bacteria 7389
923 Ga0495613_0014208 3300046689 Bacteria 5907
924 Ga0495613_0015649 3300046689 Bacteria 5645
925 Ga0495613_0031316 3300046689 Bacteria 3950
926 Ga0495613_0170093 3300046689 Bacteria 1547
927 Ga0495624_0232197 3300046690 Bacteria 1117
928 Ga0495624_0440124 3300046690 Bacteria 781
929 Ga0495624_0479688 3300046690 Bacteria 744
930 Ga0495670_0012480 3300046691 Bacteria 4180
931 Ga0495670_0093453 3300046691 Bacteria 1541
932 Ga0495670_0353959 3300046691 Bacteria 790
933 Ga0495671_0053869 3300046692 Bacteria 1995
934 Ga0495671_0588381 3300046692 Bacteria 529
935 Ga0495649_0070376 3300046694 Bacteria 1876
936 Ga0495589_0068205 3300046794 Bacteria 1740
937 Ga0495589_0119156 3300046794 Bacteria 1271
938 Ga0495589_0153168 3300046794 Bacteria 1100
939 Ga0495600_0003580 3300046809 Bacteria 9147
940 Ga0495600_0073250 3300046809 Bacteria 2236
941 Ga0495600_0363296 3300046809 Bacteria 905
942 Ga0495581_0005940 3300047315 Bacteria 7077
943 Ga0495581_0067418 3300047315 Bacteria 2069
944 Ga0495581_0228096 3300047315 Bacteria 1089
945 Ga0495581_0270327 3300047315 Bacteria 994
946 Ga0495581_0673311 3300047315 Bacteria 597
947 Ga0495604_0000096 3300047317 Bacteria 75336
948 Ga0495604_0001196 3300047317 Bacteria 21428
949 Ga0495604_0009065 3300047317 Bacteria 7873
950 Ga0495604_0877884 3300047317 Bacteria 561
951 Ga0495636_0024578 3300047318 Bacteria 2444
952 Ga0495636_0045821 3300047318 Bacteria 1823
953 Ga0495636_0155688 3300047318 Bacteria 1027
954 Ga0495636_0330006 3300047318 Bacteria 717
955 Ga0495674_0073641 3300047319 Bacteria 2943
956 Ga0495674_0396783 3300047319 Bacteria 1114
957 Ga0495674_1164456 3300047319 Bacteria 584
958 Ga0495676_0000524 3300047321 Bacteria 31468
959 Ga0495676_0008425 3300047321 Bacteria 9452
960 Ga0495676_0115209 3300047321 Bacteria 1965
961 Ga0495680_0000493 3300047322 Bacteria 44550
962 Ga0495680_0024349 3300047322 Bacteria 5022
963 Ga0495680_0309881 3300047322 Bacteria 1107
964 Ga0495680_0453274 3300047322 Bacteria 877
965 Ga0495683_0078158 3300047323 Bacteria 1617
966 Ga0495683_0090593 3300047323 Bacteria 1482
967 Ga0495683_0091728 3300047323 Bacteria 1471
968 Ga0495687_015717 3300047443 Bacteria 3837
969 Ga0495687_080483 3300047443 Bacteria 1277
970 Ga0495675_0001039 3300047444 Bacteria 16857
971 Ga0495675_0014932 3300047444 Bacteria 4911
972 Ga0495675_0018548 3300047444 Bacteria 4417
973 Ga0495675_0045858 3300047444 Bacteria 2783
974 Ga0495675_0296713 3300047444 Bacteria 961
975 Ga0495675_0579498 3300047444 Bacteria 638
976 Ga0495677_0144201 3300047445 Bacteria 915
977 Ga0495685_001204 3300047447 Bacteria 7927
978 Ga0495685_005170 3300047447 Bacteria 4251
979 Ga0495685_024300 3300047447 Bacteria 2085
980 Ga0495685_076711 3300047447 Bacteria 1115
981 Ga0495681_0004935 3300047470 Bacteria 9005
982 Ga0495681_0023963 3300047470 Bacteria 3227
983 Ga0495681_0124153 3300047470 Bacteria 1105
984 Ga0495681_0213813 3300047470 Bacteria 776
985 Ga0495684_0045075 3300047471 Bacteria 3375
986 Ga0495684_0061846 3300047471 Bacteria 2848
987 Ga0495684_0096557 3300047471 Bacteria 2236
988 Ga0495686_0074343 3300047472 Bacteria 2085
989 Ga0495686_0185450 3300047472 Bacteria 1203
990 Ga0495686_0333011 3300047472 Bacteria 829
991 Ga0495593_0001104 3300047673 Bacteria 15747
992 Ga0495593_0175616 3300047673 Bacteria 1079
993 Ga0495593_0246614 3300047673 Bacteria 894
994 Ga0495593_0277537 3300047673 Bacteria 838
995 Ga0495602_0000165 3300048088 Bacteria 61487
996 Ga0495602_0017258 3300048088 Bacteria 7238
997 Ga0495602_0094547 3300048088 Bacteria 2469
998 Ga0495602_0144585 3300048088 Bacteria 1878
999 Ga0495602_0425283 3300048088 Bacteria 942
1000 Ga0495602_0463026 3300048088 Bacteria 893
1001 Ga0495614_0000236 3300048089 Bacteria 21472
1002 Ga0495614_0071552 3300048089 Bacteria 1495
1003 Ga0495614_0106387 3300048089 Bacteria 1229
1004 Ga0495614_0173557 3300048089 Bacteria 968
1005 Ga0496100_0002555 3300048903 Bacteria 9274
1006 Ga0496100_0115098 3300048903 Bacteria 1874
1007 Ga0496100_0326600 3300048903 Bacteria 1154
1008 Ga0496100_0876821 3300048903 Bacteria 704
1009 Ga0496100_1538416 3300048903 Bacteria 526
1010 Ga0496101_0030183 3300048904 Bacteria 3798
1011 Ga0496101_0170148 3300048904 Bacteria 1674
1012 Ga0496101_0192395 3300048904 Bacteria 1575
1013 Ga0496102_0000222 3300048905 Bacteria 75152
1014 Ga0496102_0027914 3300048905 Bacteria 5042
1015 Ga0496102_0170447 3300048905 Bacteria 2049
1016 Ga0496103_0000179 3300048906 Bacteria 64934
1017 Ga0496103_0021797 3300048906 Bacteria 3856
1018 Ga0496104_0077464 3300048907 Bacteria 3168
1019 Ga0496104_0179122 3300048907 Bacteria 2030
1020 Ga0496104_0217429 3300048907 Bacteria 1823
1021 Ga0496104_0247756 3300048907 Bacteria 1694
1022 Ga0496104_0453921 3300048907 Bacteria 1193
1023 Ga0496104_0819369 3300048907 Bacteria 837
1024 Ga0496105_0040289 3300048908 Bacteria 3851
1025 Ga0496105_0055044 3300048908 Bacteria 3285
1026 Ga0496105_0236184 3300048908 Bacteria 1484
1027 Ga0496105_0345550 3300048908 Bacteria 1189
1028 Ga0496105_0814976 3300048908 Bacteria 709
1029 Ga0496106_0190924 3300048909 Bacteria 1628
1030 Ga0496106_0331240 3300048909 Bacteria 1222
1031 Ga0496106_0473192 3300048909 Bacteria 1007
1032 Ga0496107_0144454 3300048910 Bacteria 1759
1033 Ga0496107_0270229 3300048910 Bacteria 1265
1034 Ga0496107_0302108 3300048910 Bacteria 1191
1035 Ga0496108_0028685 3300048911 Bacteria 4605
1036 Ga0496108_0086688 3300048911 Bacteria 2658
1037 Ga0496108_0274069 3300048911 Bacteria 1469
1038 Ga0496108_0339622 3300048911 Bacteria 1310
1039 Ga0496108_0509882 3300048911 Bacteria 1050
1040 Ga0496108_0619380 3300048911 Bacteria 942
1041 Ga0496108_0948933 3300048911 Bacteria 736
1042 Ga0496108_1206675 3300048911 Bacteria 639
1043 Ga0496108_1787838 3300048911 Bacteria 503
1044 Ga0496109_0073164 3300048912 Bacteria 3149
1045 Ga0496109_0224389 3300048912 Bacteria 1767
1046 Ga0496109_0246883 3300048912 Bacteria 1681
1047 Ga0496109_1692959 3300048912 Bacteria 566
1048 Ga0496110_0057914 3300048913 Bacteria 3412
1049 Ga0496110_0062978 3300048913 Bacteria 3277
1050 Ga0496110_0225945 3300048913 Bacteria 1702
1051 Ga0496110_0396979 3300048913 Bacteria 1257
1052 Ga0496110_0529913 3300048913 Bacteria 1071
1053 Ga0496110_0669031 3300048913 Bacteria 939
1054 Ga0496111_0147266 3300048914 Bacteria 1746
1055 Ga0496111_0178303 3300048914 Bacteria 1579
1056 Ga0496112_0647208 3300048915 Bacteria 987
1057 Ga0496112_0966670 3300048915 Bacteria 772
1058 Ga0496113_0294154 3300048916 Bacteria 1300
1059 Ga0496114_0111481 3300048917 Bacteria 2345
1060 Ga0496114_0142574 3300048917 Bacteria 2075
1061 Ga0496114_0194222 3300048917 Bacteria 1776
1062 Ga0496114_0325661 3300048917 Bacteria 1358
1063 Ga0496114_0614621 3300048917 Bacteria 958
1064 Ga0496115_0130815 3300048918 Bacteria 2068
1065 Ga0496116_0000481 3300048919 Bacteria 54969
1066 Ga0496117_0000242 3300048920 Bacteria 103350
1067 Ga0496117_0103679 3300048920 Bacteria 1792
1068 Ga0496118_0000412 3300048921 Bacteria 71447
1069 Ga0496119_0013023 3300048922 Bacteria 6676
1070 Ga0496119_0142549 3300048922 Bacteria 1292
1071 Ga0496119_0418925 3300048922 Bacteria 636
1072 Ga0496120_0003152 3300048923 Bacteria 15386
1073 Ga0496120_0086969 3300048923 Bacteria 1679
1074 Ga0496121_0002113 3300048924 Bacteria 31255
1075 Ga0496121_0029846 3300048924 Bacteria 5026
1076 Ga0496121_0196381 3300048924 Bacteria 1442
1077 Ga0496122_0107771 3300048925 Bacteria 1840
1078 Ga0496122_0249366 3300048925 Bacteria 994
1079 Ga0496124_0028247 3300048927 Bacteria 5021
1080 Ga0496125_0000061 3300048928 Bacteria 262739
