F494001
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1443 | 637 | 2886 | 86 |
Family's Representative Sequence
| Representative Sequence | 3300005549|Ga0070704_101788189|Ga0070704_1017881891 |
| Length | 101 |
| Sequence | MAHKKGASSTRNGRDSNAQYLGVKRFGGQAVNAGEILVRQRGTHFHPGDGVGRGGDDTLFALVAGHVEFGRRRGRRVVNVTPTASEAASNSSEPAEATSAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300003160 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003284 | Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_16 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 22 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 28 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 29 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 30 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 124 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 125 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 126 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 127 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 128 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 129 | 3300013043 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300013044 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 150 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 157 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 158 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 233 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 235 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 236 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 238 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 240 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 241 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 245 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 246 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 248 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 249 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 250 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 251 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 253 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 254 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 255 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 256 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 257 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 258 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 259 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 260 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 261 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 262 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 263 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 264 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 265 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 266 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 267 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 268 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 269 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 270 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 271 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 272 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 273 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 274 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 275 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 276 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 278 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 279 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 283 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 284 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 285 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 286 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 287 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 288 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 291 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 292 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 293 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 294 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 295 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 296 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 297 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 298 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 300 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 301 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 302 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 303 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 304 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 305 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 306 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 307 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 308 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 309 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 310 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 311 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 312 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 313 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 314 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 318 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 322 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 323 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 324 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 325 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 326 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 327 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 328 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 329 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 330 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 331 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 332 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 333 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 334 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 335 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 336 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 337 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 338 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 339 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 340 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 341 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 342 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 343 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 344 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 345 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 346 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 347 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 348 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 349 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 350 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 351 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 352 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 353 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 354 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 355 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 356 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 357 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 358 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 359 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 360 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 361 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 362 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 363 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 364 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 365 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 366 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 367 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 368 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 369 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 370 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 448 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 449 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 450 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 451 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 452 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 453 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 454 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 455 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 456 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 457 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 458 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 459 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 460 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 461 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 462 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 463 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 464 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 465 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 466 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 467 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 468 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 469 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 470 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 471 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 472 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 473 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 508 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 515 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 516 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 518 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 519 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 520 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 521 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 525 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 527 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 528 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 529 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 530 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 531 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 532 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 533 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 534 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 535 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 536 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 537 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 538 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 539 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 540 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 544 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 547 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 548 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 549 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 550 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 551 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 552 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 553 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 554 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 555 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 556 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 557 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 558 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 559 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 560 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 561 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 562 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 563 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 564 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 565 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 566 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 567 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 568 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 569 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 570 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 571 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 572 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 573 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 574 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 575 | 3300053152 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere | Metagenome | Endosphere |
| 576 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 577 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 578 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 579 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 580 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 581 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 582 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 583 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 584 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 585 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 586 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 587 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 588 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 589 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 590 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 591 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 592 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 593 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 594 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 595 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 596 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 597 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 598 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 599 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 600 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 601 | 3300059603 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 602 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 603 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 604 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 605 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 606 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 607 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 608 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 609 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 610 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 611 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 612 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 613 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 614 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 615 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 616 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 617 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 618 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 619 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 620 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 621 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 622 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 623 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 624 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 625 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 626 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 627 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 628 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 629 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 630 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 631 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 632 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 633 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 634 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 635 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 636 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 637 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.06 |
| Metatranscriptomes | 15.45 |
| Isolates | 0.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.99 |
| Nodule | 0.28 |
| Rhizoplane | 5.13 |
| Rhizosphere | 84.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070704_101788189 | 3300005549 | Bacteria | 568 |
| 2 | LJQas_1014194 | 3300000549 | Bacteria | 935 |
| 3 | LJQas_1033148 | 3300000549 | Bacteria | 606 |
| 4 | JGI24740J21852_10073190 | 3300001979 | Bacteria | 913 |
| 5 | JGI24740J21852_10093328 | 3300001979 | Bacteria | 774 |
| 6 | JGI24739J22299_10068165 | 3300001989 | Bacteria | 1111 |
| 7 | JGI24737J22298_10015151 | 3300001990 | Bacteria | 2496 |
| 8 | JGI24735J21928_10055434 | 3300002067 | Bacteria | 1142 |
| 9 | JGI24738J21930_10014762 | 3300002075 | Bacteria | 1671 |
| 10 | Ga0006779J45831_101096 | 3300003160 | Bacteria | 793 |
| 11 | Ga0006778J45830_1019160 | 3300003162 | Bacteria | 827 |
| 12 | Ga0006773J48901_12202 | 3300003284 | Bacteria | 780 |
| 13 | Ga0006770J48903_1012779 | 3300003305 | Bacteria | 726 |
| 14 | Ga0006777J48905_1032659 | 3300003308 | Bacteria | 832 |
| 15 | rootL2_10032547 | 3300003322 | Bacteria | 2145 |
| 16 | JGI25160J50197_1043295 | 3300003354 | Bacteria | 1015 |
| 17 | Ga0007427J51700_100683 | 3300003559 | Bacteria | 2769 |
| 18 | Ga0006781J51513_1001670 | 3300003568 | Bacteria | 2451 |
| 19 | Ga0007410J51695_1035599 | 3300003574 | Bacteria | 638 |
| 20 | Ga0007416J51690_1037339 | 3300003577 | Bacteria | 660 |
| 21 | Ga0006562J51391_1011694 | 3300003578 | Bacteria | 638 |
| 22 | Ga0006562J51391_1176296 | 3300003578 | Bacteria | 1490 |
| 23 | Ga0007429J51699_1009559 | 3300003579 | Bacteria | 1136 |
| 24 | JGI25404J52841_10002732 | 3300003659 | Bacteria | 3385 |
| 25 | Ga0032354_1025483 | 3300003693 | Bacteria | 1074 |
| 26 | Ga0006780_1012767 | 3300003735 | Bacteria | 5668 |
| 27 | Ga0055527_1000001 | 3300003760 | Bacteria | 850044 |
| 28 | Ga0055529_1000065 | 3300003763 | Bacteria | 173112 |
| 29 | JGI25405J52794_10008681 | 3300003911 | Bacteria | 1904 |
| 30 | Ga0058863_11676597 | 3300004799 | Bacteria | 775 |
| 31 | Ga0058863_11874610 | 3300004799 | Bacteria | 691 |
| 32 | Ga0058863_11935272 | 3300004799 | Bacteria | 655 |
| 33 | Ga0058861_10049278 | 3300004800 | Bacteria | 547 |
| 34 | Ga0058860_10003778 | 3300004801 | Bacteria | 772 |
| 35 | Ga0058862_10078798 | 3300004803 | Bacteria | 805 |
| 36 | Ga0058862_10118426 | 3300004803 | Bacteria | 739 |
| 37 | Ga0070658_10000092 | 3300005327 | Bacteria | 81151 |
| 38 | Ga0070658_10002776 | 3300005327 | Bacteria | 14551 |
| 39 | Ga0070658_10205552 | 3300005327 | Bacteria | 1663 |
| 40 | Ga0070658_10470811 | 3300005327 | Bacteria | 1084 |