1081 Ga0496125_0077747 3300048928 Bacteria 2555
1082 Ga0496125_0136947 3300048928 Bacteria 1711
1083 Ga0496126_0000521 3300048929 Bacteria 74946
1084 Ga0496126_0048031 3300048929 Bacteria 3905
1085 Ga0496126_0213496 3300048929 Bacteria 1623
1086 Ga0496126_0280302 3300048929 Bacteria 1381
1087 Ga0496126_0551673 3300048929 Bacteria 914
1088 Ga0501306_003481 3300049127 Bacteria 1699
1089 Ga0501306_004717 3300049127 Bacteria 1538
1090 Ga0501306_007377 3300049127 Bacteria 1316
1091 Ga0501306_019156 3300049127 Bacteria 942
1092 Ga0501308_009812 3300049128 Bacteria 1052
1093 Ga0501308_032658 3300049128 Bacteria 705
1094 Ga0501310_011119 3300049130 Bacteria 1015
1095 Ga0501310_019890 3300049130 Bacteria 830
1096 Ga0501305_076720 3300049161 Bacteria 595
1097 Ga0501307_021176 3300049162 Bacteria 847
1098 Ga0501311_039962 3300049527 Bacteria 708
1099 Ga0501311_047315 3300049527 Bacteria 666
1100 Ga0501311_103100 3300049527 Bacteria 507
1101 Ga0501312_014058 3300049528 Bacteria 1120
1102 Ga0501313_011492 3300049529 Bacteria 1022
1103 Ga0501313_017741 3300049529 Bacteria 862
1104 Ga0501314_009432 3300049530 Bacteria 896
1105 Ga0501314_010761 3300049530 Bacteria 856
1106 Ga0501314_012777 3300049530 Bacteria 808
1107 Ga0501315_012238 3300049531 Bacteria 1059
1108 Ga0501315_025006 3300049531 Bacteria 829
1109 Ga0501315_088999 3300049531 Bacteria 533
1110 Ga0501316_007869 3300049532 Bacteria 1167
1111 Ga0501316_014305 3300049532 Bacteria 945
1112 Ga0501316_023088 3300049532 Bacteria 796
1113 Ga0501316_037117 3300049532 Bacteria 669
1114 Ga0501316_041856 3300049532 Bacteria 641
1115 Ga0501317_016309 3300049533 Bacteria 962
1116 Ga0501317_018583 3300049533 Bacteria 921
1117 Ga0501317_020344 3300049533 Bacteria 894
1118 Ga0501317_022356 3300049533 Bacteria 866
1119 Ga0501317_047918 3300049533 Bacteria 671
1120 Ga0501317_049729 3300049533 Bacteria 663
1121 Ga0501318_004377 3300049534 Bacteria 1351
1122 Ga0501318_019704 3300049534 Bacteria 843
1123 Ga0501318_061921 3300049534 Bacteria 576
1124 Ga0501318_091233 3300049534 Bacteria 505
1125 Ga0501319_001694 3300049535 Bacteria 1313
1126 Ga0501320_007687 3300049536 Bacteria 1044
1127 Ga0501320_022575 3300049536 Bacteria 739
1128 Ga0501321_003292 3300049537 Bacteria 1467
1129 Ga0501321_018131 3300049537 Bacteria 852
1130 Ga0501321_035687 3300049537 Bacteria 682
1131 Ga0501322_006261 3300049538 Bacteria 843
1132 Ga0501322_010435 3300049538 Bacteria 715
1133 Ga0501323_001352 3300049539 Bacteria 2149
1134 Ga0501323_014500 3300049539 Bacteria 986
1135 Ga0501323_042315 3300049539 Bacteria 671
1136 Ga0501323_054099 3300049539 Bacteria 615
1137 Ga0501323_072793 3300049539 Bacteria 552
1138 Ga0501324_004031 3300049540 Bacteria 1152
1139 Ga0501324_026659 3300049540 Bacteria 614
1140 Ga0501324_029688 3300049540 Bacteria 592
1141 Ga0501031_0002886 3300049568 Bacteria 10985
1142 Ga0501031_0007255 3300049568 Bacteria 7233
1143 Ga0501031_0379675 3300049568 Bacteria 914
1144 Ga0501031_0596730 3300049568 Bacteria 710
1145 Ga0501031_0667215 3300049568 Bacteria 668
1146 Ga0501032_0050350 3300049569 Bacteria 2809
1147 Ga0501032_0443877 3300049569 Bacteria 831
1148 Ga0501033_0029364 3300049570 Bacteria 4132
1149 Ga0501033_0046139 3300049570 Bacteria 3240
1150 Ga0501033_0108642 3300049570 Bacteria 2020
1151 Ga0501033_0131000 3300049570 Bacteria 1817
1152 Ga0501033_0139669 3300049570 Bacteria 1752
1153 Ga0501034_0001747 3300049571 Bacteria 27891
1154 Ga0501034_0011927 3300049571 Bacteria 8985
1155 Ga0501034_0082768 3300049571 Bacteria 3211
1156 Ga0501034_0091917 3300049571 Bacteria 3032
1157 Ga0501034_0102271 3300049571 Bacteria 2858
1158 Ga0501034_0105403 3300049571 Bacteria 2812
1159 Ga0501034_0135486 3300049571 Bacteria 2443
1160 Ga0501034_0444686 3300049571 Bacteria 1214
1161 Ga0501034_1172366 3300049571 Bacteria 647
1162 Ga0501036_0001851 3300049572 Bacteria 16402
1163 Ga0501036_0002873 3300049572 Bacteria 13656
1164 Ga0501036_0018651 3300049572 Bacteria 5817
1165 Ga0501036_0223089 3300049572 Bacteria 1582
1166 Ga0501036_0270428 3300049572 Bacteria 1423
1167 Ga0501036_0446097 3300049572 Bacteria 1078
1168 Ga0501036_0750423 3300049572 Bacteria 805
1169 Ga0501037_0030371 3300049573 Bacteria 3994
1170 Ga0501037_0933710 3300049573 Bacteria 567
1171 Ga0501038_0005037 3300049574 Bacteria 12273
1172 Ga0501038_0023851 3300049574 Bacteria 5462
1173 Ga0501038_0084137 3300049574 Bacteria 2677
1174 Ga0501038_0280743 3300049574 Bacteria 1311
1175 Ga0501038_0656036 3300049574 Bacteria 789
1176 Ga0501038_0694193 3300049574 Bacteria 763
1177 Ga0501039_0017759 3300049575 Bacteria 5457
1178 Ga0501039_0045595 3300049575 Bacteria 3387
1179 Ga0501039_0082165 3300049575 Bacteria 2508
1180 Ga0501039_0138273 3300049575 Bacteria 1913
1181 Ga0501039_0351309 3300049575 Bacteria 1159
1182 Ga0501039_0626837 3300049575 Bacteria 842
1183 Ga0501039_1392292 3300049575 Bacteria 540
1184 Ga0501040_0027714 3300049576 Bacteria 3815
1185 Ga0501040_0404015 3300049576 Bacteria 981
1186 Ga0501040_0753992 3300049576 Bacteria 704
1187 Ga0501040_0767513 3300049576 Bacteria 697
1188 Ga0501040_0860560 3300049576 Bacteria 656
1189 Ga0501041_0002007 3300049577 Bacteria 11447
1190 Ga0501041_0014490 3300049577 Bacteria 4682
1191 Ga0501042_0010139 3300049578 Bacteria 6303
1192 Ga0501042_0015522 3300049578 Bacteria 5216
1193 Ga0501042_1378547 3300049578 Bacteria 514
1194 Ga0501043_0008372 3300049579 Bacteria 8143
1195 Ga0501043_0008818 3300049579 Bacteria 7938
1196 Ga0501043_0118648 3300049579 Bacteria 2075
1197 Ga0501043_0542723 3300049579 Bacteria 865
1198 Ga0501043_0593942 3300049579 Bacteria 818
1199 Ga0501043_0648231 3300049579 Bacteria 776
1200 Ga0501046_0187191 3300049580 Bacteria 1546
1201 Ga0501046_0438930 3300049580 Bacteria 939
1202 Ga0501046_1164076 3300049580 Bacteria 531
1203 Ga0501047_0050497 3300049581 Bacteria 4017
1204 Ga0501047_0108025 3300049581 Bacteria 2664
1205 Ga0501047_0794727 3300049581 Bacteria 761
1206 Ga0501047_0803568 3300049581 Bacteria 755
1207 Ga0501048_0025883 3300049582 Bacteria 4274
1208 Ga0501048_0266912 3300049582 Bacteria 1216
1209 Ga0501048_0317278 3300049582 Bacteria 1110
1210 Ga0501067_0840002 3300049583 Bacteria 518
1211 Ga0501068_0435871 3300049584 Bacteria 847
1212 Ga0501068_0523927 3300049584 Bacteria 770
1213 Ga0501069_0318676 3300049585 Bacteria 913
1214 Ga0501070_0002423 3300049586 Bacteria 16361
1215 Ga0501070_0004597 3300049586 Bacteria 11833
1216 Ga0501070_0013006 3300049586 Bacteria 7013
1217 Ga0501070_0048446 3300049586 Bacteria 3530
1218 Ga0501070_0469133 3300049586 Bacteria 1013
1219 Ga0501070_0470881 3300049586 Bacteria 1011
1220 Ga0501071_0022953 3300049587 Bacteria 4353
1221 Ga0501071_0355265 3300049587 Bacteria 1115
1222 Ga0501071_1237690 3300049587 Bacteria 577
1223 Ga0501071_1337610 3300049587 Bacteria 553
1224 Ga0501072_0012315 3300049588 Bacteria 6536
1225 Ga0501072_0031891 3300049588 Bacteria 4125
1226 Ga0501072_0094423 3300049588 Bacteria 2376
1227 Ga0501072_1027692 3300049588 Bacteria 642
1228 Ga0501072_1383401 3300049588 Bacteria 544
1229 Ga0501073_0440627 3300049589 Bacteria 900
1230 Ga0501073_0660761 3300049589 Bacteria 721
1231 Ga0501074_0018631 3300049590 Bacteria 5044
1232 Ga0501074_0030737 3300049590 Bacteria 3891
1233 Ga0501074_0077707 3300049590 Bacteria 2382
1234 Ga0501074_0628546 3300049590 Bacteria 759
1235 Ga0501074_0903776 3300049590 Bacteria 621
1236 Ga0501075_0035364 3300049591 Bacteria 3725
1237 Ga0501075_0085048 3300049591 Bacteria 2396
1238 Ga0501075_0355200 3300049591 Bacteria 1117