| 41 | Ga0070658_11562738 | 3300005327 | Bacteria | 572 |
| 42 | Ga0070683_100100946 | 3300005329 | Bacteria | 2717 |
| 43 | Ga0070683_100515091 | 3300005329 | Bacteria | 1143 |
| 44 | Ga0070683_100592340 | 3300005329 | Bacteria | 1061 |
| 45 | Ga0070683_100667241 | 3300005329 | Bacteria | 996 |
| 46 | Ga0070683_100871583 | 3300005329 | Bacteria | 863 |
| 47 | Ga0070683_101476081 | 3300005329 | Bacteria | 654 |
| 48 | Ga0070690_101627338 | 3300005330 | Bacteria | 524 |
| 49 | Ga0068869_100265062 | 3300005334 | Bacteria | 1376 |
| 50 | Ga0070680_100000403 | 3300005336 | Bacteria | 29539 |
| 51 | Ga0070680_100211817 | 3300005336 | Bacteria | 1635 |
| 52 | Ga0070682_100167871 | 3300005337 | Bacteria | 1522 |
| 53 | Ga0070682_100305834 | 3300005337 | Bacteria | 1169 |
| 54 | Ga0070682_100376963 | 3300005337 | Bacteria | 1066 |
| 55 | Ga0070682_100661753 | 3300005337 | Bacteria | 833 |
| 56 | Ga0070682_100723148 | 3300005337 | Bacteria | 801 |
| 57 | Ga0070682_100903230 | 3300005337 | Bacteria | 726 |
| 58 | Ga0068868_100471448 | 3300005338 | Bacteria | 1095 |
| 59 | Ga0068868_100606395 | 3300005338 | Bacteria | 970 |
| 60 | Ga0070660_100308392 | 3300005339 | Bacteria | 1298 |
| 61 | Ga0070689_102080247 | 3300005340 | Bacteria | 520 |
| 62 | Ga0070691_10987020 | 3300005341 | Bacteria | 525 |
| 63 | Ga0070687_100092980 | 3300005343 | Bacteria | 1672 |
| 64 | Ga0070692_10369427 | 3300005345 | Bacteria | 897 |
| 65 | Ga0070668_100314078 | 3300005347 | Bacteria | 1318 |
| 66 | Ga0070668_100726423 | 3300005347 | Bacteria | 877 |
| 67 | Ga0070675_100190511 | 3300005354 | Bacteria | 1777 |
| 68 | Ga0070675_101435953 | 3300005354 | Bacteria | 636 |
| 69 | Ga0070671_100002585 | 3300005355 | Bacteria | 14021 |
| 70 | Ga0070674_100186377 | 3300005356 | Bacteria | 1593 |
| 71 | Ga0070674_100895236 | 3300005356 | Bacteria | 773 |
| 72 | Ga0070667_100164713 | 3300005367 | Bacteria | 1955 |
| 73 | Ga0070709_10355995 | 3300005434 | Bacteria | 1083 |
| 74 | Ga0070714_100001465 | 3300005435 | Bacteria | 17196 |
| 75 | Ga0070714_100905124 | 3300005435 | Bacteria | 857 |
| 76 | Ga0070714_102136128 | 3300005435 | Bacteria | 545 |
| 77 | Ga0070713_100184035 | 3300005436 | Bacteria | 1879 |
| 78 | Ga0070710_10266242 | 3300005437 | Bacteria | 1107 |
| 79 | Ga0070711_100111244 | 3300005439 | Bacteria | 2011 |
| 80 | Ga0070700_100586016 | 3300005441 | Bacteria | 872 |
| 81 | Ga0070694_100770397 | 3300005444 | Bacteria | 787 |
| 82 | Ga0070663_100184012 | 3300005455 | Bacteria | 1622 |
| 83 | Ga0070663_100500907 | 3300005455 | Bacteria | 1008 |
| 84 | Ga0070663_100604636 | 3300005455 | Bacteria | 923 |
| 85 | Ga0070678_100568466 | 3300005456 | Bacteria | 1008 |
| 86 | Ga0070678_100936525 | 3300005456 | Bacteria | 793 |
| 87 | Ga0070678_102121013 | 3300005456 | Bacteria | 533 |
| 88 | Ga0070662_100853253 | 3300005457 | Bacteria | 776 |
| 89 | Ga0070681_10018417 | 3300005458 | Bacteria | 6979 |
| 90 | Ga0070681_10032811 | 3300005458 | Bacteria | 5213 |
| 91 | Ga0068867_101495604 | 3300005459 | Bacteria | 629 |
| 92 | Ga0070685_10172560 | 3300005466 | Bacteria | 1387 |
| 93 | Ga0070685_10275792 | 3300005466 | Bacteria | 1124 |
| 94 | Ga0070698_100050203 | 3300005471 | Bacteria | 4254 |
| 95 | Ga0070698_100816766 | 3300005471 | Bacteria | 877 |
| 96 | Ga0070679_100000591 | 3300005530 | Bacteria | 30747 |
| 97 | Ga0070679_100003323 | 3300005530 | Bacteria | 14728 |
| 98 | Ga0070679_100943019 | 3300005530 | Bacteria | 807 |
| 99 | Ga0070684_100266548 | 3300005535 | Bacteria | 1567 |
| 100 | Ga0070684_100644801 | 3300005535 | Bacteria | 986 |
| 101 | Ga0068853_100091750 | 3300005539 | Bacteria | 2672 |
| 102 | Ga0070672_100261184 | 3300005543 | Bacteria | 1460 |
| 103 | Ga0070686_100782642 | 3300005544 | Bacteria | 768 |
| 104 | Ga0070693_100309508 | 3300005547 | Bacteria | 1068 |
| 105 | Ga0070665_100005910 | 3300005548 | Bacteria | 12537 |
| 106 | Ga0070665_100963511 | 3300005548 | Bacteria | 865 |
| 107 | Ga0070665_101117060 | 3300005548 | Bacteria | 800 |
| 108 | Ga0068855_100805807 | 3300005563 | Bacteria | 998 |
| 109 | Ga0068855_100941078 | 3300005563 | Bacteria | 911 |
| 110 | Ga0068855_101468847 | 3300005563 | Bacteria | 701 |
| 111 | Ga0068855_101637704 | 3300005563 | Bacteria | 658 |
| 112 | Ga0070664_100161857 | 3300005564 | Bacteria | 1980 |
| 113 | Ga0070664_100716853 | 3300005564 | Bacteria | 933 |
| 114 | Ga0068857_100213364 | 3300005577 | Bacteria | 1762 |
| 115 | Ga0068857_100215916 | 3300005577 | Bacteria | 1751 |
| 116 | Ga0068857_101956741 | 3300005577 | Bacteria | 575 |
| 117 | Ga0068854_100488666 | 3300005578 | Bacteria | 1035 |
| 118 | Ga0068856_101071637 | 3300005614 | Bacteria | 824 |
| 119 | Ga0068856_101084728 | 3300005614 | Bacteria | 818 |
| 120 | Ga0068856_101446489 | 3300005614 | Bacteria | 701 |
| 121 | Ga0070702_100261013 | 3300005615 | Bacteria | 1179 |
| 122 | Ga0068852_100267376 | 3300005616 | Bacteria | 1644 |
| 123 | Ga0068852_100308948 | 3300005616 | Bacteria | 1532 |
| 124 | Ga0068852_100802122 | 3300005616 | Bacteria | 956 |
| 125 | Ga0068852_100931236 | 3300005616 | Bacteria | 887 |
| 126 | Ga0068859_100385328 | 3300005617 | Bacteria | 1497 |
| 127 | Ga0068859_100981114 | 3300005617 | Bacteria | 927 |
| 128 | Ga0068859_102212824 | 3300005617 | Bacteria | 607 |
| 129 | Ga0068866_11326965 | 3300005718 | Bacteria | 523 |
| 130 | Ga0068861_100330214 | 3300005719 | Bacteria | 1331 |
| 131 | Ga0068861_100722345 | 3300005719 | Bacteria | 928 |
| 132 | Ga0068851_10343743 | 3300005834 | Bacteria | 866 |
| 133 | Ga0068870_10216843 | 3300005840 | Bacteria | 1169 |
| 134 | Ga0068870_10586055 | 3300005840 | Bacteria | 756 |
| 135 | Ga0068863_100002283 | 3300005841 | Bacteria | 19063 |
| 136 | Ga0068863_101244520 | 3300005841 | Bacteria | 750 |
| 137 | Ga0068860_100041221 | 3300005843 | Bacteria | 4410 |
| 138 | Ga0068860_100560823 | 3300005843 | Bacteria | 1145 |
| 139 | Ga0068862_100386362 | 3300005844 | Bacteria | 1307 |
| 140 | Ga0068862_100686570 | 3300005844 | Bacteria | 991 |
| 141 | Ga0081455_10001106 | 3300005937 | Bacteria | 33914 |
| 142 | Ga0081455_10930696 | 3300005937 | Bacteria | 540 |
| 143 | Ga0081538_10275024 | 3300005981 | Bacteria | 628 |
| 144 | Ga0081540_1000405 | 3300005983 | Bacteria | 42553 |
| 145 | Ga0081540_1002965 | 3300005983 | Bacteria | 13603 |
| 146 | Ga0070717_10054864 | 3300006028 | Bacteria | 3287 |
| 147 | Ga0070717_11369484 | 3300006028 | Bacteria | 643 |
| 148 | Ga0075363_100407546 | 3300006048 | Bacteria | 799 |
| 149 | Ga0075432_10041263 | 3300006058 | Bacteria | 1612 |
| 150 | Ga0070715_10318394 | 3300006163 | Bacteria | 839 |
| 151 | Ga0070712_100015788 | 3300006175 | Bacteria | 4869 |
| 152 | Ga0075370_10038886 | 3300006353 | Bacteria | 2678 |
| 153 | Ga0075370_10313016 | 3300006353 | Bacteria | 935 |
| 154 | Ga0075428_100026617 | 3300006844 | Bacteria | 6404 |
| 155 | Ga0075428_100107082 | 3300006844 | Bacteria | 3047 |
| 156 | Ga0075430_100250162 | 3300006846 | Bacteria | 1469 |
| 157 | Ga0075430_101739128 | 3300006846 | Bacteria | 512 |
| 158 | Ga0075431_100126596 | 3300006847 | Bacteria | 2636 |
| 159 | Ga0075433_10194652 | 3300006852 | Bacteria | 1803 |
| 160 | Ga0075433_11167486 | 3300006852 | Bacteria | 669 |
| 161 | Ga0075434_100526456 | 3300006871 | Bacteria | 1202 |
| 162 | Ga0075434_101401699 | 3300006871 | Bacteria | 709 |
| 163 | Ga0075429_100051179 | 3300006880 | Bacteria | 3594 |
| 164 | Ga0075429_100557017 | 3300006880 | Bacteria | 1005 |
| 165 | Ga0075429_101404488 | 3300006880 | Bacteria | 608 |
| 166 | Ga0068865_100413367 | 3300006881 | Bacteria | 1107 |
| 167 | Ga0075436_100071720 | 3300006914 | Bacteria | 2395 |
| 168 | Ga0097620_100385341 | 3300006931 | Bacteria | 1497 |
| 169 | Ga0097620_100981123 | 3300006931 | Bacteria | 927 |
| 170 | Ga0097620_102213027 | 3300006931 | Bacteria | 607 |
| 171 | Ga0099826_10070429 | 3300006948 | Bacteria | 2224 |
| 172 | Ga0075435_100084339 | 3300007076 | Bacteria | 2614 |
| 173 | Ga0099795_10175062 | 3300007788 | Bacteria | 893 |
| 174 | Ga0105251_10046141 | 3300009011 | Bacteria | 2098 |
| 175 | Ga0105251_10127611 | 3300009011 | Bacteria | 1154 |
| 176 | Ga0105244_10075453 | 3300009036 | Bacteria | 1675 |
| 177 | Ga0105250_10158816 | 3300009092 | Bacteria | 943 |
| 178 | Ga0105240_12053242 | 3300009093 | Bacteria | 594 |
| 179 | Ga0111539_10104076 | 3300009094 | Bacteria | 3331 |
| 180 | Ga0111539_10635837 | 3300009094 | Bacteria | 1242 |
| 181 | Ga0111539_12434729 | 3300009094 | Bacteria | 607 |
| 182 | Ga0105245_10022104 | 3300009098 | Bacteria | 5584 |
| 183 | Ga0105245_10441200 | 3300009098 | Bacteria | 1308 |
| 184 | Ga0105245_10647593 | 3300009098 | Bacteria | 1087 |
| 185 | Ga0105245_11469337 | 3300009098 | Bacteria | 732 |
| 186 | Ga0105247_10261583 | 3300009101 | Bacteria | 1186 |
| 187 | Ga0105247_10779596 | 3300009101 | Bacteria | 727 |
| 188 | Ga0114129_10110200 | 3300009147 | Bacteria | 3800 |
| 189 | Ga0114129_11052873 | 3300009147 | Bacteria | 1021 |
| 190 | Ga0105243_10015409 | 3300009148 | Bacteria | 5779 |
| 191 | Ga0105243_10198180 | 3300009148 | Bacteria | 1759 |
| 192 | Ga0105243_10466530 | 3300009148 | Bacteria | 1188 |
| 193 | Ga0105243_12509205 | 3300009148 | Bacteria | 555 |
| 194 | Ga0105243_13041843 | 3300009148 | Bacteria | 508 |
| 195 | Ga0105241_10779767 | 3300009174 | Bacteria | 879 |
| 196 | Ga0105242_10700149 | 3300009176 | Bacteria | 991 |
| 197 | Ga0105248_10048505 | 3300009177 | Bacteria | 4764 |
| 198 | Ga0105248_10996709 | 3300009177 | Bacteria | 946 |
| 199 | Ga0105248_11440999 | 3300009177 | Bacteria | 779 |
| 200 | Ga0105248_11753747 | 3300009177 | Bacteria | 704 |
| 201 | Ga0105237_10567703 | 3300009545 | Bacteria | 1141 |
| 202 | Ga0105237_10927228 | 3300009545 | Bacteria | 878 |
| 203 | Ga0105238_11473407 | 3300009551 | Bacteria | 709 |
| 204 | Ga0105238_11642336 | 3300009551 | Bacteria | 673 |
| 205 | Ga0105238_11718653 | 3300009551 | Bacteria | 659 |
| 206 | Ga0105238_12779377 | 3300009551 | Bacteria | 526 |
| 207 | Ga0105249_11626505 | 3300009553 | Bacteria | 718 |
| 208 | Ga0105249_11690895 | 3300009553 | Bacteria | 705 |
| 209 | Ga0105249_11839859 | 3300009553 | Bacteria | 678 |
| 210 | Ga0105249_13005227 | 3300009553 | Bacteria | 541 |
| 211 | Ga0105035_109087 | 3300009988 | Bacteria | 858 |
| 212 | Ga0105239_10399074 | 3300010375 | Bacteria | 1556 |
| 213 | Ga0105239_10564734 | 3300010375 | Bacteria | 1296 |
| 214 | Ga0105239_10918934 | 3300010375 | Bacteria | 1005 |
| 215 | Ga0105246_10121802 | 3300011119 | Bacteria | 1934 |
| 216 | Ga0105246_10516710 | 3300011119 | Bacteria | 1017 |
| 217 | Ga0105246_11114804 | 3300011119 | Bacteria | 721 |
| 218 | Ga0105246_11206286 | 3300011119 | Bacteria | 697 |
| 219 | Ga0105246_11689503 | 3300011119 | Bacteria | 601 |
| 220 | Ga0105246_12459318 | 3300011119 | Bacteria | 512 |
| 221 | Ga0157328_1010435 | 3300012478 | Bacteria | 643 |
| 222 | Ga0157318_1024565 | 3300012482 | Bacteria | 559 |
| 223 | Ga0157343_1006504 | 3300012488 | Bacteria | 790 |
| 224 | Ga0157345_1020668 | 3300012498 | Bacteria | 668 |
| 225 | Ga0157324_1017785 | 3300012506 | Bacteria | 691 |
| 226 | Ga0157338_1009093 | 3300012515 | Bacteria | 977 |
| 227 | Ga0154018_104492 | 3300013043 | Bacteria | 647 |
| 228 | Ga0154019_109330 | 3300013044 | Bacteria | 784 |
| 229 | Ga0154012_169153 | 3300013059 | Bacteria | 850 |
| 230 | Ga0154010_123501 | 3300013062 | Bacteria | 732 |
| 231 | Ga0154010_150777 | 3300013062 | Bacteria | 630 |
| 232 | Ga0157371_10798101 | 3300013102 | Bacteria | 711 |
| 233 | Ga0157369_10001098 | 3300013105 | Bacteria | 33862 |
| 234 | Ga0157369_10116316 | 3300013105 | Bacteria | 2840 |
| 235 | Ga0157369_10130572 | 3300013105 | Bacteria | 2663 |
| 236 | Ga0157369_10137927 | 3300013105 | Bacteria | 2581 |
| 237 | Ga0157369_10204676 | 3300013105 | Bacteria | 2070 |
| 238 | Ga0157369_10220252 | 3300013105 | Bacteria | 1987 |
| 239 | Ga0157369_10313236 | 3300013105 | Bacteria | 1632 |
| 240 | Ga0157369_10610401 | 3300013105 | Bacteria | 1126 |
| 241 | Ga0157374_11824123 | 3300013296 | Bacteria | 634 |
| 242 | Ga0157374_12494391 | 3300013296 | Bacteria | 544 |
| 243 | Ga0163162_10842289 | 3300013306 | Bacteria | 1033 |
| 244 | Ga0163162_11004345 | 3300013306 | Bacteria | 943 |
| 245 | Ga0157372_10130144 | 3300013307 | Bacteria | 2895 |
| 246 | Ga0157372_10130650 | 3300013307 | Bacteria | 2889 |
| 247 | Ga0157372_10375382 | 3300013307 | Bacteria | 1657 |
| 248 | Ga0157372_10380456 | 3300013307 | Bacteria | 1645 |
| 249 | Ga0157372_10461374 | 3300013307 | Bacteria | 1480 |
| 250 | Ga0157372_10514883 | 3300013307 | Bacteria | 1395 |
| 251 | Ga0157372_13110834 | 3300013307 | Bacteria | 530 |
| 252 | Ga0157375_10257655 | 3300013308 | Bacteria | 1906 |
| 253 | Ga0157375_10649606 | 3300013308 | Bacteria | 1211 |
| 254 | Ga0157375_10726443 | 3300013308 | Bacteria | 1146 |
| 255 | Ga0157375_11204296 | 3300013308 | Bacteria | 888 |
| 256 | Ga0157375_11464072 | 3300013308 | Bacteria | 805 |
| 257 | Ga0157375_12058734 | 3300013308 | Bacteria | 679 |
| 258 | Ga0163163_11298894 | 3300014325 | Bacteria | 790 |
| 259 | Ga0163163_11395587 | 3300014325 | Bacteria | 762 |
| 260 | Ga0157380_11559696 | 3300014326 | Bacteria | 715 |
| 261 | Ga0182008_10347845 | 3300014497 | Bacteria | 785 |
| 262 | Ga0157377_10112134 | 3300014745 | Bacteria | 1641 |
| 263 | Ga0157377_10368252 | 3300014745 | Bacteria | 969 |
| 264 | Ga0157379_10000011 | 3300014968 | Bacteria | 111920 |
| 265 | Ga0157379_10004447 | 3300014968 | Bacteria | 12020 |
| 266 | Ga0157379_10468608 | 3300014968 | Bacteria | 1165 |
| 267 | Ga0157379_12679166 | 3300014968 | Bacteria | 500 |
| 268 | Ga0157376_13100957 | 3300014969 | Bacteria | 503 |
| 269 | Ga0163161_10397799 | 3300017792 | Bacteria | 1104 |
| 270 | Ga0163161_10500830 | 3300017792 | Bacteria | 989 |
| 271 | Ga0197907_10137431 | 3300020069 | Bacteria | 1024 |
| 272 | Ga0197907_10164336 | 3300020069 | Bacteria | 3956 |
| 273 | Ga0197907_10287841 | 3300020069 | Bacteria | 731 |
| 274 | Ga0197907_10521472 | 3300020069 | Bacteria | 502 |
| 275 | Ga0197907_10553372 | 3300020069 | Bacteria | 746 |
| 276 | Ga0197907_10559923 | 3300020069 | Bacteria | 876 |
| 277 | Ga0197907_10612753 | 3300020069 | Bacteria | 761 |
| 278 | Ga0197907_10890214 | 3300020069 | Bacteria | 1979 |
| 279 | Ga0197907_11323563 | 3300020069 | Bacteria | 647 |
| 280 | Ga0206356_10075057 | 3300020070 | Bacteria | 3042 |
| 281 | Ga0206356_10184148 | 3300020070 | Bacteria | 1147 |
| 282 | Ga0206356_10566583 | 3300020070 | Bacteria | 890 |
| 283 | Ga0206356_10801131 | 3300020070 | Bacteria | 613 |
| 284 | Ga0206356_11542350 | 3300020070 | Bacteria | 4382 |
| 285 | Ga0206349_1049575 | 3300020075 | Bacteria | 3992 |
| 286 | Ga0206349_1145716 | 3300020075 | Bacteria | 692 |
| 287 | Ga0206349_1191611 | 3300020075 | Bacteria | 1319 |
| 288 | Ga0206349_1224460 | 3300020075 | Bacteria | 750 |
| 289 | Ga0206355_1184113 | 3300020076 | Bacteria | 801 |
| 290 | Ga0206355_1263721 | 3300020076 | Bacteria | 845 |
| 291 | Ga0206355_1680853 | 3300020076 | Bacteria | 801 |
| 292 | Ga0206355_1699297 | 3300020076 | Bacteria | 908 |
| 293 | Ga0206351_10073110 | 3300020077 | Bacteria | 828 |
| 294 | Ga0206351_10349151 | 3300020077 | Bacteria | 783 |
| 295 | Ga0206351_10366779 | 3300020077 | Bacteria | 703 |
| 296 | Ga0206351_10561642 | 3300020077 | Bacteria | 683 |
| 297 | Ga0206351_10667073 | 3300020077 | Bacteria | 793 |
| 298 | Ga0206351_10888640 | 3300020077 | Bacteria | 710 |
| 299 | Ga0206352_10175716 | 3300020078 | Bacteria | 794 |
| 300 | Ga0206352_10413355 | 3300020078 | Bacteria | 776 |
| 301 | Ga0206352_10419825 | 3300020078 | Bacteria | 640 |
| 302 | Ga0206352_10782919 | 3300020078 | Bacteria | 1378 |
| 303 | Ga0206352_10817773 | 3300020078 | Bacteria | 1816 |
| 304 | Ga0206352_11174969 | 3300020078 | Bacteria | 676 |
| 305 | Ga0206350_10387192 | 3300020080 | Bacteria | 831 |
| 306 | Ga0206350_10669342 | 3300020080 | Bacteria | 3987 |
| 307 | Ga0206350_10717286 | 3300020080 | Bacteria | 788 |
| 308 | Ga0206350_10939822 | 3300020080 | Bacteria | 1406 |
| 309 | Ga0206354_10402312 | 3300020081 | Bacteria | 909 |
| 310 | Ga0206354_11017929 | 3300020081 | Bacteria | 1669 |
| 311 | Ga0206354_11061414 | 3300020081 | Bacteria | 2112 |
| 312 | Ga0206354_11104228 | 3300020081 | Bacteria | 838 |
| 313 | Ga0206354_11147171 | 3300020081 | Bacteria | 956 |
| 314 | Ga0206354_11344924 | 3300020081 | Bacteria | 1087 |
| 315 | Ga0206354_11651120 | 3300020081 | Bacteria | 4622 |
| 316 | Ga0206353_10010990 | 3300020082 | Bacteria | 875 |
| 317 | Ga0206353_10069880 | 3300020082 | Bacteria | 1274 |
| 318 | Ga0206353_10389836 | 3300020082 | Bacteria | 19531 |
| 319 | Ga0206353_10579675 | 3300020082 | Bacteria | 787 |
| 320 | Ga0206353_10620362 | 3300020082 | Bacteria | 3239 |
| 321 | Ga0206353_10760686 | 3300020082 | Bacteria | 687 |
| 322 | Ga0206353_11142314 | 3300020082 | Bacteria | 555 |
| 323 | Ga0206353_11145209 | 3300020082 | Bacteria | 1071 |
| 324 | Ga0154015_1376143 | 3300020610 | Bacteria | 821 |
| 325 | Ga0154015_1399765 | 3300020610 | Bacteria | 1056 |
| 326 | Ga0154015_1569601 | 3300020610 | Bacteria | 710 |
| 327 | Ga0213873_10149932 | 3300021358 | Bacteria | 701 |
| 328 | Ga0213876_10000698 | 3300021384 | Bacteria | 23633 |
| 329 | Ga0224712_10004236 | 3300022467 | Bacteria | 3845 |
| 330 | Ga0224712_10030705 | 3300022467 | Bacteria | 1942 |
| 331 | Ga0224712_10044601 | 3300022467 | Bacteria | 1692 |
| 332 | Ga0224712_10057189 | 3300022467 | Bacteria | 1540 |
| 333 | Ga0224712_10342901 | 3300022467 | Bacteria | 705 |
| 334 | Ga0224712_10358259 | 3300022467 | Bacteria | 690 |
| 335 | Ga0224712_10368829 | 3300022467 | Bacteria | 681 |
| 336 | Ga0224712_10471188 | 3300022467 | Bacteria | 605 |
| 337 | Ga0209672_100006 | 3300025228 | Bacteria | 1004497 |
| 338 | Ga0209147_100870 | 3300025229 | Bacteria | 13946 |
| 339 | Ga0209258_106149 | 3300025242 | Bacteria | 1919 |
| 340 | Ga0209677_100623 | 3300025253 | Bacteria | 19023 |
| 341 | Ga0209148_1000015 | 3300025254 | Bacteria | 850103 |
| 342 | Ga0209455_1000013 | 3300025272 | Bacteria | 850103 |
| 343 | Ga0209758_1043791 | 3300025297 | Bacteria | 1644 |
| 344 | Ga0207426_1019038 | 3300025302 | Bacteria | 2407 |
| 345 | Ga0207426_1073094 | 3300025302 | Bacteria | 950 |
| 346 | Ga0207656_10218087 | 3300025321 | Bacteria | 926 |
| 347 | Ga0207696_1032158 | 3300025711 | Bacteria | 1582 |
| 348 | Ga0207655_1133466 | 3300025728 | Bacteria | 806 |
| 349 | Ga0207713_1038256 | 3300025735 | Bacteria | 2037 |
| 350 | Ga0207682_10102956 | 3300025893 | Bacteria | 1250 |
| 351 | Ga0207692_10089777 | 3300025898 | Bacteria | 1664 |
| 352 | Ga0207692_10992925 | 3300025898 | Bacteria | 554 |
| 353 | Ga0207710_10294804 | 3300025900 | Bacteria | 818 |
| 354 | Ga0207688_10063242 | 3300025901 | Bacteria | 2087 |
| 355 | Ga0207688_10491877 | 3300025901 | Bacteria | 768 |
| 356 | Ga0207647_10004777 | 3300025904 | Bacteria | 10032 |
| 357 | Ga0207685_10324380 | 3300025905 | Bacteria | 769 |
| 358 | Ga0207699_10630351 | 3300025906 | Bacteria | 782 |
| 359 | Ga0207643_10040282 | 3300025908 | Bacteria | 2630 |
| 360 | Ga0207643_10230242 | 3300025908 | Bacteria | 1136 |
| 361 | Ga0207643_10895602 | 3300025908 | Bacteria | 575 |
| 362 | Ga0207705_10000660 | 3300025909 | Bacteria | 28732 |
| 363 | Ga0207705_10003405 | 3300025909 | Bacteria | 12092 |
| 364 | Ga0207705_10364636 | 3300025909 | Bacteria | 1114 |
| 365 | Ga0207705_10728763 | 3300025909 | Bacteria | 770 |
| 366 | Ga0207654_11328679 | 3300025911 | Bacteria | 524 |
| 367 | Ga0207707_10000764 | 3300025912 | Bacteria | 31604 |
| 368 | Ga0207707_10089094 | 3300025912 | Bacteria | 2696 |
| 369 | Ga0207693_10057860 | 3300025915 | Bacteria | 3037 |
| 370 | Ga0207663_10072394 | 3300025916 | Bacteria | 2227 |
| 371 | Ga0207660_10025359 | 3300025917 | Bacteria | 4023 |
| 372 | Ga0207660_10045816 | 3300025917 | Bacteria | 3083 |
| 373 | Ga0207662_10147625 | 3300025918 | Bacteria | 1494 |
| 374 | Ga0207649_11163860 | 3300025920 | Bacteria | 609 |
| 375 | Ga0207652_10000504 | 3300025921 | Bacteria | 39783 |
| 376 | Ga0207652_10119072 | 3300025921 | Bacteria | 2348 |
| 377 | Ga0207652_10812335 | 3300025921 | Bacteria | 830 |
| 378 | Ga0207694_10277504 | 3300025924 | Bacteria | 1376 |
| 379 | Ga0207694_11001737 | 3300025924 | Bacteria | 707 |
| 380 | Ga0207694_11093018 | 3300025924 | Bacteria | 675 |
| 381 | Ga0207650_11127761 | 3300025925 | Bacteria | 667 |
| 382 | Ga0207659_10335280 | 3300025926 | Bacteria | 1251 |
| 383 | Ga0207687_10068750 | 3300025927 | Bacteria | 2524 |
| 384 | Ga0207687_10289517 | 3300025927 | Bacteria | 1316 |
| 385 | Ga0207687_11191090 | 3300025927 | Bacteria | 655 |
| 386 | Ga0207687_11322236 | 3300025927 | Bacteria | 620 |
| 387 | Ga0207700_10326546 | 3300025928 | Bacteria | 1331 |
| 388 | Ga0207664_10000625 | 3300025929 | Bacteria | 24520 |
| 389 | Ga0207664_10584697 | 3300025929 | Bacteria | 1002 |
| 390 | Ga0207664_11186877 | 3300025929 | Bacteria | 681 |
| 391 | Ga0207644_10074847 | 3300025931 | Bacteria | 2486 |
| 392 | Ga0207690_10431242 | 3300025932 | Bacteria | 1056 |
| 393 | Ga0207690_11030540 | 3300025932 | Bacteria | 685 |
| 394 | Ga0207706_10264937 | 3300025933 | Bacteria | 1500 |
| 395 | Ga0207706_11411507 | 3300025933 | Bacteria | 571 |
| 396 | Ga0207686_10612184 | 3300025934 | Bacteria | 858 |
| 397 | Ga0207709_10143851 | 3300025935 | Bacteria | 1643 |
| 398 | Ga0207709_11807970 | 3300025935 | Bacteria | 508 |
| 399 | Ga0207669_10265770 | 3300025937 | Bacteria | 1286 |
| 400 | Ga0207669_10903036 | 3300025937 | Bacteria | 738 |
| 401 | Ga0207669_11361784 | 3300025937 | Bacteria | 604 |
| 402 | Ga0207704_10726401 | 3300025938 | Bacteria | 824 |
| 403 | Ga0207704_11498368 | 3300025938 | Bacteria | 579 |
| 404 | Ga0207665_10653929 | 3300025939 | Bacteria | 824 |
| 405 | Ga0207691_10207817 | 3300025940 | Bacteria | 1702 |
| 406 | Ga0207711_10001188 | 3300025941 | Bacteria | 24715 |
| 407 | Ga0207711_11287656 | 3300025941 | Bacteria | 673 |
| 408 | Ga0207689_10217264 | 3300025942 | Bacteria | 1579 |
| 409 | Ga0207689_11630760 | 3300025942 | Bacteria | 536 |
| 410 | Ga0207661_10308794 | 3300025944 | Bacteria | 1419 |
| 411 | Ga0207661_10403977 | 3300025944 | Bacteria | 1239 |
| 412 | Ga0207661_10575334 | 3300025944 | Bacteria | 1033 |
| 413 | Ga0207661_11286164 | 3300025944 | Bacteria | 672 |
| 414 | Ga0207679_10225105 | 3300025945 | Bacteria | 1580 |
| 415 | Ga0207679_11031548 | 3300025945 | Bacteria | 754 |
| 416 | Ga0207667_10568113 | 3300025949 | Bacteria | 1146 |
| 417 | Ga0207667_10622360 | 3300025949 | Bacteria | 1087 |
| 418 | Ga0207667_10632356 | 3300025949 | Bacteria | 1077 |
| 419 | Ga0207667_11941271 | 3300025949 | Bacteria | 550 |
| 420 | Ga0207712_10061281 | 3300025961 | Bacteria | 2670 |
| 421 | Ga0207712_10929756 | 3300025961 | Bacteria | 770 |
| 422 | Ga0207668_10085199 | 3300025972 | Bacteria | 2305 |
| 423 | Ga0207668_11118483 | 3300025972 | Bacteria | 706 |
| 424 | Ga0207668_11513760 | 3300025972 | Bacteria | 605 |
| 425 | Ga0207640_10361078 | 3300025981 | Bacteria | 1170 |
| 426 | Ga0207658_10985735 | 3300025986 | Bacteria | 769 |
| 427 | Ga0207677_10268375 | 3300026023 | Bacteria | 1395 |
| 428 | Ga0207703_10000066 | 3300026035 | Bacteria | 125891 |
| 429 | Ga0207639_10434560 | 3300026041 | Bacteria | 1189 |
| 430 | Ga0207639_10555307 | 3300026041 | Bacteria | 1055 |
| 431 | Ga0207708_10103253 | 3300026075 | Bacteria | 2208 |
| 432 | Ga0207702_10431755 | 3300026078 | Bacteria | 1275 |
| 433 | Ga0207702_10626230 | 3300026078 | Bacteria | 1057 |
| 434 | Ga0207702_11067804 | 3300026078 | Bacteria | 801 |
| 435 | Ga0207702_11610440 | 3300026078 | Bacteria | 642 |
| 436 | Ga0207702_12253068 | 3300026078 | Bacteria | 533 |
| 437 | Ga0207641_10000419 | 3300026088 | Bacteria | 49566 |
| 438 | Ga0207648_10137534 | 3300026089 | Bacteria | 2152 |
| 439 | Ga0207676_11005363 | 3300026095 | Bacteria | 822 |
| 440 | Ga0207674_10106532 | 3300026116 | Bacteria | 2781 |
| 441 | Ga0207674_10209688 | 3300026116 | Bacteria | 1897 |
| 442 | Ga0207674_10240599 | 3300026116 | Bacteria | 1757 |
| 443 | Ga0207675_100292327 | 3300026118 | Bacteria | 1585 |
| 444 | Ga0207675_101183950 | 3300026118 | Bacteria | 784 |
| 445 | Ga0207675_101198448 | 3300026118 | Bacteria | 779 |
| 446 | Ga0207683_10326067 | 3300026121 | Bacteria | 1407 |
| 447 | Ga0207683_10920125 | 3300026121 | Bacteria | 812 |
| 448 | Ga0207698_10306464 | 3300026142 | Bacteria | 1481 |
| 449 | Ga0207698_10547514 | 3300026142 | Bacteria | 1133 |
| 450 | Ga0209371_1046875 | 3300027312 | Bacteria | 847 |
| 451 | Ga0209282_1298316 | 3300027666 | Bacteria | 686 |
| 452 | Ga0209974_10460285 | 3300027876 | Bacteria | 506 |
| 453 | Ga0207428_10101037 | 3300027907 | Bacteria | 2229 |
| 454 | Ga0207428_10176902 | 3300027907 | Bacteria | 1613 |
| 455 | Ga0268266_10002878 | 3300028379 | Bacteria | 17879 |
| 456 | Ga0268266_11065758 | 3300028379 | Bacteria | 782 |
| 457 | Ga0268266_11551220 | 3300028379 | Bacteria | 638 |
| 458 | Ga0268265_10977018 | 3300028380 | Bacteria | 835 |
| 459 | Ga0268264_10005396 | 3300028381 | Bacteria | 10824 |
| 460 | Ga0268264_11808235 | 3300028381 | Bacteria | 621 |
| 461 | Ga0265337_1022367 | 3300028556 | Bacteria | 1960 |
| 462 | Ga0265319_1277202 | 3300028563 | Bacteria | 510 |
| 463 | Ga0265334_10039799 | 3300028573 | Unclassified | 1844 |
| 464 | Ga0307517_10004784 | 3300028786 | Bacteria | 20661 |
| 465 | Ga0307515_10025160 | 3300028794 | Bacteria | 10317 |
| 466 | Ga0307515_10275618 | 3300028794 | Bacteria | 1396 |
| 467 | Ga0265338_10005572 | 3300028800 | Bacteria | 16380 |
| 468 | Ga0265338_10083961 | 3300028800 | Bacteria | 2661 |
| 469 | Ga0310981_1081140 | 3300029285 | Bacteria | 511 |
| 470 | Ga0268256_1044084 | 3300030500 | Bacteria | 980 |
| 471 | Ga0307511_10002017 | 3300030521 | Bacteria | 21302 |
| 472 | Ga0307512_10008068 | 3300030522 | Bacteria | 10317 |
| 473 | Ga0307512_10095303 | 3300030522 | Bacteria | 2048 |
| 474 | Ga0265777_105402 | 3300030877 | Bacteria | 842 |
| 475 | Ga0265761_108106 | 3300030889 | Bacteria | 584 |
| 476 | Ga0265332_10283728 | 3300031238 | Bacteria | 684 |
| 477 | Ga0265325_10055181 | 3300031241 | Unclassified | 2032 |
| 478 | Ga0265325_10445309 | 3300031241 | Bacteria | 564 |
| 479 | Ga0265340_10009688 | 3300031247 | Bacteria | 5163 |
| 480 | Ga0265340_10347631 | 3300031247 | Bacteria | 655 |
| 481 | Ga0265339_10039944 | 3300031249 | Bacteria | 2609 |
| 482 | Ga0265339_10089235 | 3300031249 | Unclassified | 1618 |
| 483 | Ga0265316_11001514 | 3300031344 | Bacteria | 581 |
| 484 | Ga0307513_10083290 | 3300031456 | Bacteria | 3289 |
| 485 | Ga0307513_10125628 | 3300031456 | Bacteria | 2521 |
| 486 | Ga0307513_10931061 | 3300031456 | Bacteria | 577 |
| 487 | Ga0307509_10089356 | 3300031507 | Bacteria | 3159 |
| 488 | Ga0307509_10176128 | 3300031507 | Bacteria | 2011 |
| 489 | Ga0307408_100765539 | 3300031548 | Bacteria | 873 |
| 490 | Ga0307408_100890579 | 3300031548 | Bacteria | 814 |
| 491 | Ga0307408_101022659 | 3300031548 | Bacteria | 763 |
| 492 | Ga0265313_10054039 | 3300031595 | Bacteria | 1909 |
| 493 | Ga0310103_117188 | 3300031614 | Bacteria | 943 |
| 494 | Ga0307508_10014621 | 3300031616 | Bacteria | 7162 |
| 495 | Ga0307508_10017412 | 3300031616 | Bacteria | 6532 |
| 496 | Ga0307508_10019016 | 3300031616 | Bacteria | 6241 |
| 497 | Ga0307508_10045682 | 3300031616 | Bacteria | 3912 |
| 498 | Ga0307508_10826990 | 3300031616 | Bacteria | 545 |
| 499 | Ga0307514_10003844 | 3300031649 | Bacteria | 14127 |
| 500 | Ga0307514_10043049 | 3300031649 | Bacteria | 3548 |
| 501 | Ga0307514_10059226 | 3300031649 | Bacteria | 2927 |
| 502 | Ga0307514_10118712 | 3300031649 | Bacteria | 1851 |
| 503 | Ga0307514_10206484 | 3300031649 | Bacteria | 1226 |
| 504 | Ga0316575_10075152 | 3300031665 | Bacteria | 1360 |
| 505 | Ga0316575_10391012 | 3300031665 | Bacteria | 595 |
| 506 | Ga0316579_10086636 | 3300031691 | Bacteria | 1494 |
| 507 | Ga0265342_10024150 | 3300031712 | Bacteria | 3840 |
| 508 | Ga0316576_10158163 | 3300031727 | Bacteria | 1708 |
| 509 | Ga0316576_10244994 | 3300031727 | Bacteria | 1346 |
| 510 | Ga0316578_10019112 | 3300031728 | Bacteria | 3765 |
| 511 | Ga0316578_10076370 | 3300031728 | Bacteria | 1989 |
| 512 | Ga0307516_10001550 | 3300031730 | Bacteria | 31620 |
| 513 | Ga0307516_10019048 | 3300031730 | Bacteria | 7120 |
| 514 | Ga0307516_10393705 | 3300031730 | Bacteria | 1045 |
| 515 | Ga0307405_10168909 | 3300031731 | Bacteria | 1558 |
| 516 | Ga0307405_10602635 | 3300031731 | Bacteria | 897 |
| 517 | Ga0307405_12051990 | 3300031731 | Bacteria | 512 |
| 518 | Ga0316577_10098113 | 3300031733 | Bacteria | 1641 |
| 519 | Ga0307413_10241094 | 3300031824 | Bacteria | 1335 |
| 520 | Ga0307413_11615038 | 3300031824 | Bacteria | 576 |
| 521 | Ga0307413_12014314 | 3300031824 | Bacteria | 521 |
| 522 | Ga0307518_10534050 | 3300031838 | Bacteria | 588 |
| 523 | Ga0307410_10132308 | 3300031852 | Bacteria | 1834 |
| 524 | Ga0307410_11344552 | 3300031852 | Bacteria | 626 |
| 525 | Ga0307410_12134000 | 3300031852 | Bacteria | 501 |
| 526 | Ga0307406_10000344 | 3300031901 | Bacteria | 27059 |
| 527 | Ga0307406_10070262 | 3300031901 | Bacteria | 2292 |
| 528 | Ga0307406_10213767 | 3300031901 | Bacteria | 1428 |
| 529 | Ga0307406_10788265 | 3300031901 | Bacteria | 801 |
| 530 | Ga0307406_10986329 | 3300031901 | Bacteria | 722 |
| 531 | Ga0307407_10123057 | 3300031903 | Bacteria | 1648 |
| 532 | Ga0307407_10701034 | 3300031903 | Bacteria | 763 |
| 533 | Ga0307412_10687832 | 3300031911 | Bacteria | 876 |
| 534 | Ga0307412_12230513 | 3300031911 | Bacteria | 510 |
| 535 | Ga0307409_100206366 | 3300031995 | Bacteria | 1762 |
| 536 | Ga0307409_100522046 | 3300031995 | Bacteria | 1160 |
| 537 | Ga0307409_100657511 | 3300031995 | Bacteria | 1043 |
| 538 | Ga0307409_102693573 | 3300031995 | Bacteria | 525 |
| 539 | Ga0307416_100107847 | 3300032002 | Bacteria | 2445 |
| 540 | Ga0307416_100604868 | 3300032002 | Bacteria | 1176 |
| 541 | Ga0307416_100839868 | 3300032002 | Bacteria | 1016 |
| 542 | Ga0307416_101031276 | 3300032002 | Bacteria | 926 |
| 543 | Ga0307416_101635237 | 3300032002 | Bacteria | 749 |
| 544 | Ga0307411_10881073 | 3300032005 | Bacteria | 794 |
| 545 | Ga0307411_10940885 | 3300032005 | Bacteria | 770 |
| 546 | Ga0307411_11504924 | 3300032005 | Bacteria | 619 |
| 547 | Ga0307415_101500411 | 3300032126 | Bacteria | 645 |
| 548 | Ga0316583_10012793 | 3300032133 | Bacteria | 3028 |
| 549 | Ga0316585_10029638 | 3300032137 | Bacteria | 1714 |
| 550 | Ga0316580_10002100 | 3300032139 | Bacteria | 5415 |
| 551 | Ga0316593_10133397 | 3300032168 | Bacteria | 897 |
| 552 | Ga0307507_10296439 | 3300033179 | Bacteria | 995 |
| 553 | Ga0307510_10098847 | 3300033180 | Bacteria | 2720 |
| 554 | Ga0307510_10265031 | 3300033180 | Bacteria | 1197 |
| 555 | Ga0307510_10355071 | 3300033180 | Bacteria | 915 |
| 556 | Ga0307510_10394943 | 3300033180 | Bacteria | 826 |
| 557 | Ga0316588_1024655 | 3300033528 | Bacteria | 1385 |
| 558 | Ga0316587_1077595 | 3300033529 | Bacteria | 626 |
| 559 | Ga0316587_1093269 | 3300033529 | Bacteria | 576 |
| 560 | Ga0316596_1005006 | 3300033541 | Bacteria | 3004 |
| 561 | Ga0316596_1047494 | 3300033541 | Bacteria | 1134 |
| 562 | Ga0373938_0197387 | 3300034957 | Bacteria | 556 |
| 563 | Ga0373934_0000413 | 3300035086 | Bacteria | 14982 |
| 564 | Ga0373934_0011739 | 3300035086 | Bacteria | 3299 |
| 565 | Ga0373949_0119484 | 3300035090 | Bacteria | 739 |
| 566 | Ga0373923_0083385 | 3300035111 | Bacteria | 1389 |
| 567 | Ga0373936_0071412 | 3300035113 | Bacteria | 1431 |
| 568 | Ga0373953_0000551 | 3300035117 | Bacteria | 10390 |
| 569 | Ga0373953_0093894 | 3300035117 | Bacteria | 1257 |
| 570 | Ga0373954_0001878 | 3300035118 | Bacteria | 8667 |
| 571 | Ga0373954_0060776 | 3300035118 | Bacteria | 1783 |
| 572 | Ga0373956_0000234 | 3300035119 | Bacteria | 22056 |
| 573 | Ga0373956_0171675 | 3300035119 | Bacteria | 1023 |
| 574 | Ga0373957_0000078 | 3300035120 | Bacteria | 23295 |
| 575 | Ga0373957_0016711 | 3300035120 | Bacteria | 2545 |
| 576 | Ga0373955_0000922 | 3300035172 | Bacteria | 12626 |
| 577 | Ga0373955_0003954 | 3300035172 | Bacteria | 6541 |
| 578 | Ga0316574_0054919 | 3300035398 | Bacteria | 2488 |
| 579 | Ga0316574_0140592 | 3300035398 | Bacteria | 1555 |
| 580 | Ga0316574_0421683 | 3300035398 | Bacteria | 838 |
| 581 | Ga0373924_0205784 | 3300035410 | Bacteria | 868 |
| 582 | Ga0373931_0329099 | 3300035691 | Bacteria | 951 |
| 583 | Ga0373931_0496328 | 3300035691 | Bacteria | 787 |
| 584 | Ga0373935_0943769 | 3300035692 | Bacteria | 640 |
| 585 | Ga0373927_0968657 | 3300035695 | Bacteria | 561 |
| 586 | Ga0373933_0000076 | 3300035724 | Bacteria | 61470 |
| 587 | Ga0373933_0082049 | 3300035724 | Bacteria | 1978 |
| 588 | Ga0373937_0000183 | 3300036401 | Bacteria | 61487 |
| 589 | Ga0373937_0825168 | 3300036401 | Bacteria | 875 |
| 590 | Ga0373937_1368803 | 3300036401 | Bacteria | 655 |
| 591 | Ga0316582_0011385 | 3300036647 | Bacteria | 4913 |
| 592 | Ga0316584_0063533 | 3300036712 | Bacteria | 2763 |
| 593 | Ga0316584_0229780 | 3300036712 | Bacteria | 1360 |
| 594 | Ga0395899_0046064 | 3300037312 | Bacteria | 3248 |
| 595 | Ga0395899_0144378 | 3300037312 | Bacteria | 1691 |
| 596 | Ga0395899_0173784 | 3300037312 | Bacteria | 1516 |
| 597 | Ga0395900_0149873 | 3300037418 | Bacteria | 2383 |
| 598 | Ga0395900_0498481 | 3300037418 | Bacteria | 1168 |
| 599 | Ga0395900_1775311 | 3300037418 | Bacteria | 527 |
| 600 | Ga0395898_0000622 | 3300037466 | Bacteria | 65033 |
| 601 | Ga0395898_0015578 | 3300037466 | Bacteria | 7795 |
| 602 | Ga0395898_0101510 | 3300037466 | Bacteria | 2762 |
| 603 | Ga0395898_0175903 | 3300037466 | Bacteria | 2046 |
| 604 | Ga0395898_0612000 | 3300037466 | Bacteria | 1032 |
| 605 | Ga0395898_1312800 | 3300037466 | Bacteria | 653 |
| 606 | Ga0316581_0170394 | 3300037588 | Bacteria | 671 |
| 607 | Ga0436364_0062912 | 3300037853 | Bacteria | 47359 |
| 608 | Ga0395901_0391216 | 3300038443 | Bacteria | 1429 |
| 609 | Ga0395901_0456646 | 3300038443 | Bacteria | 1306 |
| 610 | Ga0395901_1389266 | 3300038443 | Bacteria | 661 |
| 611 | Ga0436365_0879580 | 3300039437 | Bacteria | 36654 |
| 612 | Ga0436365_1225491 | 3300039437 | Bacteria | 5655 |
| 613 | Ga0439436_0002018 | 3300041404 | Bacteria | 6034 |
| 614 | Ga0439436_0015225 | 3300041404 | Bacteria | 2313 |
| 615 | Ga0439436_0042742 | 3300041404 | Bacteria | 1295 |
| 616 | Ga0439439_0000254 | 3300041406 | Bacteria | 8374 |
| 617 | Ga0439453_0104439 | 3300041408 | Bacteria | 635 |
| 618 | Ga0439466_0162495 | 3300041411 | Bacteria | 683 |
| 619 | Ga0439465_0052642 | 3300041413 | Bacteria | 1336 |
| 620 | Ga0439465_0061592 | 3300041413 | Bacteria | 1244 |
| 621 | Ga0439465_0350606 | 3300041413 | Bacteria | 557 |
| 622 | Ga0451792_12977 | 3300041445 | Bacteria | 724 |
| 623 | Ga0451791_0235911 | 3300041451 | Bacteria | 921 |
| 624 | Ga0451791_0453322 | 3300041451 | Bacteria | 561 |
| 625 | Ga0451793_1275263 | 3300041452 | Bacteria | 1479 |
| 626 | Ga0451797_0913809 | 3300041453 | Bacteria | 546 |
| 627 | Ga0451797_1306607 | 3300041453 | Bacteria | 2014 |
| 628 | Ga0451797_1364221 | 3300041453 | Bacteria | 801 |
| 629 | Ga0451801_37017 | 3300041455 | Bacteria | 764 |
| 630 | Ga0451795_1358716 | 3300041456 | Bacteria | 1332 |
| 631 | Ga0451800_0254177 | 3300041459 | Bacteria | 1773 |
| 632 | Ga0451802_0072948 | 3300041460 | Bacteria | 505 |
| 633 | Ga0451802_0104636 | 3300041460 | Bacteria | 531 |
| 634 | Ga0451802_0479341 | 3300041460 | Bacteria | 1586 |
| 635 | Ga0451805_087420 | 3300041461 | Bacteria | 654 |
| 636 | Ga0451835_1170188 | 3300041492 | Bacteria | 698 |
| 637 | Ga0451841_0125492 | 3300041498 | Bacteria | 751 |
| 638 | Ga0451841_0466799 | 3300041498 | Bacteria | 1061 |
| 639 | Ga0451845_0239999 | 3300041501 | Bacteria | 953 |
| 640 | Ga0451849_0924598 | 3300041505 | Bacteria | 1569 |
| 641 | Ga0451853_0381932 | 3300041512 | Bacteria | 781 |
| 642 | Ga0451853_1865502 | 3300041512 | Bacteria | 1122 |
| 643 | Ga0451853_2603884 | 3300041512 | Bacteria | 916 |
| 644 | Ga0451853_2920057 | 3300041512 | Bacteria | 545 |
| 645 | Ga0451853_3360855 | 3300041512 | Bacteria | 537 |
| 646 | Ga0451853_4033414 | 3300041512 | Bacteria | 861 |
| 647 | Ga0439431_0105118 | 3300041997 | Bacteria | 778 |
| 648 | Ga0439433_0006606 | 3300041999 | Bacteria | 2498 |
| 649 | Ga0439442_002078 | 3300042002 | Bacteria | 3934 |
| 650 | Ga0439448_0002469 | 3300042005 | Bacteria | 5039 |
| 651 | Ga0439449_0001172 | 3300042007 | Bacteria | 10280 |
| 652 | Ga0439449_0023539 | 3300042007 | Bacteria | 2302 |
| 653 | Ga0439449_0089653 | 3300042007 | Bacteria | 1135 |
| 654 | Ga0439449_0385676 | 3300042007 | Bacteria | 531 |
| 655 | Ga0439454_028021 | 3300042011 | Bacteria | 868 |
| 656 | Ga0439455_0020550 | 3300042012 | Bacteria | 1566 |
| 657 | Ga0439457_000267 | 3300042014 | Bacteria | 14304 |
| 658 | Ga0439457_002421 | 3300042014 | Bacteria | 5336 |
| 659 | Ga0439462_0013751 | 3300042015 | Bacteria | 2076 |
| 660 | Ga0450920_023536 | 3300042122 | Bacteria | 1194 |
| 661 | Ga0450897_000435 | 3300042128 | Bacteria | 2289 |
| 662 | Ga0450894_001474 | 3300042131 | Bacteria | 3367 |
| 663 | Ga0450895_000962 | 3300042132 | Bacteria | 1875 |
| 664 | Ga0450896_013852 | 3300042133 | Bacteria | 1149 |
| 665 | Ga0450898_000247 | 3300042134 | Bacteria | 5940 |
| 666 | Ga0450900_004404 | 3300042136 | Bacteria | 1617 |
| 667 | Ga0450900_013068 | 3300042136 | Bacteria | 1094 |
| 668 | Ga0450902_002079 | 3300042137 | Bacteria | 2811 |
| 669 | Ga0450903_002022 | 3300042138 | Bacteria | 3655 |
| 670 | Ga0450903_012578 | 3300042138 | Bacteria | 1351 |
| 671 | Ga0450905_086170 | 3300042142 | Bacteria | 551 |
| 672 | Ga0450906_023851 | 3300042145 | Bacteria | 1088 |
| 673 | Ga0450907_017555 | 3300042146 | Bacteria | 1194 |
| 674 | Ga0450910_095750 | 3300042147 | Bacteria | 529 |
| 675 | Ga0439458_0000320 | 3300042157 | Bacteria | 11976 |
| 676 | Ga0450908_019594 | 3300042184 | Bacteria | 1190 |
| 677 | Ga0439435_0136108 | 3300042436 | Bacteria | 780 |
| 678 | Ga0439460_0130240 | 3300042461 | Bacteria | 829 |
| 679 | Ga0450901_005798 | 3300042533 | Bacteria | 1269 |
| 680 | Ga0451577_0244007 | 3300042876 | Bacteria | 1626 |