1239 Ga0501075_1092788 3300049591 Bacteria 606
1240 Ga0501076_0022853 3300049592 Bacteria 4811
1241 Ga0501076_0257966 3300049592 Bacteria 1427
1242 Ga0501076_0567965 3300049592 Bacteria 935
1243 Ga0501077_0010298 3300049593 Bacteria 5818
1244 Ga0501077_0117775 3300049593 Bacteria 1683
1245 Ga0501077_0728607 3300049593 Bacteria 637
1246 Ga0501202_085562 3300049652 Bacteria 747
1247 Ga0501235_197576 3300049669 Bacteria 543
1248 Ga0501250_008668 3300049680 Bacteria 1128
1249 Ga0501079_0016088 3300049741 Bacteria 5716
1250 Ga0501079_0089420 3300049741 Bacteria 2385
1251 Ga0501079_0123914 3300049741 Bacteria 2010
1252 Ga0501080_0000238 3300049742 Bacteria 41304
1253 Ga0501080_1311609 3300049742 Bacteria 620
1254 Ga0501081_0121714 3300049743 Bacteria 1859
1255 Ga0501081_0951353 3300049743 Bacteria 648
1256 Ga0501083_0024234 3300049744 Bacteria 4206
1257 Ga0501083_0523499 3300049744 Bacteria 772
1258 Ga0501083_1048680 3300049744 Bacteria 531
1259 Ga0501035_0028585 3300049822 Bacteria 5089
1260 Ga0501035_0036349 3300049822 Bacteria 4464
1261 Ga0501035_0153957 3300049822 Bacteria 1993
1262 Ga0501035_0163161 3300049822 Bacteria 1928
1263 Ga0501035_0223604 3300049822 Bacteria 1606
1264 Ga0501044_0004971 3300049823 Bacteria 14867
1265 Ga0501044_0070782 3300049823 Bacteria 3547
1266 Ga0501044_0337997 3300049823 Bacteria 1427
1267 Ga0501044_0350648 3300049823 Bacteria 1395
1268 Ga0501044_1664640 3300049823 Bacteria 503
1269 Ga0501045_0009086 3300049824 Bacteria 6943
1270 Ga0501045_0431279 3300049824 Bacteria 980
1271 Ga0501045_0567744 3300049824 Bacteria 841
1272 Ga0501045_1273252 3300049824 Bacteria 535
1273 nmdc:mga00v17_390973_c1 3300050491 Bacteria 904
1274 nmdc:mga00v17_46398_c1 3300050491 Bacteria 2628
1275 nmdc:mga00v17_675260_c1 3300050491 Bacteria 663
1276 nmdc:mga0k408_246709_c1 3300050493 Bacteria 1066
1277 nmdc:mga06z11_395137_c1 3300050494 Bacteria 832
1278 nmdc:mga07m45_58181_c1 3300050496 Bacteria 2187
1279 nmdc:mga05p37_169332_c1 3300050507 Bacteria 2665
1280 nmdc:mga09592_1481933_c1 3300050508 Bacteria 553
1281 nmdc:mga09592_437295_c1 3300050508 Bacteria 1129
1282 nmdc:mga09592_928045_c1 3300050508 Bacteria 730
1283 nmdc:mga0qj67_125626_c1 3300050509 Bacteria 2076
1284 nmdc:mga06r32_1880485_c1 3300050510 Bacteria 533
1285 nmdc:mga08y16_101565_c1 3300050511 Bacteria 2994
1286 nmdc:mga08y16_931049_c1 3300050511 Bacteria 853
1287 nmdc:mga0n895_1716841_c1 3300050512 Bacteria 590
1288 nmdc:mga0n895_203634_c1 3300050512 Bacteria 2010
1289 nmdc:mga0n895_718113_c1 3300050512 Bacteria 994
1290 nmdc:mga0rr50_355518_c1 3300050513 Bacteria 1232
1291 nmdc:mga0rr50_612521_c1 3300050513 Bacteria 929
1292 nmdc:mga08x19_1283812_c1 3300050514 Bacteria 519
1293 nmdc:mga08x19_64295_c1 3300050514 Bacteria 2382
1294 nmdc:mga0a205_773109_c1 3300050515 Bacteria 808
1295 Ga0495601_0003320 3300053077 Bacteria 9205
1296 Ga0495601_0225476 3300053077 Bacteria 1224
1297 Ga0495612_0409133 3300053078 Bacteria 617
1298 Ga0500610_0189401 3300053079 Bacteria 1000
1299 Ga0500610_0321821 3300053079 Bacteria 670
1300 Ga0495595_0009659 3300053084 Bacteria 3995
1301 Ga0495619_0014438 3300053085 Bacteria 4989
1302 Ga0495619_0309462 3300053085 Bacteria 1094
1303 Ga0500578_0240734 3300053086 Bacteria 1093
1304 Ga0500647_0169633 3300053091 Bacteria 1008
1305 Ga0500651_0442372 3300053093 Bacteria 724
1306 Ga0500566_0119331 3300053094 Bacteria 1423
1307 Ga0500640_004289 3300053095 Bacteria 5157
1308 Ga0500641_0247538 3300053096 Bacteria 748
1309 Ga0500654_095403 3300053099 Bacteria 1299
1310 Ga0500660_068299 3300053100 Bacteria 1677
1311 Ga0500553_028044 3300053101 Bacteria 2826
1312 Ga0500556_0149048 3300053104 Bacteria 921
1313 Ga0500558_073283 3300053106 Bacteria 1408
1314 Ga0500560_018179 3300053107 Bacteria 1955
1315 Ga0500560_166228 3300053107 Bacteria 727
1316 Ga0500562_030237 3300053108 Bacteria 1427
1317 Ga0500569_033214 3300053109 Bacteria 1464
1318 Ga0500572_022923 3300053111 Bacteria 1671
1319 Ga0500580_130025 3300053113 Bacteria 943
1320 Ga0500594_0096106 3300053118 Bacteria 906
1321 Ga0500608_119833 3300053122 Bacteria 1195
1322 Ga0500614_080259 3300053123 Bacteria 911
1323 Ga0500614_283914 3300053123 Bacteria 519
1324 Ga0500621_139679 3300053126 Bacteria 920
1325 Ga0500626_219092 3300053128 Bacteria 735
1326 Ga0500628_001255 3300053129 Bacteria 4382
1327 Ga0500652_106897 3300053131 Bacteria 1169
1328 Ga0500652_109803 3300053131 Bacteria 1152
1329 Ga0500561_0001756 3300053137 Bacteria 3569
1330 Ga0500568_0000049 3300053139 Bacteria 116515
1331 Ga0500573_0028858 3300053140 Bacteria 3197
1332 Ga0500573_0157639 3300053140 Bacteria 1238
1333 Ga0500577_0251950 3300053142 Bacteria 767
1334 Ga0500600_0022039 3300053149 Bacteria 3814
1335 Ga0500600_0100363 3300053149 Bacteria 1528
1336 Ga0500600_0108148 3300053149 Bacteria 1455
1337 Ga0500600_0243487 3300053149 Bacteria 811
1338 Ga0500603_311121 3300053150 Bacteria 511
1339 Ga0500606_076038 3300053152 Bacteria 1136
1340 Ga0500616_0016342 3300053153 Bacteria 4226
1341 Ga0500616_0233930 3300053153 Bacteria 794
1342 Ga0500624_004973 3300053157 Bacteria 1759
1343 Ga0500633_0001249 3300053160 Bacteria 4675
1344 Ga0500634_0038179 3300053161 Bacteria 2611
1345 Ga0500634_0144793 3300053161 Bacteria 1119
1346 Ga0500636_0108019 3300053177 Bacteria 1575
1347 Ga0500636_0285216 3300053177 Bacteria 822
1348 Ga0500656_001023 3300053732 Bacteria 2286
1349 Ga0500565_028798 3300053734 Bacteria 718
1350 Ga0500599_042318 3300053736 Bacteria 705
1351 Ga0500587_002326 3300053739 Bacteria 2701
1352 Ga0501084_0020366 3300054114 Bacteria 5531
1353 Ga0501084_0047023 3300054114 Bacteria 3614
1354 Ga0501084_0054198 3300054114 Bacteria 3354
1355 Ga0501084_0765018 3300054114 Bacteria 814
1356 Ga0501084_1672081 3300054114 Bacteria 532
1357 Ga0590075_040684 3300059424 Bacteria 1188
1358 Ga0587084_000250 3300059477 Bacteria 3759
1359 Ga0587084_066492 3300059477 Bacteria 672
1360 Ga0587070_034175 3300059491 Bacteria 939
1361 Ga0587070_054780 3300059491 Bacteria 807
1362 Ga0587070_066060 3300059491 Bacteria 760
1363 Ga0587073_0162089 3300059492 Bacteria 642
1364 Ga0587077_063671 3300059493 Bacteria 806
1365 Ga0587080_134810 3300059503 Bacteria 559
1366 Ga0587082_029095 3300059504 Bacteria 952
1367 Ga0587082_088004 3300059504 Bacteria 658
1368 Ga0587083_0048243 3300059505 Bacteria 919
1369 Ga0587083_0081280 3300059505 Bacteria 772
1370 Ga0587083_0126898 3300059505 Bacteria 665
1371 Ga0587085_166781 3300059506 Bacteria 519
1372 Ga0587088_012792 3300059508 Bacteria 1276
1373 Ga0587089_025749 3300059509 Bacteria 841
1374 Ga0587090_044955 3300059510 Bacteria 790
1375 Ga0587090_069641 3300059510 Bacteria 684
1376 Ga0587092_014110 3300059512 Bacteria 1152
1377 Ga0587094_023924 3300059513 Bacteria 907
1378 Ga0587095_007745 3300059514 Bacteria 860
1379 Ga0587097_01558 3300059603 Bacteria 840
1380 Ga0587098_015815 3300059604 Bacteria 905
1381 Ga0587106_004245 3300059605 Bacteria 1563
1382 Ga0587106_007117 3300059605 Bacteria 1347
1383 Ga0587125_000712 3300059607 Bacteria 2121
1384 Ga0587125_048344 3300059607 Bacteria 594
1385 Ga0587129_010268 3300059608 Bacteria 721
1386 Ga0587101_000194 3300059623 Bacteria 3568
1387 Ga0587109_052908 3300059624 Bacteria 837
1388 Ga0587115_022267 3300059626 Bacteria 891
1389 Ga0587115_070533 3300059626 Bacteria 603
1390 Ga0587117_024663 3300059627 Bacteria 866
1391 Ga0587122_011989 3300059628 Bacteria 841
1392 Ga0587122_013227 3300059628 Bacteria 817
1393 Ga0587122_014879 3300059628 Bacteria 789
1394 Ga0587122_016780 3300059628 Bacteria 761