| 681 | Ga0451577_1418737 | 3300042876 | Bacteria | 616 |
| 682 | Ga0466969_0050397 | 3300044656 | Bacteria | 2052 |
| 683 | Ga0466972_0002764 | 3300044658 | Bacteria | 8692 |
| 684 | Ga0466972_0010375 | 3300044658 | Bacteria | 4677 |
| 685 | Ga0466972_0188741 | 3300044658 | Bacteria | 966 |
| 686 | Ga0466972_0224264 | 3300044658 | Bacteria | 879 |
| 687 | Ga0466972_0357153 | 3300044658 | Bacteria | 683 |
| 688 | Ga0466972_0409741 | 3300044658 | Bacteria | 635 |
| 689 | Ga0466972_0578774 | 3300044658 | Bacteria | 530 |
| 690 | Ga0466965_0001075 | 3300044683 | Bacteria | 10619 |
| 691 | Ga0466965_0026735 | 3300044683 | Bacteria | 2797 |
| 692 | Ga0466965_0047862 | 3300044683 | Bacteria | 2117 |
| 693 | Ga0466965_0049949 | 3300044683 | Bacteria | 2073 |
| 694 | Ga0466965_0052477 | 3300044683 | Bacteria | 2025 |
| 695 | Ga0466965_0136319 | 3300044683 | Bacteria | 1275 |
| 696 | Ga0466965_0200096 | 3300044683 | Bacteria | 1059 |
| 697 | Ga0466965_0381727 | 3300044683 | Bacteria | 776 |
| 698 | Ga0466966_0004673 | 3300044684 | Bacteria | 9014 |
| 699 | Ga0466966_0007573 | 3300044684 | Bacteria | 7193 |
| 700 | Ga0466966_0324123 | 3300044684 | Bacteria | 925 |
| 701 | Ga0466966_0460600 | 3300044684 | Bacteria | 764 |
| 702 | Ga0466961_0013019 | 3300044693 | Bacteria | 5321 |
| 703 | Ga0466961_0050391 | 3300044693 | Bacteria | 2659 |
| 704 | Ga0466961_0070584 | 3300044693 | Bacteria | 2217 |
| 705 | Ga0466961_0413151 | 3300044693 | Bacteria | 818 |
| 706 | Ga0466961_0601969 | 3300044693 | Bacteria | 661 |
| 707 | Ga0466961_0760318 | 3300044693 | Bacteria | 579 |
| 708 | Ga0466961_0811470 | 3300044693 | Bacteria | 558 |
| 709 | Ga0466963_0000829 | 3300044694 | Bacteria | 15494 |
| 710 | Ga0466963_0135417 | 3300044694 | Bacteria | 1704 |
| 711 | Ga0466963_0260838 | 3300044694 | Bacteria | 1217 |
| 712 | Ga0466963_0351557 | 3300044694 | Bacteria | 1038 |
| 713 | Ga0466963_0387633 | 3300044694 | Bacteria | 985 |
| 714 | Ga0466963_0505195 | 3300044694 | Bacteria | 853 |
| 715 | Ga0466963_0642272 | 3300044694 | Bacteria | 749 |
| 716 | Ga0466963_1046114 | 3300044694 | Bacteria | 574 |
| 717 | Ga0466964_0002067 | 3300044706 | Bacteria | 7063 |
| 718 | Ga0466964_0048238 | 3300044706 | Bacteria | 1741 |
| 719 | Ga0466964_0408371 | 3300044706 | Bacteria | 711 |
| 720 | Ga0466971_0001565 | 3300044719 | Bacteria | 9658 |
| 721 | Ga0466971_0101266 | 3300044719 | Bacteria | 1324 |
| 722 | Ga0466971_0213277 | 3300044719 | Bacteria | 913 |
| 723 | Ga0466971_0619884 | 3300044719 | Bacteria | 540 |
| 724 | Ga0466968_0088124 | 3300044735 | Bacteria | 1372 |
| 725 | Ga0466968_0356064 | 3300044735 | Bacteria | 712 |
| 726 | Ga0466968_0449934 | 3300044735 | Bacteria | 637 |
| 727 | Ga0466968_0533486 | 3300044735 | Bacteria | 587 |
| 728 | Ga0466970_0001647 | 3300044765 | Bacteria | 10736 |
| 729 | Ga0466970_0018545 | 3300044765 | Bacteria | 3603 |
| 730 | Ga0466970_0034486 | 3300044765 | Bacteria | 2679 |
| 731 | Ga0466970_0065227 | 3300044765 | Bacteria | 1953 |
| 732 | Ga0466970_0067431 | 3300044765 | Bacteria | 1921 |
| 733 | Ga0466970_0095485 | 3300044765 | Bacteria | 1616 |
| 734 | Ga0466970_0854453 | 3300044765 | Bacteria | 534 |
| 735 | Ga0466957_0000170 | 3300044842 | Bacteria | 29001 |
| 736 | Ga0466957_0073024 | 3300044842 | Bacteria | 2125 |
| 737 | Ga0466957_0093442 | 3300044842 | Bacteria | 1888 |
| 738 | Ga0466957_0214611 | 3300044842 | Bacteria | 1268 |
| 739 | Ga0466960_0008803 | 3300044901 | Bacteria | 4145 |
| 740 | Ga0466960_0022810 | 3300044901 | Bacteria | 2802 |
| 741 | Ga0466960_0038075 | 3300044901 | Bacteria | 2259 |
| 742 | Ga0466960_0078312 | 3300044901 | Bacteria | 1659 |
| 743 | Ga0466960_0095083 | 3300044901 | Bacteria | 1525 |
| 744 | Ga0466960_0194556 | 3300044901 | Bacteria | 1105 |
| 745 | Ga0466959_0000614 | 3300045049 | Bacteria | 20762 |
| 746 | Ga0466959_0339825 | 3300045049 | Bacteria | 1024 |
| 747 | Ga0466959_0636884 | 3300045049 | Bacteria | 716 |
| 748 | Ga0466958_0007122 | 3300045836 | Bacteria | 6126 |
| 749 | Ga0466958_0074578 | 3300045836 | Bacteria | 2079 |
| 750 | Ga0466958_0099351 | 3300045836 | Bacteria | 1808 |
| 751 | Ga0466958_0177545 | 3300045836 | Bacteria | 1351 |
| 752 | Ga0466958_0291351 | 3300045836 | Bacteria | 1047 |
| 753 | Ga0466958_0465798 | 3300045836 | Bacteria | 819 |
| 754 | Ga0466958_0579046 | 3300045836 | Bacteria | 730 |
| 755 | Ga0466967_0037190 | 3300045976 | Bacteria | 4163 |
| 756 | Ga0466967_0129919 | 3300045976 | Bacteria | 2337 |
| 757 | Ga0466967_0161606 | 3300045976 | Bacteria | 2103 |
| 758 | Ga0466967_0193790 | 3300045976 | Bacteria | 1922 |
| 759 | Ga0466967_0682896 | 3300045976 | Bacteria | 1016 |
| 760 | Ga0466967_1431781 | 3300045976 | Bacteria | 688 |
| 761 | Ga0466967_2520008 | 3300045976 | Bacteria | 509 |
| 762 | Ga0495617_231551 | 3300046452 | Bacteria | 572 |
| 763 | Ga0495627_213433 | 3300046453 | Bacteria | 530 |
| 764 | Ga0495592_0000158 | 3300046454 | Bacteria | 59662 |
| 765 | Ga0495592_0005337 | 3300046454 | Bacteria | 9485 |
| 766 | Ga0495592_0119503 | 3300046454 | Bacteria | 1855 |
| 767 | Ga0495592_0588043 | 3300046454 | Bacteria | 680 |
| 768 | Ga0495603_0000831 | 3300046455 | Bacteria | 17724 |
| 769 | Ga0495603_0005212 | 3300046455 | Bacteria | 7761 |
| 770 | Ga0495603_0023663 | 3300046455 | Bacteria | 3715 |
| 771 | Ga0495603_0051941 | 3300046455 | Bacteria | 2434 |
| 772 | Ga0495603_0068830 | 3300046455 | Bacteria | 2082 |
| 773 | Ga0495603_0423181 | 3300046455 | Bacteria | 763 |
| 774 | Ga0495590_0227656 | 3300046457 | Bacteria | 690 |
| 775 | Ga0495629_0033621 | 3300046459 | Bacteria | 3626 |
| 776 | Ga0495629_0049312 | 3300046459 | Bacteria | 2951 |
| 777 | Ga0495629_0051534 | 3300046459 | Bacteria | 2880 |
| 778 | Ga0495629_0071827 | 3300046459 | Bacteria | 2415 |
| 779 | Ga0495629_0257134 | 3300046459 | Bacteria | 1201 |
| 780 | Ga0495629_0489101 | 3300046459 | Bacteria | 830 |
| 781 | Ga0495629_0540583 | 3300046459 | Bacteria | 783 |
| 782 | Ga0495629_0802193 | 3300046459 | Bacteria | 621 |
| 783 | Ga0495638_0064630 | 3300046460 | Bacteria | 2254 |
| 784 | Ga0495638_0066404 | 3300046460 | Bacteria | 2217 |
| 785 | Ga0495638_0138853 | 3300046460 | Bacteria | 1420 |
| 786 | Ga0495638_0185109 | 3300046460 | Bacteria | 1185 |
| 787 | Ga0495638_0200061 | 3300046460 | Bacteria | 1128 |
| 788 | Ga0495638_0675224 | 3300046460 | Bacteria | 500 |
| 789 | Ga0495641_0210368 | 3300046461 | Bacteria | 872 |
| 790 | Ga0495641_0445590 | 3300046461 | Bacteria | 589 |
| 791 | Ga0495651_0000101 | 3300046462 | Bacteria | 62279 |
| 792 | Ga0495651_0019714 | 3300046462 | Bacteria | 5227 |
| 793 | Ga0495651_0028260 | 3300046462 | Bacteria | 4371 |
| 794 | Ga0495651_0078880 | 3300046462 | Bacteria | 2490 |
| 795 | Ga0495653_0008755 | 3300046463 | Bacteria | 8287 |
| 796 | Ga0495653_0035480 | 3300046463 | Bacteria | 3935 |
| 797 | Ga0495653_0038765 | 3300046463 | Bacteria | 3738 |
| 798 | Ga0495653_0165169 | 3300046463 | Bacteria | 1533 |
| 799 | Ga0495653_0372473 | 3300046463 | Bacteria | 914 |
| 800 | Ga0495580_0071165 | 3300046472 | Bacteria | 2429 |
| 801 | Ga0495582_0641847 | 3300046473 | Bacteria | 614 |
| 802 | Ga0495605_0107632 | 3300046474 | Bacteria | 1275 |
| 803 | Ga0495662_0000253 | 3300046476 | Bacteria | 22699 |
| 804 | Ga0495662_0002995 | 3300046476 | Bacteria | 8525 |
| 805 | Ga0495662_0052526 | 3300046476 | Bacteria | 1968 |
| 806 | Ga0495662_0149933 | 3300046476 | Bacteria | 1148 |
| 807 | Ga0495664_0001773 | 3300046477 | Bacteria | 11443 |
| 808 | Ga0495664_0052658 | 3300046477 | Bacteria | 2419 |
| 809 | Ga0495664_0315549 | 3300046477 | Bacteria | 943 |
| 810 | Ga0495664_0562313 | 3300046477 | Bacteria | 679 |
| 811 | Ga0495585_0040561 | 3300046492 | Bacteria | 2614 |
| 812 | Ga0495585_0059828 | 3300046492 | Bacteria | 2098 |
| 813 | Ga0495585_0193139 | 3300046492 | Bacteria | 1040 |
| 814 | Ga0495594_0029780 | 3300046499 | Bacteria | 2951 |
| 815 | Ga0495594_0034187 | 3300046499 | Bacteria | 2765 |
| 816 | Ga0495594_0068118 | 3300046499 | Bacteria | 1976 |
| 817 | Ga0495594_0090276 | 3300046499 | Bacteria | 1716 |
| 818 | Ga0495607_0039647 | 3300046501 | Bacteria | 2812 |
| 819 | Ga0495583_0201564 | 3300046506 | Bacteria | 808 |
| 820 | Ga0495608_0000099 | 3300046511 | Bacteria | 61951 |
| 821 | Ga0495608_0058479 | 3300046511 | Bacteria | 2541 |
| 822 | Ga0495608_0067568 | 3300046511 | Bacteria | 2338 |
| 823 | Ga0495608_0366264 | 3300046511 | Bacteria | 885 |
| 824 | Ga0495608_0687765 | 3300046511 | Bacteria | 609 |
| 825 | Ga0495610_0216925 | 3300046512 | Bacteria | 775 |
| 826 | Ga0495618_0031633 | 3300046514 | Bacteria | 3311 |
| 827 | Ga0495618_0354704 | 3300046514 | Bacteria | 903 |
| 828 | Ga0495620_0223795 | 3300046515 | Bacteria | 720 |
| 829 | Ga0495628_0004775 | 3300046516 | Bacteria | 11943 |
| 830 | Ga0495628_0012392 | 3300046516 | Bacteria | 7191 |
| 831 | Ga0495628_0293983 | 3300046516 | Bacteria | 1203 |
| 832 | Ga0495628_0534353 | 3300046516 | Bacteria | 843 |
| 833 | Ga0495630_0089968 | 3300046517 | Bacteria | 2319 |
| 834 | Ga0495630_0165138 | 3300046517 | Bacteria | 1685 |
| 835 | Ga0495630_0234434 | 3300046517 | Bacteria | 1402 |
| 836 | Ga0495630_0625591 | 3300046517 | Bacteria | 825 |
| 837 | Ga0495630_1473019 | 3300046517 | Bacteria | 511 |
| 838 | Ga0495631_0263974 | 3300046518 | Bacteria | 733 |
| 839 | Ga0495632_0153882 | 3300046519 | Bacteria | 1062 |
| 840 | Ga0495643_0002222 | 3300046522 | Bacteria | 15767 |
| 841 | Ga0495643_0112244 | 3300046522 | Bacteria | 1385 |
| 842 | Ga0495644_0354065 | 3300046523 | Bacteria | 578 |
| 843 | Ga0495666_0001455 | 3300046526 | Bacteria | 11535 |
| 844 | Ga0495666_0348703 | 3300046526 | Bacteria | 667 |
| 845 | Ga0495652_0000214 | 3300046529 | Bacteria | 66835 |
| 846 | Ga0495652_0091389 | 3300046529 | Bacteria | 2488 |
| 847 | Ga0495652_0119109 | 3300046529 | Bacteria | 2109 |
| 848 | Ga0495652_0227458 | 3300046529 | Bacteria | 1397 |
| 849 | Ga0495652_0838563 | 3300046529 | Bacteria | 610 |
| 850 | Ga0495665_0006386 | 3300046531 | Bacteria | 6362 |
| 851 | Ga0495640_0010020 | 3300046533 | Bacteria | 7347 |
| 852 | Ga0495640_0261979 | 3300046533 | Bacteria | 1080 |
| 853 | Ga0495640_0561378 | 3300046533 | Bacteria | 691 |
| 854 | Ga0495586_0023992 | 3300046535 | Bacteria | 3257 |
| 855 | Ga0495586_0041211 | 3300046535 | Bacteria | 2486 |
| 856 | Ga0495586_0432525 | 3300046535 | Bacteria | 758 |
| 857 | Ga0495587_0000108 | 3300046536 | Bacteria | 62874 |
| 858 | Ga0495587_0001699 | 3300046536 | Bacteria | 14697 |
| 859 | Ga0495587_0054325 | 3300046536 | Bacteria | 2360 |
| 860 | Ga0495587_0109572 | 3300046536 | Bacteria | 1587 |
| 861 | Ga0495587_0367198 | 3300046536 | Bacteria | 801 |
| 862 | Ga0495645_0018186 | 3300046543 | Bacteria | 5046 |
| 863 | Ga0495645_0020886 | 3300046543 | Bacteria | 4732 |
| 864 | Ga0495645_0024352 | 3300046543 | Bacteria | 4391 |
| 865 | Ga0495622_0036785 | 3300046557 | Bacteria | 2281 |
| 866 | Ga0495622_0059627 | 3300046557 | Bacteria | 1767 |
| 867 | Ga0495622_0138961 | 3300046557 | Bacteria | 1103 |
| 868 | Ga0495633_0049233 | 3300046558 | Bacteria | 1989 |
| 869 | Ga0495633_0182350 | 3300046558 | Bacteria | 966 |
| 870 | Ga0495667_0000102 | 3300046559 | Bacteria | 61487 |
| 871 | Ga0495667_0015573 | 3300046559 | Bacteria | 5140 |
| 872 | Ga0495667_0103249 | 3300046559 | Bacteria | 1844 |
| 873 | Ga0495667_0331498 | 3300046559 | Bacteria | 962 |
| 874 | Ga0495667_0420163 | 3300046559 | Bacteria | 841 |
| 875 | Ga0495668_0077855 | 3300046616 | Bacteria | 1821 |
| 876 | Ga0495668_0779846 | 3300046616 | Bacteria | 529 |
| 877 | Ga0495634_0006236 | 3300046642 | Bacteria | 9081 |
| 878 | Ga0495634_0033911 | 3300046642 | Bacteria | 3504 |
| 879 | Ga0495634_0293570 | 3300046642 | Bacteria | 984 |
| 880 | Ga0495611_0017340 | 3300046648 | Bacteria | 3080 |
| 881 | Ga0495611_0100048 | 3300046648 | Bacteria | 1346 |
| 882 | Ga0495625_0240681 | 3300046660 | Bacteria | 1178 |
| 883 | Ga0495625_0262017 | 3300046660 | Bacteria | 1118 |
| 884 | Ga0495625_0452801 | 3300046660 | Bacteria | 793 |
| 885 | Ga0495625_0542218 | 3300046660 | Bacteria | 705 |
| 886 | Ga0495635_0010746 | 3300046663 | Bacteria | 6413 |
| 887 | Ga0495635_0016801 | 3300046663 | Bacteria | 5111 |
| 888 | Ga0495635_0189769 | 3300046663 | Bacteria | 1395 |
| 889 | Ga0495635_0206992 | 3300046663 | Bacteria | 1329 |
| 890 | Ga0495635_0693138 | 3300046663 | Bacteria | 661 |
| 891 | Ga0495659_0154112 | 3300046664 | Bacteria | 924 |
| 892 | Ga0495659_0495150 | 3300046664 | Bacteria | 535 |
| 893 | Ga0495661_0107450 | 3300046665 | Bacteria | 1560 |
| 894 | Ga0495661_0232433 | 3300046665 | Bacteria | 950 |
| 895 | Ga0495588_0004867 | 3300046674 | Bacteria | 5949 |
| 896 | Ga0495588_0026459 | 3300046674 | Bacteria | 2896 |
| 897 | Ga0495588_0081666 | 3300046674 | Bacteria | 1687 |
| 898 | Ga0495588_0190818 | 3300046674 | Bacteria | 1082 |
| 899 | Ga0495657_0000311 | 3300046675 | Bacteria | 44641 |
| 900 | Ga0495657_0019707 | 3300046675 | Bacteria | 4862 |
| 901 | Ga0495657_0020748 | 3300046675 | Bacteria | 4723 |
| 902 | Ga0495657_0052100 | 3300046675 | Bacteria | 2745 |
| 903 | Ga0495657_0268029 | 3300046675 | Bacteria | 1024 |
| 904 | Ga0495657_0407496 | 3300046675 | Bacteria | 799 |
| 905 | Ga0495657_0472542 | 3300046675 | Bacteria | 733 |
| 906 | Ga0495599_0000275 | 3300046678 | Bacteria | 31815 |
| 907 | Ga0495599_0085201 | 3300046678 | Bacteria | 1973 |
| 908 | Ga0495599_0345462 | 3300046678 | Bacteria | 893 |
| 909 | Ga0495623_0000402 | 3300046679 | Bacteria | 28670 |
| 910 | Ga0495623_0008769 | 3300046679 | Bacteria | 6565 |
| 911 | Ga0495623_0060775 | 3300046679 | Bacteria | 2371 |
| 912 | Ga0495623_0186627 | 3300046679 | Bacteria | 1201 |
| 913 | Ga0495646_0003307 | 3300046680 | Bacteria | 10030 |
| 914 | Ga0495646_0098581 | 3300046680 | Bacteria | 1678 |
| 915 | Ga0495646_0710755 | 3300046680 | Bacteria | 505 |
| 916 | Ga0495647_0397078 | 3300046681 | Bacteria | 633 |
| 917 | Ga0495658_0021173 | 3300046683 | Bacteria | 3425 |
| 918 | Ga0495658_0500522 | 3300046683 | Bacteria | 777 |
| 919 | Ga0495658_0689341 | 3300046683 | Bacteria | 654 |
| 920 | Ga0495658_0808887 | 3300046683 | Bacteria | 600 |
| 921 | Ga0495658_0932510 | 3300046683 | Bacteria | 555 |
| 922 | Ga0495613_0009048 | 3300046689 | Bacteria | 7389 |
| 923 | Ga0495613_0014208 | 3300046689 | Bacteria | 5907 |
| 924 | Ga0495613_0015649 | 3300046689 | Bacteria | 5645 |
| 925 | Ga0495613_0031316 | 3300046689 | Bacteria | 3950 |
| 926 | Ga0495613_0170093 | 3300046689 | Bacteria | 1547 |
| 927 | Ga0495624_0232197 | 3300046690 | Bacteria | 1117 |
| 928 | Ga0495624_0440124 | 3300046690 | Bacteria | 781 |
| 929 | Ga0495624_0479688 | 3300046690 | Bacteria | 744 |
| 930 | Ga0495670_0012480 | 3300046691 | Bacteria | 4180 |
| 931 | Ga0495670_0093453 | 3300046691 | Bacteria | 1541 |
| 932 | Ga0495670_0353959 | 3300046691 | Bacteria | 790 |
| 933 | Ga0495671_0053869 | 3300046692 | Bacteria | 1995 |
| 934 | Ga0495671_0588381 | 3300046692 | Bacteria | 529 |
| 935 | Ga0495649_0070376 | 3300046694 | Bacteria | 1876 |
| 936 | Ga0495589_0068205 | 3300046794 | Bacteria | 1740 |
| 937 | Ga0495589_0119156 | 3300046794 | Bacteria | 1271 |
| 938 | Ga0495589_0153168 | 3300046794 | Bacteria | 1100 |
| 939 | Ga0495600_0003580 | 3300046809 | Bacteria | 9147 |
| 940 | Ga0495600_0073250 | 3300046809 | Bacteria | 2236 |
| 941 | Ga0495600_0363296 | 3300046809 | Bacteria | 905 |
| 942 | Ga0495581_0005940 | 3300047315 | Bacteria | 7077 |
| 943 | Ga0495581_0067418 | 3300047315 | Bacteria | 2069 |
| 944 | Ga0495581_0228096 | 3300047315 | Bacteria | 1089 |
| 945 | Ga0495581_0270327 | 3300047315 | Bacteria | 994 |
| 946 | Ga0495581_0673311 | 3300047315 | Bacteria | 597 |
| 947 | Ga0495604_0000096 | 3300047317 | Bacteria | 75336 |
| 948 | Ga0495604_0001196 | 3300047317 | Bacteria | 21428 |
| 949 | Ga0495604_0009065 | 3300047317 | Bacteria | 7873 |
| 950 | Ga0495604_0877884 | 3300047317 | Bacteria | 561 |
| 951 | Ga0495636_0024578 | 3300047318 | Bacteria | 2444 |
| 952 | Ga0495636_0045821 | 3300047318 | Bacteria | 1823 |
| 953 | Ga0495636_0155688 | 3300047318 | Bacteria | 1027 |
| 954 | Ga0495636_0330006 | 3300047318 | Bacteria | 717 |
| 955 | Ga0495674_0073641 | 3300047319 | Bacteria | 2943 |
| 956 | Ga0495674_0396783 | 3300047319 | Bacteria | 1114 |
| 957 | Ga0495674_1164456 | 3300047319 | Bacteria | 584 |
| 958 | Ga0495676_0000524 | 3300047321 | Bacteria | 31468 |
| 959 | Ga0495676_0008425 | 3300047321 | Bacteria | 9452 |
| 960 | Ga0495676_0115209 | 3300047321 | Bacteria | 1965 |
| 961 | Ga0495680_0000493 | 3300047322 | Bacteria | 44550 |
| 962 | Ga0495680_0024349 | 3300047322 | Bacteria | 5022 |
| 963 | Ga0495680_0309881 | 3300047322 | Bacteria | 1107 |
| 964 | Ga0495680_0453274 | 3300047322 | Bacteria | 877 |
| 965 | Ga0495683_0078158 | 3300047323 | Bacteria | 1617 |
| 966 | Ga0495683_0090593 | 3300047323 | Bacteria | 1482 |
| 967 | Ga0495683_0091728 | 3300047323 | Bacteria | 1471 |
| 968 | Ga0495687_015717 | 3300047443 | Bacteria | 3837 |
| 969 | Ga0495687_080483 | 3300047443 | Bacteria | 1277 |
| 970 | Ga0495675_0001039 | 3300047444 | Bacteria | 16857 |
| 971 | Ga0495675_0014932 | 3300047444 | Bacteria | 4911 |
| 972 | Ga0495675_0018548 | 3300047444 | Bacteria | 4417 |
| 973 | Ga0495675_0045858 | 3300047444 | Bacteria | 2783 |
| 974 | Ga0495675_0296713 | 3300047444 | Bacteria | 961 |
| 975 | Ga0495675_0579498 | 3300047444 | Bacteria | 638 |
| 976 | Ga0495677_0144201 | 3300047445 | Bacteria | 915 |
| 977 | Ga0495685_001204 | 3300047447 | Bacteria | 7927 |
| 978 | Ga0495685_005170 | 3300047447 | Bacteria | 4251 |
| 979 | Ga0495685_024300 | 3300047447 | Bacteria | 2085 |
| 980 | Ga0495685_076711 | 3300047447 | Bacteria | 1115 |
| 981 | Ga0495681_0004935 | 3300047470 | Bacteria | 9005 |
| 982 | Ga0495681_0023963 | 3300047470 | Bacteria | 3227 |
| 983 | Ga0495681_0124153 | 3300047470 | Bacteria | 1105 |
| 984 | Ga0495681_0213813 | 3300047470 | Bacteria | 776 |
| 985 | Ga0495684_0045075 | 3300047471 | Bacteria | 3375 |
| 986 | Ga0495684_0061846 | 3300047471 | Bacteria | 2848 |
| 987 | Ga0495684_0096557 | 3300047471 | Bacteria | 2236 |
| 988 | Ga0495686_0074343 | 3300047472 | Bacteria | 2085 |
| 989 | Ga0495686_0185450 | 3300047472 | Bacteria | 1203 |
| 990 | Ga0495686_0333011 | 3300047472 | Bacteria | 829 |
| 991 | Ga0495593_0001104 | 3300047673 | Bacteria | 15747 |
| 992 | Ga0495593_0175616 | 3300047673 | Bacteria | 1079 |
| 993 | Ga0495593_0246614 | 3300047673 | Bacteria | 894 |
| 994 | Ga0495593_0277537 | 3300047673 | Bacteria | 838 |
| 995 | Ga0495602_0000165 | 3300048088 | Bacteria | 61487 |
| 996 | Ga0495602_0017258 | 3300048088 | Bacteria | 7238 |
| 997 | Ga0495602_0094547 | 3300048088 | Bacteria | 2469 |
| 998 | Ga0495602_0144585 | 3300048088 | Bacteria | 1878 |
| 999 | Ga0495602_0425283 | 3300048088 | Bacteria | 942 |
| 1000 | Ga0495602_0463026 | 3300048088 | Bacteria | 893 |
| 1001 | Ga0495614_0000236 | 3300048089 | Bacteria | 21472 |
| 1002 | Ga0495614_0071552 | 3300048089 | Bacteria | 1495 |
| 1003 | Ga0495614_0106387 | 3300048089 | Bacteria | 1229 |