1395 Ga0587127_006681 3300059629 Bacteria 823
1396 Ga0587128_015239 3300059630 Bacteria 1111
1397 Ga0587128_020510 3300059630 Bacteria 1010
1398 Ga0587128_071743 3300059630 Bacteria 676
1399 Ga0587128_122781 3300059630 Bacteria 567
1400 Ga0587130_017017 3300059631 Bacteria 761
1401 Ga0587062_102325 3300059639 Bacteria 559
1402 Ga0587069_031819 3300059642 Bacteria 857
1403 Ga0587069_034852 3300059642 Bacteria 833
1404 Ga0587075_024646 3300059644 Bacteria 919
1405 Ga0587076_172660 3300059645 Bacteria 539
1406 Ga0587078_044951 3300059646 Bacteria 634
1407 Ga0587078_070099 3300059646 Bacteria 546
1408 Ga0587100_000585 3300059648 Bacteria 1809
1409 Ga0587105_008756 3300059651 Bacteria 740
1410 Ga0587105_019286 3300059651 Bacteria 587
1411 Ga0587105_032997 3300059651 Bacteria 501
1412 Ga0587107_087875 3300059652 Bacteria 595
1413 Ga0587110_026077 3300059654 Bacteria 690
1414 Ga0587114_046082 3300059655 Bacteria 723
1415 Ga0587114_066732 3300059655 Bacteria 643
1416 Ga0587119_011068 3300059658 Bacteria 1033
1417 Ga0587119_055512 3300059658 Bacteria 600
1418 Ga0587120_011474 3300059659 Bacteria 763
1419 Ga0587124_006138 3300059660 Bacteria 981
1420 Ga0587124_042228 3300059660 Bacteria 536
1421 Ga0587111_0006112 3300060346 Bacteria 1894
1422 Ga0587111_0059990 3300060346 Bacteria 862
1423 Ga0587111_0093223 3300060346 Bacteria 739
1424 Ga0587111_0134420 3300060346 Bacteria 650
1425 Ga0501082_0104865 3300060353 Bacteria 2446
1426 Ga0501082_0132745 3300060353 Bacteria 2160
1427 Ga0501082_1884131 3300060353 Bacteria 521
1428 Ga0466962_0003148 3300061719 Bacteria 7837
1429 Ga0466962_0035513 3300061719 Bacteria 2386
1430 Ga0466962_0057532 3300061719 Bacteria 1856
1431 Ga0466962_0116763 3300061719 Bacteria 1286
1432 Ga0466962_0375414 3300061719 Bacteria 710
1433 Ga0466962_0530393 3300061719 Bacteria 597
1434 Ga0530510_0013846 3300061734 Bacteria 5680
1435 Ga0530510_0092387 3300061734 Bacteria 2208
1436 Ga0530510_0212890 3300061734 Bacteria 1436
1437 2517763569 2517572101 Bacteria 6884336
1438 2842891711 2842888712 Bacteria 4279094
1439 2956941863 2956939328 Bacteria 3474458
1440 3001119220 3001119090 Bacteria 3449530
1441 3001891064 3001889506 Bacteria 2975194
1442 8002792314 8002784119 Bacteria 9788632
1443 8016257469 8016254467 Bacteria 3797036
1444 Ga0070704_101788189
1445 LJQas_1014194
1446 LJQas_1033148
1447 JGI24740J21852_10073190
1448 JGI24740J21852_10093328
1449 JGI24739J22299_10068165
1450 JGI24737J22298_10015151
1451 JGI24735J21928_10055434
1452 JGI24738J21930_10014762
1453 Ga0006779J45831_101096
1454 Ga0006778J45830_1019160
1455 Ga0006773J48901_12202
1456 Ga0006770J48903_1012779
1457 Ga0006777J48905_1032659
1458 rootL2_10032547
1459 JGI25160J50197_1043295
1460 Ga0007427J51700_100683
1461 Ga0006781J51513_1001670
1462 Ga0007410J51695_1035599
1463 Ga0007416J51690_1037339
1464 Ga0006562J51391_1011694
1465 Ga0006562J51391_1176296
1466 Ga0007429J51699_1009559
1467 JGI25404J52841_10002732
1468 Ga0032354_1025483
1469 Ga0006780_1012767
1470 Ga0055527_1000001
1471 Ga0055529_1000065
1472 JGI25405J52794_10008681
1473 Ga0058863_11676597
1474 Ga0058863_11874610
1475 Ga0058863_11935272
1476 Ga0058861_10049278
1477 Ga0058860_10003778
1478 Ga0058862_10078798
1479 Ga0058862_10118426
1480 Ga0070658_10000092
1481 Ga0070658_10002776
1482 Ga0070658_10205552
1483 Ga0070658_10470811
1484 Ga0070658_11562738
1485 Ga0070683_100100946
1486 Ga0070683_100515091
1487 Ga0070683_100592340
1488 Ga0070683_100667241
1489 Ga0070683_100871583
1490 Ga0070683_101476081
1491 Ga0070690_101627338
1492 Ga0068869_100265062
1493 Ga0070680_100000403
1494 Ga0070680_100211817
1495 Ga0070682_100167871
1496 Ga0070682_100305834
1497 Ga0070682_100376963
1498 Ga0070682_100661753
1499 Ga0070682_100723148
1500 Ga0070682_100903230
1501 Ga0068868_100471448
1502 Ga0068868_100606395
1503 Ga0070660_100308392
1504 Ga0070689_102080247
1505 Ga0070691_10987020
1506 Ga0070687_100092980
1507 Ga0070692_10369427
1508 Ga0070668_100314078
1509 Ga0070668_100726423
1510 Ga0070675_100190511
1511 Ga0070675_101435953
1512 Ga0070671_100002585
1513 Ga0070674_100186377
1514 Ga0070674_100895236
1515 Ga0070667_100164713
1516 Ga0070709_10355995
1517 Ga0070714_100001465
1518 Ga0070714_100905124
1519 Ga0070714_102136128
1520 Ga0070713_100184035
1521 Ga0070710_10266242
1522 Ga0070711_100111244
1523 Ga0070700_100586016
1524 Ga0070694_100770397
1525 Ga0070663_100184012
1526 Ga0070663_100500907
1527 Ga0070663_100604636
1528 Ga0070678_100568466
1529 Ga0070678_100936525
1530 Ga0070678_102121013
1531 Ga0070662_100853253
1532 Ga0070681_10018417
1533 Ga0070681_10032811
1534 Ga0068867_101495604
1535 Ga0070685_10172560
1536 Ga0070685_10275792
1537 Ga0070698_100050203
1538 Ga0070698_100816766
1539 Ga0070679_100000591
1540 Ga0070679_100003323
1541 Ga0070679_100943019
1542 Ga0070684_100266548
1543 Ga0070684_100644801
1544 Ga0068853_100091750
1545 Ga0070672_100261184
1546 Ga0070686_100782642
1547 Ga0070693_100309508
1548 Ga0070665_100005910
1549 Ga0070665_100963511
1550 Ga0070665_101117060
1551 Ga0068855_100805807
1552 Ga0068855_100941078
1553 Ga0068855_101468847
1554 Ga0068855_101637704
1555 Ga0070664_100161857
1556 Ga0070664_100716853
1557 Ga0068857_100213364
1558 Ga0068857_100215916
1559 Ga0068857_101956741
1560 Ga0068854_100488666
1561 Ga0068856_101071637
1562 Ga0068856_101084728
1563 Ga0068856_101446489
1564 Ga0070702_100261013
1565 Ga0068852_100267376
1566 Ga0068852_100308948
1567 Ga0068852_100802122
1568 Ga0068852_100931236
1569 Ga0068859_100385328
1570 Ga0068859_100981114
1571 Ga0068859_102212824
1572 Ga0068866_11326965
1573 Ga0068861_100330214
1574 Ga0068861_100722345
1575 Ga0068851_10343743
1576 Ga0068870_10216843
1577 Ga0068870_10586055
1578 Ga0068863_100002283
1579 Ga0068863_101244520
1580 Ga0068860_100041221
1581 Ga0068860_100560823
1582 Ga0068862_100386362
1583 Ga0068862_100686570
1584 Ga0081455_10001106
1585 Ga0081455_10930696
1586 Ga0081538_10275024
1587 Ga0081540_1000405
1588 Ga0081540_1002965
1589 Ga0070717_10054864
1590 Ga0070717_11369484
1591 Ga0075363_100407546
1592 Ga0075432_10041263
1593 Ga0070715_10318394
1594 Ga0070712_100015788
1595 Ga0075370_10038886
1596 Ga0075370_10313016
1597 Ga0075428_100026617
1598 Ga0075428_100107082
1599 Ga0075430_100250162
1600 Ga0075430_101739128
1601 Ga0075431_100126596
1602 Ga0075433_10194652
1603 Ga0075433_11167486
1604 Ga0075434_100526456
1605 Ga0075434_101401699
1606 Ga0075429_100051179
1607 Ga0075429_100557017
1608 Ga0075429_101404488
1609 Ga0068865_100413367
1610 Ga0075436_100071720
1611 Ga0097620_100385341
1612 Ga0097620_100981123
1613 Ga0097620_102213027
1614 Ga0099826_10070429
1615 Ga0075435_100084339
1616 Ga0099795_10175062
1617 Ga0105251_10046141
1618 Ga0105251_10127611
1619 Ga0105244_10075453
1620 Ga0105250_10158816
1621 Ga0105240_12053242
1622 Ga0111539_10104076
1623 Ga0111539_10635837
1624 Ga0111539_12434729
1625 Ga0105245_10022104
1626 Ga0105245_10441200
1627 Ga0105245_10647593
1628 Ga0105245_11469337
1629 Ga0105247_10261583
1630 Ga0105247_10779596
1631 Ga0114129_10110200
1632 Ga0114129_11052873
1633 Ga0105243_10015409
1634 Ga0105243_10198180
1635 Ga0105243_10466530
1636 Ga0105243_12509205
1637 Ga0105243_13041843
1638 Ga0105241_10779767
1639 Ga0105242_10700149
1640 Ga0105248_10048505
1641 Ga0105248_10996709
1642 Ga0105248_11440999
1643 Ga0105248_11753747
1644 Ga0105237_10567703
1645 Ga0105237_10927228
1646 Ga0105238_11473407
1647 Ga0105238_11642336
1648 Ga0105238_11718653
1649 Ga0105238_12779377
1650 Ga0105249_11626505
1651 Ga0105249_11690895
1652 Ga0105249_11839859
1653 Ga0105249_13005227
1654 Ga0105035_109087
1655 Ga0105239_10399074
1656 Ga0105239_10564734
1657 Ga0105239_10918934
1658 Ga0105246_10121802
1659 Ga0105246_10516710
1660 Ga0105246_11114804
1661 Ga0105246_11206286
1662 Ga0105246_11689503
1663 Ga0105246_12459318
1664 Ga0157328_1010435
1665 Ga0157318_1024565
1666 Ga0157343_1006504
1667 Ga0157345_1020668
1668 Ga0157324_1017785
1669 Ga0157338_1009093
1670 Ga0154018_104492
1671 Ga0154019_109330
1672 Ga0154012_169153
1673 Ga0154010_123501
1674 Ga0154010_150777
1675 Ga0157371_10798101
1676 Ga0157369_10001098
1677 Ga0157369_10116316
1678 Ga0157369_10130572
1679 Ga0157369_10137927
1680 Ga0157369_10204676
1681 Ga0157369_10220252
1682 Ga0157369_10313236
1683 Ga0157369_10610401
1684 Ga0157374_11824123
1685 Ga0157374_12494391
1686 Ga0163162_10842289
1687 Ga0163162_11004345
1688 Ga0157372_10130144
1689 Ga0157372_10130650
1690 Ga0157372_10375382
1691 Ga0157372_10380456
1692 Ga0157372_10461374
1693 Ga0157372_10514883
1694 Ga0157372_13110834
1695 Ga0157375_10257655
1696 Ga0157375_10649606
1697 Ga0157375_10726443
1698 Ga0157375_11204296
1699 Ga0157375_11464072
1700 Ga0157375_12058734
1701 Ga0163163_11298894
1702 Ga0163163_11395587
1703 Ga0157380_11559696
1704 Ga0182008_10347845
1705 Ga0157377_10112134
1706 Ga0157377_10368252
1707 Ga0157379_10000011
1708 Ga0157379_10004447
1709 Ga0157379_10468608
1710 Ga0157379_12679166
1711 Ga0157376_13100957
1712 Ga0163161_10397799
1713 Ga0163161_10500830
1714 Ga0197907_10137431
1715 Ga0197907_10164336
1716 Ga0197907_10287841
1717 Ga0197907_10521472
1718 Ga0197907_10553372
1719 Ga0197907_10559923
1720 Ga0197907_10612753
1721 Ga0197907_10890214
1722 Ga0197907_11323563
1723 Ga0206356_10075057
1724 Ga0206356_10184148
1725 Ga0206356_10566583
1726 Ga0206356_10801131
1727 Ga0206356_11542350
1728 Ga0206349_1049575
1729 Ga0206349_1145716
1730 Ga0206349_1191611
1731 Ga0206349_1224460
1732 Ga0206355_1184113
1733 Ga0206355_1263721
1734 Ga0206355_1680853
1735 Ga0206355_1699297
1736 Ga0206351_10073110
1737 Ga0206351_10349151
1738 Ga0206351_10366779
1739 Ga0206351_10561642
1740 Ga0206351_10667073
1741 Ga0206351_10888640
1742 Ga0206352_10175716
1743 Ga0206352_10413355
1744 Ga0206352_10419825
1745 Ga0206352_10782919
1746 Ga0206352_10817773
1747 Ga0206352_11174969
1748 Ga0206350_10387192
1749 Ga0206350_10669342
1750 Ga0206350_10717286
1751 Ga0206350_10939822
1752 Ga0206354_10402312
1753 Ga0206354_11017929
1754 Ga0206354_11061414
1755 Ga0206354_11104228
1756 Ga0206354_11147171
1757 Ga0206354_11344924
1758 Ga0206354_11651120
1759 Ga0206353_10010990
1760 Ga0206353_10069880
1761 Ga0206353_10389836
1762 Ga0206353_10579675
1763 Ga0206353_10620362
1764 Ga0206353_10760686
1765 Ga0206353_11142314
1766 Ga0206353_11145209
1767 Ga0154015_1376143
1768 Ga0154015_1399765
1769 Ga0154015_1569601
1770 Ga0213873_10149932
1771 Ga0213876_10000698
1772 Ga0224712_10004236
1773 Ga0224712_10030705
1774 Ga0224712_10044601
1775 Ga0224712_10057189
1776 Ga0224712_10342901
1777 Ga0224712_10358259
1778 Ga0224712_10368829
1779 Ga0224712_10471188
1780 Ga0209672_100006
1781 Ga0209147_100870
1782 Ga0209258_106149
1783 Ga0209677_100623
1784 Ga0209148_1000015
1785 Ga0209455_1000013
1786 Ga0209758_1043791
1787 Ga0207426_1019038
1788 Ga0207426_1073094
1789 Ga0207656_10218087
1790 Ga0207696_1032158
1791 Ga0207655_1133466
1792 Ga0207713_1038256
1793 Ga0207682_10102956
1794 Ga0207692_10089777
1795 Ga0207692_10992925
1796 Ga0207710_10294804
1797 Ga0207688_10063242
1798 Ga0207688_10491877
1799 Ga0207647_10004777
1800 Ga0207685_10324380
1801 Ga0207699_10630351
1802 Ga0207643_10040282
1803 Ga0207643_10230242
1804 Ga0207643_10895602
1805 Ga0207705_10000660
1806 Ga0207705_10003405
1807 Ga0207705_10364636
1808 Ga0207705_10728763
1809 Ga0207654_11328679
1810 Ga0207707_10000764
1811 Ga0207707_10089094
1812 Ga0207693_10057860
1813 Ga0207663_10072394
1814 Ga0207660_10025359
1815 Ga0207660_10045816
1816 Ga0207662_10147625
1817 Ga0207649_11163860
1818 Ga0207652_10000504
1819 Ga0207652_10119072
1820 Ga0207652_10812335
1821 Ga0207694_10277504
1822 Ga0207694_11001737
1823 Ga0207694_11093018
1824 Ga0207650_11127761
1825 Ga0207659_10335280
1826 Ga0207687_10068750
1827 Ga0207687_10289517
1828 Ga0207687_11191090
1829 Ga0207687_11322236
1830 Ga0207700_10326546
1831 Ga0207664_10000625
1832 Ga0207664_10584697
1833 Ga0207664_11186877
1834 Ga0207644_10074847
1835 Ga0207690_10431242
1836 Ga0207690_11030540
1837 Ga0207706_10264937
1838 Ga0207706_11411507
1839 Ga0207686_10612184
1840 Ga0207709_10143851
1841 Ga0207709_11807970
1842 Ga0207669_10265770
1843 Ga0207669_10903036
1844 Ga0207669_11361784
1845 Ga0207704_10726401
1846 Ga0207704_11498368
1847 Ga0207665_10653929
1848 Ga0207691_10207817
1849 Ga0207711_10001188
1850 Ga0207711_11287656
1851 Ga0207689_10217264
1852 Ga0207689_11630760
1853 Ga0207661_10308794
1854 Ga0207661_10403977
1855 Ga0207661_10575334
1856 Ga0207661_11286164
1857 Ga0207679_10225105
1858 Ga0207679_11031548
1859 Ga0207667_10568113
1860 Ga0207667_10622360
1861 Ga0207667_10632356
1862 Ga0207667_11941271
1863 Ga0207712_10061281
1864 Ga0207712_10929756
1865 Ga0207668_10085199
1866 Ga0207668_11118483
1867 Ga0207668_11513760
1868 Ga0207640_10361078
1869 Ga0207658_10985735
1870 Ga0207677_10268375
1871 Ga0207703_10000066
1872 Ga0207639_10434560
1873 Ga0207639_10555307
1874 Ga0207708_10103253
1875 Ga0207702_10431755
1876 Ga0207702_10626230
1877 Ga0207702_11067804
1878 Ga0207702_11610440
1879 Ga0207702_12253068
1880 Ga0207641_10000419
1881 Ga0207648_10137534
1882 Ga0207676_11005363
1883 Ga0207674_10106532
1884 Ga0207674_10209688
1885 Ga0207674_10240599
1886 Ga0207675_100292327
1887 Ga0207675_101183950
1888 Ga0207675_101198448
1889 Ga0207683_10326067
1890 Ga0207683_10920125
1891 Ga0207698_10306464
1892 Ga0207698_10547514
1893 Ga0209371_1046875
1894 Ga0209282_1298316
1895 Ga0209974_10460285
1896 Ga0207428_10101037
1897 Ga0207428_10176902
1898 Ga0268266_10002878
1899 Ga0268266_11065758
1900 Ga0268266_11551220
1901 Ga0268265_10977018
1902 Ga0268264_10005396
1903 Ga0268264_11808235
1904 Ga0265337_1022367
1905 Ga0265319_1277202
1906 Ga0265334_10039799
1907 Ga0307517_10004784
1908 Ga0307515_10025160
1909 Ga0307515_10275618
1910 Ga0265338_10005572
1911 Ga0265338_10083961
1912 Ga0310981_1081140
1913 Ga0268256_1044084
1914 Ga0307511_10002017
1915 Ga0307512_10008068
1916 Ga0307512_10095303
1917 Ga0265777_105402
1918 Ga0265761_108106
1919 Ga0265332_10283728
1920 Ga0265325_10055181
1921 Ga0265325_10445309
1922 Ga0265340_10009688
1923 Ga0265340_10347631
1924 Ga0265339_10039944
1925 Ga0265339_10089235
1926 Ga0265316_11001514
1927 Ga0307513_10083290
1928 Ga0307513_10125628
1929 Ga0307513_10931061
1930 Ga0307509_10089356
1931 Ga0307509_10176128
1932 Ga0307408_100765539
1933 Ga0307408_100890579
1934 Ga0307408_101022659
1935 Ga0265313_10054039
1936 Ga0310103_117188
1937 Ga0307508_10014621
1938 Ga0307508_10017412
1939 Ga0307508_10019016
1940 Ga0307508_10045682
1941 Ga0307508_10826990
1942 Ga0307514_10003844
1943 Ga0307514_10043049
1944 Ga0307514_10059226
1945 Ga0307514_10118712
1946 Ga0307514_10206484
1947 Ga0316575_10075152
1948 Ga0316575_10391012
1949 Ga0316579_10086636
1950 Ga0265342_10024150
1951 Ga0316576_10158163
1952 Ga0316576_10244994
1953 Ga0316578_10019112
1954 Ga0316578_10076370
1955 Ga0307516_10001550
1956 Ga0307516_10019048
1957 Ga0307516_10393705
1958 Ga0307405_10168909
1959 Ga0307405_10602635
1960 Ga0307405_12051990
1961 Ga0316577_10098113
1962 Ga0307413_10241094
1963 Ga0307413_11615038
1964 Ga0307413_12014314
1965 Ga0307518_10534050
1966 Ga0307410_10132308
1967 Ga0307410_11344552
1968 Ga0307410_12134000