| 1004 | Ga0495614_0173557 | 3300048089 | Bacteria | 968 |
| 1005 | Ga0496100_0002555 | 3300048903 | Bacteria | 9274 |
| 1006 | Ga0496100_0115098 | 3300048903 | Bacteria | 1874 |
| 1007 | Ga0496100_0326600 | 3300048903 | Bacteria | 1154 |
| 1008 | Ga0496100_0876821 | 3300048903 | Bacteria | 704 |
| 1009 | Ga0496100_1538416 | 3300048903 | Bacteria | 526 |
| 1010 | Ga0496101_0030183 | 3300048904 | Bacteria | 3798 |
| 1011 | Ga0496101_0170148 | 3300048904 | Bacteria | 1674 |
| 1012 | Ga0496101_0192395 | 3300048904 | Bacteria | 1575 |
| 1013 | Ga0496102_0000222 | 3300048905 | Bacteria | 75152 |
| 1014 | Ga0496102_0027914 | 3300048905 | Bacteria | 5042 |
| 1015 | Ga0496102_0170447 | 3300048905 | Bacteria | 2049 |
| 1016 | Ga0496103_0000179 | 3300048906 | Bacteria | 64934 |
| 1017 | Ga0496103_0021797 | 3300048906 | Bacteria | 3856 |
| 1018 | Ga0496104_0077464 | 3300048907 | Bacteria | 3168 |
| 1019 | Ga0496104_0179122 | 3300048907 | Bacteria | 2030 |
| 1020 | Ga0496104_0217429 | 3300048907 | Bacteria | 1823 |
| 1021 | Ga0496104_0247756 | 3300048907 | Bacteria | 1694 |
| 1022 | Ga0496104_0453921 | 3300048907 | Bacteria | 1193 |
| 1023 | Ga0496104_0819369 | 3300048907 | Bacteria | 837 |
| 1024 | Ga0496105_0040289 | 3300048908 | Bacteria | 3851 |
| 1025 | Ga0496105_0055044 | 3300048908 | Bacteria | 3285 |
| 1026 | Ga0496105_0236184 | 3300048908 | Bacteria | 1484 |
| 1027 | Ga0496105_0345550 | 3300048908 | Bacteria | 1189 |
| 1028 | Ga0496105_0814976 | 3300048908 | Bacteria | 709 |
| 1029 | Ga0496106_0190924 | 3300048909 | Bacteria | 1628 |
| 1030 | Ga0496106_0331240 | 3300048909 | Bacteria | 1222 |
| 1031 | Ga0496106_0473192 | 3300048909 | Bacteria | 1007 |
| 1032 | Ga0496107_0144454 | 3300048910 | Bacteria | 1759 |
| 1033 | Ga0496107_0270229 | 3300048910 | Bacteria | 1265 |
| 1034 | Ga0496107_0302108 | 3300048910 | Bacteria | 1191 |
| 1035 | Ga0496108_0028685 | 3300048911 | Bacteria | 4605 |
| 1036 | Ga0496108_0086688 | 3300048911 | Bacteria | 2658 |
| 1037 | Ga0496108_0274069 | 3300048911 | Bacteria | 1469 |
| 1038 | Ga0496108_0339622 | 3300048911 | Bacteria | 1310 |
| 1039 | Ga0496108_0509882 | 3300048911 | Bacteria | 1050 |
| 1040 | Ga0496108_0619380 | 3300048911 | Bacteria | 942 |
| 1041 | Ga0496108_0948933 | 3300048911 | Bacteria | 736 |
| 1042 | Ga0496108_1206675 | 3300048911 | Bacteria | 639 |
| 1043 | Ga0496108_1787838 | 3300048911 | Bacteria | 503 |
| 1044 | Ga0496109_0073164 | 3300048912 | Bacteria | 3149 |
| 1045 | Ga0496109_0224389 | 3300048912 | Bacteria | 1767 |
| 1046 | Ga0496109_0246883 | 3300048912 | Bacteria | 1681 |
| 1047 | Ga0496109_1692959 | 3300048912 | Bacteria | 566 |
| 1048 | Ga0496110_0057914 | 3300048913 | Bacteria | 3412 |
| 1049 | Ga0496110_0062978 | 3300048913 | Bacteria | 3277 |
| 1050 | Ga0496110_0225945 | 3300048913 | Bacteria | 1702 |
| 1051 | Ga0496110_0396979 | 3300048913 | Bacteria | 1257 |
| 1052 | Ga0496110_0529913 | 3300048913 | Bacteria | 1071 |
| 1053 | Ga0496110_0669031 | 3300048913 | Bacteria | 939 |
| 1054 | Ga0496111_0147266 | 3300048914 | Bacteria | 1746 |
| 1055 | Ga0496111_0178303 | 3300048914 | Bacteria | 1579 |
| 1056 | Ga0496112_0647208 | 3300048915 | Bacteria | 987 |
| 1057 | Ga0496112_0966670 | 3300048915 | Bacteria | 772 |
| 1058 | Ga0496113_0294154 | 3300048916 | Bacteria | 1300 |
| 1059 | Ga0496114_0111481 | 3300048917 | Bacteria | 2345 |
| 1060 | Ga0496114_0142574 | 3300048917 | Bacteria | 2075 |
| 1061 | Ga0496114_0194222 | 3300048917 | Bacteria | 1776 |
| 1062 | Ga0496114_0325661 | 3300048917 | Bacteria | 1358 |
| 1063 | Ga0496114_0614621 | 3300048917 | Bacteria | 958 |
| 1064 | Ga0496115_0130815 | 3300048918 | Bacteria | 2068 |
| 1065 | Ga0496116_0000481 | 3300048919 | Bacteria | 54969 |
| 1066 | Ga0496117_0000242 | 3300048920 | Bacteria | 103350 |
| 1067 | Ga0496117_0103679 | 3300048920 | Bacteria | 1792 |
| 1068 | Ga0496118_0000412 | 3300048921 | Bacteria | 71447 |
| 1069 | Ga0496119_0013023 | 3300048922 | Bacteria | 6676 |
| 1070 | Ga0496119_0142549 | 3300048922 | Bacteria | 1292 |
| 1071 | Ga0496119_0418925 | 3300048922 | Bacteria | 636 |
| 1072 | Ga0496120_0003152 | 3300048923 | Bacteria | 15386 |
| 1073 | Ga0496120_0086969 | 3300048923 | Bacteria | 1679 |
| 1074 | Ga0496121_0002113 | 3300048924 | Bacteria | 31255 |
| 1075 | Ga0496121_0029846 | 3300048924 | Bacteria | 5026 |
| 1076 | Ga0496121_0196381 | 3300048924 | Bacteria | 1442 |
| 1077 | Ga0496122_0107771 | 3300048925 | Bacteria | 1840 |
| 1078 | Ga0496122_0249366 | 3300048925 | Bacteria | 994 |
| 1079 | Ga0496124_0028247 | 3300048927 | Bacteria | 5021 |
| 1080 | Ga0496125_0000061 | 3300048928 | Bacteria | 262739 |
| 1081 | Ga0496125_0077747 | 3300048928 | Bacteria | 2555 |
| 1082 | Ga0496125_0136947 | 3300048928 | Bacteria | 1711 |
| 1083 | Ga0496126_0000521 | 3300048929 | Bacteria | 74946 |
| 1084 | Ga0496126_0048031 | 3300048929 | Bacteria | 3905 |
| 1085 | Ga0496126_0213496 | 3300048929 | Bacteria | 1623 |
| 1086 | Ga0496126_0280302 | 3300048929 | Bacteria | 1381 |
| 1087 | Ga0496126_0551673 | 3300048929 | Bacteria | 914 |
| 1088 | Ga0501306_003481 | 3300049127 | Bacteria | 1699 |
| 1089 | Ga0501306_004717 | 3300049127 | Bacteria | 1538 |
| 1090 | Ga0501306_007377 | 3300049127 | Bacteria | 1316 |
| 1091 | Ga0501306_019156 | 3300049127 | Bacteria | 942 |
| 1092 | Ga0501308_009812 | 3300049128 | Bacteria | 1052 |
| 1093 | Ga0501308_032658 | 3300049128 | Bacteria | 705 |
| 1094 | Ga0501310_011119 | 3300049130 | Bacteria | 1015 |
| 1095 | Ga0501310_019890 | 3300049130 | Bacteria | 830 |
| 1096 | Ga0501305_076720 | 3300049161 | Bacteria | 595 |
| 1097 | Ga0501307_021176 | 3300049162 | Bacteria | 847 |
| 1098 | Ga0501311_039962 | 3300049527 | Bacteria | 708 |
| 1099 | Ga0501311_047315 | 3300049527 | Bacteria | 666 |
| 1100 | Ga0501311_103100 | 3300049527 | Bacteria | 507 |
| 1101 | Ga0501312_014058 | 3300049528 | Bacteria | 1120 |
| 1102 | Ga0501313_011492 | 3300049529 | Bacteria | 1022 |
| 1103 | Ga0501313_017741 | 3300049529 | Bacteria | 862 |
| 1104 | Ga0501314_009432 | 3300049530 | Bacteria | 896 |
| 1105 | Ga0501314_010761 | 3300049530 | Bacteria | 856 |
| 1106 | Ga0501314_012777 | 3300049530 | Bacteria | 808 |
| 1107 | Ga0501315_012238 | 3300049531 | Bacteria | 1059 |
| 1108 | Ga0501315_025006 | 3300049531 | Bacteria | 829 |
| 1109 | Ga0501315_088999 | 3300049531 | Bacteria | 533 |
| 1110 | Ga0501316_007869 | 3300049532 | Bacteria | 1167 |
| 1111 | Ga0501316_014305 | 3300049532 | Bacteria | 945 |
| 1112 | Ga0501316_023088 | 3300049532 | Bacteria | 796 |
| 1113 | Ga0501316_037117 | 3300049532 | Bacteria | 669 |
| 1114 | Ga0501316_041856 | 3300049532 | Bacteria | 641 |
| 1115 | Ga0501317_016309 | 3300049533 | Bacteria | 962 |
| 1116 | Ga0501317_018583 | 3300049533 | Bacteria | 921 |
| 1117 | Ga0501317_020344 | 3300049533 | Bacteria | 894 |
| 1118 | Ga0501317_022356 | 3300049533 | Bacteria | 866 |
| 1119 | Ga0501317_047918 | 3300049533 | Bacteria | 671 |
| 1120 | Ga0501317_049729 | 3300049533 | Bacteria | 663 |
| 1121 | Ga0501318_004377 | 3300049534 | Bacteria | 1351 |
| 1122 | Ga0501318_019704 | 3300049534 | Bacteria | 843 |
| 1123 | Ga0501318_061921 | 3300049534 | Bacteria | 576 |
| 1124 | Ga0501318_091233 | 3300049534 | Bacteria | 505 |
| 1125 | Ga0501319_001694 | 3300049535 | Bacteria | 1313 |
| 1126 | Ga0501320_007687 | 3300049536 | Bacteria | 1044 |
| 1127 | Ga0501320_022575 | 3300049536 | Bacteria | 739 |
| 1128 | Ga0501321_003292 | 3300049537 | Bacteria | 1467 |
| 1129 | Ga0501321_018131 | 3300049537 | Bacteria | 852 |
| 1130 | Ga0501321_035687 | 3300049537 | Bacteria | 682 |
| 1131 | Ga0501322_006261 | 3300049538 | Bacteria | 843 |
| 1132 | Ga0501322_010435 | 3300049538 | Bacteria | 715 |
| 1133 | Ga0501323_001352 | 3300049539 | Bacteria | 2149 |
| 1134 | Ga0501323_014500 | 3300049539 | Bacteria | 986 |
| 1135 | Ga0501323_042315 | 3300049539 | Bacteria | 671 |
| 1136 | Ga0501323_054099 | 3300049539 | Bacteria | 615 |
| 1137 | Ga0501323_072793 | 3300049539 | Bacteria | 552 |
| 1138 | Ga0501324_004031 | 3300049540 | Bacteria | 1152 |
| 1139 | Ga0501324_026659 | 3300049540 | Bacteria | 614 |
| 1140 | Ga0501324_029688 | 3300049540 | Bacteria | 592 |
| 1141 | Ga0501031_0002886 | 3300049568 | Bacteria | 10985 |
| 1142 | Ga0501031_0007255 | 3300049568 | Bacteria | 7233 |
| 1143 | Ga0501031_0379675 | 3300049568 | Bacteria | 914 |
| 1144 | Ga0501031_0596730 | 3300049568 | Bacteria | 710 |
| 1145 | Ga0501031_0667215 | 3300049568 | Bacteria | 668 |
| 1146 | Ga0501032_0050350 | 3300049569 | Bacteria | 2809 |
| 1147 | Ga0501032_0443877 | 3300049569 | Bacteria | 831 |
| 1148 | Ga0501033_0029364 | 3300049570 | Bacteria | 4132 |
| 1149 | Ga0501033_0046139 | 3300049570 | Bacteria | 3240 |
| 1150 | Ga0501033_0108642 | 3300049570 | Bacteria | 2020 |
| 1151 | Ga0501033_0131000 | 3300049570 | Bacteria | 1817 |
| 1152 | Ga0501033_0139669 | 3300049570 | Bacteria | 1752 |
| 1153 | Ga0501034_0001747 | 3300049571 | Bacteria | 27891 |
| 1154 | Ga0501034_0011927 | 3300049571 | Bacteria | 8985 |
| 1155 | Ga0501034_0082768 | 3300049571 | Bacteria | 3211 |
| 1156 | Ga0501034_0091917 | 3300049571 | Bacteria | 3032 |
| 1157 | Ga0501034_0102271 | 3300049571 | Bacteria | 2858 |
| 1158 | Ga0501034_0105403 | 3300049571 | Bacteria | 2812 |
| 1159 | Ga0501034_0135486 | 3300049571 | Bacteria | 2443 |
| 1160 | Ga0501034_0444686 | 3300049571 | Bacteria | 1214 |
| 1161 | Ga0501034_1172366 | 3300049571 | Bacteria | 647 |
| 1162 | Ga0501036_0001851 | 3300049572 | Bacteria | 16402 |
| 1163 | Ga0501036_0002873 | 3300049572 | Bacteria | 13656 |
| 1164 | Ga0501036_0018651 | 3300049572 | Bacteria | 5817 |
| 1165 | Ga0501036_0223089 | 3300049572 | Bacteria | 1582 |
| 1166 | Ga0501036_0270428 | 3300049572 | Bacteria | 1423 |
| 1167 | Ga0501036_0446097 | 3300049572 | Bacteria | 1078 |
| 1168 | Ga0501036_0750423 | 3300049572 | Bacteria | 805 |
| 1169 | Ga0501037_0030371 | 3300049573 | Bacteria | 3994 |
| 1170 | Ga0501037_0933710 | 3300049573 | Bacteria | 567 |
| 1171 | Ga0501038_0005037 | 3300049574 | Bacteria | 12273 |
| 1172 | Ga0501038_0023851 | 3300049574 | Bacteria | 5462 |
| 1173 | Ga0501038_0084137 | 3300049574 | Bacteria | 2677 |
| 1174 | Ga0501038_0280743 | 3300049574 | Bacteria | 1311 |
| 1175 | Ga0501038_0656036 | 3300049574 | Bacteria | 789 |
| 1176 | Ga0501038_0694193 | 3300049574 | Bacteria | 763 |
| 1177 | Ga0501039_0017759 | 3300049575 | Bacteria | 5457 |
| 1178 | Ga0501039_0045595 | 3300049575 | Bacteria | 3387 |
| 1179 | Ga0501039_0082165 | 3300049575 | Bacteria | 2508 |
| 1180 | Ga0501039_0138273 | 3300049575 | Bacteria | 1913 |
| 1181 | Ga0501039_0351309 | 3300049575 | Bacteria | 1159 |
| 1182 | Ga0501039_0626837 | 3300049575 | Bacteria | 842 |
| 1183 | Ga0501039_1392292 | 3300049575 | Bacteria | 540 |
| 1184 | Ga0501040_0027714 | 3300049576 | Bacteria | 3815 |
| 1185 | Ga0501040_0404015 | 3300049576 | Bacteria | 981 |
| 1186 | Ga0501040_0753992 | 3300049576 | Bacteria | 704 |
| 1187 | Ga0501040_0767513 | 3300049576 | Bacteria | 697 |
| 1188 | Ga0501040_0860560 | 3300049576 | Bacteria | 656 |
| 1189 | Ga0501041_0002007 | 3300049577 | Bacteria | 11447 |
| 1190 | Ga0501041_0014490 | 3300049577 | Bacteria | 4682 |
| 1191 | Ga0501042_0010139 | 3300049578 | Bacteria | 6303 |
| 1192 | Ga0501042_0015522 | 3300049578 | Bacteria | 5216 |
| 1193 | Ga0501042_1378547 | 3300049578 | Bacteria | 514 |
| 1194 | Ga0501043_0008372 | 3300049579 | Bacteria | 8143 |
| 1195 | Ga0501043_0008818 | 3300049579 | Bacteria | 7938 |
| 1196 | Ga0501043_0118648 | 3300049579 | Bacteria | 2075 |
| 1197 | Ga0501043_0542723 | 3300049579 | Bacteria | 865 |
| 1198 | Ga0501043_0593942 | 3300049579 | Bacteria | 818 |
| 1199 | Ga0501043_0648231 | 3300049579 | Bacteria | 776 |
| 1200 | Ga0501046_0187191 | 3300049580 | Bacteria | 1546 |
| 1201 | Ga0501046_0438930 | 3300049580 | Bacteria | 939 |
| 1202 | Ga0501046_1164076 | 3300049580 | Bacteria | 531 |
| 1203 | Ga0501047_0050497 | 3300049581 | Bacteria | 4017 |
| 1204 | Ga0501047_0108025 | 3300049581 | Bacteria | 2664 |
| 1205 | Ga0501047_0794727 | 3300049581 | Bacteria | 761 |
| 1206 | Ga0501047_0803568 | 3300049581 | Bacteria | 755 |
| 1207 | Ga0501048_0025883 | 3300049582 | Bacteria | 4274 |
| 1208 | Ga0501048_0266912 | 3300049582 | Bacteria | 1216 |
| 1209 | Ga0501048_0317278 | 3300049582 | Bacteria | 1110 |
| 1210 | Ga0501067_0840002 | 3300049583 | Bacteria | 518 |
| 1211 | Ga0501068_0435871 | 3300049584 | Bacteria | 847 |
| 1212 | Ga0501068_0523927 | 3300049584 | Bacteria | 770 |
| 1213 | Ga0501069_0318676 | 3300049585 | Bacteria | 913 |
| 1214 | Ga0501070_0002423 | 3300049586 | Bacteria | 16361 |
| 1215 | Ga0501070_0004597 | 3300049586 | Bacteria | 11833 |
| 1216 | Ga0501070_0013006 | 3300049586 | Bacteria | 7013 |
| 1217 | Ga0501070_0048446 | 3300049586 | Bacteria | 3530 |
| 1218 | Ga0501070_0469133 | 3300049586 | Bacteria | 1013 |
| 1219 | Ga0501070_0470881 | 3300049586 | Bacteria | 1011 |
| 1220 | Ga0501071_0022953 | 3300049587 | Bacteria | 4353 |
| 1221 | Ga0501071_0355265 | 3300049587 | Bacteria | 1115 |
| 1222 | Ga0501071_1237690 | 3300049587 | Bacteria | 577 |
| 1223 | Ga0501071_1337610 | 3300049587 | Bacteria | 553 |
| 1224 | Ga0501072_0012315 | 3300049588 | Bacteria | 6536 |
| 1225 | Ga0501072_0031891 | 3300049588 | Bacteria | 4125 |
| 1226 | Ga0501072_0094423 | 3300049588 | Bacteria | 2376 |
| 1227 | Ga0501072_1027692 | 3300049588 | Bacteria | 642 |
| 1228 | Ga0501072_1383401 | 3300049588 | Bacteria | 544 |
| 1229 | Ga0501073_0440627 | 3300049589 | Bacteria | 900 |
| 1230 | Ga0501073_0660761 | 3300049589 | Bacteria | 721 |
| 1231 | Ga0501074_0018631 | 3300049590 | Bacteria | 5044 |
| 1232 | Ga0501074_0030737 | 3300049590 | Bacteria | 3891 |
| 1233 | Ga0501074_0077707 | 3300049590 | Bacteria | 2382 |
| 1234 | Ga0501074_0628546 | 3300049590 | Bacteria | 759 |
| 1235 | Ga0501074_0903776 | 3300049590 | Bacteria | 621 |
| 1236 | Ga0501075_0035364 | 3300049591 | Bacteria | 3725 |
| 1237 | Ga0501075_0085048 | 3300049591 | Bacteria | 2396 |
| 1238 | Ga0501075_0355200 | 3300049591 | Bacteria | 1117 |
| 1239 | Ga0501075_1092788 | 3300049591 | Bacteria | 606 |
| 1240 | Ga0501076_0022853 | 3300049592 | Bacteria | 4811 |
| 1241 | Ga0501076_0257966 | 3300049592 | Bacteria | 1427 |
| 1242 | Ga0501076_0567965 | 3300049592 | Bacteria | 935 |
| 1243 | Ga0501077_0010298 | 3300049593 | Bacteria | 5818 |
| 1244 | Ga0501077_0117775 | 3300049593 | Bacteria | 1683 |
| 1245 | Ga0501077_0728607 | 3300049593 | Bacteria | 637 |
| 1246 | Ga0501202_085562 | 3300049652 | Bacteria | 747 |
| 1247 | Ga0501235_197576 | 3300049669 | Bacteria | 543 |
| 1248 | Ga0501250_008668 | 3300049680 | Bacteria | 1128 |
| 1249 | Ga0501079_0016088 | 3300049741 | Bacteria | 5716 |
| 1250 | Ga0501079_0089420 | 3300049741 | Bacteria | 2385 |
| 1251 | Ga0501079_0123914 | 3300049741 | Bacteria | 2010 |
| 1252 | Ga0501080_0000238 | 3300049742 | Bacteria | 41304 |
| 1253 | Ga0501080_1311609 | 3300049742 | Bacteria | 620 |
| 1254 | Ga0501081_0121714 | 3300049743 | Bacteria | 1859 |
| 1255 | Ga0501081_0951353 | 3300049743 | Bacteria | 648 |
| 1256 | Ga0501083_0024234 | 3300049744 | Bacteria | 4206 |
| 1257 | Ga0501083_0523499 | 3300049744 | Bacteria | 772 |
| 1258 | Ga0501083_1048680 | 3300049744 | Bacteria | 531 |
| 1259 | Ga0501035_0028585 | 3300049822 | Bacteria | 5089 |
| 1260 | Ga0501035_0036349 | 3300049822 | Bacteria | 4464 |
| 1261 | Ga0501035_0153957 | 3300049822 | Bacteria | 1993 |
| 1262 | Ga0501035_0163161 | 3300049822 | Bacteria | 1928 |
| 1263 | Ga0501035_0223604 | 3300049822 | Bacteria | 1606 |
| 1264 | Ga0501044_0004971 | 3300049823 | Bacteria | 14867 |
| 1265 | Ga0501044_0070782 | 3300049823 | Bacteria | 3547 |
| 1266 | Ga0501044_0337997 | 3300049823 | Bacteria | 1427 |
| 1267 | Ga0501044_0350648 | 3300049823 | Bacteria | 1395 |
| 1268 | Ga0501044_1664640 | 3300049823 | Bacteria | 503 |
| 1269 | Ga0501045_0009086 | 3300049824 | Bacteria | 6943 |
| 1270 | Ga0501045_0431279 | 3300049824 | Bacteria | 980 |
| 1271 | Ga0501045_0567744 | 3300049824 | Bacteria | 841 |
| 1272 | Ga0501045_1273252 | 3300049824 | Bacteria | 535 |
| 1273 | nmdc:mga00v17_390973_c1 | 3300050491 | Bacteria | 904 |
| 1274 | nmdc:mga00v17_46398_c1 | 3300050491 | Bacteria | 2628 |
| 1275 | nmdc:mga00v17_675260_c1 | 3300050491 | Bacteria | 663 |
| 1276 | nmdc:mga0k408_246709_c1 | 3300050493 | Bacteria | 1066 |
| 1277 | nmdc:mga06z11_395137_c1 | 3300050494 | Bacteria | 832 |
| 1278 | nmdc:mga07m45_58181_c1 | 3300050496 | Bacteria | 2187 |
| 1279 | nmdc:mga05p37_169332_c1 | 3300050507 | Bacteria | 2665 |
| 1280 | nmdc:mga09592_1481933_c1 | 3300050508 | Bacteria | 553 |
| 1281 | nmdc:mga09592_437295_c1 | 3300050508 | Bacteria | 1129 |
| 1282 | nmdc:mga09592_928045_c1 | 3300050508 | Bacteria | 730 |
| 1283 | nmdc:mga0qj67_125626_c1 | 3300050509 | Bacteria | 2076 |
| 1284 | nmdc:mga06r32_1880485_c1 | 3300050510 | Bacteria | 533 |
| 1285 | nmdc:mga08y16_101565_c1 | 3300050511 | Bacteria | 2994 |
| 1286 | nmdc:mga08y16_931049_c1 | 3300050511 | Bacteria | 853 |
| 1287 | nmdc:mga0n895_1716841_c1 | 3300050512 | Bacteria | 590 |
| 1288 | nmdc:mga0n895_203634_c1 | 3300050512 | Bacteria | 2010 |
| 1289 | nmdc:mga0n895_718113_c1 | 3300050512 | Bacteria | 994 |
| 1290 | nmdc:mga0rr50_355518_c1 | 3300050513 | Bacteria | 1232 |
| 1291 | nmdc:mga0rr50_612521_c1 | 3300050513 | Bacteria | 929 |
| 1292 | nmdc:mga08x19_1283812_c1 | 3300050514 | Bacteria | 519 |
| 1293 | nmdc:mga08x19_64295_c1 | 3300050514 | Bacteria | 2382 |
| 1294 | nmdc:mga0a205_773109_c1 | 3300050515 | Bacteria | 808 |
| 1295 | Ga0495601_0003320 | 3300053077 | Bacteria | 9205 |
| 1296 | Ga0495601_0225476 | 3300053077 | Bacteria | 1224 |
| 1297 | Ga0495612_0409133 | 3300053078 | Bacteria | 617 |
| 1298 | Ga0500610_0189401 | 3300053079 | Bacteria | 1000 |
| 1299 | Ga0500610_0321821 | 3300053079 | Bacteria | 670 |
| 1300 | Ga0495595_0009659 | 3300053084 | Bacteria | 3995 |
| 1301 | Ga0495619_0014438 | 3300053085 | Bacteria | 4989 |
| 1302 | Ga0495619_0309462 | 3300053085 | Bacteria | 1094 |
| 1303 | Ga0500578_0240734 | 3300053086 | Bacteria | 1093 |
| 1304 | Ga0500647_0169633 | 3300053091 | Bacteria | 1008 |
| 1305 | Ga0500651_0442372 | 3300053093 | Bacteria | 724 |
| 1306 | Ga0500566_0119331 | 3300053094 | Bacteria | 1423 |
| 1307 | Ga0500640_004289 | 3300053095 | Bacteria | 5157 |
| 1308 | Ga0500641_0247538 | 3300053096 | Bacteria | 748 |
| 1309 | Ga0500654_095403 | 3300053099 | Bacteria | 1299 |
| 1310 | Ga0500660_068299 | 3300053100 | Bacteria | 1677 |
| 1311 | Ga0500553_028044 | 3300053101 | Bacteria | 2826 |
| 1312 | Ga0500556_0149048 | 3300053104 | Bacteria | 921 |
| 1313 | Ga0500558_073283 | 3300053106 | Bacteria | 1408 |
| 1314 | Ga0500560_018179 | 3300053107 | Bacteria | 1955 |
| 1315 | Ga0500560_166228 | 3300053107 | Bacteria | 727 |
| 1316 | Ga0500562_030237 | 3300053108 | Bacteria | 1427 |
| 1317 | Ga0500569_033214 | 3300053109 | Bacteria | 1464 |
| 1318 | Ga0500572_022923 | 3300053111 | Bacteria | 1671 |
| 1319 | Ga0500580_130025 | 3300053113 | Bacteria | 943 |
| 1320 | Ga0500594_0096106 | 3300053118 | Bacteria | 906 |
| 1321 | Ga0500608_119833 | 3300053122 | Bacteria | 1195 |
| 1322 | Ga0500614_080259 | 3300053123 | Bacteria | 911 |
| 1323 | Ga0500614_283914 | 3300053123 | Bacteria | 519 |
| 1324 | Ga0500621_139679 | 3300053126 | Bacteria | 920 |
| 1325 | Ga0500626_219092 | 3300053128 | Bacteria | 735 |
| 1326 | Ga0500628_001255 | 3300053129 | Bacteria | 4382 |
| 1327 | Ga0500652_106897 | 3300053131 | Bacteria | 1169 |
| 1328 | Ga0500652_109803 | 3300053131 | Bacteria | 1152 |
| 1329 | Ga0500561_0001756 | 3300053137 | Bacteria | 3569 |
| 1330 | Ga0500568_0000049 | 3300053139 | Bacteria | 116515 |
| 1331 | Ga0500573_0028858 | 3300053140 | Bacteria | 3197 |
| 1332 | Ga0500573_0157639 | 3300053140 | Bacteria | 1238 |
| 1333 | Ga0500577_0251950 | 3300053142 | Bacteria | 767 |
| 1334 | Ga0500600_0022039 | 3300053149 | Bacteria | 3814 |
| 1335 | Ga0500600_0100363 | 3300053149 | Bacteria | 1528 |
| 1336 | Ga0500600_0108148 | 3300053149 | Bacteria | 1455 |
| 1337 | Ga0500600_0243487 | 3300053149 | Bacteria | 811 |
| 1338 | Ga0500603_311121 | 3300053150 | Bacteria | 511 |
| 1339 | Ga0500606_076038 | 3300053152 | Bacteria | 1136 |
| 1340 | Ga0500616_0016342 | 3300053153 | Bacteria | 4226 |
| 1341 | Ga0500616_0233930 | 3300053153 | Bacteria | 794 |
| 1342 | Ga0500624_004973 | 3300053157 | Bacteria | 1759 |
| 1343 | Ga0500633_0001249 | 3300053160 | Bacteria | 4675 |
| 1344 | Ga0500634_0038179 | 3300053161 | Bacteria | 2611 |
| 1345 | Ga0500634_0144793 | 3300053161 | Bacteria | 1119 |
| 1346 | Ga0500636_0108019 | 3300053177 | Bacteria | 1575 |
| 1347 | Ga0500636_0285216 | 3300053177 | Bacteria | 822 |
| 1348 | Ga0500656_001023 | 3300053732 | Bacteria | 2286 |
| 1349 | Ga0500565_028798 | 3300053734 | Bacteria | 718 |
| 1350 | Ga0500599_042318 | 3300053736 | Bacteria | 705 |
| 1351 | Ga0500587_002326 | 3300053739 | Bacteria | 2701 |
| 1352 | Ga0501084_0020366 | 3300054114 | Bacteria | 5531 |
| 1353 | Ga0501084_0047023 | 3300054114 | Bacteria | 3614 |
| 1354 | Ga0501084_0054198 | 3300054114 | Bacteria | 3354 |
| 1355 | Ga0501084_0765018 | 3300054114 | Bacteria | 814 |
| 1356 | Ga0501084_1672081 | 3300054114 | Bacteria | 532 |
| 1357 | Ga0590075_040684 | 3300059424 | Bacteria | 1188 |
| 1358 | Ga0587084_000250 | 3300059477 | Bacteria | 3759 |
| 1359 | Ga0587084_066492 | 3300059477 | Bacteria | 672 |
| 1360 | Ga0587070_034175 | 3300059491 | Bacteria | 939 |
| 1361 | Ga0587070_054780 | 3300059491 | Bacteria | 807 |
| 1362 | Ga0587070_066060 | 3300059491 | Bacteria | 760 |
| 1363 | Ga0587073_0162089 | 3300059492 | Bacteria | 642 |
| 1364 | Ga0587077_063671 | 3300059493 | Bacteria | 806 |
| 1365 | Ga0587080_134810 | 3300059503 | Bacteria | 559 |
| 1366 | Ga0587082_029095 | 3300059504 | Bacteria | 952 |
| 1367 | Ga0587082_088004 | 3300059504 | Bacteria | 658 |
| 1368 | Ga0587083_0048243 | 3300059505 | Bacteria | 919 |
| 1369 | Ga0587083_0081280 | 3300059505 | Bacteria | 772 |
| 1370 | Ga0587083_0126898 | 3300059505 | Bacteria | 665 |
| 1371 | Ga0587085_166781 | 3300059506 | Bacteria | 519 |
| 1372 | Ga0587088_012792 | 3300059508 | Bacteria | 1276 |
| 1373 | Ga0587089_025749 | 3300059509 | Bacteria | 841 |
| 1374 | Ga0587090_044955 | 3300059510 | Bacteria | 790 |
| 1375 | Ga0587090_069641 | 3300059510 | Bacteria | 684 |
| 1376 | Ga0587092_014110 | 3300059512 | Bacteria | 1152 |
| 1377 | Ga0587094_023924 | 3300059513 | Bacteria | 907 |
| 1378 | Ga0587095_007745 | 3300059514 | Bacteria | 860 |
| 1379 | Ga0587097_01558 | 3300059603 | Bacteria | 840 |
| 1380 | Ga0587098_015815 | 3300059604 | Bacteria | 905 |
| 1381 | Ga0587106_004245 | 3300059605 | Bacteria | 1563 |
| 1382 | Ga0587106_007117 | 3300059605 | Bacteria | 1347 |
| 1383 | Ga0587125_000712 | 3300059607 | Bacteria | 2121 |
| 1384 | Ga0587125_048344 | 3300059607 | Bacteria | 594 |
| 1385 | Ga0587129_010268 | 3300059608 | Bacteria | 721 |
| 1386 | Ga0587101_000194 | 3300059623 | Bacteria | 3568 |
| 1387 | Ga0587109_052908 | 3300059624 | Bacteria | 837 |
| 1388 | Ga0587115_022267 | 3300059626 | Bacteria | 891 |
| 1389 | Ga0587115_070533 | 3300059626 | Bacteria | 603 |
| 1390 | Ga0587117_024663 | 3300059627 | Bacteria | 866 |
| 1391 | Ga0587122_011989 | 3300059628 | Bacteria | 841 |
| 1392 | Ga0587122_013227 | 3300059628 | Bacteria | 817 |
| 1393 | Ga0587122_014879 | 3300059628 | Bacteria | 789 |
| 1394 | Ga0587122_016780 | 3300059628 | Bacteria | 761 |
| 1395 | Ga0587127_006681 | 3300059629 | Bacteria | 823 |
| 1396 | Ga0587128_015239 | 3300059630 | Bacteria | 1111 |
| 1397 | Ga0587128_020510 | 3300059630 | Bacteria | 1010 |
| 1398 | Ga0587128_071743 | 3300059630 | Bacteria | 676 |
| 1399 | Ga0587128_122781 | 3300059630 | Bacteria | 567 |
| 1400 | Ga0587130_017017 | 3300059631 | Bacteria | 761 |
| 1401 | Ga0587062_102325 | 3300059639 | Bacteria | 559 |
| 1402 | Ga0587069_031819 | 3300059642 | Bacteria | 857 |
| 1403 | Ga0587069_034852 | 3300059642 | Bacteria | 833 |
| 1404 | Ga0587075_024646 | 3300059644 | Bacteria | 919 |
| 1405 | Ga0587076_172660 | 3300059645 | Bacteria | 539 |
| 1406 | Ga0587078_044951 | 3300059646 | Bacteria | 634 |
| 1407 | Ga0587078_070099 | 3300059646 | Bacteria | 546 |
| 1408 | Ga0587100_000585 | 3300059648 | Bacteria | 1809 |
| 1409 | Ga0587105_008756 | 3300059651 | Bacteria | 740 |
| 1410 | Ga0587105_019286 | 3300059651 | Bacteria | 587 |
| 1411 | Ga0587105_032997 | 3300059651 | Bacteria | 501 |
| 1412 | Ga0587107_087875 | 3300059652 | Bacteria | 595 |
| 1413 | Ga0587110_026077 | 3300059654 | Bacteria | 690 |
| 1414 | Ga0587114_046082 | 3300059655 | Bacteria | 723 |
| 1415 | Ga0587114_066732 | 3300059655 | Bacteria | 643 |
| 1416 | Ga0587119_011068 | 3300059658 | Bacteria | 1033 |
| 1417 | Ga0587119_055512 | 3300059658 | Bacteria | 600 |
| 1418 | Ga0587120_011474 | 3300059659 | Bacteria | 763 |
| 1419 | Ga0587124_006138 | 3300059660 | Bacteria | 981 |
| 1420 | Ga0587124_042228 | 3300059660 | Bacteria | 536 |
| 1421 | Ga0587111_0006112 | 3300060346 | Bacteria | 1894 |
| 1422 | Ga0587111_0059990 | 3300060346 | Bacteria | 862 |
| 1423 | Ga0587111_0093223 | 3300060346 | Bacteria | 739 |
| 1424 | Ga0587111_0134420 | 3300060346 | Bacteria | 650 |
| 1425 | Ga0501082_0104865 | 3300060353 | Bacteria | 2446 |
| 1426 | Ga0501082_0132745 | 3300060353 | Bacteria | 2160 |
| 1427 | Ga0501082_1884131 | 3300060353 | Bacteria | 521 |
| 1428 | Ga0466962_0003148 | 3300061719 | Bacteria | 7837 |
| 1429 | Ga0466962_0035513 | 3300061719 | Bacteria | 2386 |
| 1430 | Ga0466962_0057532 | 3300061719 | Bacteria | 1856 |
| 1431 | Ga0466962_0116763 | 3300061719 | Bacteria | 1286 |
| 1432 | Ga0466962_0375414 | 3300061719 | Bacteria | 710 |
| 1433 | Ga0466962_0530393 | 3300061719 | Bacteria | 597 |
| 1434 | Ga0530510_0013846 | 3300061734 | Bacteria | 5680 |
| 1435 | Ga0530510_0092387 | 3300061734 | Bacteria | 2208 |
| 1436 | Ga0530510_0212890 | 3300061734 | Bacteria | 1436 |
| 1437 | 2517763569 | 2517572101 | Bacteria | 6884336 |
| 1438 | 2842891711 | 2842888712 | Bacteria | 4279094 |
| 1439 | 2956941863 | 2956939328 | Bacteria | 3474458 |
| 1440 | 3001119220 | 3001119090 | Bacteria | 3449530 |
| 1441 | 3001891064 | 3001889506 | Bacteria | 2975194 |
| 1442 | 8002792314 | 8002784119 | Bacteria | 9788632 |
| 1443 | 8016257469 | 8016254467 | Bacteria | 3797036 |
| 1444 | Ga0070704_101788189 | |||
| 1445 | LJQas_1014194 | |||
| 1446 | LJQas_1033148 | |||
| 1447 | JGI24740J21852_10073190 | |||
| 1448 | JGI24740J21852_10093328 | |||
| 1449 | JGI24739J22299_10068165 | |||
| 1450 | JGI24737J22298_10015151 | |||
| 1451 | JGI24735J21928_10055434 | |||
| 1452 | JGI24738J21930_10014762 | |||
| 1453 | Ga0006779J45831_101096 | |||
| 1454 | Ga0006778J45830_1019160 | |||
| 1455 | Ga0006773J48901_12202 | |||
| 1456 | Ga0006770J48903_1012779 | |||
| 1457 | Ga0006777J48905_1032659 | |||
| 1458 | rootL2_10032547 | |||
| 1459 | JGI25160J50197_1043295 | |||
| 1460 | Ga0007427J51700_100683 | |||
| 1461 | Ga0006781J51513_1001670 | |||
| 1462 | Ga0007410J51695_1035599 | |||
| 1463 | Ga0007416J51690_1037339 | |||
| 1464 | Ga0006562J51391_1011694 | |||
| 1465 | Ga0006562J51391_1176296 | |||
| 1466 | Ga0007429J51699_1009559 | |||
| 1467 | JGI25404J52841_10002732 | |||
| 1468 | Ga0032354_1025483 | |||
| 1469 | Ga0006780_1012767 | |||
| 1470 | Ga0055527_1000001 | |||
| 1471 | Ga0055529_1000065 | |||
| 1472 | JGI25405J52794_10008681 | |||
| 1473 | Ga0058863_11676597 | |||
| 1474 | Ga0058863_11874610 | |||
| 1475 | Ga0058863_11935272 | |||
| 1476 | Ga0058861_10049278 | |||
| 1477 | Ga0058860_10003778 | |||
| 1478 | Ga0058862_10078798 | |||
| 1479 | Ga0058862_10118426 | |||
| 1480 | Ga0070658_10000092 | |||
| 1481 | Ga0070658_10002776 | |||
| 1482 | Ga0070658_10205552 | |||
| 1483 | Ga0070658_10470811 | |||
| 1484 | Ga0070658_11562738 | |||
| 1485 | Ga0070683_100100946 | |||
| 1486 | Ga0070683_100515091 | |||
| 1487 | Ga0070683_100592340 | |||
| 1488 | Ga0070683_100667241 | |||
| 1489 | Ga0070683_100871583 | |||
| 1490 | Ga0070683_101476081 | |||
| 1491 | Ga0070690_101627338 | |||
| 1492 | Ga0068869_100265062 | |||
| 1493 | Ga0070680_100000403 | |||
| 1494 | Ga0070680_100211817 | |||
| 1495 | Ga0070682_100167871 | |||
| 1496 | Ga0070682_100305834 | |||
| 1497 | Ga0070682_100376963 | |||
| 1498 | Ga0070682_100661753 | |||
| 1499 | Ga0070682_100723148 | |||
| 1500 | Ga0070682_100903230 | |||
| 1501 | Ga0068868_100471448 | |||
| 1502 | Ga0068868_100606395 | |||
| 1503 | Ga0070660_100308392 | |||
| 1504 | Ga0070689_102080247 | |||
| 1505 | Ga0070691_10987020 | |||
| 1506 | Ga0070687_100092980 | |||
| 1507 | Ga0070692_10369427 | |||
| 1508 | Ga0070668_100314078 | |||
| 1509 | Ga0070668_100726423 | |||
| 1510 | Ga0070675_100190511 | |||
| 1511 | Ga0070675_101435953 | |||
| 1512 | Ga0070671_100002585 | |||
| 1513 | Ga0070674_100186377 | |||
| 1514 | Ga0070674_100895236 | |||
| 1515 | Ga0070667_100164713 | |||
| 1516 | Ga0070709_10355995 | |||
| 1517 | Ga0070714_100001465 | |||
| 1518 | Ga0070714_100905124 | |||
| 1519 | Ga0070714_102136128 | |||
| 1520 | Ga0070713_100184035 | |||
| 1521 | Ga0070710_10266242 | |||
| 1522 | Ga0070711_100111244 | |||
| 1523 | Ga0070700_100586016 | |||
| 1524 | Ga0070694_100770397 | |||
| 1525 | Ga0070663_100184012 | |||
| 1526 | Ga0070663_100500907 | |||
| 1527 | Ga0070663_100604636 | |||
| 1528 | Ga0070678_100568466 | |||
| 1529 | Ga0070678_100936525 | |||
| 1530 | Ga0070678_102121013 | |||
| 1531 | Ga0070662_100853253 | |||
| 1532 | Ga0070681_10018417 | |||
| 1533 | Ga0070681_10032811 | |||
| 1534 | Ga0068867_101495604 | |||
| 1535 | Ga0070685_10172560 | |||
| 1536 | Ga0070685_10275792 | |||
| 1537 | Ga0070698_100050203 | |||
| 1538 | Ga0070698_100816766 | |||
| 1539 | Ga0070679_100000591 | |||
| 1540 | Ga0070679_100003323 | |||
| 1541 | Ga0070679_100943019 | |||
| 1542 | Ga0070684_100266548 | |||
| 1543 | Ga0070684_100644801 | |||
| 1544 | Ga0068853_100091750 | |||
| 1545 | Ga0070672_100261184 | |||
| 1546 | Ga0070686_100782642 | |||
| 1547 | Ga0070693_100309508 | |||
| 1548 | Ga0070665_100005910 | |||
| 1549 | Ga0070665_100963511 | |||
| 1550 | Ga0070665_101117060 | |||
| 1551 | Ga0068855_100805807 | |||
| 1552 | Ga0068855_100941078 | |||
| 1553 | Ga0068855_101468847 | |||
| 1554 | Ga0068855_101637704 | |||
| 1555 | Ga0070664_100161857 | |||
| 1556 | Ga0070664_100716853 | |||
| 1557 | Ga0068857_100213364 | |||
| 1558 | Ga0068857_100215916 | |||
| 1559 | Ga0068857_101956741 | |||
| 1560 | Ga0068854_100488666 | |||
| 1561 | Ga0068856_101071637 | |||
| 1562 | Ga0068856_101084728 | |||
| 1563 | Ga0068856_101446489 | |||
| 1564 | Ga0070702_100261013 | |||
| 1565 | Ga0068852_100267376 | |||
| 1566 | Ga0068852_100308948 | |||
| 1567 | Ga0068852_100802122 | |||
| 1568 | Ga0068852_100931236 | |||
| 1569 | Ga0068859_100385328 | |||
| 1570 | Ga0068859_100981114 | |||
| 1571 | Ga0068859_102212824 | |||
| 1572 | Ga0068866_11326965 | |||
| 1573 | Ga0068861_100330214 | |||
| 1574 | Ga0068861_100722345 | |||
| 1575 | Ga0068851_10343743 | |||
| 1576 | Ga0068870_10216843 | |||
| 1577 | Ga0068870_10586055 | |||
| 1578 | Ga0068863_100002283 | |||
| 1579 | Ga0068863_101244520 | |||
| 1580 | Ga0068860_100041221 | |||
| 1581 | Ga0068860_100560823 | |||
| 1582 | Ga0068862_100386362 | |||
| 1583 | Ga0068862_100686570 | |||
| 1584 | Ga0081455_10001106 | |||
| 1585 | Ga0081455_10930696 | |||
| 1586 | Ga0081538_10275024 | |||
| 1587 | Ga0081540_1000405 | |||
| 1588 | Ga0081540_1002965 | |||
| 1589 | Ga0070717_10054864 | |||
| 1590 | Ga0070717_11369484 | |||
| 1591 | Ga0075363_100407546 | |||
| 1592 | Ga0075432_10041263 | |||
| 1593 | Ga0070715_10318394 | |||
| 1594 | Ga0070712_100015788 | |||
| 1595 | Ga0075370_10038886 | |||
| 1596 | Ga0075370_10313016 | |||
| 1597 | Ga0075428_100026617 | |||
| 1598 | Ga0075428_100107082 | |||
| 1599 | Ga0075430_100250162 | |||
| 1600 | Ga0075430_101739128 | |||
| 1601 | Ga0075431_100126596 | |||
| 1602 | Ga0075433_10194652 | |||
| 1603 | Ga0075433_11167486 | |||
| 1604 | Ga0075434_100526456 | |||
| 1605 | Ga0075434_101401699 | |||
| 1606 | Ga0075429_100051179 | |||
| 1607 | Ga0075429_100557017 | |||
| 1608 | Ga0075429_101404488 | |||
| 1609 | Ga0068865_100413367 | |||
| 1610 | Ga0075436_100071720 | |||
| 1611 | Ga0097620_100385341 | |||
| 1612 | Ga0097620_100981123 | |||
| 1613 | Ga0097620_102213027 | |||
| 1614 | Ga0099826_10070429 | |||
| 1615 | Ga0075435_100084339 | |||
| 1616 | Ga0099795_10175062 | |||
| 1617 | Ga0105251_10046141 | |||
| 1618 | Ga0105251_10127611 | |||
| 1619 | Ga0105244_10075453 | |||
| 1620 | Ga0105250_10158816 | |||
| 1621 | Ga0105240_12053242 | |||
| 1622 | Ga0111539_10104076 | |||
| 1623 | Ga0111539_10635837 | |||
| 1624 | Ga0111539_12434729 | |||
| 1625 | Ga0105245_10022104 | |||
| 1626 | Ga0105245_10441200 | |||
| 1627 | Ga0105245_10647593 | |||
| 1628 | Ga0105245_11469337 | |||
| 1629 | Ga0105247_10261583 | |||
| 1630 | Ga0105247_10779596 | |||
| 1631 | Ga0114129_10110200 | |||
| 1632 | Ga0114129_11052873 | |||
| 1633 | Ga0105243_10015409 | |||
| 1634 | Ga0105243_10198180 | |||
| 1635 | Ga0105243_10466530 | |||
| 1636 | Ga0105243_12509205 | |||
| 1637 | Ga0105243_13041843 | |||
| 1638 | Ga0105241_10779767 | |||
| 1639 | Ga0105242_10700149 | |||
| 1640 | Ga0105248_10048505 | |||
| 1641 | Ga0105248_10996709 | |||
| 1642 | Ga0105248_11440999 | |||
| 1643 | Ga0105248_11753747 | |||
| 1644 | Ga0105237_10567703 | |||
| 1645 | Ga0105237_10927228 | |||
| 1646 | Ga0105238_11473407 | |||
| 1647 | Ga0105238_11642336 | |||
| 1648 | Ga0105238_11718653 | |||
| 1649 | Ga0105238_12779377 | |||
| 1650 | Ga0105249_11626505 | |||
| 1651 | Ga0105249_11690895 | |||
| 1652 | Ga0105249_11839859 | |||
| 1653 | Ga0105249_13005227 | |||
| 1654 | Ga0105035_109087 | |||
| 1655 | Ga0105239_10399074 | |||
| 1656 | Ga0105239_10564734 | |||
| 1657 | Ga0105239_10918934 | |||
| 1658 | Ga0105246_10121802 | |||
| 1659 | Ga0105246_10516710 | |||
| 1660 | Ga0105246_11114804 | |||
| 1661 | Ga0105246_11206286 | |||
| 1662 | Ga0105246_11689503 | |||
| 1663 | Ga0105246_12459318 | |||
| 1664 | Ga0157328_1010435 | |||
| 1665 | Ga0157318_1024565 | |||
| 1666 | Ga0157343_1006504 | |||
| 1667 | Ga0157345_1020668 | |||
| 1668 | Ga0157324_1017785 | |||
| 1669 | Ga0157338_1009093 | |||
| 1670 | Ga0154018_104492 | |||
| 1671 | Ga0154019_109330 | |||
| 1672 | Ga0154012_169153 | |||
| 1673 | Ga0154010_123501 | |||
| 1674 | Ga0154010_150777 | |||
| 1675 | Ga0157371_10798101 | |||
| 1676 | Ga0157369_10001098 | |||
| 1677 | Ga0157369_10116316 | |||
| 1678 | Ga0157369_10130572 | |||
| 1679 | Ga0157369_10137927 | |||
| 1680 | Ga0157369_10204676 | |||
| 1681 | Ga0157369_10220252 | |||
| 1682 | Ga0157369_10313236 | |||
| 1683 | Ga0157369_10610401 | |||
| 1684 | Ga0157374_11824123 | |||
| 1685 | Ga0157374_12494391 | |||
| 1686 | Ga0163162_10842289 | |||
| 1687 | Ga0163162_11004345 | |||
| 1688 | Ga0157372_10130144 | |||
| 1689 | Ga0157372_10130650 | |||
| 1690 | Ga0157372_10375382 | |||
| 1691 | Ga0157372_10380456 | |||
| 1692 | Ga0157372_10461374 | |||
| 1693 | Ga0157372_10514883 | |||
| 1694 | Ga0157372_13110834 | |||
| 1695 | Ga0157375_10257655 | |||
| 1696 | Ga0157375_10649606 | |||
| 1697 | Ga0157375_10726443 | |||
| 1698 | Ga0157375_11204296 | |||
| 1699 | Ga0157375_11464072 | |||
| 1700 | Ga0157375_12058734 | |||
| 1701 | Ga0163163_11298894 | |||
| 1702 | Ga0163163_11395587 | |||
| 1703 | Ga0157380_11559696 | |||
| 1704 | Ga0182008_10347845 | |||
| 1705 | Ga0157377_10112134 | |||
| 1706 | Ga0157377_10368252 | |||
| 1707 | Ga0157379_10000011 | |||
| 1708 | Ga0157379_10004447 | |||
| 1709 | Ga0157379_10468608 | |||
| 1710 | Ga0157379_12679166 | |||
| 1711 | Ga0157376_13100957 | |||
| 1712 | Ga0163161_10397799 | |||
| 1713 | Ga0163161_10500830 | |||
| 1714 | Ga0197907_10137431 | |||
| 1715 | Ga0197907_10164336 | |||
| 1716 | Ga0197907_10287841 | |||
| 1717 | Ga0197907_10521472 | |||
| 1718 | Ga0197907_10553372 | |||
| 1719 | Ga0197907_10559923 | |||
| 1720 | Ga0197907_10612753 | |||
| 1721 | Ga0197907_10890214 | |||
| 1722 | Ga0197907_11323563 | |||
| 1723 | Ga0206356_10075057 | |||
| 1724 | Ga0206356_10184148 | |||
| 1725 | Ga0206356_10566583 | |||
| 1726 | Ga0206356_10801131 | |||
| 1727 | Ga0206356_11542350 | |||
| 1728 | Ga0206349_1049575 | |||
| 1729 | Ga0206349_1145716 | |||
| 1730 | Ga0206349_1191611 | |||
| 1731 | Ga0206349_1224460 | |||
| 1732 | Ga0206355_1184113 | |||
| 1733 | Ga0206355_1263721 | |||
| 1734 | Ga0206355_1680853 | |||
| 1735 | Ga0206355_1699297 | |||
| 1736 | Ga0206351_10073110 | |||
| 1737 | Ga0206351_10349151 | |||
| 1738 | Ga0206351_10366779 | |||
| 1739 | Ga0206351_10561642 | |||
| 1740 | Ga0206351_10667073 | |||
| 1741 | Ga0206351_10888640 | |||
| 1742 | Ga0206352_10175716 | |||
| 1743 | Ga0206352_10413355 | |||
| 1744 | Ga0206352_10419825 | |||
| 1745 | Ga0206352_10782919 | |||
| 1746 | Ga0206352_10817773 | |||
| 1747 | Ga0206352_11174969 | |||
| 1748 | Ga0206350_10387192 | |||
| 1749 | Ga0206350_10669342 | |||
| 1750 | Ga0206350_10717286 | |||
| 1751 | Ga0206350_10939822 | |||
| 1752 | Ga0206354_10402312 | |||
| 1753 | Ga0206354_11017929 | |||
| 1754 | Ga0206354_11061414 | |||
| 1755 | Ga0206354_11104228 | |||
| 1756 | Ga0206354_11147171 | |||
| 1757 | Ga0206354_11344924 | |||
| 1758 | Ga0206354_11651120 | |||
| 1759 | Ga0206353_10010990 | |||
| 1760 | Ga0206353_10069880 | |||
| 1761 | Ga0206353_10389836 | |||
| 1762 | Ga0206353_10579675 | |||
| 1763 | Ga0206353_10620362 | |||
| 1764 | Ga0206353_10760686 | |||
| 1765 | Ga0206353_11142314 | |||
| 1766 | Ga0206353_11145209 | |||
| 1767 | Ga0154015_1376143 | |||
| 1768 | Ga0154015_1399765 | |||
| 1769 | Ga0154015_1569601 | |||
| 1770 | Ga0213873_10149932 | |||
| 1771 | Ga0213876_10000698 | |||
| 1772 | Ga0224712_10004236 | |||
| 1773 | Ga0224712_10030705 | |||
| 1774 | Ga0224712_10044601 | |||
| 1775 | Ga0224712_10057189 | |||
| 1776 | Ga0224712_10342901 | |||
| 1777 | Ga0224712_10358259 | |||
| 1778 | Ga0224712_10368829 | |||
| 1779 | Ga0224712_10471188 | |||
| 1780 | Ga0209672_100006 | |||
| 1781 | Ga0209147_100870 | |||
| 1782 | Ga0209258_106149 | |||
| 1783 | Ga0209677_100623 | |||
| 1784 | Ga0209148_1000015 | |||
| 1785 | Ga0209455_1000013 | |||
| 1786 | Ga0209758_1043791 | |||