1969 Ga0307406_10000344
1970 Ga0307406_10070262
1971 Ga0307406_10213767
1972 Ga0307406_10788265
1973 Ga0307406_10986329
1974 Ga0307407_10123057
1975 Ga0307407_10701034
1976 Ga0307412_10687832
1977 Ga0307412_12230513
1978 Ga0307409_100206366
1979 Ga0307409_100522046
1980 Ga0307409_100657511
1981 Ga0307409_102693573
1982 Ga0307416_100107847
1983 Ga0307416_100604868
1984 Ga0307416_100839868
1985 Ga0307416_101031276
1986 Ga0307416_101635237
1987 Ga0307411_10881073
1988 Ga0307411_10940885
1989 Ga0307411_11504924
1990 Ga0307415_101500411
1991 Ga0316583_10012793
1992 Ga0316585_10029638
1993 Ga0316580_10002100
1994 Ga0316593_10133397
1995 Ga0307507_10296439
1996 Ga0307510_10098847
1997 Ga0307510_10265031
1998 Ga0307510_10355071
1999 Ga0307510_10394943
2000 Ga0316588_1024655
2001 Ga0316587_1077595
2002 Ga0316587_1093269
2003 Ga0316596_1005006
2004 Ga0316596_1047494
2005 Ga0373938_0197387
2006 Ga0373934_0000413
2007 Ga0373934_0011739
2008 Ga0373949_0119484
2009 Ga0373923_0083385
2010 Ga0373936_0071412
2011 Ga0373953_0000551
2012 Ga0373953_0093894
2013 Ga0373954_0001878
2014 Ga0373954_0060776
2015 Ga0373956_0000234
2016 Ga0373956_0171675
2017 Ga0373957_0000078
2018 Ga0373957_0016711
2019 Ga0373955_0000922
2020 Ga0373955_0003954
2021 Ga0316574_0054919
2022 Ga0316574_0140592
2023 Ga0316574_0421683
2024 Ga0373924_0205784
2025 Ga0373931_0329099
2026 Ga0373931_0496328
2027 Ga0373935_0943769
2028 Ga0373927_0968657
2029 Ga0373933_0000076
2030 Ga0373933_0082049
2031 Ga0373937_0000183
2032 Ga0373937_0825168
2033 Ga0373937_1368803
2034 Ga0316582_0011385
2035 Ga0316584_0063533
2036 Ga0316584_0229780
2037 Ga0395899_0046064
2038 Ga0395899_0144378
2039 Ga0395899_0173784
2040 Ga0395900_0149873
2041 Ga0395900_0498481
2042 Ga0395900_1775311
2043 Ga0395898_0000622
2044 Ga0395898_0015578
2045 Ga0395898_0101510
2046 Ga0395898_0175903
2047 Ga0395898_0612000
2048 Ga0395898_1312800
2049 Ga0316581_0170394
2050 Ga0436364_0062912
2051 Ga0395901_0391216
2052 Ga0395901_0456646
2053 Ga0395901_1389266
2054 Ga0436365_0879580
2055 Ga0436365_1225491
2056 Ga0439436_0002018
2057 Ga0439436_0015225
2058 Ga0439436_0042742
2059 Ga0439439_0000254
2060 Ga0439453_0104439
2061 Ga0439466_0162495
2062 Ga0439465_0052642
2063 Ga0439465_0061592
2064 Ga0439465_0350606
2065 Ga0451792_12977
2066 Ga0451791_0235911
2067 Ga0451791_0453322
2068 Ga0451793_1275263
2069 Ga0451797_0913809
2070 Ga0451797_1306607
2071 Ga0451797_1364221
2072 Ga0451801_37017
2073 Ga0451795_1358716
2074 Ga0451800_0254177
2075 Ga0451802_0072948
2076 Ga0451802_0104636
2077 Ga0451802_0479341
2078 Ga0451805_087420
2079 Ga0451835_1170188
2080 Ga0451841_0125492
2081 Ga0451841_0466799
2082 Ga0451845_0239999
2083 Ga0451849_0924598
2084 Ga0451853_0381932
2085 Ga0451853_1865502
2086 Ga0451853_2603884
2087 Ga0451853_2920057
2088 Ga0451853_3360855
2089 Ga0451853_4033414
2090 Ga0439431_0105118
2091 Ga0439433_0006606
2092 Ga0439442_002078
2093 Ga0439448_0002469
2094 Ga0439449_0001172
2095 Ga0439449_0023539
2096 Ga0439449_0089653
2097 Ga0439449_0385676
2098 Ga0439454_028021
2099 Ga0439455_0020550
2100 Ga0439457_000267
2101 Ga0439457_002421
2102 Ga0439462_0013751
2103 Ga0450920_023536
2104 Ga0450897_000435
2105 Ga0450894_001474
2106 Ga0450895_000962
2107 Ga0450896_013852
2108 Ga0450898_000247
2109 Ga0450900_004404
2110 Ga0450900_013068
2111 Ga0450902_002079
2112 Ga0450903_002022
2113 Ga0450903_012578
2114 Ga0450905_086170
2115 Ga0450906_023851
2116 Ga0450907_017555
2117 Ga0450910_095750
2118 Ga0439458_0000320
2119 Ga0450908_019594
2120 Ga0439435_0136108
2121 Ga0439460_0130240
2122 Ga0450901_005798
2123 Ga0451577_0244007
2124 Ga0451577_1418737
2125 Ga0466969_0050397
2126 Ga0466972_0002764
2127 Ga0466972_0010375
2128 Ga0466972_0188741
2129 Ga0466972_0224264
2130 Ga0466972_0357153
2131 Ga0466972_0409741
2132 Ga0466972_0578774
2133 Ga0466965_0001075
2134 Ga0466965_0026735
2135 Ga0466965_0047862
2136 Ga0466965_0049949
2137 Ga0466965_0052477
2138 Ga0466965_0136319
2139 Ga0466965_0200096
2140 Ga0466965_0381727
2141 Ga0466966_0004673
2142 Ga0466966_0007573
2143 Ga0466966_0324123
2144 Ga0466966_0460600
2145 Ga0466961_0013019
2146 Ga0466961_0050391
2147 Ga0466961_0070584
2148 Ga0466961_0413151
2149 Ga0466961_0601969
2150 Ga0466961_0760318
2151 Ga0466961_0811470
2152 Ga0466963_0000829
2153 Ga0466963_0135417
2154 Ga0466963_0260838
2155 Ga0466963_0351557
2156 Ga0466963_0387633
2157 Ga0466963_0505195
2158 Ga0466963_0642272
2159 Ga0466963_1046114
2160 Ga0466964_0002067
2161 Ga0466964_0048238
2162 Ga0466964_0408371
2163 Ga0466971_0001565
2164 Ga0466971_0101266
2165 Ga0466971_0213277
2166 Ga0466971_0619884
2167 Ga0466968_0088124
2168 Ga0466968_0356064
2169 Ga0466968_0449934
2170 Ga0466968_0533486
2171 Ga0466970_0001647
2172 Ga0466970_0018545
2173 Ga0466970_0034486
2174 Ga0466970_0065227
2175 Ga0466970_0067431
2176 Ga0466970_0095485
2177 Ga0466970_0854453
2178 Ga0466957_0000170
2179 Ga0466957_0073024
2180 Ga0466957_0093442
2181 Ga0466957_0214611
2182 Ga0466960_0008803
2183 Ga0466960_0022810
2184 Ga0466960_0038075
2185 Ga0466960_0078312
2186 Ga0466960_0095083
2187 Ga0466960_0194556
2188 Ga0466959_0000614
2189 Ga0466959_0339825
2190 Ga0466959_0636884
2191 Ga0466958_0007122
2192 Ga0466958_0074578
2193 Ga0466958_0099351
2194 Ga0466958_0177545
2195 Ga0466958_0291351
2196 Ga0466958_0465798
2197 Ga0466958_0579046
2198 Ga0466967_0037190
2199 Ga0466967_0129919
2200 Ga0466967_0161606
2201 Ga0466967_0193790
2202 Ga0466967_0682896
2203 Ga0466967_1431781
2204 Ga0466967_2520008
2205 Ga0495617_231551
2206 Ga0495627_213433
2207 Ga0495592_0000158
2208 Ga0495592_0005337
2209 Ga0495592_0119503
2210 Ga0495592_0588043
2211 Ga0495603_0000831
2212 Ga0495603_0005212
2213 Ga0495603_0023663
2214 Ga0495603_0051941
2215 Ga0495603_0068830
2216 Ga0495603_0423181
2217 Ga0495590_0227656
2218 Ga0495629_0033621
2219 Ga0495629_0049312
2220 Ga0495629_0051534
2221 Ga0495629_0071827
2222 Ga0495629_0257134
2223 Ga0495629_0489101
2224 Ga0495629_0540583
2225 Ga0495629_0802193
2226 Ga0495638_0064630
2227 Ga0495638_0066404
2228 Ga0495638_0138853
2229 Ga0495638_0185109
2230 Ga0495638_0200061
2231 Ga0495638_0675224
2232 Ga0495641_0210368
2233 Ga0495641_0445590
2234 Ga0495651_0000101
2235 Ga0495651_0019714
2236 Ga0495651_0028260
2237 Ga0495651_0078880
2238 Ga0495653_0008755
2239 Ga0495653_0035480
2240 Ga0495653_0038765
2241 Ga0495653_0165169
2242 Ga0495653_0372473
2243 Ga0495580_0071165
2244 Ga0495582_0641847
2245 Ga0495605_0107632
2246 Ga0495662_0000253
2247 Ga0495662_0002995
2248 Ga0495662_0052526
2249 Ga0495662_0149933
2250 Ga0495664_0001773
2251 Ga0495664_0052658
2252 Ga0495664_0315549
2253 Ga0495664_0562313
2254 Ga0495585_0040561
2255 Ga0495585_0059828
2256 Ga0495585_0193139
2257 Ga0495594_0029780
2258 Ga0495594_0034187
2259 Ga0495594_0068118
2260 Ga0495594_0090276
2261 Ga0495607_0039647
2262 Ga0495583_0201564
2263 Ga0495608_0000099
2264 Ga0495608_0058479
2265 Ga0495608_0067568
2266 Ga0495608_0366264
2267 Ga0495608_0687765
2268 Ga0495610_0216925
2269 Ga0495618_0031633
2270 Ga0495618_0354704
2271 Ga0495620_0223795
2272 Ga0495628_0004775
2273 Ga0495628_0012392
2274 Ga0495628_0293983
2275 Ga0495628_0534353
2276 Ga0495630_0089968
2277 Ga0495630_0165138
2278 Ga0495630_0234434
2279 Ga0495630_0625591
2280 Ga0495630_1473019
2281 Ga0495631_0263974
2282 Ga0495632_0153882
2283 Ga0495643_0002222
2284 Ga0495643_0112244
2285 Ga0495644_0354065
2286 Ga0495666_0001455
2287 Ga0495666_0348703
2288 Ga0495652_0000214
2289 Ga0495652_0091389
2290 Ga0495652_0119109
2291 Ga0495652_0227458
2292 Ga0495652_0838563
2293 Ga0495665_0006386