| 1787 | Ga0207426_1019038 | |||
| 1788 | Ga0207426_1073094 | |||
| 1789 | Ga0207656_10218087 | |||
| 1790 | Ga0207696_1032158 | |||
| 1791 | Ga0207655_1133466 | |||
| 1792 | Ga0207713_1038256 | |||
| 1793 | Ga0207682_10102956 | |||
| 1794 | Ga0207692_10089777 | |||
| 1795 | Ga0207692_10992925 | |||
| 1796 | Ga0207710_10294804 | |||
| 1797 | Ga0207688_10063242 | |||
| 1798 | Ga0207688_10491877 | |||
| 1799 | Ga0207647_10004777 | |||
| 1800 | Ga0207685_10324380 | |||
| 1801 | Ga0207699_10630351 | |||
| 1802 | Ga0207643_10040282 | |||
| 1803 | Ga0207643_10230242 | |||
| 1804 | Ga0207643_10895602 | |||
| 1805 | Ga0207705_10000660 | |||
| 1806 | Ga0207705_10003405 | |||
| 1807 | Ga0207705_10364636 | |||
| 1808 | Ga0207705_10728763 | |||
| 1809 | Ga0207654_11328679 | |||
| 1810 | Ga0207707_10000764 | |||
| 1811 | Ga0207707_10089094 | |||
| 1812 | Ga0207693_10057860 | |||
| 1813 | Ga0207663_10072394 | |||
| 1814 | Ga0207660_10025359 | |||
| 1815 | Ga0207660_10045816 | |||
| 1816 | Ga0207662_10147625 | |||
| 1817 | Ga0207649_11163860 | |||
| 1818 | Ga0207652_10000504 | |||
| 1819 | Ga0207652_10119072 | |||
| 1820 | Ga0207652_10812335 | |||
| 1821 | Ga0207694_10277504 | |||
| 1822 | Ga0207694_11001737 | |||
| 1823 | Ga0207694_11093018 | |||
| 1824 | Ga0207650_11127761 | |||
| 1825 | Ga0207659_10335280 | |||
| 1826 | Ga0207687_10068750 | |||
| 1827 | Ga0207687_10289517 | |||
| 1828 | Ga0207687_11191090 | |||
| 1829 | Ga0207687_11322236 | |||
| 1830 | Ga0207700_10326546 | |||
| 1831 | Ga0207664_10000625 | |||
| 1832 | Ga0207664_10584697 | |||
| 1833 | Ga0207664_11186877 | |||
| 1834 | Ga0207644_10074847 | |||
| 1835 | Ga0207690_10431242 | |||
| 1836 | Ga0207690_11030540 | |||
| 1837 | Ga0207706_10264937 | |||
| 1838 | Ga0207706_11411507 | |||
| 1839 | Ga0207686_10612184 | |||
| 1840 | Ga0207709_10143851 | |||
| 1841 | Ga0207709_11807970 | |||
| 1842 | Ga0207669_10265770 | |||
| 1843 | Ga0207669_10903036 | |||
| 1844 | Ga0207669_11361784 | |||
| 1845 | Ga0207704_10726401 | |||
| 1846 | Ga0207704_11498368 | |||
| 1847 | Ga0207665_10653929 | |||
| 1848 | Ga0207691_10207817 | |||
| 1849 | Ga0207711_10001188 | |||
| 1850 | Ga0207711_11287656 | |||
| 1851 | Ga0207689_10217264 | |||
| 1852 | Ga0207689_11630760 | |||
| 1853 | Ga0207661_10308794 | |||
| 1854 | Ga0207661_10403977 | |||
| 1855 | Ga0207661_10575334 | |||
| 1856 | Ga0207661_11286164 | |||
| 1857 | Ga0207679_10225105 | |||
| 1858 | Ga0207679_11031548 | |||
| 1859 | Ga0207667_10568113 | |||
| 1860 | Ga0207667_10622360 | |||
| 1861 | Ga0207667_10632356 | |||
| 1862 | Ga0207667_11941271 | |||
| 1863 | Ga0207712_10061281 | |||
| 1864 | Ga0207712_10929756 | |||
| 1865 | Ga0207668_10085199 | |||
| 1866 | Ga0207668_11118483 | |||
| 1867 | Ga0207668_11513760 | |||
| 1868 | Ga0207640_10361078 | |||
| 1869 | Ga0207658_10985735 | |||
| 1870 | Ga0207677_10268375 | |||
| 1871 | Ga0207703_10000066 | |||
| 1872 | Ga0207639_10434560 | |||
| 1873 | Ga0207639_10555307 | |||
| 1874 | Ga0207708_10103253 | |||
| 1875 | Ga0207702_10431755 | |||
| 1876 | Ga0207702_10626230 | |||
| 1877 | Ga0207702_11067804 | |||
| 1878 | Ga0207702_11610440 | |||
| 1879 | Ga0207702_12253068 | |||
| 1880 | Ga0207641_10000419 | |||
| 1881 | Ga0207648_10137534 | |||
| 1882 | Ga0207676_11005363 | |||
| 1883 | Ga0207674_10106532 | |||
| 1884 | Ga0207674_10209688 | |||
| 1885 | Ga0207674_10240599 | |||
| 1886 | Ga0207675_100292327 | |||
| 1887 | Ga0207675_101183950 | |||
| 1888 | Ga0207675_101198448 | |||
| 1889 | Ga0207683_10326067 | |||
| 1890 | Ga0207683_10920125 | |||
| 1891 | Ga0207698_10306464 | |||
| 1892 | Ga0207698_10547514 | |||
| 1893 | Ga0209371_1046875 | |||
| 1894 | Ga0209282_1298316 | |||
| 1895 | Ga0209974_10460285 | |||
| 1896 | Ga0207428_10101037 | |||
| 1897 | Ga0207428_10176902 | |||
| 1898 | Ga0268266_10002878 | |||
| 1899 | Ga0268266_11065758 | |||
| 1900 | Ga0268266_11551220 | |||
| 1901 | Ga0268265_10977018 | |||
| 1902 | Ga0268264_10005396 | |||
| 1903 | Ga0268264_11808235 | |||
| 1904 | Ga0265337_1022367 | |||
| 1905 | Ga0265319_1277202 | |||
| 1906 | Ga0265334_10039799 | |||
| 1907 | Ga0307517_10004784 | |||
| 1908 | Ga0307515_10025160 | |||
| 1909 | Ga0307515_10275618 | |||
| 1910 | Ga0265338_10005572 | |||
| 1911 | Ga0265338_10083961 | |||
| 1912 | Ga0310981_1081140 | |||
| 1913 | Ga0268256_1044084 | |||
| 1914 | Ga0307511_10002017 | |||
| 1915 | Ga0307512_10008068 | |||
| 1916 | Ga0307512_10095303 | |||
| 1917 | Ga0265777_105402 | |||
| 1918 | Ga0265761_108106 | |||
| 1919 | Ga0265332_10283728 | |||
| 1920 | Ga0265325_10055181 | |||
| 1921 | Ga0265325_10445309 | |||
| 1922 | Ga0265340_10009688 | |||
| 1923 | Ga0265340_10347631 | |||
| 1924 | Ga0265339_10039944 | |||
| 1925 | Ga0265339_10089235 | |||
| 1926 | Ga0265316_11001514 | |||
| 1927 | Ga0307513_10083290 | |||
| 1928 | Ga0307513_10125628 | |||
| 1929 | Ga0307513_10931061 | |||
| 1930 | Ga0307509_10089356 | |||
| 1931 | Ga0307509_10176128 | |||
| 1932 | Ga0307408_100765539 | |||
| 1933 | Ga0307408_100890579 | |||
| 1934 | Ga0307408_101022659 | |||
| 1935 | Ga0265313_10054039 | |||
| 1936 | Ga0310103_117188 | |||
| 1937 | Ga0307508_10014621 | |||
| 1938 | Ga0307508_10017412 | |||
| 1939 | Ga0307508_10019016 | |||
| 1940 | Ga0307508_10045682 | |||
| 1941 | Ga0307508_10826990 | |||
| 1942 | Ga0307514_10003844 | |||
| 1943 | Ga0307514_10043049 | |||
| 1944 | Ga0307514_10059226 | |||
| 1945 | Ga0307514_10118712 | |||
| 1946 | Ga0307514_10206484 | |||
| 1947 | Ga0316575_10075152 | |||
| 1948 | Ga0316575_10391012 | |||
| 1949 | Ga0316579_10086636 | |||
| 1950 | Ga0265342_10024150 | |||
| 1951 | Ga0316576_10158163 | |||
| 1952 | Ga0316576_10244994 | |||
| 1953 | Ga0316578_10019112 | |||
| 1954 | Ga0316578_10076370 | |||
| 1955 | Ga0307516_10001550 | |||
| 1956 | Ga0307516_10019048 | |||
| 1957 | Ga0307516_10393705 | |||
| 1958 | Ga0307405_10168909 | |||
| 1959 | Ga0307405_10602635 | |||
| 1960 | Ga0307405_12051990 | |||
| 1961 | Ga0316577_10098113 | |||
| 1962 | Ga0307413_10241094 | |||
| 1963 | Ga0307413_11615038 | |||
| 1964 | Ga0307413_12014314 | |||
| 1965 | Ga0307518_10534050 | |||
| 1966 | Ga0307410_10132308 | |||
| 1967 | Ga0307410_11344552 | |||
| 1968 | Ga0307410_12134000 | |||
| 1969 | Ga0307406_10000344 | |||
| 1970 | Ga0307406_10070262 | |||
| 1971 | Ga0307406_10213767 | |||
| 1972 | Ga0307406_10788265 | |||
| 1973 | Ga0307406_10986329 | |||
| 1974 | Ga0307407_10123057 | |||
| 1975 | Ga0307407_10701034 | |||
| 1976 | Ga0307412_10687832 | |||
| 1977 | Ga0307412_12230513 | |||
| 1978 | Ga0307409_100206366 | |||
| 1979 | Ga0307409_100522046 | |||
| 1980 | Ga0307409_100657511 | |||
| 1981 | Ga0307409_102693573 | |||
| 1982 | Ga0307416_100107847 | |||
| 1983 | Ga0307416_100604868 | |||
| 1984 | Ga0307416_100839868 | |||
| 1985 | Ga0307416_101031276 | |||
| 1986 | Ga0307416_101635237 | |||
| 1987 | Ga0307411_10881073 | |||
| 1988 | Ga0307411_10940885 | |||
| 1989 | Ga0307411_11504924 | |||
| 1990 | Ga0307415_101500411 | |||
| 1991 | Ga0316583_10012793 | |||
| 1992 | Ga0316585_10029638 | |||
| 1993 | Ga0316580_10002100 | |||
| 1994 | Ga0316593_10133397 | |||
| 1995 | Ga0307507_10296439 | |||
| 1996 | Ga0307510_10098847 | |||
| 1997 | Ga0307510_10265031 | |||
| 1998 | Ga0307510_10355071 | |||
| 1999 | Ga0307510_10394943 | |||
| 2000 | Ga0316588_1024655 | |||
| 2001 | Ga0316587_1077595 | |||
| 2002 | Ga0316587_1093269 | |||
| 2003 | Ga0316596_1005006 | |||
| 2004 | Ga0316596_1047494 | |||
| 2005 | Ga0373938_0197387 | |||
| 2006 | Ga0373934_0000413 | |||
| 2007 | Ga0373934_0011739 | |||
| 2008 | Ga0373949_0119484 | |||
| 2009 | Ga0373923_0083385 | |||
| 2010 | Ga0373936_0071412 | |||
| 2011 | Ga0373953_0000551 | |||
| 2012 | Ga0373953_0093894 | |||
| 2013 | Ga0373954_0001878 | |||
| 2014 | Ga0373954_0060776 | |||
| 2015 | Ga0373956_0000234 | |||
| 2016 | Ga0373956_0171675 | |||
| 2017 | Ga0373957_0000078 | |||
| 2018 | Ga0373957_0016711 | |||
| 2019 | Ga0373955_0000922 | |||
| 2020 | Ga0373955_0003954 | |||
| 2021 | Ga0316574_0054919 | |||
| 2022 | Ga0316574_0140592 | |||
| 2023 | Ga0316574_0421683 | |||
| 2024 | Ga0373924_0205784 | |||
| 2025 | Ga0373931_0329099 | |||
| 2026 | Ga0373931_0496328 | |||
| 2027 | Ga0373935_0943769 | |||
| 2028 | Ga0373927_0968657 | |||
| 2029 | Ga0373933_0000076 | |||
| 2030 | Ga0373933_0082049 | |||
| 2031 | Ga0373937_0000183 | |||
| 2032 | Ga0373937_0825168 | |||
| 2033 | Ga0373937_1368803 | |||
| 2034 | Ga0316582_0011385 | |||
| 2035 | Ga0316584_0063533 | |||
| 2036 | Ga0316584_0229780 | |||
| 2037 | Ga0395899_0046064 | |||
| 2038 | Ga0395899_0144378 | |||
| 2039 | Ga0395899_0173784 | |||
| 2040 | Ga0395900_0149873 | |||
| 2041 | Ga0395900_0498481 | |||
| 2042 | Ga0395900_1775311 | |||
| 2043 | Ga0395898_0000622 | |||
| 2044 | Ga0395898_0015578 | |||
| 2045 | Ga0395898_0101510 | |||
| 2046 | Ga0395898_0175903 | |||
| 2047 | Ga0395898_0612000 | |||
| 2048 | Ga0395898_1312800 | |||
| 2049 | Ga0316581_0170394 | |||
| 2050 | Ga0436364_0062912 | |||
| 2051 | Ga0395901_0391216 | |||
| 2052 | Ga0395901_0456646 | |||
| 2053 | Ga0395901_1389266 | |||
| 2054 | Ga0436365_0879580 | |||
| 2055 | Ga0436365_1225491 | |||
| 2056 | Ga0439436_0002018 | |||
| 2057 | Ga0439436_0015225 | |||
| 2058 | Ga0439436_0042742 | |||
| 2059 | Ga0439439_0000254 | |||
| 2060 | Ga0439453_0104439 | |||
| 2061 | Ga0439466_0162495 | |||
| 2062 | Ga0439465_0052642 | |||
| 2063 | Ga0439465_0061592 | |||
| 2064 | Ga0439465_0350606 | |||
| 2065 | Ga0451792_12977 | |||
| 2066 | Ga0451791_0235911 | |||
| 2067 | Ga0451791_0453322 | |||
| 2068 | Ga0451793_1275263 | |||
| 2069 | Ga0451797_0913809 | |||
| 2070 | Ga0451797_1306607 | |||
| 2071 | Ga0451797_1364221 | |||
| 2072 | Ga0451801_37017 | |||
| 2073 | Ga0451795_1358716 | |||
| 2074 | Ga0451800_0254177 | |||
| 2075 | Ga0451802_0072948 | |||
| 2076 | Ga0451802_0104636 | |||
| 2077 | Ga0451802_0479341 | |||
| 2078 | Ga0451805_087420 | |||
| 2079 | Ga0451835_1170188 | |||
| 2080 | Ga0451841_0125492 | |||
| 2081 | Ga0451841_0466799 | |||
| 2082 | Ga0451845_0239999 | |||
| 2083 | Ga0451849_0924598 | |||
| 2084 | Ga0451853_0381932 | |||
| 2085 | Ga0451853_1865502 | |||
| 2086 | Ga0451853_2603884 | |||
| 2087 | Ga0451853_2920057 | |||
| 2088 | Ga0451853_3360855 | |||
| 2089 | Ga0451853_4033414 | |||
| 2090 | Ga0439431_0105118 | |||
| 2091 | Ga0439433_0006606 | |||
| 2092 | Ga0439442_002078 | |||
| 2093 | Ga0439448_0002469 | |||
| 2094 | Ga0439449_0001172 | |||
| 2095 | Ga0439449_0023539 | |||
| 2096 | Ga0439449_0089653 | |||
| 2097 | Ga0439449_0385676 | |||
| 2098 | Ga0439454_028021 | |||
| 2099 | Ga0439455_0020550 | |||
| 2100 | Ga0439457_000267 | |||
| 2101 | Ga0439457_002421 | |||
| 2102 | Ga0439462_0013751 | |||
| 2103 | Ga0450920_023536 | |||
| 2104 | Ga0450897_000435 | |||
| 2105 | Ga0450894_001474 | |||
| 2106 | Ga0450895_000962 | |||
| 2107 | Ga0450896_013852 | |||
| 2108 | Ga0450898_000247 | |||
| 2109 | Ga0450900_004404 | |||
| 2110 | Ga0450900_013068 | |||
| 2111 | Ga0450902_002079 | |||
| 2112 | Ga0450903_002022 | |||
| 2113 | Ga0450903_012578 | |||
| 2114 | Ga0450905_086170 | |||
| 2115 | Ga0450906_023851 | |||
| 2116 | Ga0450907_017555 | |||
| 2117 | Ga0450910_095750 | |||
| 2118 | Ga0439458_0000320 | |||
| 2119 | Ga0450908_019594 | |||
| 2120 | Ga0439435_0136108 | |||
| 2121 | Ga0439460_0130240 | |||
| 2122 | Ga0450901_005798 | |||
| 2123 | Ga0451577_0244007 | |||
| 2124 | Ga0451577_1418737 | |||
| 2125 | Ga0466969_0050397 | |||
| 2126 | Ga0466972_0002764 | |||
| 2127 | Ga0466972_0010375 | |||
| 2128 | Ga0466972_0188741 | |||
| 2129 | Ga0466972_0224264 | |||
| 2130 | Ga0466972_0357153 | |||
| 2131 | Ga0466972_0409741 | |||
| 2132 | Ga0466972_0578774 | |||
| 2133 | Ga0466965_0001075 | |||
| 2134 | Ga0466965_0026735 | |||
| 2135 | Ga0466965_0047862 | |||
| 2136 | Ga0466965_0049949 | |||
| 2137 | Ga0466965_0052477 | |||
| 2138 | Ga0466965_0136319 | |||
| 2139 | Ga0466965_0200096 | |||
| 2140 | Ga0466965_0381727 | |||
| 2141 | Ga0466966_0004673 | |||
| 2142 | Ga0466966_0007573 | |||
| 2143 | Ga0466966_0324123 | |||
| 2144 | Ga0466966_0460600 | |||
| 2145 | Ga0466961_0013019 | |||
| 2146 | Ga0466961_0050391 | |||
| 2147 | Ga0466961_0070584 | |||
| 2148 | Ga0466961_0413151 | |||
| 2149 | Ga0466961_0601969 | |||
| 2150 | Ga0466961_0760318 | |||
| 2151 | Ga0466961_0811470 | |||
| 2152 | Ga0466963_0000829 | |||
| 2153 | Ga0466963_0135417 | |||
| 2154 | Ga0466963_0260838 | |||
| 2155 | Ga0466963_0351557 | |||
| 2156 | Ga0466963_0387633 | |||
| 2157 | Ga0466963_0505195 | |||
| 2158 | Ga0466963_0642272 | |||
| 2159 | Ga0466963_1046114 | |||
| 2160 | Ga0466964_0002067 | |||
| 2161 | Ga0466964_0048238 | |||
| 2162 | Ga0466964_0408371 | |||
| 2163 | Ga0466971_0001565 | |||
| 2164 | Ga0466971_0101266 | |||
| 2165 | Ga0466971_0213277 | |||
| 2166 | Ga0466971_0619884 | |||
| 2167 | Ga0466968_0088124 | |||
| 2168 | Ga0466968_0356064 | |||
| 2169 | Ga0466968_0449934 | |||
| 2170 | Ga0466968_0533486 | |||
| 2171 | Ga0466970_0001647 | |||
| 2172 | Ga0466970_0018545 | |||
| 2173 | Ga0466970_0034486 | |||
| 2174 | Ga0466970_0065227 | |||
| 2175 | Ga0466970_0067431 | |||
| 2176 | Ga0466970_0095485 | |||
| 2177 | Ga0466970_0854453 | |||
| 2178 | Ga0466957_0000170 | |||
| 2179 | Ga0466957_0073024 | |||
| 2180 | Ga0466957_0093442 | |||
| 2181 | Ga0466957_0214611 | |||
| 2182 | Ga0466960_0008803 | |||
| 2183 | Ga0466960_0022810 | |||
| 2184 | Ga0466960_0038075 | |||
| 2185 | Ga0466960_0078312 | |||
| 2186 | Ga0466960_0095083 | |||
| 2187 | Ga0466960_0194556 | |||
| 2188 | Ga0466959_0000614 | |||
| 2189 | Ga0466959_0339825 | |||
| 2190 | Ga0466959_0636884 | |||
| 2191 | Ga0466958_0007122 | |||
| 2192 | Ga0466958_0074578 | |||
| 2193 | Ga0466958_0099351 | |||
| 2194 | Ga0466958_0177545 | |||
| 2195 | Ga0466958_0291351 | |||
| 2196 | Ga0466958_0465798 | |||
| 2197 | Ga0466958_0579046 | |||
| 2198 | Ga0466967_0037190 | |||
| 2199 | Ga0466967_0129919 | |||
| 2200 | Ga0466967_0161606 | |||
| 2201 | Ga0466967_0193790 | |||
| 2202 | Ga0466967_0682896 | |||
| 2203 | Ga0466967_1431781 | |||
| 2204 | Ga0466967_2520008 | |||
| 2205 | Ga0495617_231551 | |||
| 2206 | Ga0495627_213433 | |||
| 2207 | Ga0495592_0000158 | |||
| 2208 | Ga0495592_0005337 | |||
| 2209 | Ga0495592_0119503 | |||
| 2210 | Ga0495592_0588043 | |||
| 2211 | Ga0495603_0000831 | |||
| 2212 | Ga0495603_0005212 | |||
| 2213 | Ga0495603_0023663 | |||
| 2214 | Ga0495603_0051941 | |||
| 2215 | Ga0495603_0068830 | |||
| 2216 | Ga0495603_0423181 | |||
| 2217 | Ga0495590_0227656 | |||
| 2218 | Ga0495629_0033621 | |||
| 2219 | Ga0495629_0049312 | |||
| 2220 | Ga0495629_0051534 | |||
| 2221 | Ga0495629_0071827 | |||
| 2222 | Ga0495629_0257134 | |||
| 2223 | Ga0495629_0489101 | |||
| 2224 | Ga0495629_0540583 | |||
| 2225 | Ga0495629_0802193 | |||
| 2226 | Ga0495638_0064630 | |||
| 2227 | Ga0495638_0066404 | |||
| 2228 | Ga0495638_0138853 | |||
| 2229 | Ga0495638_0185109 | |||
| 2230 | Ga0495638_0200061 | |||
| 2231 | Ga0495638_0675224 | |||
| 2232 | Ga0495641_0210368 | |||
| 2233 | Ga0495641_0445590 | |||
| 2234 | Ga0495651_0000101 | |||
| 2235 | Ga0495651_0019714 | |||
| 2236 | Ga0495651_0028260 | |||
| 2237 | Ga0495651_0078880 | |||
| 2238 | Ga0495653_0008755 | |||
| 2239 | Ga0495653_0035480 | |||
| 2240 | Ga0495653_0038765 | |||
| 2241 | Ga0495653_0165169 | |||
| 2242 | Ga0495653_0372473 | |||
| 2243 | Ga0495580_0071165 | |||
| 2244 | Ga0495582_0641847 | |||
| 2245 | Ga0495605_0107632 | |||
| 2246 | Ga0495662_0000253 | |||
| 2247 | Ga0495662_0002995 | |||
| 2248 | Ga0495662_0052526 | |||
| 2249 | Ga0495662_0149933 | |||
| 2250 | Ga0495664_0001773 | |||
| 2251 | Ga0495664_0052658 | |||
| 2252 | Ga0495664_0315549 | |||
| 2253 | Ga0495664_0562313 | |||
| 2254 | Ga0495585_0040561 | |||
| 2255 | Ga0495585_0059828 | |||
| 2256 | Ga0495585_0193139 | |||
| 2257 | Ga0495594_0029780 | |||
| 2258 | Ga0495594_0034187 | |||
| 2259 | Ga0495594_0068118 | |||
| 2260 | Ga0495594_0090276 | |||
| 2261 | Ga0495607_0039647 | |||
| 2262 | Ga0495583_0201564 | |||
| 2263 | Ga0495608_0000099 | |||
| 2264 | Ga0495608_0058479 | |||
| 2265 | Ga0495608_0067568 | |||
| 2266 | Ga0495608_0366264 | |||
| 2267 | Ga0495608_0687765 | |||
| 2268 | Ga0495610_0216925 | |||
| 2269 | Ga0495618_0031633 | |||
| 2270 | Ga0495618_0354704 | |||
| 2271 | Ga0495620_0223795 | |||
| 2272 | Ga0495628_0004775 | |||
| 2273 | Ga0495628_0012392 | |||
| 2274 | Ga0495628_0293983 | |||
| 2275 | Ga0495628_0534353 | |||
| 2276 | Ga0495630_0089968 | |||
| 2277 | Ga0495630_0165138 | |||
| 2278 | Ga0495630_0234434 | |||
| 2279 | Ga0495630_0625591 | |||
| 2280 | Ga0495630_1473019 | |||
| 2281 | Ga0495631_0263974 | |||
| 2282 | Ga0495632_0153882 | |||
| 2283 | Ga0495643_0002222 | |||
| 2284 | Ga0495643_0112244 | |||
| 2285 | Ga0495644_0354065 | |||
| 2286 | Ga0495666_0001455 | |||
| 2287 | Ga0495666_0348703 | |||
| 2288 | Ga0495652_0000214 | |||
| 2289 | Ga0495652_0091389 | |||
| 2290 | Ga0495652_0119109 | |||
| 2291 | Ga0495652_0227458 | |||
| 2292 | Ga0495652_0838563 | |||
| 2293 | Ga0495665_0006386 | |||
| 2294 | Ga0495640_0010020 | |||
| 2295 | Ga0495640_0261979 | |||
| 2296 | Ga0495640_0561378 | |||
| 2297 | Ga0495586_0023992 | |||
| 2298 | Ga0495586_0041211 | |||
| 2299 | Ga0495586_0432525 | |||
| 2300 | Ga0495587_0000108 | |||
| 2301 | Ga0495587_0001699 | |||
| 2302 | Ga0495587_0054325 | |||
| 2303 | Ga0495587_0109572 | |||
| 2304 | Ga0495587_0367198 | |||
| 2305 | Ga0495645_0018186 | |||
| 2306 | Ga0495645_0020886 | |||
| 2307 | Ga0495645_0024352 | |||
| 2308 | Ga0495622_0036785 | |||
| 2309 | Ga0495622_0059627 | |||
| 2310 | Ga0495622_0138961 | |||
| 2311 | Ga0495633_0049233 | |||
| 2312 | Ga0495633_0182350 | |||
| 2313 | Ga0495667_0000102 | |||
| 2314 | Ga0495667_0015573 | |||
| 2315 | Ga0495667_0103249 | |||
| 2316 | Ga0495667_0331498 | |||
| 2317 | Ga0495667_0420163 | |||
| 2318 | Ga0495668_0077855 | |||
| 2319 | Ga0495668_0779846 | |||
| 2320 | Ga0495634_0006236 | |||
| 2321 | Ga0495634_0033911 | |||
| 2322 | Ga0495634_0293570 | |||
| 2323 | Ga0495611_0017340 | |||
| 2324 | Ga0495611_0100048 | |||
| 2325 | Ga0495625_0240681 | |||
| 2326 | Ga0495625_0262017 | |||
| 2327 | Ga0495625_0452801 | |||
| 2328 | Ga0495625_0542218 | |||
| 2329 | Ga0495635_0010746 | |||
| 2330 | Ga0495635_0016801 | |||
| 2331 | Ga0495635_0189769 | |||
| 2332 | Ga0495635_0206992 | |||
| 2333 | Ga0495635_0693138 | |||
| 2334 | Ga0495659_0154112 | |||
| 2335 | Ga0495659_0495150 | |||
| 2336 | Ga0495661_0107450 | |||
| 2337 | Ga0495661_0232433 | |||
| 2338 | Ga0495588_0004867 | |||
| 2339 | Ga0495588_0026459 | |||
| 2340 | Ga0495588_0081666 | |||
| 2341 | Ga0495588_0190818 | |||
| 2342 | Ga0495657_0000311 | |||
| 2343 | Ga0495657_0019707 | |||
| 2344 | Ga0495657_0020748 | |||
| 2345 | Ga0495657_0052100 | |||
| 2346 | Ga0495657_0268029 | |||
| 2347 | Ga0495657_0407496 | |||
| 2348 | Ga0495657_0472542 | |||
| 2349 | Ga0495599_0000275 | |||
| 2350 | Ga0495599_0085201 | |||
| 2351 | Ga0495599_0345462 | |||
| 2352 | Ga0495623_0000402 | |||
| 2353 | Ga0495623_0008769 | |||
| 2354 | Ga0495623_0060775 | |||
| 2355 | Ga0495623_0186627 | |||
| 2356 | Ga0495646_0003307 | |||