2294 Ga0495640_0010020
2295 Ga0495640_0261979
2296 Ga0495640_0561378
2297 Ga0495586_0023992
2298 Ga0495586_0041211
2299 Ga0495586_0432525
2300 Ga0495587_0000108
2301 Ga0495587_0001699
2302 Ga0495587_0054325
2303 Ga0495587_0109572
2304 Ga0495587_0367198
2305 Ga0495645_0018186
2306 Ga0495645_0020886
2307 Ga0495645_0024352
2308 Ga0495622_0036785
2309 Ga0495622_0059627
2310 Ga0495622_0138961
2311 Ga0495633_0049233
2312 Ga0495633_0182350
2313 Ga0495667_0000102
2314 Ga0495667_0015573
2315 Ga0495667_0103249
2316 Ga0495667_0331498
2317 Ga0495667_0420163
2318 Ga0495668_0077855
2319 Ga0495668_0779846
2320 Ga0495634_0006236
2321 Ga0495634_0033911
2322 Ga0495634_0293570
2323 Ga0495611_0017340
2324 Ga0495611_0100048
2325 Ga0495625_0240681
2326 Ga0495625_0262017
2327 Ga0495625_0452801
2328 Ga0495625_0542218
2329 Ga0495635_0010746
2330 Ga0495635_0016801
2331 Ga0495635_0189769
2332 Ga0495635_0206992
2333 Ga0495635_0693138
2334 Ga0495659_0154112
2335 Ga0495659_0495150
2336 Ga0495661_0107450
2337 Ga0495661_0232433
2338 Ga0495588_0004867
2339 Ga0495588_0026459
2340 Ga0495588_0081666
2341 Ga0495588_0190818
2342 Ga0495657_0000311
2343 Ga0495657_0019707
2344 Ga0495657_0020748
2345 Ga0495657_0052100
2346 Ga0495657_0268029
2347 Ga0495657_0407496
2348 Ga0495657_0472542
2349 Ga0495599_0000275
2350 Ga0495599_0085201
2351 Ga0495599_0345462
2352 Ga0495623_0000402
2353 Ga0495623_0008769
2354 Ga0495623_0060775
2355 Ga0495623_0186627
2356 Ga0495646_0003307
2357 Ga0495646_0098581
2358 Ga0495646_0710755
2359 Ga0495647_0397078
2360 Ga0495658_0021173
2361 Ga0495658_0500522
2362 Ga0495658_0689341
2363 Ga0495658_0808887
2364 Ga0495658_0932510
2365 Ga0495613_0009048
2366 Ga0495613_0014208
2367 Ga0495613_0015649
2368 Ga0495613_0031316
2369 Ga0495613_0170093
2370 Ga0495624_0232197
2371 Ga0495624_0440124
2372 Ga0495624_0479688
2373 Ga0495670_0012480
2374 Ga0495670_0093453
2375 Ga0495670_0353959
2376 Ga0495671_0053869
2377 Ga0495671_0588381
2378 Ga0495649_0070376
2379 Ga0495589_0068205
2380 Ga0495589_0119156
2381 Ga0495589_0153168
2382 Ga0495600_0003580
2383 Ga0495600_0073250
2384 Ga0495600_0363296
2385 Ga0495581_0005940
2386 Ga0495581_0067418
2387 Ga0495581_0228096
2388 Ga0495581_0270327
2389 Ga0495581_0673311
2390 Ga0495604_0000096
2391 Ga0495604_0001196
2392 Ga0495604_0009065
2393 Ga0495604_0877884
2394 Ga0495636_0024578
2395 Ga0495636_0045821
2396 Ga0495636_0155688
2397 Ga0495636_0330006
2398 Ga0495674_0073641
2399 Ga0495674_0396783
2400 Ga0495674_1164456
2401 Ga0495676_0000524
2402 Ga0495676_0008425
2403 Ga0495676_0115209
2404 Ga0495680_0000493
2405 Ga0495680_0024349
2406 Ga0495680_0309881
2407 Ga0495680_0453274
2408 Ga0495683_0078158
2409 Ga0495683_0090593
2410 Ga0495683_0091728
2411 Ga0495687_015717
2412 Ga0495687_080483
2413 Ga0495675_0001039
2414 Ga0495675_0014932
2415 Ga0495675_0018548
2416 Ga0495675_0045858
2417 Ga0495675_0296713
2418 Ga0495675_0579498
2419 Ga0495677_0144201
2420 Ga0495685_001204
2421 Ga0495685_005170
2422 Ga0495685_024300
2423 Ga0495685_076711
2424 Ga0495681_0004935
2425 Ga0495681_0023963
2426 Ga0495681_0124153
2427 Ga0495681_0213813
2428 Ga0495684_0045075
2429 Ga0495684_0061846
2430 Ga0495684_0096557
2431 Ga0495686_0074343
2432 Ga0495686_0185450
2433 Ga0495686_0333011
2434 Ga0495593_0001104
2435 Ga0495593_0175616
2436 Ga0495593_0246614
2437 Ga0495593_0277537
2438 Ga0495602_0000165
2439 Ga0495602_0017258
2440 Ga0495602_0094547
2441 Ga0495602_0144585
2442 Ga0495602_0425283
2443 Ga0495602_0463026
2444 Ga0495614_0000236
2445 Ga0495614_0071552
2446 Ga0495614_0106387
2447 Ga0495614_0173557
2448 Ga0496100_0002555
2449 Ga0496100_0115098
2450 Ga0496100_0326600
2451 Ga0496100_0876821
2452 Ga0496100_1538416
2453 Ga0496101_0030183
2454 Ga0496101_0170148
2455 Ga0496101_0192395
2456 Ga0496102_0000222
2457 Ga0496102_0027914
2458 Ga0496102_0170447
2459 Ga0496103_0000179
2460 Ga0496103_0021797
2461 Ga0496104_0077464
2462 Ga0496104_0179122
2463 Ga0496104_0217429
2464 Ga0496104_0247756
2465 Ga0496104_0453921
2466 Ga0496104_0819369
2467 Ga0496105_0040289
2468 Ga0496105_0055044
2469 Ga0496105_0236184
2470 Ga0496105_0345550
2471 Ga0496105_0814976
2472 Ga0496106_0190924
2473 Ga0496106_0331240
2474 Ga0496106_0473192
2475 Ga0496107_0144454
2476 Ga0496107_0270229
2477 Ga0496107_0302108
2478 Ga0496108_0028685
2479 Ga0496108_0086688
2480 Ga0496108_0274069
2481 Ga0496108_0339622
2482 Ga0496108_0509882
2483 Ga0496108_0619380
2484 Ga0496108_0948933
2485 Ga0496108_1206675
2486 Ga0496108_1787838
2487 Ga0496109_0073164
2488 Ga0496109_0224389
2489 Ga0496109_0246883
2490 Ga0496109_1692959
2491 Ga0496110_0057914
2492 Ga0496110_0062978
2493 Ga0496110_0225945
2494 Ga0496110_0396979
2495 Ga0496110_0529913
2496 Ga0496110_0669031
2497 Ga0496111_0147266
2498 Ga0496111_0178303
2499 Ga0496112_0647208
2500 Ga0496112_0966670
2501 Ga0496113_0294154
2502 Ga0496114_0111481
2503 Ga0496114_0142574
2504 Ga0496114_0194222
2505 Ga0496114_0325661
2506 Ga0496114_0614621
2507 Ga0496115_0130815
2508 Ga0496116_0000481
2509 Ga0496117_0000242
2510 Ga0496117_0103679
2511 Ga0496118_0000412
2512 Ga0496119_0013023
2513 Ga0496119_0142549
2514 Ga0496119_0418925
2515 Ga0496120_0003152
2516 Ga0496120_0086969
2517 Ga0496121_0002113
2518 Ga0496121_0029846
2519 Ga0496121_0196381
2520 Ga0496122_0107771
2521 Ga0496122_0249366
2522 Ga0496124_0028247
2523 Ga0496125_0000061
2524 Ga0496125_0077747
2525 Ga0496125_0136947
2526 Ga0496126_0000521
2527 Ga0496126_0048031
2528 Ga0496126_0213496
2529 Ga0496126_0280302
2530 Ga0496126_0551673
2531 Ga0501306_003481
2532 Ga0501306_004717
2533 Ga0501306_007377
2534 Ga0501306_019156
2535 Ga0501308_009812
2536 Ga0501308_032658
2537 Ga0501310_011119
2538 Ga0501310_019890
2539 Ga0501305_076720
2540 Ga0501307_021176
2541 Ga0501311_039962
2542 Ga0501311_047315
2543 Ga0501311_103100
2544 Ga0501312_014058
2545 Ga0501313_011492
2546 Ga0501313_017741
2547 Ga0501314_009432
2548 Ga0501314_010761
2549 Ga0501314_012777
2550 Ga0501315_012238
2551 Ga0501315_025006
2552 Ga0501315_088999
2553 Ga0501316_007869
2554 Ga0501316_014305
2555 Ga0501316_023088
2556 Ga0501316_037117
2557 Ga0501316_041856
2558 Ga0501317_016309
2559 Ga0501317_018583
2560 Ga0501317_020344
2561 Ga0501317_022356
2562 Ga0501317_047918
2563 Ga0501317_049729
2564 Ga0501318_004377
2565 Ga0501318_019704
2566 Ga0501318_061921
2567 Ga0501318_091233
2568 Ga0501319_001694
2569 Ga0501320_007687
2570 Ga0501320_022575
2571 Ga0501321_003292
2572 Ga0501321_018131
2573 Ga0501321_035687
2574 Ga0501322_006261
2575 Ga0501322_010435
2576 Ga0501323_001352
2577 Ga0501323_014500
2578 Ga0501323_042315
2579 Ga0501323_054099
2580 Ga0501323_072793
2581 Ga0501324_004031
2582 Ga0501324_026659
2583 Ga0501324_029688
2584 Ga0501031_0002886
2585 Ga0501031_0007255
2586 Ga0501031_0379675
2587 Ga0501031_0596730
2588 Ga0501031_0667215
2589 Ga0501032_0050350
2590 Ga0501032_0443877
2591 Ga0501033_0029364
2592 Ga0501033_0046139
2593 Ga0501033_0108642
2594 Ga0501033_0131000
2595 Ga0501033_0139669
2596 Ga0501034_0001747
2597 Ga0501034_0011927
2598 Ga0501034_0082768
2599 Ga0501034_0091917
2600 Ga0501034_0102271
2601 Ga0501034_0105403
2602 Ga0501034_0135486
2603 Ga0501034_0444686
2604 Ga0501034_1172366
2605 Ga0501036_0001851
2606 Ga0501036_0002873
2607 Ga0501036_0018651
2608 Ga0501036_0223089
2609 Ga0501036_0270428
2610 Ga0501036_0446097
2611 Ga0501036_0750423
2612 Ga0501037_0030371
2613 Ga0501037_0933710
2614 Ga0501038_0005037
2615 Ga0501038_0023851
2616 Ga0501038_0084137
2617 Ga0501038_0280743
2618 Ga0501038_0656036
2619 Ga0501038_0694193
2620 Ga0501039_0017759
2621 Ga0501039_0045595