| 2357 | Ga0495646_0098581 | |||
| 2358 | Ga0495646_0710755 | |||
| 2359 | Ga0495647_0397078 | |||
| 2360 | Ga0495658_0021173 | |||
| 2361 | Ga0495658_0500522 | |||
| 2362 | Ga0495658_0689341 | |||
| 2363 | Ga0495658_0808887 | |||
| 2364 | Ga0495658_0932510 | |||
| 2365 | Ga0495613_0009048 | |||
| 2366 | Ga0495613_0014208 | |||
| 2367 | Ga0495613_0015649 | |||
| 2368 | Ga0495613_0031316 | |||
| 2369 | Ga0495613_0170093 | |||
| 2370 | Ga0495624_0232197 | |||
| 2371 | Ga0495624_0440124 | |||
| 2372 | Ga0495624_0479688 | |||
| 2373 | Ga0495670_0012480 | |||
| 2374 | Ga0495670_0093453 | |||
| 2375 | Ga0495670_0353959 | |||
| 2376 | Ga0495671_0053869 | |||
| 2377 | Ga0495671_0588381 | |||
| 2378 | Ga0495649_0070376 | |||
| 2379 | Ga0495589_0068205 | |||
| 2380 | Ga0495589_0119156 | |||
| 2381 | Ga0495589_0153168 | |||
| 2382 | Ga0495600_0003580 | |||
| 2383 | Ga0495600_0073250 | |||
| 2384 | Ga0495600_0363296 | |||
| 2385 | Ga0495581_0005940 | |||
| 2386 | Ga0495581_0067418 | |||
| 2387 | Ga0495581_0228096 | |||
| 2388 | Ga0495581_0270327 | |||
| 2389 | Ga0495581_0673311 | |||
| 2390 | Ga0495604_0000096 | |||
| 2391 | Ga0495604_0001196 | |||
| 2392 | Ga0495604_0009065 | |||
| 2393 | Ga0495604_0877884 | |||
| 2394 | Ga0495636_0024578 | |||
| 2395 | Ga0495636_0045821 | |||
| 2396 | Ga0495636_0155688 | |||
| 2397 | Ga0495636_0330006 | |||
| 2398 | Ga0495674_0073641 | |||
| 2399 | Ga0495674_0396783 | |||
| 2400 | Ga0495674_1164456 | |||
| 2401 | Ga0495676_0000524 | |||
| 2402 | Ga0495676_0008425 | |||
| 2403 | Ga0495676_0115209 | |||
| 2404 | Ga0495680_0000493 | |||
| 2405 | Ga0495680_0024349 | |||
| 2406 | Ga0495680_0309881 | |||
| 2407 | Ga0495680_0453274 | |||
| 2408 | Ga0495683_0078158 | |||
| 2409 | Ga0495683_0090593 | |||
| 2410 | Ga0495683_0091728 | |||
| 2411 | Ga0495687_015717 | |||
| 2412 | Ga0495687_080483 | |||
| 2413 | Ga0495675_0001039 | |||
| 2414 | Ga0495675_0014932 | |||
| 2415 | Ga0495675_0018548 | |||
| 2416 | Ga0495675_0045858 | |||
| 2417 | Ga0495675_0296713 | |||
| 2418 | Ga0495675_0579498 | |||
| 2419 | Ga0495677_0144201 | |||
| 2420 | Ga0495685_001204 | |||
| 2421 | Ga0495685_005170 | |||
| 2422 | Ga0495685_024300 | |||
| 2423 | Ga0495685_076711 | |||
| 2424 | Ga0495681_0004935 | |||
| 2425 | Ga0495681_0023963 | |||
| 2426 | Ga0495681_0124153 | |||
| 2427 | Ga0495681_0213813 | |||
| 2428 | Ga0495684_0045075 | |||
| 2429 | Ga0495684_0061846 | |||
| 2430 | Ga0495684_0096557 | |||
| 2431 | Ga0495686_0074343 | |||
| 2432 | Ga0495686_0185450 | |||
| 2433 | Ga0495686_0333011 | |||
| 2434 | Ga0495593_0001104 | |||
| 2435 | Ga0495593_0175616 | |||
| 2436 | Ga0495593_0246614 | |||
| 2437 | Ga0495593_0277537 | |||
| 2438 | Ga0495602_0000165 | |||
| 2439 | Ga0495602_0017258 | |||
| 2440 | Ga0495602_0094547 | |||
| 2441 | Ga0495602_0144585 | |||
| 2442 | Ga0495602_0425283 | |||
| 2443 | Ga0495602_0463026 | |||
| 2444 | Ga0495614_0000236 | |||
| 2445 | Ga0495614_0071552 | |||
| 2446 | Ga0495614_0106387 | |||
| 2447 | Ga0495614_0173557 | |||
| 2448 | Ga0496100_0002555 | |||
| 2449 | Ga0496100_0115098 | |||
| 2450 | Ga0496100_0326600 | |||
| 2451 | Ga0496100_0876821 | |||
| 2452 | Ga0496100_1538416 | |||
| 2453 | Ga0496101_0030183 | |||
| 2454 | Ga0496101_0170148 | |||
| 2455 | Ga0496101_0192395 | |||
| 2456 | Ga0496102_0000222 | |||
| 2457 | Ga0496102_0027914 | |||
| 2458 | Ga0496102_0170447 | |||
| 2459 | Ga0496103_0000179 | |||
| 2460 | Ga0496103_0021797 | |||
| 2461 | Ga0496104_0077464 | |||
| 2462 | Ga0496104_0179122 | |||
| 2463 | Ga0496104_0217429 | |||
| 2464 | Ga0496104_0247756 | |||
| 2465 | Ga0496104_0453921 | |||
| 2466 | Ga0496104_0819369 | |||
| 2467 | Ga0496105_0040289 | |||
| 2468 | Ga0496105_0055044 | |||
| 2469 | Ga0496105_0236184 | |||
| 2470 | Ga0496105_0345550 | |||
| 2471 | Ga0496105_0814976 | |||
| 2472 | Ga0496106_0190924 | |||
| 2473 | Ga0496106_0331240 | |||
| 2474 | Ga0496106_0473192 | |||
| 2475 | Ga0496107_0144454 | |||
| 2476 | Ga0496107_0270229 | |||
| 2477 | Ga0496107_0302108 | |||
| 2478 | Ga0496108_0028685 | |||
| 2479 | Ga0496108_0086688 | |||
| 2480 | Ga0496108_0274069 | |||
| 2481 | Ga0496108_0339622 | |||
| 2482 | Ga0496108_0509882 | |||
| 2483 | Ga0496108_0619380 | |||
| 2484 | Ga0496108_0948933 | |||
| 2485 | Ga0496108_1206675 | |||
| 2486 | Ga0496108_1787838 | |||
| 2487 | Ga0496109_0073164 | |||
| 2488 | Ga0496109_0224389 | |||
| 2489 | Ga0496109_0246883 | |||
| 2490 | Ga0496109_1692959 | |||
| 2491 | Ga0496110_0057914 | |||
| 2492 | Ga0496110_0062978 | |||
| 2493 | Ga0496110_0225945 | |||
| 2494 | Ga0496110_0396979 | |||
| 2495 | Ga0496110_0529913 | |||
| 2496 | Ga0496110_0669031 | |||
| 2497 | Ga0496111_0147266 | |||
| 2498 | Ga0496111_0178303 | |||
| 2499 | Ga0496112_0647208 | |||
| 2500 | Ga0496112_0966670 | |||
| 2501 | Ga0496113_0294154 | |||
| 2502 | Ga0496114_0111481 | |||
| 2503 | Ga0496114_0142574 | |||
| 2504 | Ga0496114_0194222 | |||
| 2505 | Ga0496114_0325661 | |||
| 2506 | Ga0496114_0614621 | |||
| 2507 | Ga0496115_0130815 | |||
| 2508 | Ga0496116_0000481 | |||
| 2509 | Ga0496117_0000242 | |||
| 2510 | Ga0496117_0103679 | |||
| 2511 | Ga0496118_0000412 | |||
| 2512 | Ga0496119_0013023 | |||
| 2513 | Ga0496119_0142549 | |||
| 2514 | Ga0496119_0418925 | |||
| 2515 | Ga0496120_0003152 | |||
| 2516 | Ga0496120_0086969 | |||
| 2517 | Ga0496121_0002113 | |||
| 2518 | Ga0496121_0029846 | |||
| 2519 | Ga0496121_0196381 | |||
| 2520 | Ga0496122_0107771 | |||
| 2521 | Ga0496122_0249366 | |||
| 2522 | Ga0496124_0028247 | |||
| 2523 | Ga0496125_0000061 | |||
| 2524 | Ga0496125_0077747 | |||
| 2525 | Ga0496125_0136947 | |||
| 2526 | Ga0496126_0000521 | |||
| 2527 | Ga0496126_0048031 | |||
| 2528 | Ga0496126_0213496 | |||
| 2529 | Ga0496126_0280302 | |||
| 2530 | Ga0496126_0551673 | |||
| 2531 | Ga0501306_003481 | |||
| 2532 | Ga0501306_004717 | |||
| 2533 | Ga0501306_007377 | |||
| 2534 | Ga0501306_019156 | |||
| 2535 | Ga0501308_009812 | |||
| 2536 | Ga0501308_032658 | |||
| 2537 | Ga0501310_011119 | |||
| 2538 | Ga0501310_019890 | |||
| 2539 | Ga0501305_076720 | |||
| 2540 | Ga0501307_021176 | |||
| 2541 | Ga0501311_039962 | |||
| 2542 | Ga0501311_047315 | |||
| 2543 | Ga0501311_103100 | |||
| 2544 | Ga0501312_014058 | |||
| 2545 | Ga0501313_011492 | |||
| 2546 | Ga0501313_017741 | |||
| 2547 | Ga0501314_009432 | |||
| 2548 | Ga0501314_010761 | |||
| 2549 | Ga0501314_012777 | |||
| 2550 | Ga0501315_012238 | |||
| 2551 | Ga0501315_025006 | |||
| 2552 | Ga0501315_088999 | |||
| 2553 | Ga0501316_007869 | |||
| 2554 | Ga0501316_014305 | |||
| 2555 | Ga0501316_023088 | |||
| 2556 | Ga0501316_037117 | |||
| 2557 | Ga0501316_041856 | |||
| 2558 | Ga0501317_016309 | |||
| 2559 | Ga0501317_018583 | |||
| 2560 | Ga0501317_020344 | |||
| 2561 | Ga0501317_022356 | |||
| 2562 | Ga0501317_047918 | |||
| 2563 | Ga0501317_049729 | |||
| 2564 | Ga0501318_004377 | |||
| 2565 | Ga0501318_019704 | |||
| 2566 | Ga0501318_061921 | |||
| 2567 | Ga0501318_091233 | |||
| 2568 | Ga0501319_001694 | |||
| 2569 | Ga0501320_007687 | |||
| 2570 | Ga0501320_022575 | |||
| 2571 | Ga0501321_003292 | |||
| 2572 | Ga0501321_018131 | |||
| 2573 | Ga0501321_035687 | |||
| 2574 | Ga0501322_006261 | |||
| 2575 | Ga0501322_010435 | |||
| 2576 | Ga0501323_001352 | |||
| 2577 | Ga0501323_014500 | |||
| 2578 | Ga0501323_042315 | |||
| 2579 | Ga0501323_054099 | |||
| 2580 | Ga0501323_072793 | |||
| 2581 | Ga0501324_004031 | |||
| 2582 | Ga0501324_026659 | |||
| 2583 | Ga0501324_029688 | |||
| 2584 | Ga0501031_0002886 | |||
| 2585 | Ga0501031_0007255 | |||
| 2586 | Ga0501031_0379675 | |||
| 2587 | Ga0501031_0596730 | |||
| 2588 | Ga0501031_0667215 | |||
| 2589 | Ga0501032_0050350 | |||
| 2590 | Ga0501032_0443877 | |||
| 2591 | Ga0501033_0029364 | |||
| 2592 | Ga0501033_0046139 | |||
| 2593 | Ga0501033_0108642 | |||
| 2594 | Ga0501033_0131000 | |||
| 2595 | Ga0501033_0139669 | |||
| 2596 | Ga0501034_0001747 | |||
| 2597 | Ga0501034_0011927 | |||
| 2598 | Ga0501034_0082768 | |||
| 2599 | Ga0501034_0091917 | |||
| 2600 | Ga0501034_0102271 | |||
| 2601 | Ga0501034_0105403 | |||
| 2602 | Ga0501034_0135486 | |||
| 2603 | Ga0501034_0444686 | |||
| 2604 | Ga0501034_1172366 | |||
| 2605 | Ga0501036_0001851 | |||
| 2606 | Ga0501036_0002873 | |||
| 2607 | Ga0501036_0018651 | |||
| 2608 | Ga0501036_0223089 | |||
| 2609 | Ga0501036_0270428 | |||
| 2610 | Ga0501036_0446097 | |||
| 2611 | Ga0501036_0750423 | |||
| 2612 | Ga0501037_0030371 | |||
| 2613 | Ga0501037_0933710 | |||
| 2614 | Ga0501038_0005037 | |||
| 2615 | Ga0501038_0023851 | |||
| 2616 | Ga0501038_0084137 | |||
| 2617 | Ga0501038_0280743 | |||
| 2618 | Ga0501038_0656036 | |||
| 2619 | Ga0501038_0694193 | |||
| 2620 | Ga0501039_0017759 | |||
| 2621 | Ga0501039_0045595 | |||
| 2622 | Ga0501039_0082165 | |||
| 2623 | Ga0501039_0138273 | |||
| 2624 | Ga0501039_0351309 | |||
| 2625 | Ga0501039_0626837 | |||
| 2626 | Ga0501039_1392292 | |||
| 2627 | Ga0501040_0027714 | |||
| 2628 | Ga0501040_0404015 | |||
| 2629 | Ga0501040_0753992 | |||
| 2630 | Ga0501040_0767513 | |||
| 2631 | Ga0501040_0860560 | |||
| 2632 | Ga0501041_0002007 | |||
| 2633 | Ga0501041_0014490 | |||
| 2634 | Ga0501042_0010139 | |||
| 2635 | Ga0501042_0015522 | |||
| 2636 | Ga0501042_1378547 | |||
| 2637 | Ga0501043_0008372 | |||
| 2638 | Ga0501043_0008818 | |||
| 2639 | Ga0501043_0118648 | |||
| 2640 | Ga0501043_0542723 | |||
| 2641 | Ga0501043_0593942 | |||
| 2642 | Ga0501043_0648231 | |||
| 2643 | Ga0501046_0187191 | |||
| 2644 | Ga0501046_0438930 | |||
| 2645 | Ga0501046_1164076 | |||
| 2646 | Ga0501047_0050497 | |||
| 2647 | Ga0501047_0108025 | |||
| 2648 | Ga0501047_0794727 | |||
| 2649 | Ga0501047_0803568 | |||
| 2650 | Ga0501048_0025883 | |||
| 2651 | Ga0501048_0266912 | |||
| 2652 | Ga0501048_0317278 | |||
| 2653 | Ga0501067_0840002 | |||
| 2654 | Ga0501068_0435871 | |||
| 2655 | Ga0501068_0523927 | |||
| 2656 | Ga0501069_0318676 | |||
| 2657 | Ga0501070_0002423 | |||
| 2658 | Ga0501070_0004597 | |||
| 2659 | Ga0501070_0013006 | |||
| 2660 | Ga0501070_0048446 | |||
| 2661 | Ga0501070_0469133 | |||
| 2662 | Ga0501070_0470881 | |||
| 2663 | Ga0501071_0022953 | |||
| 2664 | Ga0501071_0355265 | |||
| 2665 | Ga0501071_1237690 | |||
| 2666 | Ga0501071_1337610 | |||
| 2667 | Ga0501072_0012315 | |||
| 2668 | Ga0501072_0031891 | |||
| 2669 | Ga0501072_0094423 | |||
| 2670 | Ga0501072_1027692 | |||
| 2671 | Ga0501072_1383401 | |||
| 2672 | Ga0501073_0440627 | |||
| 2673 | Ga0501073_0660761 | |||
| 2674 | Ga0501074_0018631 | |||
| 2675 | Ga0501074_0030737 | |||
| 2676 | Ga0501074_0077707 | |||
| 2677 | Ga0501074_0628546 | |||
| 2678 | Ga0501074_0903776 | |||
| 2679 | Ga0501075_0035364 | |||
| 2680 | Ga0501075_0085048 | |||
| 2681 | Ga0501075_0355200 | |||
| 2682 | Ga0501075_1092788 | |||
| 2683 | Ga0501076_0022853 | |||
| 2684 | Ga0501076_0257966 | |||
| 2685 | Ga0501076_0567965 | |||
| 2686 | Ga0501077_0010298 | |||
| 2687 | Ga0501077_0117775 | |||
| 2688 | Ga0501077_0728607 | |||
| 2689 | Ga0501202_085562 | |||
| 2690 | Ga0501235_197576 | |||
| 2691 | Ga0501250_008668 | |||
| 2692 | Ga0501079_0016088 | |||
| 2693 | Ga0501079_0089420 | |||
| 2694 | Ga0501079_0123914 | |||
| 2695 | Ga0501080_0000238 | |||
| 2696 | Ga0501080_1311609 | |||
| 2697 | Ga0501081_0121714 | |||
| 2698 | Ga0501081_0951353 | |||
| 2699 | Ga0501083_0024234 | |||
| 2700 | Ga0501083_0523499 | |||
| 2701 | Ga0501083_1048680 | |||
| 2702 | Ga0501035_0028585 | |||
| 2703 | Ga0501035_0036349 | |||
| 2704 | Ga0501035_0153957 | |||
| 2705 | Ga0501035_0163161 | |||
| 2706 | Ga0501035_0223604 | |||
| 2707 | Ga0501044_0004971 | |||
| 2708 | Ga0501044_0070782 | |||
| 2709 | Ga0501044_0337997 | |||
| 2710 | Ga0501044_0350648 | |||
| 2711 | Ga0501044_1664640 | |||
| 2712 | Ga0501045_0009086 | |||
| 2713 | Ga0501045_0431279 | |||
| 2714 | Ga0501045_0567744 | |||
| 2715 | Ga0501045_1273252 | |||
| 2716 | nmdc:mga00v17_390973_c1 | |||
| 2717 | nmdc:mga00v17_46398_c1 | |||
| 2718 | nmdc:mga00v17_675260_c1 | |||
| 2719 | nmdc:mga0k408_246709_c1 | |||
| 2720 | nmdc:mga06z11_395137_c1 | |||
| 2721 | nmdc:mga07m45_58181_c1 | |||
| 2722 | nmdc:mga05p37_169332_c1 | |||
| 2723 | nmdc:mga09592_1481933_c1 | |||
| 2724 | nmdc:mga09592_437295_c1 | |||
| 2725 | nmdc:mga09592_928045_c1 | |||
| 2726 | nmdc:mga0qj67_125626_c1 | |||
| 2727 | nmdc:mga06r32_1880485_c1 | |||
| 2728 | nmdc:mga08y16_101565_c1 | |||
| 2729 | nmdc:mga08y16_931049_c1 | |||
| 2730 | nmdc:mga0n895_1716841_c1 | |||
| 2731 | nmdc:mga0n895_203634_c1 | |||
| 2732 | nmdc:mga0n895_718113_c1 | |||
| 2733 | nmdc:mga0rr50_355518_c1 | |||
| 2734 | nmdc:mga0rr50_612521_c1 | |||
| 2735 | nmdc:mga08x19_1283812_c1 | |||
| 2736 | nmdc:mga08x19_64295_c1 | |||
| 2737 | nmdc:mga0a205_773109_c1 | |||
| 2738 | Ga0495601_0003320 | |||
| 2739 | Ga0495601_0225476 | |||
| 2740 | Ga0495612_0409133 | |||
| 2741 | Ga0500610_0189401 | |||
| 2742 | Ga0500610_0321821 | |||
| 2743 | Ga0495595_0009659 | |||
| 2744 | Ga0495619_0014438 | |||
| 2745 | Ga0495619_0309462 | |||
| 2746 | Ga0500578_0240734 | |||
| 2747 | Ga0500647_0169633 | |||
| 2748 | Ga0500651_0442372 | |||
| 2749 | Ga0500566_0119331 | |||
| 2750 | Ga0500640_004289 | |||
| 2751 | Ga0500641_0247538 | |||
| 2752 | Ga0500654_095403 | |||
| 2753 | Ga0500660_068299 | |||
| 2754 | Ga0500553_028044 | |||
| 2755 | Ga0500556_0149048 | |||
| 2756 | Ga0500558_073283 | |||
| 2757 | Ga0500560_018179 | |||
| 2758 | Ga0500560_166228 | |||
| 2759 | Ga0500562_030237 | |||
| 2760 | Ga0500569_033214 | |||
| 2761 | Ga0500572_022923 | |||
| 2762 | Ga0500580_130025 | |||
| 2763 | Ga0500594_0096106 | |||
| 2764 | Ga0500608_119833 | |||
| 2765 | Ga0500614_080259 | |||
| 2766 | Ga0500614_283914 | |||
| 2767 | Ga0500621_139679 | |||
| 2768 | Ga0500626_219092 | |||
| 2769 | Ga0500628_001255 | |||
| 2770 | Ga0500652_106897 | |||
| 2771 | Ga0500652_109803 | |||
| 2772 | Ga0500561_0001756 | |||
| 2773 | Ga0500568_0000049 | |||
| 2774 | Ga0500573_0028858 | |||
| 2775 | Ga0500573_0157639 | |||
| 2776 | Ga0500577_0251950 | |||
| 2777 | Ga0500600_0022039 | |||
| 2778 | Ga0500600_0100363 | |||
| 2779 | Ga0500600_0108148 | |||
| 2780 | Ga0500600_0243487 | |||
| 2781 | Ga0500603_311121 | |||
| 2782 | Ga0500606_076038 | |||
| 2783 | Ga0500616_0016342 | |||
| 2784 | Ga0500616_0233930 | |||
| 2785 | Ga0500624_004973 | |||
| 2786 | Ga0500633_0001249 | |||
| 2787 | Ga0500634_0038179 | |||
| 2788 | Ga0500634_0144793 | |||
| 2789 | Ga0500636_0108019 | |||
| 2790 | Ga0500636_0285216 | |||
| 2791 | Ga0500656_001023 | |||
| 2792 | Ga0500565_028798 | |||
| 2793 | Ga0500599_042318 | |||
| 2794 | Ga0500587_002326 | |||
| 2795 | Ga0501084_0020366 | |||
| 2796 | Ga0501084_0047023 | |||
| 2797 | Ga0501084_0054198 | |||
| 2798 | Ga0501084_0765018 | |||
| 2799 | Ga0501084_1672081 | |||
| 2800 | Ga0590075_040684 | |||
| 2801 | Ga0587084_000250 | |||
| 2802 | Ga0587084_066492 | |||
| 2803 | Ga0587070_034175 | |||
| 2804 | Ga0587070_054780 | |||
| 2805 | Ga0587070_066060 | |||
| 2806 | Ga0587073_0162089 | |||
| 2807 | Ga0587077_063671 | |||
| 2808 | Ga0587080_134810 | |||
| 2809 | Ga0587082_029095 | |||
| 2810 | Ga0587082_088004 | |||
| 2811 | Ga0587083_0048243 | |||
| 2812 | Ga0587083_0081280 | |||
| 2813 | Ga0587083_0126898 | |||
| 2814 | Ga0587085_166781 | |||
| 2815 | Ga0587088_012792 | |||
| 2816 | Ga0587089_025749 | |||
| 2817 | Ga0587090_044955 | |||
| 2818 | Ga0587090_069641 | |||
| 2819 | Ga0587092_014110 | |||
| 2820 | Ga0587094_023924 | |||
| 2821 | Ga0587095_007745 | |||
| 2822 | Ga0587097_01558 | |||
| 2823 | Ga0587098_015815 | |||
| 2824 | Ga0587106_004245 | |||
| 2825 | Ga0587106_007117 | |||
| 2826 | Ga0587125_000712 | |||
| 2827 | Ga0587125_048344 | |||
| 2828 | Ga0587129_010268 | |||
| 2829 | Ga0587101_000194 | |||
| 2830 | Ga0587109_052908 | |||
| 2831 | Ga0587115_022267 | |||
| 2832 | Ga0587115_070533 | |||
| 2833 | Ga0587117_024663 | |||
| 2834 | Ga0587122_011989 | |||
| 2835 | Ga0587122_013227 | |||
| 2836 | Ga0587122_014879 | |||
| 2837 | Ga0587122_016780 | |||
| 2838 | Ga0587127_006681 | |||
| 2839 | Ga0587128_015239 | |||
| 2840 | Ga0587128_020510 | |||
| 2841 | Ga0587128_071743 | |||
| 2842 | Ga0587128_122781 | |||
| 2843 | Ga0587130_017017 | |||
| 2844 | Ga0587062_102325 | |||
| 2845 | Ga0587069_031819 | |||
| 2846 | Ga0587069_034852 | |||
| 2847 | Ga0587075_024646 | |||
| 2848 | Ga0587076_172660 | |||
| 2849 | Ga0587078_044951 | |||
| 2850 | Ga0587078_070099 | |||
| 2851 | Ga0587100_000585 | |||
| 2852 | Ga0587105_008756 | |||
| 2853 | Ga0587105_019286 | |||
| 2854 | Ga0587105_032997 | |||
| 2855 | Ga0587107_087875 | |||
| 2856 | Ga0587110_026077 | |||
| 2857 | Ga0587114_046082 | |||
| 2858 | Ga0587114_066732 | |||
| 2859 | Ga0587119_011068 | |||
| 2860 | Ga0587119_055512 | |||
| 2861 | Ga0587120_011474 | |||
| 2862 | Ga0587124_006138 | |||
| 2863 | Ga0587124_042228 | |||
| 2864 | Ga0587111_0006112 | |||
| 2865 | Ga0587111_0059990 | |||
| 2866 | Ga0587111_0093223 | |||
| 2867 | Ga0587111_0134420 | |||
| 2868 | Ga0501082_0104865 | |||
| 2869 | Ga0501082_0132745 | |||
| 2870 | Ga0501082_1884131 | |||
| 2871 | Ga0466962_0003148 | |||
| 2872 | Ga0466962_0035513 | |||
| 2873 | Ga0466962_0057532 | |||
| 2874 | Ga0466962_0116763 | |||
| 2875 | Ga0466962_0375414 | |||
| 2876 | Ga0466962_0530393 | |||
| 2877 | Ga0530510_0013846 | |||
| 2878 | Ga0530510_0092387 | |||
| 2879 | Ga0530510_0212890 | |||
| 2880 | 2517763569 | |||
| 2881 | 2842891711 | |||
| 2882 | 2956941863 | |||
| 2883 | 3001119220 | |||
| 2884 | 3001891064 | |||
| 2885 | 8002792314 | |||
| 2886 | 8016257469 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7pkt-assembly1.cif.gz_u | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.9147 | 23 | 84 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9102 | 20 | 82 |
| 6ywy-assembly1.cif.gz_R | the structure of the mitoribosome from neurospora crassa with bound trna at the p-site | 0.9091 | 19 | 82 |
| 6yws-assembly1.cif.gz_R | the structure of the large subunit of the mitoribosome from neurospora crassa | 0.9071 | 19 | 82 |
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9066 | 20 | 82 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9102 | 20 | 82 | 2.40.50.100 |
| af_C0Z3L6_20_123_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8694 | 22 | 85 | 2.40.50.100 |
| af_Q4DLT4_19_136_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8643 | 23 | 83 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8587 | 20 | 82 | 2.40.50.100 |
| af_Q9U0I4_44_103_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8436 | 28 | 85 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K1D6X7-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9773 | 29 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-I4M014-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9772 | 27 | 83 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-I0R0V1-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9721 | 23 | 82 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-W4UE80-F1-model_v4 | deleted | 0.9646 | 23 | 85 |
|
| AF-I4M014-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9607 | 27 | 83 |
GO:0003735
GO:0006412 GO:0022625 |