2622 Ga0501039_0082165
2623 Ga0501039_0138273
2624 Ga0501039_0351309
2625 Ga0501039_0626837
2626 Ga0501039_1392292
2627 Ga0501040_0027714
2628 Ga0501040_0404015
2629 Ga0501040_0753992
2630 Ga0501040_0767513
2631 Ga0501040_0860560
2632 Ga0501041_0002007
2633 Ga0501041_0014490
2634 Ga0501042_0010139
2635 Ga0501042_0015522
2636 Ga0501042_1378547
2637 Ga0501043_0008372
2638 Ga0501043_0008818
2639 Ga0501043_0118648
2640 Ga0501043_0542723
2641 Ga0501043_0593942
2642 Ga0501043_0648231
2643 Ga0501046_0187191
2644 Ga0501046_0438930
2645 Ga0501046_1164076
2646 Ga0501047_0050497
2647 Ga0501047_0108025
2648 Ga0501047_0794727
2649 Ga0501047_0803568
2650 Ga0501048_0025883
2651 Ga0501048_0266912
2652 Ga0501048_0317278
2653 Ga0501067_0840002
2654 Ga0501068_0435871
2655 Ga0501068_0523927
2656 Ga0501069_0318676
2657 Ga0501070_0002423
2658 Ga0501070_0004597
2659 Ga0501070_0013006
2660 Ga0501070_0048446
2661 Ga0501070_0469133
2662 Ga0501070_0470881
2663 Ga0501071_0022953
2664 Ga0501071_0355265
2665 Ga0501071_1237690
2666 Ga0501071_1337610
2667 Ga0501072_0012315
2668 Ga0501072_0031891
2669 Ga0501072_0094423
2670 Ga0501072_1027692
2671 Ga0501072_1383401
2672 Ga0501073_0440627
2673 Ga0501073_0660761
2674 Ga0501074_0018631
2675 Ga0501074_0030737
2676 Ga0501074_0077707
2677 Ga0501074_0628546
2678 Ga0501074_0903776
2679 Ga0501075_0035364
2680 Ga0501075_0085048
2681 Ga0501075_0355200
2682 Ga0501075_1092788
2683 Ga0501076_0022853
2684 Ga0501076_0257966
2685 Ga0501076_0567965
2686 Ga0501077_0010298
2687 Ga0501077_0117775
2688 Ga0501077_0728607
2689 Ga0501202_085562
2690 Ga0501235_197576
2691 Ga0501250_008668
2692 Ga0501079_0016088
2693 Ga0501079_0089420
2694 Ga0501079_0123914
2695 Ga0501080_0000238
2696 Ga0501080_1311609
2697 Ga0501081_0121714
2698 Ga0501081_0951353
2699 Ga0501083_0024234
2700 Ga0501083_0523499
2701 Ga0501083_1048680
2702 Ga0501035_0028585
2703 Ga0501035_0036349
2704 Ga0501035_0153957
2705 Ga0501035_0163161
2706 Ga0501035_0223604
2707 Ga0501044_0004971
2708 Ga0501044_0070782
2709 Ga0501044_0337997
2710 Ga0501044_0350648
2711 Ga0501044_1664640
2712 Ga0501045_0009086
2713 Ga0501045_0431279
2714 Ga0501045_0567744
2715 Ga0501045_1273252
2716 nmdc:mga00v17_390973_c1
2717 nmdc:mga00v17_46398_c1
2718 nmdc:mga00v17_675260_c1
2719 nmdc:mga0k408_246709_c1
2720 nmdc:mga06z11_395137_c1
2721 nmdc:mga07m45_58181_c1
2722 nmdc:mga05p37_169332_c1
2723 nmdc:mga09592_1481933_c1
2724 nmdc:mga09592_437295_c1
2725 nmdc:mga09592_928045_c1
2726 nmdc:mga0qj67_125626_c1
2727 nmdc:mga06r32_1880485_c1
2728 nmdc:mga08y16_101565_c1
2729 nmdc:mga08y16_931049_c1
2730 nmdc:mga0n895_1716841_c1
2731 nmdc:mga0n895_203634_c1
2732 nmdc:mga0n895_718113_c1
2733 nmdc:mga0rr50_355518_c1
2734 nmdc:mga0rr50_612521_c1
2735 nmdc:mga08x19_1283812_c1
2736 nmdc:mga08x19_64295_c1
2737 nmdc:mga0a205_773109_c1
2738 Ga0495601_0003320
2739 Ga0495601_0225476
2740 Ga0495612_0409133
2741 Ga0500610_0189401
2742 Ga0500610_0321821
2743 Ga0495595_0009659
2744 Ga0495619_0014438
2745 Ga0495619_0309462
2746 Ga0500578_0240734
2747 Ga0500647_0169633
2748 Ga0500651_0442372
2749 Ga0500566_0119331
2750 Ga0500640_004289
2751 Ga0500641_0247538
2752 Ga0500654_095403
2753 Ga0500660_068299
2754 Ga0500553_028044
2755 Ga0500556_0149048
2756 Ga0500558_073283
2757 Ga0500560_018179
2758 Ga0500560_166228
2759 Ga0500562_030237
2760 Ga0500569_033214
2761 Ga0500572_022923
2762 Ga0500580_130025
2763 Ga0500594_0096106
2764 Ga0500608_119833
2765 Ga0500614_080259
2766 Ga0500614_283914
2767 Ga0500621_139679
2768 Ga0500626_219092
2769 Ga0500628_001255
2770 Ga0500652_106897
2771 Ga0500652_109803
2772 Ga0500561_0001756
2773 Ga0500568_0000049
2774 Ga0500573_0028858
2775 Ga0500573_0157639
2776 Ga0500577_0251950
2777 Ga0500600_0022039
2778 Ga0500600_0100363
2779 Ga0500600_0108148
2780 Ga0500600_0243487
2781 Ga0500603_311121
2782 Ga0500606_076038
2783 Ga0500616_0016342
2784 Ga0500616_0233930
2785 Ga0500624_004973
2786 Ga0500633_0001249
2787 Ga0500634_0038179
2788 Ga0500634_0144793
2789 Ga0500636_0108019
2790 Ga0500636_0285216
2791 Ga0500656_001023
2792 Ga0500565_028798
2793 Ga0500599_042318
2794 Ga0500587_002326
2795 Ga0501084_0020366
2796 Ga0501084_0047023
2797 Ga0501084_0054198
2798 Ga0501084_0765018
2799 Ga0501084_1672081
2800 Ga0590075_040684
2801 Ga0587084_000250
2802 Ga0587084_066492
2803 Ga0587070_034175
2804 Ga0587070_054780
2805 Ga0587070_066060
2806 Ga0587073_0162089
2807 Ga0587077_063671
2808 Ga0587080_134810
2809 Ga0587082_029095
2810 Ga0587082_088004
2811 Ga0587083_0048243
2812 Ga0587083_0081280
2813 Ga0587083_0126898
2814 Ga0587085_166781
2815 Ga0587088_012792
2816 Ga0587089_025749
2817 Ga0587090_044955
2818 Ga0587090_069641
2819 Ga0587092_014110
2820 Ga0587094_023924
2821 Ga0587095_007745
2822 Ga0587097_01558
2823 Ga0587098_015815
2824 Ga0587106_004245
2825 Ga0587106_007117
2826 Ga0587125_000712
2827 Ga0587125_048344
2828 Ga0587129_010268
2829 Ga0587101_000194
2830 Ga0587109_052908
2831 Ga0587115_022267
2832 Ga0587115_070533
2833 Ga0587117_024663
2834 Ga0587122_011989
2835 Ga0587122_013227
2836 Ga0587122_014879
2837 Ga0587122_016780
2838 Ga0587127_006681
2839 Ga0587128_015239
2840 Ga0587128_020510
2841 Ga0587128_071743
2842 Ga0587128_122781
2843 Ga0587130_017017
2844 Ga0587062_102325
2845 Ga0587069_031819
2846 Ga0587069_034852
2847 Ga0587075_024646
2848 Ga0587076_172660
2849 Ga0587078_044951
2850 Ga0587078_070099
2851 Ga0587100_000585
2852 Ga0587105_008756
2853 Ga0587105_019286
2854 Ga0587105_032997
2855 Ga0587107_087875
2856 Ga0587110_026077
2857 Ga0587114_046082
2858 Ga0587114_066732
2859 Ga0587119_011068
2860 Ga0587119_055512
2861 Ga0587120_011474
2862 Ga0587124_006138
2863 Ga0587124_042228
2864 Ga0587111_0006112
2865 Ga0587111_0059990
2866 Ga0587111_0093223
2867 Ga0587111_0134420
2868 Ga0501082_0104865
2869 Ga0501082_0132745
2870 Ga0501082_1884131
2871 Ga0466962_0003148
2872 Ga0466962_0035513
2873 Ga0466962_0057532
2874 Ga0466962_0116763
2875 Ga0466962_0375414
2876 Ga0466962_0530393
2877 Ga0530510_0013846
2878 Ga0530510_0092387
2879 Ga0530510_0212890
2880 2517763569
2881 2842891711
2882 2956941863
2883 3001119220
2884 3001891064
2885 8002792314
2886 8016257469

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

80

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.9147 23 84
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9102 20 82
6ywy-assembly1.cif.gz_R the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.9091 19 82
6yws-assembly1.cif.gz_R the structure of the large subunit of the mitoribosome from neurospora crassa 0.9071 19 82
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9066 20 82
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9102 20 82 2.40.50.100
af_C0Z3L6_20_123_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8694 22 85 2.40.50.100
af_Q4DLT4_19_136_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8643 23 83 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8587 20 82 2.40.50.100
af_Q9U0I4_44_103_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8436 28 85 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7K1D6X7-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9773 29 84 GO:0003735
GO:0006412
GO:0022625
AF-I4M014-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9772 27 83 GO:0003735
GO:0006412
GO:0022625
AF-I0R0V1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9721 23 82 GO:0003735
GO:0006412
GO:0022625
AF-W4UE80-F1-model_v4 deleted 0.9646 23 85
AF-I4M014-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9607 27 83 GO:0003735
GO:0006412
GO:0022625

Map